BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c84007_g1_i1 len=771 path=[699:0-624 1324:625-697 1324:698-770]

Length=771
                                                                      Score     E

ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           251   7e-74   
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                248   6e-73   
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease                245   8e-72   
emb|CAN75240.1|  hypothetical protein VITISV_014207                     238   2e-70   Vitis vinifera
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                240   6e-70   
emb|CDP20511.1|  unnamed protein product                                238   3e-69   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                237   8e-69   Vitis vinifera
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           236   2e-68   
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                233   4e-67   
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                233   5e-67   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                231   2e-66   
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                   223   1e-64   
ref|XP_007024651.1|  Subtilase family protein                           225   3e-64   
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                225   3e-64   
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             222   3e-63   
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like           221   5e-63   
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     220   2e-62   
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                219   3e-62   
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease                219   3e-62   
ref|XP_006369129.1|  subtilase family protein                           218   8e-62   
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease                217   2e-61   
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                217   2e-61   
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             217   2e-61   
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    216   3e-61   
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g             215   1e-60   
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease                214   1e-60   
gb|ADW11233.1|  subtilisin-like protease 2                              214   2e-60   
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease                214   2e-60   
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    214   3e-60   
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    214   3e-60   
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease-like           214   3e-60   
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                213   4e-60   
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...    213   8e-60   
gb|KHN01421.1|  Subtilisin-like protease                                205   1e-59   
emb|CBI35855.3|  unnamed protein product                                216   1e-59   
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                212   1e-59   
gb|KHN39620.1|  Subtilisin-like protease                                209   2e-59   
gb|EPS74243.1|  subtilase family protein                                211   2e-59   
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           210   6e-59   
gb|EAY87746.1|  hypothetical protein OsI_09161                          206   7e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                210   8e-59   
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           210   8e-59   
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                209   2e-58   
emb|CAN75239.1|  hypothetical protein VITISV_014205                     208   3e-58   Vitis vinifera
gb|ACN34516.1|  unknown                                                 201   4e-58   Zea mays [maize]
ref|XP_010111996.1|  Subtilisin-like protease                           208   4e-58   
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like           207   6e-58   
ref|NP_001048301.1|  Os02g0779200                                       207   6e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             206   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                205   3e-57   
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease                205   4e-57   
ref|NP_001146035.1|  uncharacterized protein LOC100279566               201   5e-57   Zea mays [maize]
ref|XP_002454656.1|  hypothetical protein SORBIDRAFT_04g034980          204   1e-56   Sorghum bicolor [broomcorn]
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...    204   1e-56   
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             202   5e-56   
gb|ACJ26761.1|  subtilisin-like protein                                 189   5e-56   Nicotiana benthamiana
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease                201   7e-56   
dbj|BAH20348.1|  AT3G14067                                              199   8e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AFW73751.1|  putative subtilase family protein                       201   9e-56   
ref|XP_002885009.1|  subtilase family protein                           201   1e-55   
dbj|BAJ87876.1|  predicted protein                                      200   2e-55   
dbj|BAJ93208.1|  predicted protein                                      200   2e-55   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             199   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566473.2|  Subtilase family protein                              199   5e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97539.1|  BnaA05g25400D                                          194   8e-55   
gb|ACB87529.1|  subtilisin protease                                     196   1e-54   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                197   2e-54   
emb|CDY33251.1|  BnaC01g37240D                                          197   2e-54   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    197   3e-54   
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease                196   4e-54   
gb|KDP40686.1|  hypothetical protein JCGZ_24685                         196   8e-54   
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease                195   1e-53   
emb|CDY39093.1|  BnaA01g29630D                                          195   1e-53   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                195   1e-53   
emb|CDY52259.1|  BnaC05g52030D                                          194   2e-53   
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease                194   3e-53   
ref|XP_002452918.1|  hypothetical protein SORBIDRAFT_04g034950          192   1e-52   Sorghum bicolor [broomcorn]
ref|XP_004954114.1|  PREDICTED: subtilisin-like protease-like           192   2e-52   
gb|AGN03879.1|  senescence-associated subtilisin protease               191   5e-52   
gb|EMT02947.1|  Subtilisin-like protease                                185   7e-52   
gb|EAY87749.1|  hypothetical protein OsI_09164                          187   7e-52   Oryza sativa Indica Group [Indian rice]
gb|AFW73750.1|  putative subtilase family protein                       188   3e-51   
ref|NP_001145849.1|  uncharacterized protein LOC100279360 precursor     188   4e-51   Zea mays [maize]
ref|XP_004954112.1|  PREDICTED: subtilisin-like protease-like           188   4e-51   
dbj|BAJ91400.1|  predicted protein                                      187   7e-51   
gb|EMT11314.1|  hypothetical protein F775_42966                         182   4e-50   
gb|ABK96588.1|  unknown                                                 175   4e-50   Populus trichocarpa x Populus deltoides
ref|XP_008679257.1|  PREDICTED: subtilisin-like protease                185   5e-50   
ref|XP_004954113.1|  PREDICTED: subtilisin-like protease-like           184   1e-49   
ref|XP_003570499.1|  PREDICTED: subtilisin-like protease                183   2e-49   
dbj|BAD19523.1|  putative subtilisin-like proteinase                    182   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010088794.1|  Subtilisin-like protease                           182   5e-49   
ref|XP_002452917.1|  hypothetical protein SORBIDRAFT_04g034940          180   2e-48   Sorghum bicolor [broomcorn]
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      180   2e-48   Ricinus communis
dbj|BAJ93872.1|  predicted protein                                      180   2e-48   
gb|EMS59706.1|  Subtilisin-like protease                                177   3e-48   
gb|EAZ24824.1|  hypothetical protein OsJ_08603                          179   6e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EMS46826.1|  Subtilisin-like protease                                175   7e-48   
ref|NP_001048303.1|  Os02g0780200                                       179   8e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87753.1|  hypothetical protein OsI_09169                          178   1e-47   Oryza sativa Indica Group [Indian rice]
dbj|BAJ97136.1|  predicted protein                                      177   3e-47   
gb|KGN66306.1|  hypothetical protein Csa_1G597040                       175   4e-47   
ref|XP_003570496.1|  PREDICTED: subtilisin-like protease                177   4e-47   
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         176   1e-46   
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           175   2e-46   
dbj|BAD94244.1|  serine protease like protein                           169   2e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDP15538.1|  unnamed protein product                                175   2e-46   
gb|EMT01939.1|  Subtilisin-like protease                                174   2e-46   
ref|XP_006381615.1|  subtilase family protein                           174   2e-46   
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             177   2e-46   
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                174   3e-46   
ref|XP_010088796.1|  Subtilisin-like protease                           174   3e-46   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                174   3e-46   
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                174   4e-46   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                174   4e-46   
gb|EMT11726.1|  Subtilisin-like protease                                172   2e-45   
ref|XP_003595292.1|  Subtilisin-like protease                           172   2e-45   
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    171   4e-45   
ref|XP_007012625.1|  Subtilase family protein                           171   4e-45   
ref|XP_002885806.1|  predicted protein                                  170   6e-45   
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                170   9e-45   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          170   1e-44   
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                169   1e-44   
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             169   2e-44   
gb|ACL52505.1|  unknown                                                 166   2e-44   Zea mays [maize]
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             169   2e-44   
gb|ADE77855.1|  unknown                                                 165   2e-44   
ref|NP_565330.1|  Subtilase-like protein                                169   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like           168   3e-44   
ref|NP_001064523.2|  Os10g0394200                                       160   4e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                168   4e-44   
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                168   5e-44   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     168   6e-44   
emb|CDY18042.1|  BnaC07g04280D                                          167   6e-44   
emb|CDY33400.1|  BnaA07g04390D                                          167   7e-44   
gb|EYU25845.1|  hypothetical protein MIMGU_mgv1a013289mg                159   8e-44   
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                167   8e-44   
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             167   8e-44   
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     167   1e-43   
gb|EMS60034.1|  Subtilisin-like protease                                164   1e-43   
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease                167   1e-43   
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           167   1e-43   
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease                166   1e-43   
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                166   2e-43   
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    166   2e-43   
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                166   3e-43   
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                166   3e-43   
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                166   3e-43   
ref|XP_010238670.1|  PREDICTED: subtilisin-like protease isoform X1     166   3e-43   
gb|ADE76648.1|  unknown                                                 162   3e-43   
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             166   3e-43   
tpg|DAA50071.1|  TPA: putative subtilase family protein                 165   5e-43   
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor     165   5e-43   Zea mays [maize]
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease-like           165   5e-43   
ref|XP_010232411.1|  PREDICTED: subtilisin-like protease                166   5e-43   
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                165   6e-43   
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                165   6e-43   
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                164   8e-43   
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                164   1e-42   
gb|EMT11725.1|  Subtilisin-like protease                                162   2e-42   
tpg|DAA61658.1|  TPA: putative subtilase family protein                 162   2e-42   
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    164   2e-42   
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                164   2e-42   
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor     163   2e-42   Zea mays [maize]
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                163   3e-42   
gb|KHG16003.1|  Subtilisin-like protease                                162   4e-42   
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                162   4e-42   Vitis vinifera
gb|EMT24678.1|  Subtilisin-like protease                                161   5e-42   
dbj|BAD36156.1|  putative serine protease                               162   5e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010090170.1|  Subtilisin-like protease                           162   5e-42   
gb|ACF79126.1|  unknown                                                 162   8e-42   Zea mays [maize]
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                161   1e-41   
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    161   1e-41   
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                161   2e-41   
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   160   3e-41   
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like           160   3e-41   
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                160   3e-41   
dbj|BAK06243.1|  predicted protein                                      160   4e-41   
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             160   4e-41   
ref|XP_007051971.1|  Subtilase family protein                           160   4e-41   
gb|KHN07895.1|  Subtilisin-like protease                                158   5e-41   
gb|AHA84190.1|  subtilisin-like protease                                159   7e-41   
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                159   8e-41   
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    159   8e-41   
ref|XP_006841510.1|  hypothetical protein AMTR_s00003p00138760          159   9e-41   
ref|XP_003609994.1|  Subtilisin-like protease                           159   1e-40   
gb|AES92191.2|  subtilisin-like serine protease                         159   1e-40   
gb|EEE50901.1|  hypothetical protein OsJ_31407                          159   1e-40   Oryza sativa Japonica Group [Japonica rice]
gb|KHN17728.1|  Subtilisin-like protease                                150   1e-40   
gb|AAM22744.1|AC092388_28  putative cucumisin-like serine protease      159   1e-40   Oryza sativa Japonica Group [Japonica rice]
gb|EAY78354.1|  hypothetical protein OsI_33442                          159   1e-40   Oryza sativa Indica Group [Indian rice]
gb|KHN12283.1|  Subtilisin-like protease                                155   1e-40   
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          158   1e-40   
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           158   2e-40   
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190          158   2e-40   Sorghum bicolor [broomcorn]
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease                158   2e-40   
ref|XP_010931682.1|  PREDICTED: subtilisin-like protease                158   2e-40   
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           157   3e-40   
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                157   4e-40   
ref|XP_006648004.1|  PREDICTED: subtilisin-like protease-like           157   4e-40   
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           157   4e-40   
gb|EMS67351.1|  Subtilisin-like protease                                156   5e-40   
dbj|BAJ97849.1|  predicted protein                                      156   5e-40   
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like           157   6e-40   
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like           155   7e-40   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           156   9e-40   
ref|XP_002519362.1|  conserved hypothetical protein                     148   9e-40   Ricinus communis
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           156   1e-39   
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    156   1e-39   
dbj|BAJ87169.1|  predicted protein                                      156   1e-39   
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                156   1e-39   
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                156   1e-39   
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          155   1e-39   Sorghum bicolor [broomcorn]
emb|CDO96926.1|  unnamed protein product                                155   2e-39   
ref|XP_010111995.1|  Subtilisin-like protease                           154   3e-39   
gb|AGT17100.1|  serine protease                                         154   3e-39   
gb|KHN06066.1|  Subtilisin-like protease                                153   3e-39   
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             154   4e-39   
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg                154   4e-39   
ref|XP_007051969.1|  Subtilase family protein isoform 1                 154   4e-39   
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like           154   5e-39   
gb|KHG02130.1|  Subtilisin-like protease                                154   8e-39   
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                153   1e-38   
gb|ACN35690.1|  unknown                                                 147   1e-38   Zea mays [maize]
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease                153   1e-38   
gb|EYU32830.1|  hypothetical protein MIMGU_mgv1a020631mg                152   2e-38   
gb|ACN28035.1|  unknown                                                 148   2e-38   Zea mays [maize]
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260          152   3e-38   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                152   3e-38   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    152   3e-38   
ref|XP_010109072.1|  Subtilisin-like protease                           152   3e-38   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    152   4e-38   
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                152   4e-38   
ref|XP_009112378.1|  PREDICTED: subtilisin-like protease                150   4e-38   
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease                151   5e-38   
gb|EPS65938.1|  hypothetical protein M569_08836                         151   5e-38   
gb|EPS68206.1|  hypothetical protein M569_06564                         143   5e-38   
emb|CDY43568.1|  BnaC02g16650D                                          143   7e-38   
gb|EMT24677.1|  hypothetical protein F775_42866                         150   7e-38   
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                150   8e-38   
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             150   1e-37   
emb|CDY63869.1|  BnaCnng42760D                                          142   1e-37   
emb|CDY18651.1|  BnaA09g07440D                                          149   2e-37   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                150   2e-37   
ref|XP_011035007.1|  PREDICTED: subtilisin-like protease                149   2e-37   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                149   2e-37   
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                149   2e-37   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                149   3e-37   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                149   3e-37   
gb|EMT07781.1|  Subtilisin-like protease                                147   3e-37   
ref|XP_003627424.1|  Subtilisin-like serine protease                    149   3e-37   
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          149   4e-37   
gb|EMS67510.1|  Subtilisin-like protease                                147   4e-37   
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             149   4e-37   
gb|ACN27710.1|  unknown                                                 148   4e-37   Zea mays [maize]
ref|XP_006339499.1|  PREDICTED: subtilisin-like protease-like           149   4e-37   
gb|KHN13888.1|  Subtilisin-like protease                                148   5e-37   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                149   5e-37   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                149   5e-37   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             149   5e-37   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease                148   6e-37   
tpg|DAA50265.1|  TPA: putative subtilase family protein                 148   7e-37   
ref|NP_001151549.1|  subtilisin-like protease precursor                 148   7e-37   Zea mays [maize]
gb|EAY95232.1|  hypothetical protein OsI_17050                          145   8e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_002533857.1|  Cucumisin precursor, putative                      148   8e-37   Ricinus communis
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease                148   8e-37   
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           148   9e-37   
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g             148   9e-37   
gb|ACN28204.1|  unknown                                                 148   9e-37   Zea mays [maize]
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           148   9e-37   
ref|XP_006358905.1|  PREDICTED: subtilisin-like protease SDD1-like      147   1e-36   
ref|XP_002320086.2|  subtilase family protein                           148   1e-36   Populus trichocarpa [western balsam poplar]
gb|EMT32146.1|  Subtilisin-like protease                                140   1e-36   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          147   1e-36   Sorghum bicolor [broomcorn]
ref|XP_004140440.1|  PREDICTED: subtilisin-like protease-like           147   1e-36   
dbj|BAJ87780.1|  predicted protein                                      147   1e-36   
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease                147   1e-36   
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease                147   2e-36   
ref|XP_011048160.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    147   2e-36   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             147   2e-36   
ref|XP_009381912.1|  PREDICTED: subtilisin-like protease                148   2e-36   
ref|XP_008354238.1|  PREDICTED: subtilisin-like protease                144   2e-36   
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      147   2e-36   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    147   2e-36   
ref|XP_011048159.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    147   2e-36   
ref|XP_011048158.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    147   2e-36   
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     147   2e-36   
ref|XP_010914489.1|  PREDICTED: subtilisin-like protease                147   3e-36   
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     146   3e-36   
ref|XP_004976550.1|  PREDICTED: subtilisin-like protease-like           146   3e-36   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor     146   3e-36   
gb|KHN13887.1|  Subtilisin-like protease                                145   4e-36   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                146   4e-36   
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          146   4e-36   
gb|KHN31561.1|  Subtilisin-like protease                                145   4e-36   
ref|XP_002448366.1|  hypothetical protein SORBIDRAFT_06g025980          146   4e-36   
emb|CDY18653.1|  BnaA09g07420D                                          145   4e-36   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                146   4e-36   
ref|NP_001169390.1|  putative subtilase family protein precursor        146   5e-36   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease-like           145   5e-36   
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           145   5e-36   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           145   5e-36   
emb|CAN77487.1|  hypothetical protein VITISV_020248                     145   6e-36   
gb|KDP29636.1|  hypothetical protein JCGZ_18798                         145   6e-36   
gb|KHN15704.1|  Subtilisin-like protease                                145   7e-36   
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                145   8e-36   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                145   8e-36   
ref|XP_006387513.1|  hypothetical protein POPTR_0909s00200g             140   8e-36   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                145   8e-36   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           145   9e-36   
ref|XP_009381819.1|  PREDICTED: subtilisin-like protease                145   9e-36   
emb|CAH66960.1|  OSIGBa0147H17.8                                        145   9e-36   
ref|XP_010651399.1|  PREDICTED: subtilisin-like protease SBT3.5         145   1e-35   
ref|NP_001234288.1|  SBT2 protein precursor                             145   1e-35   
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           145   1e-35   
emb|CBI16560.3|  unnamed protein product                                145   1e-35   
dbj|BAJ89916.1|  predicted protein                                      145   1e-35   
ref|NP_001053614.1|  Os04g0573300                                       145   1e-35   
ref|XP_008454762.1|  PREDICTED: subtilisin-like protease                145   1e-35   
ref|NP_001060094.1|  Os07g0578300                                       145   1e-35   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             145   1e-35   
gb|EAZ04458.1|  hypothetical protein OsI_26606                          145   1e-35   
gb|AFW61874.1|  putative subtilase family protein                       145   1e-35   
ref|XP_009781097.1|  PREDICTED: subtilisin-like protease                144   1e-35   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     144   1e-35   
ref|NP_001159342.1|  putative subtilase family protein precursor        144   1e-35   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     144   1e-35   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             144   2e-35   
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                144   2e-35   
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                144   2e-35   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           144   2e-35   
ref|NP_001152427.1|  LOC100286067 precursor                             144   2e-35   
ref|XP_006653695.1|  PREDICTED: subtilisin-like protease-like           144   2e-35   
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         144   2e-35   
ref|XP_010917391.1|  PREDICTED: subtilisin-like protease                144   2e-35   
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    144   2e-35   
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like           144   2e-35   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                144   2e-35   
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease                144   2e-35   
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      144   2e-35   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             144   2e-35   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             144   2e-35   
ref|XP_010238218.1|  PREDICTED: subtilisin-like protease                144   2e-35   
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    144   3e-35   
ref|XP_002510884.1|  Cucumisin precursor, putative                      144   3e-35   
emb|CDY63300.1|  BnaCnng41800D                                          143   3e-35   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           144   3e-35   
gb|KHN27220.1|  Subtilisin-like protease                                143   3e-35   
ref|XP_007026418.1|  Subtilase family protein, putative                 144   3e-35   
ref|XP_009410252.1|  PREDICTED: subtilisin-like protease                144   3e-35   
gb|KHN44005.1|  Subtilisin-like protease                                141   4e-35   
gb|KHM99187.1|  Subtilisin-like protease                                135   4e-35   
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                     144   4e-35   
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             143   4e-35   
gb|EMT02587.1|  Subtilisin-like protease                                136   4e-35   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                143   4e-35   
emb|CDY29697.1|  BnaA04g17300D                                          143   4e-35   
gb|KHN01461.1|  Subtilisin-like protease                                139   5e-35   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease-like           143   5e-35   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                143   6e-35   
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           143   6e-35   
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            143   6e-35   
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                143   6e-35   
ref|XP_008378050.1|  PREDICTED: subtilisin-like protease                142   7e-35   
ref|XP_006826300.1|  hypothetical protein AMTR_s00004p00071240          142   8e-35   
emb|CAA59963.1|  subtilisin-like protease                               142   8e-35   
emb|CBI35805.3|  unnamed protein product                                141   8e-35   
gb|AES80028.2|  subtilisin-like serine protease                         142   9e-35   
ref|XP_010932346.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    142   9e-35   
ref|XP_003623810.1|  Subtilisin-like protease                           142   9e-35   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             142   1e-34   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             142   1e-34   
gb|EEC83669.1|  hypothetical protein OsI_29445                          142   1e-34   
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           142   1e-34   
emb|CAD29822.2|  putative serine protease                               140   1e-34   
ref|XP_007207186.1|  hypothetical protein PRUPE_ppa017229mg             142   1e-34   
ref|XP_006423460.1|  hypothetical protein CICLE_v10027857mg             140   1e-34   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             142   1e-34   
gb|EAY90937.1|  hypothetical protein OsI_12551                          139   1e-34   
gb|KDO40058.1|  hypothetical protein CISIN_1g006582mg                   140   1e-34   
ref|NP_569048.1|  subtilisin-like protease                              142   1e-34   
gb|AAM10321.1|  AT5g67360/K8K14_8                                       142   1e-34   
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease                142   1e-34   
ref|XP_006452708.1|  hypothetical protein CICLE_v10010806mg             142   1e-34   
gb|EMT16255.1|  Subtilisin-like protease                                141   2e-34   
gb|KEH18575.1|  subtilisin-like serine protease                         141   2e-34   
ref|XP_002304250.2|  hypothetical protein POPTR_0003s06940g             139   2e-34   
gb|EEC76224.1|  hypothetical protein OsI_13631                          139   2e-34   
ref|XP_009611962.1|  PREDICTED: subtilisin-like protease                141   2e-34   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             141   2e-34   
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           141   2e-34   
gb|KDO74053.1|  hypothetical protein CISIN_1g047013mg                   141   2e-34   
ref|XP_006426784.1|  hypothetical protein CICLE_v10024934mg             141   2e-34   
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     141   2e-34   
ref|XP_008797372.1|  PREDICTED: subtilisin-like protease                141   2e-34   
ref|XP_007020377.1|  Xylem serine proteinase 1, putative                141   2e-34   
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             141   2e-34   
ref|XP_006487362.1|  PREDICTED: subtilisin-like protease SDD1-lik...    140   2e-34   
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                141   2e-34   
ref|XP_010089708.1|  Subtilisin-like protease                           141   3e-34   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                141   3e-34   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                141   3e-34   
emb|CDY63302.1|  BnaCnng41810D                                          140   3e-34   
ref|XP_008377981.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    141   3e-34   
emb|CDY55359.1|  BnaCnng28690D                                          140   3e-34   
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                141   3e-34   
ref|XP_006465816.1|  PREDICTED: subtilisin-like protease-like           141   3e-34   
ref|XP_006426785.1|  hypothetical protein CICLE_v10024934mg             141   3e-34   
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    140   3e-34   
dbj|BAJ90522.1|  predicted protein                                      137   3e-34   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             141   3e-34   
ref|XP_009357945.1|  PREDICTED: subtilisin-like protease                140   3e-34   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...    141   3e-34   
ref|XP_008228336.1|  PREDICTED: subtilisin-like protease                140   3e-34   
ref|XP_008221640.1|  PREDICTED: subtilisin-like protease                140   3e-34   
ref|XP_006583358.1|  PREDICTED: subtilisin-like protease-like iso...    140   3e-34   
gb|KHN10472.1|  Subtilisin-like protease                                140   4e-34   
gb|KHN04600.1|  Subtilisin-like protease                                140   4e-34   
ref|XP_010109770.1|  hypothetical protein L484_008446                   140   4e-34   
ref|XP_006445191.1|  hypothetical protein CICLE_v10018512mg             142   4e-34   
ref|XP_006475105.1|  PREDICTED: subtilisin-like protease-like           141   4e-34   
ref|XP_009383072.1|  PREDICTED: subtilisin-like protease SBT5.3         132   4e-34   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    140   4e-34   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             140   5e-34   
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          140   5e-34   
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease                140   5e-34   
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             140   5e-34   
gb|KDP32432.1|  hypothetical protein JCGZ_13357                         141   5e-34   
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           140   5e-34   
ref|XP_002463079.1|  hypothetical protein SORBIDRAFT_02g037440          140   5e-34   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                140   5e-34   
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                140   6e-34   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                140   6e-34   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                140   6e-34   
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease                140   6e-34   
emb|CDX72509.1|  BnaC07g45310D                                          140   6e-34   
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease                140   6e-34   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                140   6e-34   
ref|XP_007042043.1|  Subtilase family protein, putative isoform 2       139   7e-34   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           140   7e-34   
emb|CDY40653.1|  BnaA03g53100D                                          140   7e-34   
ref|XP_006369092.1|  subtilase family protein                           140   7e-34   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           140   7e-34   
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                140   7e-34   
ref|XP_006345402.1|  PREDICTED: subtilisin-like protease-like           140   7e-34   
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    139   8e-34   
gb|KDP28200.1|  hypothetical protein JCGZ_13971                         139   8e-34   
ref|XP_009375850.1|  PREDICTED: subtilisin-like protease                139   8e-34   
gb|KEH18578.1|  subtilisin-like serine protease                         139   8e-34   
ref|XP_008810220.1|  PREDICTED: subtilisin-like protease                140   9e-34   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                139   9e-34   
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like           139   9e-34   
ref|XP_010251263.1|  PREDICTED: subtilisin-like protease SBT5.4         139   9e-34   
ref|XP_002518939.1|  Cucumisin precursor, putative                      139   1e-33   
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease                139   1e-33   
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310          139   1e-33   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                139   1e-33   
ref|XP_010540256.1|  PREDICTED: subtilisin-like protease                139   1e-33   
ref|XP_002886065.1|  predicted protein                                  139   1e-33   
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like           139   1e-33   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg             139   1e-33   
ref|XP_010046680.1|  PREDICTED: subtilisin-like protease                139   1e-33   
ref|XP_009357900.1|  PREDICTED: subtilisin-like protease isoform X2     139   1e-33   
ref|XP_009357899.1|  PREDICTED: subtilisin-like protease isoform X1     139   1e-33   
ref|XP_008357992.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    137   1e-33   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                139   1e-33   
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3         139   1e-33   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           139   1e-33   
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       139   1e-33   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                139   1e-33   
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease                139   2e-33   
ref|XP_006358904.1|  PREDICTED: subtilisin-like protease-like           139   2e-33   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    139   2e-33   
gb|EAZ09847.1|  hypothetical protein OsI_32138                          139   2e-33   
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3       139   2e-33   
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g             139   2e-33   
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3         139   2e-33   
gb|ACN26674.1|  unknown                                                 137   2e-33   
ref|NP_001051353.1|  Os03g0761500                                       139   2e-33   
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g             139   2e-33   
ref|NP_001049024.1|  Os03g0158700                                       133   2e-33   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                138   2e-33   
ref|XP_010105478.1|  Subtilisin-like protease                           138   2e-33   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                138   2e-33   
gb|KFK30136.1|  hypothetical protein AALP_AA7G221600                    138   2e-33   
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           138   2e-33   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      138   2e-33   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                138   2e-33   
gb|ACN27570.1|  unknown                                                 136   2e-33   
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             138   2e-33   
ref|XP_007038510.1|  Subtilase 1.3                                      138   2e-33   
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                138   2e-33   
ref|XP_002534008.1|  Xylem serine proteinase 1 precursor, putative      138   2e-33   
gb|KEH42928.1|  subtilisin-like serine protease                         138   3e-33   
gb|KHN04108.1|  Subtilisin-like protease                                138   3e-33   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease                138   3e-33   
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg             138   3e-33   
ref|XP_007024750.1|  Subtilase family protein isoform 1                 138   3e-33   
gb|KDO68023.1|  hypothetical protein CISIN_1g004010mg                   138   3e-33   
ref|XP_002512984.1|  Xylem serine proteinase 1 precursor, putative      138   3e-33   



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score =   251 bits (640),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 151/198 (76%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G    D ATG +S PF+HG+GHVDPNRALDPGLVYD+  SDYV 
Sbjct  569  AIKSALMTTAYNLDNSGKIFTDLATGEESTPFVHGSGHVDPNRALDPGLVYDIETSDYVN  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LCTI Y+ D+++VFV+D S VNCSE++L TPG LNYP+FS+DF   +   VKYKR VKN
Sbjct  629  FLCTIGYDGDDIAVFVRDSSRVNCSERSLATPGDLNYPSFSVDFTSDSNGVVKYKRVVKN  688

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VG +  AVYEVKVNAP  V+VSVSP KLVF+E  + LSYEI+FT+ +    +     +++
Sbjct  689  VGGDSNAVYEVKVNAPSAVEVSVSPAKLVFSEENNSLSYEISFTSKRSEDIMVKGIQSAF  748

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG+H V+SPIAV
Sbjct  749  GSIEWSDGIHSVRSPIAV  766



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 152/199 (76%), Gaps = 8/199 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G    D ATG +S PF+HG+GHVDPNRAL+PGLVYD+  SDYV 
Sbjct  568  AIKSALMTTAYNLDNSGKIFTDLATGEESTPFVHGSGHVDPNRALNPGLVYDIETSDYVN  627

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LCTI Y+ D+++VFV+D S VNCSE++L TPG LNYP+F++DF   +   VKYKR VKN
Sbjct  628  FLCTIGYDGDDIAVFVRDSSRVNCSERSLATPGDLNYPSFAVDFTSDSNGVVKYKRVVKN  687

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL------NS  517
            VG    AVYEVKVNAPLGV+VSVSP KLVF+E  + LSYEI+FT+ +    +      ++
Sbjct  688  VGGNPNAVYEVKVNAPLGVEVSVSPAKLVFSEENNSLSYEISFTSKRSEDNIMVKGTPSA  747

Query  518  YGSIAWEDGVHIVKSPIAV  574
            +GSI W DG+H V+SPIAV
Sbjct  748  FGSIEWSDGIHSVRSPIAV  766



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 153/200 (77%), Gaps = 8/200 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G N+ D ATG++SNPF+HG+GHVDPNRA+DPGLVYDL ++DYVA
Sbjct  566  AIKSALMTTAYNLDNSGGNITDLATGSESNPFVHGSGHVDPNRAVDPGLVYDLEITDYVA  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFL-YKNQVKYKRSVKNV  358
             LCTI Y+   +SVF K  S+V+C      TPG+LNYP+FS+ F   ++ VKYKR+VKNV
Sbjct  626  FLCTIGYDSRRISVFTKQASSVDCDALGFKTPGNLNYPSFSVVFSGSESVVKYKRTVKNV  685

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL------NSY  520
            G E  AVYEVKVN PLGV+VSVSP+KLVF+E  D LSYE+TF ++  A         +S+
Sbjct  686  GKEANAVYEVKVNTPLGVEVSVSPSKLVFSEKEDKLSYEVTFKSSANAVGFEITGSKSSF  745

Query  521  GSIAWED-GVHIVKSPIAVL  577
            GSI W D G H+V+SPIAVL
Sbjct  746  GSIEWSDGGSHLVRSPIAVL  765



>emb|CAN75240.1| hypothetical protein VITISV_014207 [Vitis vinifera]
Length=579

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 153/208 (74%), Gaps = 8/208 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+GNN+ D ATGNQS+PFIHGAGHVDPNRAL PGLVYD+  +DY++
Sbjct  373  AIKSALMTTAYNLDNSGNNIADLATGNQSSPFIHGAGHVDPNRALYPGLVYDIDANDYIS  432

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK-------NQVKYK  340
             LC I Y+ + +++FV+  +TV+C+ + L TPG LNYPAFS+ F +        N++K K
Sbjct  433  FLCAIGYDTERIAIFVRRHTTVDCNTEKLHTPGDLNYPAFSVVFNFDHDPVHQGNEIKLK  492

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R VKNVGS   AVYEVKVN P G++V VSP KLVF++     SYE++FT+ + +   + +
Sbjct  493  RVVKNVGSSANAVYEVKVNPPEGIEVDVSPKKLVFSKENQTASYEVSFTSVE-SYIGSRF  551

Query  521  GSIAWEDGVHIVKSPIAVL*LNEARSAL  604
            GSI W DG HIV+SP+AV    +A S++
Sbjct  552  GSIEWSDGTHIVRSPVAVRFHQDAVSSI  579



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 146/199 (73%), Gaps = 8/199 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY +DN+G    D ATG +S PF+HG+GHVDPNRALDPGLVYD+  SDYV 
Sbjct  566  AVKSALMTTAYNLDNSGKVFTDLATGQESTPFVHGSGHVDPNRALDPGLVYDIETSDYVN  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC+I Y+ D+++VFV+D S VNCSEQNL TPG LNYP+FS+ F  ++   VKYKR +KN
Sbjct  626  FLCSIGYDGDDVAVFVRDSSRVNCSEQNLATPGDLNYPSFSVVFTGESNGVVKYKRVMKN  685

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARF------LNS  517
            VG    AVYEVKVNAP  V+VSVSP KLVF+E    LSYEI+F +             ++
Sbjct  686  VGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSEEKKSLSYEISFKSKSSGDLEMVKGIESA  745

Query  518  YGSIAWEDGVHIVKSPIAV  574
            +GSI W DG+H V+SPIAV
Sbjct  746  FGSIEWSDGIHNVRSPIAV  764



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 147/197 (75%), Gaps = 5/197 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN G ++ D ATG +SNPF+HG+GHVDPNRAL+PGLVYDLG SDYVA
Sbjct  571  AIKSALMTTAYNVDNIGESIKDLATGEESNPFVHGSGHVDPNRALNPGLVYDLGTSDYVA  630

Query  182  LLCTIAYNMDELSVFVKD-PSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             LC + Y+   ++VFV+D P  V+C  Q +GTPG LNYP+FS+ F   N  VKY R VKN
Sbjct  631  FLCAVGYSPGRIAVFVRDGPVPVDCGAQGMGTPGDLNYPSFSVVFSPGNSVVKYTRVVKN  690

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQP---ARFLNSYGS  526
            VGS   AVYEVKVNAP  V+V+VSP++LVF++  D LSYE++FT A          ++GS
Sbjct  691  VGSNAEAVYEVKVNAPPSVEVTVSPSQLVFSQGNDTLSYEVSFTTASGILVGALKPAFGS  750

Query  527  IAWEDGVHIVKSPIAVL  577
            + W DG H+V+SPIAV+
Sbjct  751  LEWSDGEHLVRSPIAVV  767



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score =   237 bits (605),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 153/208 (74%), Gaps = 8/208 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+GNN+ D ATGNQS+PFIHGAGHVDPNRAL PGLVYD+  +DY++
Sbjct  565  AIKSALMTTAYNLDNSGNNIADLATGNQSSPFIHGAGHVDPNRALYPGLVYDIDANDYIS  624

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK-------NQVKYK  340
             LC I Y+ + +++FV+  +TV+C+ + L TPG LNYPAFS+ F +        N++K K
Sbjct  625  FLCAIGYDTERIAIFVRRHTTVDCNTEKLHTPGDLNYPAFSVVFNFDHDPVHQGNEIKLK  684

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R VKNVGS   AVYEVKVN P G++V VSP KLVF++     SYE++FT+ + +   + +
Sbjct  685  RVVKNVGSSANAVYEVKVNPPEGIEVDVSPKKLVFSKENQTASYEVSFTSVE-SYIGSRF  743

Query  521  GSIAWEDGVHIVKSPIAVL*LNEARSAL  604
            GSI W DG HIV+SP+AV    +A S++
Sbjct  744  GSIEWSDGTHIVRSPVAVRFHQDAVSSI  771



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 147/203 (72%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D ATG +S+PF+ G+GHVDPNRAL PGLVYD+  SDYV 
Sbjct  565  AIKSALMTTAYNVDNSGKTITDLATGQESSPFVRGSGHVDPNRALHPGLVYDIESSDYVG  624

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC I Y    +S F KD S+VNCSE +L +PG LNYP+FS+ F+ +N VKYKR VKNVG
Sbjct  625  FLCAIGYGPSRISPFTKDTSSVNCSEHSLASPGDLNYPSFSVVFMSENVVKYKRVVKNVG  684

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR---FLNSYGSIA  532
                 VY+VKVNAP  V+V V+P+KL F+E  + LSYEI+F++    R     +++GSI 
Sbjct  685  RNANVVYKVKVNAPSSVEVKVTPSKLSFSEEKNSLSYEISFSSVGSERVKGLESAFGSIE  744

Query  533  WEDGVHIVKSPIAVL*LNEARSA  601
            W DG+H V+SPIAV  L+ + +A
Sbjct  745  WSDGIHSVRSPIAVRWLSSSAAA  767



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 147/202 (73%), Gaps = 10/202 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMT+AY +DN G N+ D ATG +S PF+HGAGHVDPNRA+DPGLVYDL  +DY+A
Sbjct  567  AIKSALMTSAYNLDNTGANITDLATGAESTPFVHGAGHVDPNRAVDPGLVYDLDTTDYIA  626

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LCTI Y+   +SVF KD S+V+C +    TPG+LNYP+FS+ F  +   VKY R+V NV
Sbjct  627  FLCTIGYDSRRISVFTKDASSVDCDKLGFKTPGNLNYPSFSVVFYGEESVVKYNRTVTNV  686

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQP--------ARFLN  514
            GSE  AVYEV+V AP GV+VSVSP+KLVF+ET D LSYE+TF ++              +
Sbjct  687  GSEVDAVYEVRVGAPPGVEVSVSPSKLVFSETEDKLSYEVTFKSSSSASSGLEIVGSAKS  746

Query  515  SYGSIAWED-GVHIVKSPIAVL  577
            S+GSI W D G H+V+SPIA +
Sbjct  747  SFGSIEWSDGGSHLVRSPIAAV  768



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 148/201 (74%), Gaps = 10/201 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY +DN+G N+ D ATG QS+PF+HG+GHVDPN+AL+PGLVYD+  +DY++
Sbjct  594  AVKSALMTTAYYLDNSGKNITDLATGKQSSPFVHGSGHVDPNKALNPGLVYDINANDYIS  653

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLY-KNQVKYKRSVKNV  358
            LLC + YN   +++F+K+P+T++C+ +NL T G+LNYP+FS+ F   KN VKY R VKNV
Sbjct  654  LLCAMGYNSTRIAIFLKEPTTIDCAAKNLSTAGNLNYPSFSVVFESGKNVVKYTRVVKNV  713

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN---------AQPARFL  511
            GS   AVYEV VNAPL V VSVSP KL F+     LSYEI+FT+          +P    
Sbjct  714  GSSADAVYEVSVNAPLNVDVSVSPRKLEFSADKQTLSYEISFTSISETYLTGKVKPILGT  773

Query  512  NSYGSIAWEDGVHIVKSPIAV  574
            +S+GSI W DG H V+SPIAV
Sbjct  774  SSFGSIEWSDGSHRVRSPIAV  794



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 141/199 (71%), Gaps = 8/199 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY +DN+G    D ATG +S PF+HG+GHVDPNRALDPGLVYD+  SDYV 
Sbjct  566  AVKSALMTTAYNLDNSGKVFTDLATGQESTPFVHGSGHVDPNRALDPGLVYDIETSDYVN  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC+I Y+  +++VF +D S VNCSE++L TPG LNYP+FS+ F  +    VKYKR VKN
Sbjct  626  FLCSIGYDGTDVAVFARDSSRVNCSERSLATPGDLNYPSFSVVFTGETNGVVKYKRVVKN  685

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARF------LNS  517
            VG    AVYEVKVNAP  V+VSVSP KLVF+E    LSYEI+                ++
Sbjct  686  VGKNTDAVYEVKVNAPSSVEVSVSPAKLVFSEEKQSLSYEISLKGKSSGDLEMVKGIESA  745

Query  518  YGSIAWEDGVHIVKSPIAV  574
            +GSI W DG+H V+SPIAV
Sbjct  746  FGSIEWSDGIHNVRSPIAV  764



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 143/195 (73%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G N+ D A+G +S PFIHGAGHVDPNRAL+PGLVYD+ VS+YVA
Sbjct  400  AIKSALMTTAYNLDNSGENIKDLASGEESTPFIHGAGHVDPNRALNPGLVYDIDVSEYVA  459

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC+I Y++  +SVFV++P + +   + L TPG+LNYP+FS+ F   N  VKYKR VKNV
Sbjct  460  FLCSIGYDVKRISVFVREPVSSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRVVKNV  519

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS---YGSI  529
            GS   AVYEVKVNAP  V V+V P+KL F+     L+YEITF++        S    GSI
Sbjct  520  GSSVDAVYEVKVNAPPNVAVNVWPSKLAFSAEKKALAYEITFSSVGLDGLGVSPQQSGSI  579

Query  530  AWEDGVHIVKSPIAV  574
             W DGVH+V+SPIAV
Sbjct  580  EWSDGVHLVRSPIAV  594



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 149/205 (73%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY++DN+GN + D ATG +S+PF++GAGHVDPN AL PGLVYD+   DYVA
Sbjct  563  AIKSALMTTAYSLDNSGNTIKDLATGVESSPFVYGAGHVDPNIALMPGLVYDIDDGDYVA  622

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC+I Y+   +++FV++P+  +  E  L TPG+LNYP+FS+ F   +  VKYKR+VKNV
Sbjct  623  FLCSIGYDSKRIAIFVREPTGPDVCEGKLATPGNLNYPSFSVVFDSNDHVVKYKRTVKNV  682

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARF---LNSYGSI  529
            G    AVYE KVNAP GV++SVSP+KL F+     LSYEITF +   A F   L ++GSI
Sbjct  683  GPSVDAVYEAKVNAPPGVEISVSPSKLEFSAENQTLSYEITFASDGLALFAVALEAFGSI  742

Query  530  AWEDGVHIVKSPIAVL*LNEARSAL  604
             W DGVH+V+SPIAV  L   + ++
Sbjct  743  EWSDGVHLVRSPIAVRWLQGLKDSI  767



>ref|XP_009610930.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=779

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 144/197 (73%), Gaps = 6/197 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY IDN+G    D ATG +S+PF+HG+GHVDPNRALDPGLVYD+   DYV 
Sbjct  572  AIKSALMTTAYNIDNSGKTFTDLATGQESSPFVHGSGHVDPNRALDPGLVYDIATRDYVD  631

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC I Y+   +S FVKD S+VNCSE++L +PG LNYP+FS+ F  ++ VKYKR VKNVG
Sbjct  632  FLCAIGYDPKRISPFVKDTSSVNCSEKSLVSPGDLNYPSFSVVFSSESVVKYKRVVKNVG  691

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN-----AQPARFLNS-YG  523
                A YEVK+NAP  V+V V+PTKL F+E    LSYEI+F++      +  + L S +G
Sbjct  692  RNTNAAYEVKINAPASVEVKVTPTKLSFSEENKSLSYEISFSSNGSVGLERVKGLESAFG  751

Query  524  SIAWEDGVHIVKSPIAV  574
            SI W DG+H V+SPIAV
Sbjct  752  SIEWSDGIHSVRSPIAV  768



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 143/194 (74%), Gaps = 4/194 (2%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            IKSALMTTAY +DN+G N+ D A+G +S PFIHGAGHVDPNRAL+PGLVYD+ VS+YVA 
Sbjct  573  IKSALMTTAYNLDNSGENIKDLASGEESTPFIHGAGHVDPNRALNPGLVYDIDVSEYVAF  632

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNVG  361
            LC+I Y++  +SVFV++P++ +   + L TPG+LNYP+FS+ F   N  VKYKR VKNVG
Sbjct  633  LCSIGYDVKRISVFVREPASSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRVVKNVG  692

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS---YGSIA  532
            S   AVYEVKVNAP  V V+V P+KL F+     L+YEITF++        S    GSI 
Sbjct  693  SSVDAVYEVKVNAPPNVAVNVWPSKLAFSAEKKALAYEITFSSVGLDGLGVSPQQSGSIE  752

Query  533  WEDGVHIVKSPIAV  574
            W DGVH+V+SPIAV
Sbjct  753  WSDGVHLVRSPIAV  766



>ref|XP_006465903.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=776

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 143/199 (72%), Gaps = 12/199 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G N+ D A+G +S PFIHGAGHVDPNRAL+PGLVYD+ VS+YVA
Sbjct  572  AIKSALMTTAYNLDNSGENIKDLASGEESTPFIHGAGHVDPNRALNPGLVYDIDVSEYVA  631

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC+I Y++  +SVFV++P + +   + L TPG+LNYP+FS+ F   N  VKYKR VKNV
Sbjct  632  FLCSIGYDVKRISVFVREPVSSDICTRALATPGNLNYPSFSVVFNSNNDVVKYKRVVKNV  691

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT-------NAQPARFLNS  517
            GS   AVYEVKVNAP  V ++V P+KL F+     L+YEITF+          P +    
Sbjct  692  GSSVDAVYEVKVNAPPNVAINVWPSKLAFSAEKKALAYEITFSIVGLDGLGVSPQQ----  747

Query  518  YGSIAWEDGVHIVKSPIAV  574
             GSI W DGVH+V+SPIAV
Sbjct  748  SGSIEWSDGVHLVRSPIAV  766



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 135/192 (70%), Gaps = 1/192 (1%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN G N+ D A+G++S+PF+HGAGHVDPNRAL+PGLVYD+ V DYV 
Sbjct  577  AIKSALMTTAYNLDNGGRNIKDLASGDESSPFVHGAGHVDPNRALNPGLVYDIDVDDYVG  636

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC I Y    ++VF+++P +       + TPG LNYP+FS+        VKY+R VKNV
Sbjct  637  FLCAIGYEPRRIAVFLREPMSSTVCANRMATPGELNYPSFSVVLTSNGDVVKYRRVVKNV  696

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            GS   AVYEVKV+AP  V+VSVSP+KL F+    +LSYEITF++         +GSI W 
Sbjct  697  GSSADAVYEVKVDAPENVEVSVSPSKLEFSAENQILSYEITFSSIALGSSTPKFGSIEWT  756

Query  539  DGVHIVKSPIAV  574
            DG H V+SPIAV
Sbjct  757  DGTHRVRSPIAV  768



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 135/192 (70%), Gaps = 1/192 (1%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN G N+ D A+G++S+PF+HGAGHVDPNRAL+PGLVYD+ V DYV 
Sbjct  628  AIKSALMTTAYNLDNGGRNIKDLASGDESSPFVHGAGHVDPNRALNPGLVYDIDVDDYVG  687

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC I Y    ++VF+++P +       + TPG LNYP+FS+        VKY+R VKNV
Sbjct  688  FLCAIGYEPRRIAVFLREPMSSTVCANRMATPGELNYPSFSVVLTSNGDVVKYRRVVKNV  747

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            GS   AVYEVKV+AP  V+VSVSP+KL F+    +LSYEITF++         +GSI W 
Sbjct  748  GSSADAVYEVKVDAPENVEVSVSPSKLEFSAENQILSYEITFSSIALGSSTPKFGSIEWT  807

Query  539  DGVHIVKSPIAV  574
            DG H V+SPIAV
Sbjct  808  DGTHRVRSPIAV  819



>ref|XP_009788688.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=776

 Score =   219 bits (558),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 144/197 (73%), Gaps = 6/197 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G    D ATG +S+PF+HG+GHVDPNRALDPGLVYD+ + DYV 
Sbjct  569  AIKSALMTTAYNVDNSGKTFTDLATGQESSPFVHGSGHVDPNRALDPGLVYDIEMKDYVN  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC I Y+   +S FVK+ S+VNCSE++  +PG LNYP+FS+ F  ++ VKYKR VKNVG
Sbjct  629  FLCAIGYDPKRISPFVKETSSVNCSEKSFVSPGDLNYPSFSVVFSSESVVKYKRVVKNVG  688

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN-----AQPARFLNS-YG  523
                AVYEVK++ P  V+V V+PTKL F+E    LSYEI+F++      +  + L S +G
Sbjct  689  RNTNAVYEVKISVPASVEVKVTPTKLSFSEENKSLSYEISFSSNGSVGLETVKGLESAFG  748

Query  524  SIAWEDGVHIVKSPIAV  574
            SI W DG+H V+SPIAV
Sbjct  749  SIEWSDGIHSVRSPIAV  765



>ref|XP_006369129.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65698.1| subtilase family protein [Populus trichocarpa]
Length=772

 Score =   218 bits (555),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 140/195 (72%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAYT+DN+G N+ D A+G +S PFIHGAGHVDPN ALDPGLVYD+  SDY++
Sbjct  567  AIKSALVTTAYTLDNSGKNIKDLASGEESTPFIHGAGHVDPNSALDPGLVYDMDTSDYIS  626

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC I Y+ + ++VFV++P + +     +G+PG+LNYP+ S+ F   +  V YKR VKNV
Sbjct  627  FLCAIGYDSNRIAVFVREPPSSDICSGKVGSPGNLNYPSISVVFQSTSDVVTYKRVVKNV  686

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQ---PARFLNSYGSI  529
            G    AVYEVKVN+P  V + VSP+KLVF+     LSYEITF++     P    +++GSI
Sbjct  687  GGSLDAVYEVKVNSPANVDIKVSPSKLVFSAENKTLSYEITFSSVSLDWPTIIPSTFGSI  746

Query  530  AWEDGVHIVKSPIAV  574
             W DG+H V+ PIAV
Sbjct  747  EWSDGIHGVRGPIAV  761



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 3/192 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI SA+MTTAY ID+ G  +ID +T   S PF+ G+GH+DPN+A+DPGLVYDL VSDY+A
Sbjct  569  AIMSAIMTTAYNIDSTGKEIIDVSTLLPSTPFVRGSGHIDPNKAVDPGLVYDLQVSDYIA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFL-YKNQVKYKRSVKNV  358
             LCT  Y  + + V  K P+ ++C+ Q L +PG+LNYP+FS+ F    N+VKY R VKNV
Sbjct  629  FLCTAGYTKNMIRVIFKAPAVIDCASQKLSSPGNLNYPSFSVVFRGATNKVKYTRVVKNV  688

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            GS K AVY+V V APL VQ+SV+P+ L F  T   LSY+ITFT+   +R  +S+GSI W 
Sbjct  689  GSSKNAVYKVNVKAPLNVQISVAPSTLTFTSTVQTLSYDITFTST--SRGASSFGSIEWS  746

Query  539  DGVHIVKSPIAV  574
            DG H V+SPIA+
Sbjct  747  DGNHHVRSPIAI  758



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 142/202 (70%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAYT+DNAG  + D  TG +S PF+HGAGHVDPNRAL+PGLVYDL V+DYVA
Sbjct  607  AIKSALITTAYTLDNAGKKINDLGTGEESTPFVHGAGHVDPNRALNPGLVYDLNVNDYVA  666

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVK  352
             LC+I Y+  +++VFV  P+  + C+  +L +PG LNYP+FS+  L  +Q  VKYKR   
Sbjct  667  FLCSIGYSPRQIAVFVGKPTGSDICTRNSLASPGDLNYPSFSV-VLSSDQGLVKYKRIAT  725

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIA  532
            NVG++  AVYEV VNAP GV++SV P KLVF+      SYE+TF           YGSI 
Sbjct  726  NVGADADAVYEVTVNAPAGVEISVEPRKLVFSAENQTQSYEVTFKRGVGYDSGERYGSIE  785

Query  533  WEDGVHIVKSPIAVL*LNEARS  598
            W DG H+V+SP+AV   + ARS
Sbjct  786  WTDGRHLVRSPVAVR-WSSARS  806



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 141/202 (70%), Gaps = 5/202 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAYT+DNAG  + D  TG +S PF+HGAGHVDPNRAL+PGL+YDL V+DYVA
Sbjct  569  AIKSALITTAYTLDNAGKKIKDLGTGEESTPFVHGAGHVDPNRALNPGLIYDLNVNDYVA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVK  352
             LC+I Y+  +++VFV  P+  + C+  +L +PG LNYP+FS+  L  +Q  +KYKR   
Sbjct  629  FLCSIGYSPRQIAVFVGKPTGSDMCTRNSLASPGDLNYPSFSV-VLSSDQGLIKYKRIAT  687

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIA  532
            NVG +  AVYEV VNAP GV++SV P KLVF+      SYE+TF           YGSI 
Sbjct  688  NVGGDADAVYEVTVNAPAGVEISVEPRKLVFSAENQTQSYEVTFKRGVGYDGGERYGSIE  747

Query  533  WEDGVHIVKSPIAVL*LNEARS  598
            W DG H+V+SP+AV   + ARS
Sbjct  748  WTDGRHLVRSPVAVR-WSSARS  768



>ref|XP_003627323.1| Cucumisin-like serine protease subtilisin-like protease [Medicago 
truncatula]
 gb|AET01799.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 139/193 (72%), Gaps = 4/193 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D  TG +SNPF+HGAGHVDPN+AL+PGLVYDL ++DY+A
Sbjct  582  AIKSALMTTAYNVDNSGGKIKDLGTGKESNPFVHGAGHVDPNKALNPGLVYDLNINDYLA  641

Query  182  LLCTIAYNMDELSVFVKDPSTVN-C-SEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVK  352
             LC+I Y+  E+ +F ++P++ N C +E+   +PG LNYP+FS+ F   N  VKYKR + 
Sbjct  642  FLCSIGYDAKEIQIFTREPTSYNVCENERKFTSPGDLNYPSFSVVFGANNGLVKYKRVLT  701

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIA  532
            NVG    AVY VKVNAP GV VSVSP+KLVF+      ++E+TFT         S+GS+ 
Sbjct  702  NVGDSVDAVYTVKVNAPFGVDVSVSPSKLVFSSENKTQAFEVTFTRIGYGG-SQSFGSLE  760

Query  533  WEDGVHIVKSPIA  571
            W DG HIV+SPIA
Sbjct  761  WSDGSHIVRSPIA  773



>ref|XP_007135429.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
 gb|ESW07423.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
Length=778

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 145/208 (70%), Gaps = 8/208 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G N+ D  TG +SNPF HGAGHVDPNRAL+PGLVYD  ++DY+A
Sbjct  572  AIKSALMTTAYNVDNSGGNIKDLGTGKESNPFTHGAGHVDPNRALNPGLVYDSDINDYLA  631

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLG------TPGSLNYPAFSLDFLYKNQ-VKYK  340
             LC+I Y+ ++++VF ++P+  N  E  +G      +PG LNYP+FS++    +  VKYK
Sbjct  632  FLCSIGYDANQIAVFTREPAAANPCEGKVGRTGRLASPGDLNYPSFSVELGRGSDLVKYK  691

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R V NVGS   AVY VKVNAP GV V+V+P  LVF+      ++E+ F+   PA   +S+
Sbjct  692  RVVTNVGSVVDAVYTVKVNAPPGVDVTVAPNTLVFSGENKTQAFEVAFSRVTPAT-SDSF  750

Query  521  GSIAWEDGVHIVKSPIAVL*LNEARSAL  604
            GSI W DG H+V+SPIAV    ++ S+L
Sbjct  751  GSIEWTDGSHVVRSPIAVRWSGDSSSSL  778



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 139/195 (71%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAYT+DN+G N+ D A+  +S PFIHGAGHVDPN ALDPGLVYD+  SDY++
Sbjct  569  AIKSALVTTAYTLDNSGKNIKDLASAEESTPFIHGAGHVDPNSALDPGLVYDMDTSDYIS  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC I Y+ + ++VFV++P + +     + +PG+LNYP+FS+ F   +  V  KR VKNV
Sbjct  629  FLCAIGYDSNRIAVFVREPPSSDICSGKVSSPGNLNYPSFSVVFQSTSDVVTCKRVVKNV  688

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNA---QPARFLNSYGSI  529
            GS   AVYEVKVN+P  V + VSP+KLVF+     LSYEITF++     P    ++YGSI
Sbjct  689  GSSLDAVYEVKVNSPANVDIKVSPSKLVFSAENKTLSYEITFSSVGLDWPTIIPSTYGSI  748

Query  530  AWEDGVHIVKSPIAV  574
             W DG+H V+ PIAV
Sbjct  749  EWSDGIHGVRGPIAV  763



>gb|ADW11233.1| subtilisin-like protease 2 [Phaseolus vulgaris]
Length=810

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 145/208 (70%), Gaps = 8/208 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G N+ D  TG +SNPF HGAGHVDPNRAL+PGLVYD  ++DY+A
Sbjct  604  AIKSALMTTAYNVDNSGGNIKDLGTGKESNPFTHGAGHVDPNRALNPGLVYDSDINDYLA  663

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLG------TPGSLNYPAFSLDFLYKNQ-VKYK  340
             LC+I Y+ ++++VF ++P+  N  E  +G      +PG LNYP+FS++    +  VKYK
Sbjct  664  FLCSIGYDANQIAVFTREPAAANPCEGKVGRTGRLASPGDLNYPSFSVELGRGSDLVKYK  723

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R V NVGS   AVY VKVNAP GV V+V+P  LVF+      ++E+ F+   PA   +S+
Sbjct  724  RVVTNVGSVVDAVYTVKVNAPPGVDVTVAPNTLVFSGENKTQAFEVAFSRVTPATS-DSF  782

Query  521  GSIAWEDGVHIVKSPIAVL*LNEARSAL  604
            GSI W DG H+V+SPIAV    ++ S+L
Sbjct  783  GSIEWTDGSHVVRSPIAVRWSGDSSSSL  810



>ref|XP_010685296.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=767

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 135/192 (70%), Gaps = 3/192 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI SA+ TTAY ID+ G  +I+ +T   S PF+HG+GH+DPN+A+DPGLVYDL +SDY+A
Sbjct  571  AIMSAIKTTAYNIDSTGKEIIEASTLLPSTPFVHGSGHIDPNKAVDPGLVYDLQISDYIA  630

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLY-KNQVKYKRSVKNV  358
             LCTI Y+   + V  K+P+ V+C+ Q L +PG+LNYP+FS+ F    N+VKY R VKNV
Sbjct  631  FLCTIGYDTKRIHVLFKEPAVVDCASQILSSPGNLNYPSFSVVFRGDTNKVKYTRVVKNV  690

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            GS K AVY+V V  PL V +SV+PT L F  T   LSY+ITFT+        S+GSI W 
Sbjct  691  GSSKNAVYKVNVKVPLNVHISVAPTTLAFTSTVQTLSYDITFTSTSIGP--PSFGSIEWT  748

Query  539  DGVHIVKSPIAV  574
            DG H V+SPIAV
Sbjct  749  DGSHHVRSPIAV  760



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 135/194 (70%), Gaps = 3/194 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D +TG +S PF+ GAGHVDPN+ALDPGL+YD  V DY+A
Sbjct  575  AIKSALMTTAYNLDNSGEIIKDLSTGEESTPFVRGAGHVDPNKALDPGLIYDSQVEDYLA  634

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC I Y+  ++++F +D +TVNCS   L +PG LNYPAFS+ F   +  V + R V+NV
Sbjct  635  FLCAIGYSTQQIALFTRDETTVNCSAMTLASPGDLNYPAFSVVFSSTSDIVTFSRVVRNV  694

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSIA  532
            G    AVYE +++ P GV V+V+P+KLVF+     LSYEITF +   A     N +G I+
Sbjct  695  GGPDDAVYEAEISGPPGVNVTVAPSKLVFDAVDQSLSYEITFASIADAAVAGSNGFGGIS  754

Query  533  WEDGVHIVKSPIAV  574
            W DG H V+SPIAV
Sbjct  755  WSDGTHSVRSPIAV  768



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 135/191 (71%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TT+Y++D++G+ + D AT  +SNPF+HGAGH+DPN+AL+PGL+YDL   DYV+
Sbjct  570  AIKSALITTSYSLDSSGSPIKDLATSEESNPFVHGAGHIDPNQALNPGLIYDLTPQDYVS  629

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC+I Y+  +++VFVK  S     E  L  PG+LNYP+FS+ F     VKY R+V NVG
Sbjct  630  FLCSIGYDSKQIAVFVKGSSYSQLCEHKLSNPGNLNYPSFSVVFDDGEVVKYTRTVTNVG  689

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWED  541
             E   VY VKV AP GV++SV P KL FN+    LSYEITFT     +   S+GSI W D
Sbjct  690  DETEVVYGVKVEAPQGVEISVVPNKLEFNKEKTTLSYEITFTKINGFKESASFGSIQWSD  749

Query  542  GVHIVKSPIAV  574
            G+H V+SPIAV
Sbjct  750  GIHNVRSPIAV  760



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=773

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 147/204 (72%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAYT+DN+GN + D A G +S PF+HGAGHVDPNRAL+PGLVYD+ V+DYVA
Sbjct  570  AIKSALVTTAYTLDNSGNKIKDLANGGESTPFVHGAGHVDPNRALNPGLVYDIDVNDYVA  629

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             +C+I Y   +++VF+++ +  + C+  +L +PG LNYP+F++ F    + VKYKR V N
Sbjct  630  FMCSIGYGPRQIAVFMRELAGDDICARNSLASPGDLNYPSFAVVFKPGRELVKYKRVVTN  689

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS--YGSI  529
            VGS   AVYEV V+AP GV++SV P+KLVF+E     SYE+TF  A+   ++N   YGSI
Sbjct  690  VGSVVDAVYEVNVDAPAGVEISVEPSKLVFSEVNQTQSYEVTF--AKGIGYVNGERYGSI  747

Query  530  AWEDGVHIVKSPIAVL*LNEARSA  601
             W DG H V+SP+AV   N   SA
Sbjct  748  EWSDGRHHVRSPVAVRWSNTGYSA  771



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 139/201 (69%), Gaps = 11/201 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY +DN G N+ D ATG +S PF+HGAGHVDPNRALDPGLVYD+ V+DYV 
Sbjct  572  ALKSALMTTAYNLDNGGKNISDLATGKESTPFVHGAGHVDPNRALDPGLVYDISVNDYVE  631

Query  182  LLCTIAYNMDELSVFVKDPST-VNCSEQNLGTPGSLNYPAFSLDFLY---KNQVKYKRSV  349
             LC+I Y+   +++F++D +T VNCS Q+L +PG LNYP+FS+ F     K+ VKY+R V
Sbjct  632  FLCSIGYDEKMIALFIRDGNTSVNCSAQSLPSPGDLNYPSFSVVFKLNGGKDVVKYRRVV  691

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQP-------ARF  508
             NVG    AVYE KV  P  V++SVSP+KLVF+   +  SYEITF +  P          
Sbjct  692  TNVGDSVDAVYEAKVWGPDSVEISVSPSKLVFSGEEERQSYEITFKSVVPPNETEERTAS  751

Query  509  LNSYGSIAWEDGVHIVKSPIA  571
             + +G I W DG H V+SPIA
Sbjct  752  ASKFGWIEWSDGSHRVRSPIA  772



>ref|XP_004510506.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004510507.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=769

 Score =   213 bits (541),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D  TG +SNPF+HGAGHVDPNRAL+PGLVYDL  +DY++
Sbjct  566  AIKSALMTTAYDVDNSGEKIKDLGTGKESNPFVHGAGHVDPNRALNPGLVYDLNSNDYLS  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSE--QNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVK  352
             LC+I Y+  ++ +F ++P++ +  E  + L +PG+LNYP+FS+ F   N  VKYKR V 
Sbjct  626  FLCSIGYDAKKIQIFTREPTSFDVCEKREKLVSPGNLNYPSFSVVFGVNNGLVKYKRVVT  685

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIA  532
            NVG    AVY VKVN+P GV VSVSP+KLVF+      ++EITF          S+GSI 
Sbjct  686  NVGGYVDAVYTVKVNSPFGVDVSVSPSKLVFSGENKTQAFEITFARVGYGG-SQSFGSIE  744

Query  533  WEDGVHIVKSPIAV  574
            W DG HIV+SPIAV
Sbjct  745  WSDGSHIVRSPIAV  758



>gb|KHN01421.1| Subtilisin-like protease [Glycine soja]
Length=387

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 137/198 (69%), Gaps = 8/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G ++ D  +G +SNPFIHGAGHVDPNRA++PGLVYDL   DYVA
Sbjct  181  AIKSALMTTAYNVDNSGGSIKDLGSGKESNPFIHGAGHVDPNRAINPGLVYDLDTGDYVA  240

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLG------TPGSLNYPAFSLDFLYKNQ-VKYK  340
             LC++ Y+ ++++VF ++P+  +  E  +G      +PG LNYP+F++    +   VK K
Sbjct  241  FLCSVGYDANQIAVFTREPAAESVCEGKVGRTGKLASPGDLNYPSFAVKLGGEGDLVKNK  300

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R V NVGSE  AVY VKVN P GV V VSP+ +VF+      ++E+TF+  +      S+
Sbjct  301  RVVTNVGSEVDAVYTVKVNPPPGVGVGVSPSTIVFSAENKTQAFEVTFSRVK-LDGSESF  359

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+V+SPIAV
Sbjct  360  GSIEWTDGSHVVRSPIAV  377



>emb|CBI35855.3| unnamed protein product [Vitis vinifera]
Length=1791

 Score =   216 bits (550),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = +2

Query  2     AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
             AIKSALMTTAY +DN+GNN+ D ATGNQS+PFIHGAGHVDPNRAL PGLVYD+  +DY++
Sbjct  1596  AIKSALMTTAYNLDNSGNNIADLATGNQSSPFIHGAGHVDPNRALYPGLVYDIDANDYIS  1655

Query  182   LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK-------NQVKYK  340
              LC I Y+ + +++FV+  +TV+C+ + L TPG LNYPAFS+ F +        N++K K
Sbjct  1656  FLCAIGYDTERIAIFVRRHTTVDCNTEKLHTPGDLNYPAFSVVFNFDHDPVHQGNEIKLK  1715

Query  341   RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
             R VKNVGS   AVYEVKVN P G++V VSP KLVF++     SYE++FT+ + +   + +
Sbjct  1716  RVVKNVGSSANAVYEVKVNPPEGIEVDVSPKKLVFSKENQTASYEVSFTSVE-SYIGSRF  1774

Query  521   GSIAWE  538
             GSI W+
Sbjct  1775  GSIEWK  1780


 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 132/191 (69%), Gaps = 14/191 (7%)
 Frame = +2

Query  2     AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
             AIKSALMTTAY  DN+G+ + D ATGN+S P IHG+GHV+P  ALDPGLVYD+G  DYV 
Sbjct  986   AIKSALMTTAYNSDNSGSQITDLATGNKSTPLIHGSGHVNPIGALDPGLVYDIGPDDYVT  1045

Query  182   LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
              LC++ Y+ + + +FV+D + VNC  Q +  PG LNYP+FS+           R V+NVG
Sbjct  1046  FLCSVGYS-ENIEIFVRDGTKVNCDSQKM-KPGDLNYPSFSV-----------RVVRNVG  1092

Query  362   SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWED  541
             S K AVY VKVN P  V+++VSP+KLVF E   + SYE+TFT+   A  +  +GSI W D
Sbjct  1093  SSKNAVYSVKVNPPPSVKINVSPSKLVFTEKNQVASYEVTFTSVG-ASLMTEFGSIEWTD  1151

Query  542   GVHIVKSPIAV  574
             G H V+SP+AV
Sbjct  1152  GSHRVRSPVAV  1162



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 139/194 (72%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAYT+D++G  + D ATG +S PF+HGAGHVDPNRAL+PGL+YDL V+DYVA
Sbjct  569  AIKSALITTAYTLDDSGKKIRDLATGKESTPFVHGAGHVDPNRALNPGLIYDLNVNDYVA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVK  352
             LC+I Y+  +++VF+  P+  + C++ +L +PG LNYP+ S+  L  +Q  VKYKR   
Sbjct  629  FLCSIGYSPRQIAVFLGKPTGSDICTKNSLASPGDLNYPSLSV-ILSSDQSLVKYKRVAT  687

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIA  532
            NVG    AVY+V V AP GV++SVSP+KL F+E    LSYE+TF           YGSI 
Sbjct  688  NVGGNVDAVYKVNVTAPAGVEISVSPSKLEFSEENQSLSYEVTFRRGVGYDGGERYGSIE  747

Query  533  WEDGVHIVKSPIAV  574
            W DG H+V+SP+AV
Sbjct  748  WTDGSHLVRSPVAV  761



>gb|KHN39620.1| Subtilisin-like protease, partial [Glycine soja]
Length=618

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 140/198 (71%), Gaps = 8/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G N+ D  +G +SNPFIHGAGHVDPNRAL+PGLVYDL  +DY+A
Sbjct  412  AIKSALMTTAYNVDNSGGNIKDLGSGKESNPFIHGAGHVDPNRALNPGLVYDLDSNDYLA  471

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLG------TPGSLNYPAFSLDFLYKNQ-VKYK  340
             LC++ Y+ ++++VF ++P+  +  E  +G      +PG LNYP+F++    +   VKY+
Sbjct  472  FLCSVGYDANQIAVFTREPAVESVCEGKVGRTGKLASPGDLNYPSFAVKLGGEGDLVKYR  531

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R V NVGSE   VY VKVNAP GV V VSP+ LVF+      ++E+TF+ A+      S+
Sbjct  532  RVVTNVGSEVDVVYTVKVNAPPGVGVGVSPSTLVFSGENKTQAFEVTFSRAK-LDGSESF  590

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+V+SPIAV
Sbjct  591  GSIEWTDGSHVVRSPIAV  608



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 139/201 (69%), Gaps = 9/201 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY +D+ G  + D ATG +SN F+HGAGHVDPNRALDPGLVYD+  SDYVA
Sbjct  544  AIKSALVTTAYVVDDNGAPISDLATGGKSNSFVHGAGHVDPNRALDPGLVYDIQTSDYVA  603

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LCTI Y+ + +SVF     + +CS   LGTPG+LNYP+FS  F  +   VKYKR+VKNV
Sbjct  604  FLCTIGYDANRISVFTDAAYSTDCSAVGLGTPGNLNYPSFSAVFSGRGAVVKYKRTVKNV  663

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS-------  517
            G    AVYEV+V AP+G  V+V+P+KL F++    LS+E+  ++   A  L S       
Sbjct  664  GLNADAVYEVEVKAPIGASVTVTPSKLTFSQNATELSFEVELSSVAGAVDLESSGSSLAA  723

Query  518  YGSIAWED-GVHIVKSPIAVL  577
            +GSI W D G H V+SP+AVL
Sbjct  724  FGSIEWSDGGSHRVRSPVAVL  744



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 134/191 (70%), Gaps = 0/191 (0%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TT+Y++D++G  + D +T  +SNPF+HGAGH++PN+AL+PGL+YDL   DYV+
Sbjct  570  AIKSALITTSYSLDSSGKPIKDLSTSEESNPFVHGAGHINPNQALNPGLIYDLTPQDYVS  629

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC+I Y+  +++VFVK  S     E  L  PG+LNYP+FS+ F  +  VKY R+V NVG
Sbjct  630  FLCSIGYDSKQIAVFVKGSSYFQLCEHKLTNPGNLNYPSFSVVFDEEEVVKYTRTVTNVG  689

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWED  541
             E   VYEVKV AP GV +SV P KL FN+     SYEITFT     +   S+GSI W D
Sbjct  690  DETEVVYEVKVEAPQGVVISVVPNKLEFNKEKTTQSYEITFTKINGFKESASFGSIQWGD  749

Query  542  GVHIVKSPIAV  574
            G+H V+SPIAV
Sbjct  750  GIHSVRSPIAV  760



>gb|EAY87746.1| hypothetical protein OsI_09161 [Oryza sativa Indica Group]
Length=536

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 139/204 (68%), Gaps = 5/204 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D ATG +S PF+ GAGHVDPNRALDPGLVYD G  DYV+
Sbjct  332  AIKSALMTTAYNVDNSGAVIKDLATGTESTPFVRGAGHVDPNRALDPGLVYDAGTEDYVS  391

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LCT+ Y+   +S+F  D S  NCS +   T G LNY AF++    YK+ V Y R V+NV
Sbjct  392  FLCTLGYSPSIISLFTTDGSVANCSTKFPRT-GDLNYAAFAVVLSSYKDSVTYHRVVRNV  450

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN---SYGSI  529
            GS   AVYE K+++P GV V+VSP+KLVF+E+   LSY+IT   +     ++   ++GS+
Sbjct  451  GSNANAVYEAKIDSPSGVDVTVSPSKLVFDESHQSLSYDITIAASGNPVIVDTEYTFGSV  510

Query  530  AWEDGVHIVKSPIAVL*LNEARSA  601
             W DGVH V SPIAV   +  R+A
Sbjct  511  TWSDGVHDVTSPIAVTWPSNGRAA  534



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 140/198 (71%), Gaps = 10/198 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN+G+ + D ATGN+S P IHG+GHV+P  ALDPGLVYD+G  DYV 
Sbjct  584  AIKSALMTTAYNSDNSGSQITDLATGNKSTPLIHGSGHVNPIGALDPGLVYDIGPDDYVT  643

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF------LYKNQ-VKYK  340
             LC++ Y+ + + +FV+D + VNC  Q +  PG LNYP+FS+ F      + + + VK+K
Sbjct  644  FLCSVGYS-ENIEIFVRDGTKVNCDSQKM-KPGDLNYPSFSVVFNADSAVIKRGRVVKHK  701

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R V+NVGS K AVY VKVN P  V+++VSP+KLVF E   + SYE+TFT+   A  +  +
Sbjct  702  RVVRNVGSSKNAVYSVKVNPPPSVKINVSPSKLVFTEKNQVASYEVTFTSVG-ASLMTEF  760

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H V+SP+AV
Sbjct  761  GSIEWTDGSHRVRSPVAV  778



>ref|XP_003547763.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 140/198 (71%), Gaps = 8/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G N+ D  +G +SNPFIHGAGHVDPNRAL+PGLVYDL  +DY+A
Sbjct  567  AIKSALMTTAYNVDNSGGNIKDLGSGKESNPFIHGAGHVDPNRALNPGLVYDLDSNDYLA  626

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLG------TPGSLNYPAFSLDFLYKNQ-VKYK  340
             LC++ Y+ ++++VF ++P+  +  E  +G      +PG LNYP+F++    +   VKY+
Sbjct  627  FLCSVGYDANQIAVFTREPAVESVCEGKVGRTGKLASPGDLNYPSFAVKLGGEGDLVKYR  686

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R V NVGSE   VY VKVNAP GV V VSP+ LVF+      ++E+TF+ A+      S+
Sbjct  687  RVVTNVGSEVDVVYTVKVNAPPGVGVGVSPSTLVFSGENKTQAFEVTFSRAK-LDGSESF  745

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+V+SPIAV
Sbjct  746  GSIEWTDGSHVVRSPIAV  763



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTA+ +DN+G N+ D A+  +S PFIHGAGHVDPN ALDPGLVYD+  SDY+A
Sbjct  569  AIKSALVTTAHNLDNSGKNIKDLASSEESTPFIHGAGHVDPNSALDPGLVYDMDTSDYIA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC I Y+   ++VFV++P + +     +G+PG+LNYP+FS+ F   +  V Y+R+VK+V
Sbjct  629  FLCAIGYDSKRIAVFVREPPSSDICSGKVGSPGNLNYPSFSVVFQSNSDVVTYRRTVKSV  688

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF-TNAQPARFLNS--YGSI  529
            G+   AVYEV+VNAP  V + VSP++LVFN     +SYEITF + +     +NS  +GSI
Sbjct  689  GNSPDAVYEVEVNAPANVDIKVSPSRLVFNAENKTVSYEITFSSVSSGWSSINSATFGSI  748

Query  530  AWEDGVHIVKSPIAV  574
             W +G+H V+SPIAV
Sbjct  749  EWSNGIHRVRSPIAV  763



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 139/198 (70%), Gaps = 10/198 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN+G+ + D A+GN+S P IHG+GHV+P  ALDPGLVYD+G  DYV 
Sbjct  564  AIKSALMTTAYNSDNSGSQITDLASGNKSTPLIHGSGHVNPIGALDPGLVYDIGPDDYVT  623

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-------VKYK  340
             LC++ Y+ + + +FV+D + VNC  Q +  PG LNYP+FS+ F   +        VK+K
Sbjct  624  FLCSVGYS-ENIEIFVRDGTKVNCDSQKM-KPGDLNYPSFSVVFNADSAVIKRGGVVKHK  681

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R V+NVGS K AVY VKVN+P  V+++VSP+KLVF E   + SYE+TFT+   A  +  +
Sbjct  682  RVVRNVGSSKDAVYSVKVNSPPSVKINVSPSKLVFTEKNQVASYEVTFTSVG-ASLMTVF  740

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H V+SP+AV
Sbjct  741  GSIEWTDGSHRVRSPVAV  758



>gb|ACN34516.1| unknown [Zea mays]
Length=384

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 130/195 (67%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D ATG +S PF+ GAGHVDPN ALDPGLVYD G  DYVA
Sbjct  180  AIKSALMTTAYNLDNSGETIKDLATGVESTPFVRGAGHVDPNAALDPGLVYDAGSDDYVA  239

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LCT+ Y+   +S+F +D S  +CS +    PG LNYPAF+  F  Y++ V Y+R V+NV
Sbjct  240  FLCTLGYSPSLISIFTQDASVADCSTK-FARPGDLNYPAFAAVFSSYQDSVTYRRVVRNV  298

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT-NAQPARFLNSY--GSI  529
            GS   AVY+  + +P GV V+V+P+KL F+     L YEIT   +  P    +SY  GSI
Sbjct  299  GSNSSAVYQPTIASPYGVDVTVTPSKLAFDGKQQSLGYEITIAVSGNPVIVDSSYSFGSI  358

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V SPIAV
Sbjct  359  TWSDGAHDVTSPIAV  373



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 137/197 (70%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY +DN+G  L D ATG +SNPF+HGAGHVDPNRAL+PGLVYD GV+DYVA
Sbjct  619  AIKSALITTAYDVDNSGETLRDLATGEESNPFVHGAGHVDPNRALNPGLVYDAGVNDYVA  678

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQN------LGTPGSLNYPAFSLDFLYKNQ-VKYK  340
             LC+I Y+   +S+FV++P++ +   +       L + G LNYP+FS+ F    Q VKYK
Sbjct  679  FLCSIGYDSALISIFVREPTSSDICAKTFDKIGALISSGDLNYPSFSVVFDSNRQVVKYK  738

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R V NVGSE  AVYEV V+ P GV + VSP++LVF       ++E+TFT +      + +
Sbjct  739  RVVTNVGSETDAVYEVSVSEPAGVDIKVSPSRLVFRADNQKQTFEVTFTTSVDYIKSSRF  798

Query  521  GSIAWEDGVHIVKSPIA  571
            GS+ W DG H V+SP+A
Sbjct  799  GSVVWTDGTHRVRSPVA  815



>ref|XP_004954115.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 135/197 (69%), Gaps = 9/197 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D ATG +S PF+ GAGHVDPN ALDPGLVYD G  DYVA
Sbjct  579  AIKSALMTTAYNLDNSGETIKDLATGVESTPFVRGAGHVDPNSALDPGLVYDAGTDDYVA  638

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LCT+ Y    +S+F KD S  +CS +     G LNYPAF+  F  YK+ V Y R V+NV
Sbjct  639  FLCTLGYPPSLISIFTKDSSVADCSRK-FARSGDLNYPAFAAVFSSYKDSVTYHRVVRNV  697

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT-NAQP----ARFLNSYG  523
            GS   AVYE K+ +P GV V+VSP+KLVF++    L+YEIT   +  P    A++  S+G
Sbjct  698  GSNSSAVYESKIVSPSGVDVTVSPSKLVFDDKNRSLAYEITIAVSGNPVIVDAKY--SFG  755

Query  524  SIAWEDGVHIVKSPIAV  574
            SI+W DGVH V SPIAV
Sbjct  756  SISWSDGVHNVTSPIAV  772



>ref|NP_001048301.1| Os02g0779200 [Oryza sativa Japonica Group]
 dbj|BAD19517.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF10215.1| Os02g0779200 [Oryza sativa Japonica Group]
 gb|EAZ24820.1| hypothetical protein OsJ_08598 [Oryza sativa Japonica Group]
Length=782

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 139/204 (68%), Gaps = 5/204 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+   + D ATG +S PF+ GAGHVDPNRALDPGLVYD G  DYV+
Sbjct  578  AIKSALMTTAYNVDNSSAVIKDLATGTESTPFVRGAGHVDPNRALDPGLVYDAGTEDYVS  637

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LCT+ Y+   +S+F  D S  NCS +   T G LNYPAF++    YK+ V Y R V+NV
Sbjct  638  FLCTLGYSPSIISLFTTDGSVANCSTKFPRT-GDLNYPAFAVVLSSYKDSVTYHRVVRNV  696

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN---SYGSI  529
            GS   AVYE K+++P GV V+VSP+KLVF+E+   LSY+IT   +     ++   ++GS+
Sbjct  697  GSNANAVYEAKIDSPSGVDVTVSPSKLVFDESHQSLSYDITIAASGNPVIVDTEYTFGSV  756

Query  530  AWEDGVHIVKSPIAVL*LNEARSA  601
             W DGVH V SPIAV   +  R+A
Sbjct  757  TWSDGVHDVTSPIAVTWPSNGRAA  780



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKS+L+TTA+ +DN+G N+ D A+  +S PFIHGAGHVDPN AL+PGLVYD+  SDY+A
Sbjct  569  AIKSSLVTTAHNLDNSGKNIKDLASSEESTPFIHGAGHVDPNSALNPGLVYDMDTSDYIA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLY-KNQVKYKRSVKNV  358
             LC I Y+   ++VFV++P + +      G+PG+LNYP+FS+ F    ++V Y+R+VKNV
Sbjct  629  FLCAIGYDSKRIAVFVREPPSSDICSGKEGSPGNLNYPSFSVVFQSNSDEVTYRRTVKNV  688

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF-TNAQPARFLNS--YGSI  529
            G+   AVYEV+VNAP  V + VSP+KLVFN     +SY+ITF + +     +NS  +GSI
Sbjct  689  GNSLDAVYEVEVNAPANVDIKVSPSKLVFNAENKTVSYDITFSSVSSGWSSINSATFGSI  748

Query  530  AWEDGVHIVKSPIAV  574
             W +G+H V+SPIAV
Sbjct  749  EWSNGIHRVRSPIAV  763



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 136/194 (70%), Gaps = 3/194 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  D++G  + D AT  +S PF+ GAGHVDPNRALDPGLVYD  V DY+A
Sbjct  570  AIKSALMTTAYNSDDSGETIKDLATEAESTPFVRGAGHVDPNRALDPGLVYDSNVDDYLA  629

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC + Y+  +++VF ++  +VNCS   L +PG LNYPAFS+ F   +  V YKR V+NV
Sbjct  630  FLCAMEYSPAQIAVFTRNEISVNCSTAALDSPGDLNYPAFSVIFSSNSDVVTYKRVVRNV  689

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN--AQPARFLNSYGSIA  532
            G+   A YE +V++P GV V+V+P+ LVF+     LSYEITFT+  +Q      +YGSI+
Sbjct  690  GTSAAAAYEARVSSPPGVDVTVTPSTLVFDAVNVSLSYEITFTSLASQAVAGSYAYGSIS  749

Query  533  WEDGVHIVKSPIAV  574
            W DG H V+SPIAV
Sbjct  750  WSDGDHDVRSPIAV  763



>ref|XP_008792869.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=781

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 130/194 (67%), Gaps = 3/194 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTA  +DN+G  + D ATG +S PF+ GAGHVDPN+ALDPGLVYD  V DY+A
Sbjct  578  AIKSALMTTASNLDNSGELIKDLATGKESTPFVRGAGHVDPNKALDPGLVYDSQVEDYLA  637

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC I Y+  ++++F +D   VNCS   L +PG LNYPAFS  F   +  V Y R V+NV
Sbjct  638  FLCAIGYSPQQIALFTRDEIAVNCSALTLASPGDLNYPAFSAVFSSASDVVTYSRVVRNV  697

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSIA  532
            G    A YE +V+ P GV V+V+P+KLVF+     LSY+IT  +   A      S+G I+
Sbjct  698  GGPDDAAYEAEVSCPPGVNVTVTPSKLVFDAVEQSLSYKITLASMADAAVAGSRSFGWIS  757

Query  533  WEDGVHIVKSPIAV  574
            W DG HIV+SPIAV
Sbjct  758  WSDGAHIVRSPIAV  771



>ref|NP_001146035.1| uncharacterized protein LOC100279566 [Zea mays]
 gb|ACL53074.1| unknown [Zea mays]
Length=503

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 130/195 (67%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D ATG +S PF+ GAGHVDPN ALDPGLVYD G  DYVA
Sbjct  299  AIKSALMTTAYNLDNSGETIKDLATGVESTPFVRGAGHVDPNAALDPGLVYDAGSDDYVA  358

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LCT+ Y+   +S+F +D S  +CS +    PG LNYPAF+  F  Y++ V Y+R V+NV
Sbjct  359  FLCTLGYSPSLISIFTQDASVADCSTK-FARPGDLNYPAFAAVFSSYQDSVTYRRVVRNV  417

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT-NAQPARFLNSY--GSI  529
            GS   AVY+  + +P GV V+V+P+KL F+     L YEIT   +  P    +SY  GSI
Sbjct  418  GSNSSAVYQPTIASPYGVDVTVTPSKLAFDGKQQSLGYEITIAVSGNPVIVDSSYSFGSI  477

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V SPIAV
Sbjct  478  TWSDGAHDVTSPIAV  492



>ref|XP_002454656.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
 gb|EES07632.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
Length=787

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 131/195 (67%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D ATG +S PF+ GAGHVDPN ALDPGLVYD G+ DYVA
Sbjct  583  AIKSALMTTAYNLDNSGETIKDLATGVESTPFVRGAGHVDPNAALDPGLVYDAGIDDYVA  642

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LCT+ Y+   +S+F +D S  NCS +     G LNYPAF+  F  Y++ V Y R V+NV
Sbjct  643  FLCTLGYSPSLISIFTQDGSVANCSRK-FARSGDLNYPAFAAVFSSYQDSVTYHRVVRNV  701

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN---SYGSI  529
            GS   AVYE K+ +P GV V+VSP+KLVF+     L YEIT   +     ++   S+GSI
Sbjct  702  GSNSSAVYEPKIVSPSGVDVTVSPSKLVFDGKQQSLGYEITIAVSGNPVIVDVSYSFGSI  761

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V SPIAV
Sbjct  762  TWSDGAHDVTSPIAV  776



>ref|XP_006583162.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=817

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 137/198 (69%), Gaps = 8/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G ++ D  +G +SNPFIHGAGHVDPNRA++PGLVYDL   DYVA
Sbjct  611  AIKSALMTTAYNVDNSGGSIKDLGSGKESNPFIHGAGHVDPNRAINPGLVYDLDTGDYVA  670

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLG------TPGSLNYPAFSLDFLYKNQ-VKYK  340
             LC++ Y+ ++++VF ++P+  +  E  +G      +PG LNYP+F++    +   VK K
Sbjct  671  FLCSVGYDANQIAVFTREPAAESVCEGKVGRTGKLASPGDLNYPSFAVKLGGEGDLVKNK  730

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY  520
            R V NVGSE  AVY VKVN P GV V VSP+ +VF+      ++E+TF+  +      S+
Sbjct  731  RVVTNVGSEVDAVYTVKVNPPPGVGVGVSPSTIVFSAENKTQAFEVTFSRVK-LDGSESF  789

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+V+SPIAV
Sbjct  790  GSIEWTDGSHVVRSPIAV  807



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 134/197 (68%), Gaps = 7/197 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY ++N+G  + D ATG  SNPFIHGAGHVDPN+AL+PGLVYD+ V +YVA
Sbjct  576  AIKSALVTTAYDVENSGEAIEDLATGKSSNPFIHGAGHVDPNKALNPGLVYDIEVKEYVA  635

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQV-KYKRSVKN  355
             LC + Y    + VF++DPS  + C    L T G LNYP+FS+ F    +V KY+R VKN
Sbjct  636  FLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSTGEVAKYRRVVKN  695

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS-----Y  520
            VGS   AVYEV V +P  V++ VSP+KLVF++    L YE+TF +      + S     +
Sbjct  696  VGSNVDAVYEVGVKSPANVEIEVSPSKLVFSKEKRELEYEVTFKSVVLGGGVGSMPGQEF  755

Query  521  GSIAWEDGVHIVKSPIA  571
            GSI W DG H+VKSP+A
Sbjct  756  GSIEWTDGDHVVKSPVA  772



>gb|ACJ26761.1| subtilisin-like protein [Nicotiana benthamiana]
Length=191

 Score =   189 bits (480),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 121/170 (71%), Gaps = 8/170 (5%)
 Frame = +2

Query  89   NPFIHGAGHVDPNRALDPGLVYDLGVSDYVALLCTIAYNMDELSVFVKDPSTVNCSEQNL  268
            N   +G+GHVDPNRALDPGL+YD+  SDYV  LC+I Y+ D+++VF +D S VNCSE++L
Sbjct  11   NSPCYGSGHVDPNRALDPGLIYDIETSDYVNFLCSIGYDGDDVAVFARDSSRVNCSERSL  70

Query  269  GTPGSLNYPAFSLDFLYKNQ--VKYKRSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLV  442
             TPG LNYP+FS+ F  ++   VKYKR VKNVG    AVYEVKVNAP  V+V+VSP KLV
Sbjct  71   ATPGDLNYPSFSVVFTGESNGVVKYKRVVKNVGKNTDAVYEVKVNAPSSVEVNVSPAKLV  130

Query  443  FNETTDMLSYEITFTNAQPARFL------NSYGSIAWEDGVHIVKSPIAV  574
            F+E    LSYEI+  + +           +++GSI W DG+H V+SPIAV
Sbjct  131  FSEEKQSLSYEISLKSKKSGDLQMVKGIESAFGSIEWSDGIHNVRSPIAV  180



>ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=781

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 133/200 (67%), Gaps = 13/200 (7%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            IKSAL+TTAY +DN+G ++ D ATG  SNPFIHGAGHVDPN+ALDPGLVYD+ + +YVA 
Sbjct  575  IKSALVTTAYNVDNSGESIKDLATGKSSNPFIHGAGHVDPNKALDPGLVYDIDMKEYVAF  634

Query  185  LCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
            LC + Y+   +SVF+ DP   N C    L TPG LNYP+         + VKY+R VKNV
Sbjct  635  LCAVGYDWPAISVFIHDPKLFNACETSKLRTPGDLNYPSLVAVLGSSGEVVKYRRVVKNV  694

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN--------AQPARFLN  514
            GS+  AVY V +N+P  V++ VSP++L F++    L YE+TF +        A+P     
Sbjct  695  GSKADAVYNVGINSPTNVEIEVSPSRLEFSKEKRELEYEVTFRSVVLGGRVGAEP---RE  751

Query  515  SYGSIAWEDGVHIVKSPIAV  574
             +GSI W DG H+V+SP+A+
Sbjct  752  EFGSIEWTDGDHVVRSPVAI  771



>dbj|BAH20348.1| AT3G14067 [Arabidopsis thaliana]
Length=601

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 134/198 (68%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY ++N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V +YVA
Sbjct  394  AIKSALVTTAYDVENSGEPIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVA  453

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             LC + Y    + VF++DP+  + C    L T G LNYP+FS+ F    + VKYKR VKN
Sbjct  454  FLCAVGYEFPGILVFLQDPTLYDACDTSKLRTAGDLNYPSFSVVFASTGEVVKYKRVVKN  513

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVYEV V +P  V++ VSP+KL F++   +L YE+TF +      +     + +
Sbjct  514  VGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSVLEYEVTFKSVVLGGGVGSVPGHEF  573

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  574  GSIEWTDGEHVVKSPVAV  591



>gb|AFW73751.1| putative subtilase family protein [Zea mays]
Length=783

 Score =   201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 130/195 (67%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  + D ATG +S PF+ GAGHVDPN ALDPGLVYD G  DYVA
Sbjct  579  AIKSALMTTAYNLDNSGETIKDLATGVESTPFVRGAGHVDPNAALDPGLVYDAGSDDYVA  638

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LCT+ Y+   +S+F +D S  +CS +    PG LNYPAF+  F  Y++ V Y+R V+NV
Sbjct  639  FLCTLGYSPSLISIFTQDASVADCSTK-FARPGDLNYPAFAAVFSSYQDSVTYRRVVRNV  697

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT-NAQPARFLNSY--GSI  529
            GS   AVY+  + +P GV V+V+P+KL F+     L YEIT   +  P    +SY  GSI
Sbjct  698  GSNSSAVYQPTIASPYGVDVTVTPSKLAFDGKQQSLGYEITIAVSGNPVIVDSSYSFGSI  757

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V SPIAV
Sbjct  758  TWSDGAHDVTSPIAV  772



>ref|XP_002885009.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61268.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=777

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 134/198 (68%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY ++N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V +YVA
Sbjct  570  AIKSALVTTAYDVENSGEPIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVA  629

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             LC + Y    + VF++DP+  N C    L T G LNYP+FS+ F    + VKYKR+VKN
Sbjct  630  FLCAVGYEFPGILVFLQDPTLFNACETSKLRTAGDLNYPSFSVVFGSTGEVVKYKRAVKN  689

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVYEV V +P  V++ VSP+KL F++    L YE+TF +      +     + +
Sbjct  690  VGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSELEYEVTFKSVVLGGGVGSVPGHEF  749

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  750  GSIEWADGEHVVKSPVAV  767



>dbj|BAJ87876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 131/195 (67%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY +DN+G  + D ATG+QS PF+ GAGHVDPN AL+PGLVYD   +DY+ 
Sbjct  580  AVKSALMTTAYNLDNSGEIIKDLATGSQSTPFVRGAGHVDPNSALNPGLVYDADTADYIG  639

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LC + Y   +++VF +D S  +CS++   + G LNYPAF+  F  YK+ V Y R V NV
Sbjct  640  FLCALGYTPSQIAVFTRDGSVADCSKKPARS-GDLNYPAFAAVFSSYKDSVTYHRVVSNV  698

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN---SYGSI  529
            G + +AVYE KV +P GV   V+P KLVF+E    L+YEIT   A     ++   S+GS+
Sbjct  699  GGDPKAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVAGNPVIVDGKYSFGSV  758

Query  530  AWEDGVHIVKSPIAV  574
             W DGVH V SPIAV
Sbjct  759  TWSDGVHNVTSPIAV  773



>dbj|BAJ93208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 131/195 (67%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY +DN+G  + D ATG+QS PF+ GAGHVDPN AL+PGLVYD   +DY+ 
Sbjct  580  AVKSALMTTAYNLDNSGEIIKDLATGSQSTPFVRGAGHVDPNSALNPGLVYDADTADYIG  639

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LC + Y   +++VF +D S  +CS++   + G LNYPAF+  F  YK+ V Y R V NV
Sbjct  640  FLCALGYTPSQIAVFTRDGSVADCSKKPARS-GDLNYPAFAAVFSSYKDSVTYHRVVSNV  698

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN---SYGSI  529
            G + +AVYE KV +P GV   V+P KLVF+E    L+YEIT   A     ++   S+GS+
Sbjct  699  GGDPKAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVAGNPVIVDGKYSFGSV  758

Query  530  AWEDGVHIVKSPIAV  574
             W DGVH V SPIAV
Sbjct  759  TWSDGVHNVTSPIAV  773



>dbj|BAE98521.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
Length=777

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 134/198 (68%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY ++N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V +YVA
Sbjct  570  AIKSALVTTAYDVENSGEPIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVA  629

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             LC + Y    + VF++DP+  + C    L T G LNYP+FS+ F    + VKYKR VKN
Sbjct  630  FLCAVGYEFPGILVFLQDPTLYDACETSKLRTAGDLNYPSFSVVFASTGEVVKYKRVVKN  689

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVYEV V +P  V++ VSP+KL F++   +L YE+TF +      +     + +
Sbjct  690  VGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSVLEYEVTFKSVVLGGGVGSVPGHEF  749

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  750  GSIEWTDGEHVVKSPVAV  767



>ref|NP_566473.2| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB02339.1| cucumisin-like serine protease; subtilisin-like protease [Arabidopsis 
thaliana]
 gb|AAS49055.1| At3g14067 [Arabidopsis thaliana]
 gb|AAS76762.1| At3g14067 [Arabidopsis thaliana]
 dbj|BAF00939.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
 gb|AEE75461.1| Subtilase family protein [Arabidopsis thaliana]
Length=777

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 134/198 (68%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY ++N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V +YVA
Sbjct  570  AIKSALVTTAYDVENSGEPIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVA  629

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             LC + Y    + VF++DP+  + C    L T G LNYP+FS+ F    + VKYKR VKN
Sbjct  630  FLCAVGYEFPGILVFLQDPTLYDACETSKLRTAGDLNYPSFSVVFASTGEVVKYKRVVKN  689

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVYEV V +P  V++ VSP+KL F++   +L YE+TF +      +     + +
Sbjct  690  VGSNVDAVYEVGVKSPANVEIDVSPSKLAFSKEKSVLEYEVTFKSVVLGGGVGSVPGHEF  749

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  750  GSIEWTDGEHVVKSPVAV  767



>emb|CDX97539.1| BnaA05g25400D [Brassica napus]
Length=481

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 131/198 (66%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY  +N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V DYVA
Sbjct  273  AIKSALVTTAYDTENSGEPIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIDVKDYVA  332

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYK-NQVKYKRSVKN  355
             LC + Y    + VF++DP+  N C    L T G LNYP+FS+ F    + VKY+R VKN
Sbjct  333  FLCAVGYEFPGILVFLQDPTLYNACETSKLRTAGDLNYPSFSVVFGSTVDVVKYRRVVKN  392

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VG+   AVYEV V +P  V++ VSP KL F++    L YE+TF +      +     + +
Sbjct  393  VGTNVDAVYEVGVKSPANVEIDVSPRKLAFSKGEGELEYEVTFRSVVLGGGVGSVPGHEF  452

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  453  GSIEWTDGEHVVKSPVAV  470



>gb|ACB87529.1| subtilisin protease [Triticum aestivum]
Length=571

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 129/195 (66%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY +DN+G  + D ATG +S PF+ GAGHVDPN ALDPGLVYD   +DY+ 
Sbjct  367  AVKSALMTTAYNLDNSGEIIKDLATGTESTPFVRGAGHVDPNSALDPGLVYDADTADYIG  426

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LC + Y   +++VF +D S  +C ++   + G LNYPAF+  F  YK+ V Y R V+NV
Sbjct  427  FLCALGYTPSQIAVFTRDGSVADCLKKPARS-GDLNYPAFAAVFSSYKDSVTYHRVVRNV  485

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN---SYGSI  529
            GS+  AVYE KV +P GV   V+P KLVF+E    L+YEIT   +     ++   S+GS+
Sbjct  486  GSDASAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVSGNPVIVDAKYSFGSV  545

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V SPIAV
Sbjct  546  TWSDGKHNVTSPIAV  560



>ref|XP_010501588.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=788

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 132/198 (67%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSAL+TTAY ++N+G  L D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V +YVA
Sbjct  579  AVKSALVTTAYDVENSGEPLEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVA  638

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             LC + Y    + VF++DPS  + C    L T G LNYP+F++ F    + VKYKR VKN
Sbjct  639  FLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFAVVFGSSGEVVKYKRVVKN  698

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVYEV V +P  V++ VSP+KL FN+    L YE+TF +      +       +
Sbjct  699  VGSNVDAVYEVGVKSPANVEIDVSPSKLEFNKEKSELEYEVTFKSVVLGGGVGSVPSQEF  758

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  759  GSIEWTDGDHVVKSPVAV  776



>emb|CDY33251.1| BnaC01g37240D [Brassica napus]
Length=775

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 132/198 (67%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY  +N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+   DYVA
Sbjct  568  AIKSALVTTAYDTENSGEPIEDLATGESSNSFIHGAGHVDPNKALNPGLVYDVDAKDYVA  627

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             LC + Y    + VF++DPS  + C    L T G LNYP+FS+ F   +  VKY+R VKN
Sbjct  628  FLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSNDGVVKYRRVVKN  687

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVYEV V AP  V++ VSP+KL F++ T  + YE+TF +      +     + +
Sbjct  688  VGSNVDAVYEVGVKAPANVEIDVSPSKLAFSKETREMEYEVTFKSVVLGGGVGSVPGHEF  747

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  748  GSIEWTDGEHVVKSPVAV  765



>gb|KFK38761.1| hypothetical protein AALP_AA3G157200 [Arabis alpina]
Length=775

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 134/198 (68%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY I+N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V +YVA
Sbjct  568  AIKSALVTTAYDIENSGEPIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIDVKEYVA  627

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYK-NQVKYKRSVKN  355
             LC + Y+   + VF++DPS  + C    L T G LNYP+FS+ F    + VKYKR VKN
Sbjct  628  FLCAVGYSFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVIFGSTVDVVKYKRVVKN  687

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVY+V V +P+ V++ VSP+KL F++    L YE+TF +      +       +
Sbjct  688  VGSNVDAVYQVGVKSPVNVEIDVSPSKLEFSKEKSELEYEVTFKSVVLGGGVGSVPGQEF  747

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  748  GSIQWTDGEHVVKSPVAV  765



>ref|XP_010487192.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=786

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 131/198 (66%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSAL+TTAY ++N+G  L D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V +YVA
Sbjct  578  AVKSALVTTAYDVENSGEPLEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVA  637

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             LC + Y    + VF++DPS  + C    L T G LNYP+F++ F      VKYKR VKN
Sbjct  638  FLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFAVVFGSTGDVVKYKRVVKN  697

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVYEV V +P  V++ VSP+KL FN+    L YE+TF +      +       +
Sbjct  698  VGSNVDAVYEVGVKSPANVEIDVSPSKLEFNKEKSELEYEVTFKSVVLGGGVGSVPSQEF  757

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  758  GSIEWTDGDHVVKSPVAV  775



>gb|KDP40686.1| hypothetical protein JCGZ_24685 [Jatropha curcas]
Length=773

 Score =   196 bits (497),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 135/195 (69%), Gaps = 4/195 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY++DN+G N++D A+G +S  F+HGAGHVDPN ALDPGLVYDL   D++ 
Sbjct  568  AIKSALITTAYSLDNSGENILDLASGKESTAFVHGAGHVDPNSALDPGLVYDLETRDFIL  627

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYP-AFSLDFLYKNQVKYKRSVKNV  358
             LCTI Y+   +SVF+ +P+++N  +Q L +PG+LNYP    +     + V YKR VKNV
Sbjct  628  FLCTIGYDSKRISVFIGEPASLNVCDQKLSSPGNLNYPSFSVVFDSSSDVVTYKRVVKNV  687

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQ---PARFLNSYGSI  529
            GS   AVYE KVNAP  V + +S +KL F+     LSYEITF++A     +    S+GSI
Sbjct  688  GSSVNAVYEAKVNAPANVDIKLSTSKLEFSAENKSLSYEITFSSASLGLSSFGSQSFGSI  747

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V+SPIAV
Sbjct  748  EWSDGTHRVRSPIAV  762



>ref|XP_009117189.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 132/198 (67%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY  +N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYDL   +YVA
Sbjct  568  AIKSALVTTAYDTENSGEPIEDLATGESSNSFIHGAGHVDPNKALNPGLVYDLDAKEYVA  627

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYK-NQVKYKRSVKN  355
             LC + Y    + VF++DPS  + C    L T G LNYP+FS+ F    + VKY+R VKN
Sbjct  628  FLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSSVDVVKYRRVVKN  687

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVY+V V AP  V++ VSP+KL F++ T  + YE+TF +      +     + +
Sbjct  688  VGSNVDAVYQVGVKAPANVEIDVSPSKLAFSKETREMEYEVTFKSVVLGGGVGSVPGHEF  747

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  748  GSIEWTDGEHVVKSPVAV  765



>emb|CDY39093.1| BnaA01g29630D [Brassica napus]
Length=775

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 132/198 (67%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY  +N+G  + D ATG  SN FIHGAGHVDPN+AL+PGL+YDL   +YVA
Sbjct  568  AIKSALVTTAYDTENSGEPIEDLATGESSNSFIHGAGHVDPNKALNPGLIYDLDAKEYVA  627

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYK-NQVKYKRSVKN  355
             LC + Y    + VF++DPS  + C    L T G LNYP+FS+ F    + VKY+R VKN
Sbjct  628  FLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFSVVFGSSVDVVKYRRVVKN  687

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VGS   AVY+V V AP  V++ VSP+KL F++ T  + YE+TF +      +     + +
Sbjct  688  VGSNVDAVYQVGVKAPANVEIDVSPSKLAFSKETREMEYEVTFKSVVLGGGVGSVPGHEF  747

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  748  GSIEWTDGEHVVKSPVAV  765



>ref|XP_009146419.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=776

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 131/198 (66%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY  +N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V DYVA
Sbjct  568  AIKSALVTTAYDTENSGEPIEDLATGKSSNSFIHGAGHVDPNKALNPGLVYDIDVKDYVA  627

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYK-NQVKYKRSVKN  355
             LC + Y    + VF++DP+  N C    L T G LNYP+FS+ F    + VKY+R VKN
Sbjct  628  FLCAVGYEFPGILVFLQDPTLYNACETSKLRTAGDLNYPSFSVVFGSSVDVVKYRRVVKN  687

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VG+   AVYEV V +P  V++ VSP +L F++    L YE+TF +      +     + +
Sbjct  688  VGTNVEAVYEVGVKSPANVEIDVSPRRLAFSKGESELEYEVTFRSVVLGGGVGSVPGHEF  747

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  748  GSIEWTDGEHVVKSPVAV  765



>emb|CDY52259.1| BnaC05g52030D [Brassica napus]
Length=736

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 131/198 (66%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL+TTAY  +N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V DYVA
Sbjct  529  AIKSALVTTAYDTENSGEPIEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIDVKDYVA  588

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYK-NQVKYKRSVKN  355
             LC + Y    + VF++DP+  N C    L T G LNYP+FS+ F    + VKY+R VKN
Sbjct  589  FLCAVGYEFPGILVFLQDPTLYNACETSKLKTSGDLNYPSFSVVFGSTVDVVKYRRVVKN  648

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NSY  520
            VG+   AVYEV V +P  V++ VSP KL F++    L YE+TF +      +     + +
Sbjct  649  VGTNVDAVYEVGVKSPANVEIDVSPRKLAFSKGEGELEYEVTFRSVVLGGGVGSVPGHEF  708

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H+VKSP+AV
Sbjct  709  GSIEWTDGEHVVKSPVAV  726



>ref|XP_010465286.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=789

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 131/199 (66%), Gaps = 8/199 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSAL+TTAY ++N+G  L D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V +YVA
Sbjct  580  AVKSALVTTAYDVENSGEPLEDLATGKPSNSFIHGAGHVDPNKALNPGLVYDIEVKEYVA  639

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDF--LYKNQVKYKRSVK  352
             LC + Y    + VF++DPS  + C    L T G LNYP+F++ F       VKYKR VK
Sbjct  640  FLCAVGYEFPGILVFLQDPSLYDACETSKLRTAGDLNYPSFAVVFGSTTGEVVKYKRVVK  699

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-----NS  517
            NVGS   AVYEV V +P  V++ VSP+KL F++    L YE+TF +      +       
Sbjct  700  NVGSNVDAVYEVGVKSPANVEIDVSPSKLEFSKEKSELEYEVTFKSVVLGGGVGSVPSQE  759

Query  518  YGSIAWEDGVHIVKSPIAV  574
            +GSI W DG H+VKSP+AV
Sbjct  760  FGSIEWTDGDHVVKSPVAV  778



>ref|XP_002452918.1| hypothetical protein SORBIDRAFT_04g034950 [Sorghum bicolor]
 gb|EES05894.1| hypothetical protein SORBIDRAFT_04g034950 [Sorghum bicolor]
Length=780

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 129/196 (66%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DNAG+ + D +TG  S PF+ GAGHVDPNRAL+PGLVYD+G  DYV+
Sbjct  579  AIKSALMTTAYNVDNAGDIIKDMSTGTASTPFVRGAGHVDPNRALNPGLVYDVGTDDYVS  638

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLY-KNQVKYKRSVKNV  358
             LC + Y   +++V  +D ST +CS ++ G+ G LNYPAFS+ F    ++V   R V+NV
Sbjct  639  FLCALGYTARQIAVLTRDGSTTDCSTRS-GSVGDLNYPAFSVLFGSGGDEVTQHRIVRNV  697

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SYGSIAW  535
            GS  RA Y   V +P GV+V+V P  L F+ T     Y ITF   Q +     ++GSI W
Sbjct  698  GSNVRATYTASVASPAGVRVTVEPPTLKFSATQQTQEYAITFAREQGSVTEKYTFGSIVW  757

Query  536  EDGVHIVKSPIAVL*L  583
             DG H V SPI+V+ L
Sbjct  758  SDGEHKVTSPISVIWL  773



>ref|XP_004954114.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=782

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 122/194 (63%), Gaps = 3/194 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSA+MTTAY +DNAGN + D +TG  S PF++GAGHVDPNRA+DPGLVYD GV DY++
Sbjct  579  AIKSAMMTTAYVLDNAGNVIKDTSTGRASTPFVYGAGHVDPNRAVDPGLVYDAGVRDYIS  638

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK-NQVKYKRSVKNV  358
             LC + Y   E+ +F +D S  +      G+ G LNYPAFS  F    ++V  +R V+NV
Sbjct  639  FLCALGYTSKEIGIFTRDDSRADYCSTRTGSSGDLNYPAFSAVFHSDMDEVTQRRVVRNV  698

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GSIA  532
            G    A Y  ++ +P GV+V+V P KL F  T     Y +TF     AR  + Y  GSI 
Sbjct  699  GRNVSATYTARIISPAGVRVTVEPRKLQFTATQQTREYVMTFAPRGDARVTDKYTFGSIV  758

Query  533  WEDGVHIVKSPIAV  574
            W DG H V SPIA+
Sbjct  759  WSDGEHKVTSPIAI  772



>gb|AGN03879.1| senescence-associated subtilisin protease [Triticum aestivum]
Length=786

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 130/196 (66%), Gaps = 9/196 (5%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            +KSALMTTAY +DN+G  + D ATG +S PF+ GAGHVDP  AL+PGLVYD   +DY+  
Sbjct  583  VKSALMTTAYNMDNSGEIIKDLATGTESTPFVRGAGHVDPISALNPGLVYDADTADYIGF  642

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNVG  361
            LC + Y   +++VF +D S  +CS++   + G LNYPAF+  F  YK+ V Y R V+NVG
Sbjct  643  LCALGYTPAQIAVFTRDGSVADCSKKPARS-GDLNYPAFAAVFSSYKDSVTYHRVVRNVG  701

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT-NAQP----ARFLNSYGS  526
            S+  AVYE KV +P GV   V+P KLVF+E    L+YEIT   +  P    A++  S+GS
Sbjct  702  SDASAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVSGNPVIVDAKY--SFGS  759

Query  527  IAWEDGVHIVKSPIAV  574
            + W DG H V SPIAV
Sbjct  760  VTWSDGKHNVTSPIAV  775



>gb|EMT02947.1| Subtilisin-like protease [Aegilops tauschii]
Length=411

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 121/194 (62%), Gaps = 3/194 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DNAG+ + D ATG  S PF  GAGHVDPNRALDPGLVYD G+ DYV 
Sbjct  206  AIKSALMTTAYNMDNAGHVIGDMATGKASTPFARGAGHVDPNRALDPGLVYDAGMDDYVT  265

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSE-QNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKN  355
             LC + Y  DE+++F +D S+ NCS     G  G  NYPAF   F  +N+ +   R V+N
Sbjct  266  FLCALGYTADEVAIFTRDGSSTNCSTLPGSGYVGDHNYPAFVAVFTSRNETITQHRMVRN  325

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SYGSIA  532
            VG+   A Y   V +P G++V V P KL F+ T +   Y++TF+          ++GSI 
Sbjct  326  VGNNVDATYRATVTSPAGMRVDVKPQKLQFSTTHNTQEYQVTFSIRAAGSIKEYTFGSIT  385

Query  533  WEDGVHIVKSPIAV  574
            W DG H V SP A+
Sbjct  386  WSDGKHTVTSPNAI  399



>gb|EAY87749.1| hypothetical protein OsI_09164 [Oryza sativa Indica Group]
Length=525

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 122/190 (64%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSA+MTTAY +DN GN + D ATG  + PF  G+GHVDPNRALDPGLVY+    DY+ 
Sbjct  331  AIKSAMMTTAYNVDNDGNAIKDMATGQAAGPFELGSGHVDPNRALDPGLVYNTTADDYIT  390

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKN-QVKYKRSVKNV  358
             LC++ YN  ++++F  D ST +CS +   + G LNYPAFS+ F     QV  +R+V NV
Sbjct  391  FLCSLGYNSSQIALFTNDGSTTDCSTRPRRSVGDLNYPAFSVVFARSGEQVTQRRAVTNV  450

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            G+    VY V + AP G  ++V+PT+L F+     L Y IT +    +   + +GSI W 
Sbjct  451  GANTNVVYNVTITAPPGTTLTVTPTRLAFDAQRRTLDYSITVSAGATSSSEHQWGSIVWS  510

Query  539  DGVHIVKSPI  568
            DG H+V+SP+
Sbjct  511  DGQHMVRSPV  520



>gb|AFW73750.1| putative subtilase family protein [Zea mays]
Length=787

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 132/197 (67%), Gaps = 9/197 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSA+MTTAY +DNAG+ + D +TG  S PF+ GAGHVDP+RA+DPGLVYD G  +Y++
Sbjct  582  AVKSAMMTTAYNVDNAGDIIKDMSTGKASTPFVRGAGHVDPDRAVDPGLVYDAGADEYLS  641

Query  182  LLCTIAYNMDELSVF-VKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKN  355
             LC I Y  ++++VF  KD   V+CS++     G  NYPAFS+     ++ V  +R V+N
Sbjct  642  FLCAIGYTAEQIAVFRTKDDPAVDCSKRKASV-GDHNYPAFSVVLNSTRDAVTQRRVVRN  700

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQ----PARFLNSYG  523
            VGS  RA Y   V +P GV+V+V+P KL F+ T    +YEITFT+ +    P ++  ++G
Sbjct  701  VGSSARATYWASVTSPAGVRVTVNPRKLRFSATQKTQAYEITFTSRRMWSVPDKY--TFG  758

Query  524  SIAWEDGVHIVKSPIAV  574
            SI W DG H V SPIA+
Sbjct  759  SIVWSDGEHKVTSPIAI  775



>ref|NP_001145849.1| uncharacterized protein LOC100279360 precursor [Zea mays]
 gb|ACL52723.1| unknown [Zea mays]
Length=786

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 129/196 (66%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSA+MTTAY +DNAG+ + D +TG  S PF+ GAGHVDP+RA+DPGLVYD G  +Y++
Sbjct  582  AVKSAMMTTAYNVDNAGDIIKDMSTGKASTPFVRGAGHVDPDRAVDPGLVYDAGADEYLS  641

Query  182  LLCTIAYNMDELSVF-VKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNV  358
             LC I Y  ++++VF  KD   V+CS++     G  NYPAFS+          +R V+NV
Sbjct  642  FLCAIGYTAEQIAVFRTKDDPAVDCSKRKASV-GDHNYPAFSVVLNSTRDAVTRRVVRNV  700

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQ----PARFLNSYGS  526
            GS  RA Y   V +P GV+V+V+P KL F+ T    +YEITFT+ +    P ++  ++GS
Sbjct  701  GSSARATYWASVTSPAGVRVTVNPRKLRFSATQKTQAYEITFTSRRMWSVPDKY--TFGS  758

Query  527  IAWEDGVHIVKSPIAV  574
            I W DG H V SPIA+
Sbjct  759  IVWSDGEHKVTSPIAI  774



>ref|XP_004954112.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=780

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 124/197 (63%), Gaps = 8/197 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DNAG+ + D +TG  S PF+ GAGHVDPNRA DPGLVYD G  DY++
Sbjct  576  AIKSALMTTAYNVDNAGDIIRDMSTGQASTPFVRGAGHVDPNRAADPGLVYDAGADDYMS  635

Query  182  LLCTIAYNMDELSVFVK--DPSTVNCSEQNLGTPGSLNYPAFSLDFL--YKNQVKYKRSV  349
             LC I Y  ++++ F    DP+ VNCS +   T G LNYPAFS+ F+   KN+V  +R V
Sbjct  636  FLCAIGYTDEQIAKFTTKGDPA-VNCSTRR-ATAGDLNYPAFSVVFVNSTKNEVTQRRVV  693

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--G  523
            +NVGS  RA Y V V  P GV+V+V P  L FN       Y +TF     A     Y  G
Sbjct  694  RNVGSNVRAKYRVAVTRPAGVRVTVKPRILRFNRRQRTQEYAVTFMPLVGANVTEKYTDG  753

Query  524  SIAWEDGVHIVKSPIAV  574
            SI W DG H V SP+A+
Sbjct  754  SIVWSDGKHRVTSPLAI  770



>dbj|BAJ91400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   187 bits (475),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 123/198 (62%), Gaps = 11/198 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +D+AGN + D ATG  S PF  GAGHVDP+RALDPGLVYD G  DYVA
Sbjct  578  AIKSALMTTAYNVDSAGNVIGDMATGKASTPFARGAGHVDPDRALDPGLVYDAGTDDYVA  637

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSL-----NYPAFSLDFLYKN-QVKYKR  343
             LC + Y  DE++VF +D S+ NCS      PGS      NYPAF      +N  +  +R
Sbjct  638  FLCALGYTADEVAVFTRDGSSTNCSA----APGSAYVGDHNYPAFVAVLTSRNGTITQRR  693

Query  344  SVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SY  520
             V+NVGS+  A Y   V +P G++++V P KL F++T     Y++TF           ++
Sbjct  694  VVRNVGSDVVATYRATVTSPAGMRITVKPRKLRFSKTHKTQEYQVTFAIRAAGSIKEYTF  753

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H V SPIA+
Sbjct  754  GSIVWSDGEHKVTSPIAI  771



>gb|EMT11314.1| hypothetical protein F775_42966 [Aegilops tauschii]
Length=516

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 131/234 (56%), Gaps = 44/234 (19%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY +DN+G  + D ATG +S PF+ GAGHVDP  AL+PGLVYD   +DY+ 
Sbjct  273  AVKSALMTTAYNMDNSGEIIKDLATGTESTPFVRGAGHVDPISALNPGLVYDADTADYIG  332

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LC + Y   +++VF +D S  +CS++   + G LNYPAF+  F  YK+ V Y R+V+NV
Sbjct  333  FLCALGYTPAQIAVFTRDGSVADCSKKPARS-GDLNYPAFAAVFSSYKDSVTYPRAVRNV  391

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF----------------TN  490
            GS+  AVYE KV +P GV   V+P KLVF+E    L+YEIT                   
Sbjct  392  GSDASAVYEAKVESPAGVDAKVTPAKLVFDEEHRSLAYEITLAVSGNPAKVESPAGVDAK  451

Query  491  AQPARFL--------------------------NSYGSIAWEDGVHIVKSPIAV  574
              PA+ +                           S+GS+ W DG H V SPIAV
Sbjct  452  VTPAKLVFDEEHRSLAYEITLAVSGNPVIVDAKYSFGSVTWSDGKHNVTSPIAV  505



>gb|ABK96588.1| unknown [Populus trichocarpa x Populus deltoides]
Length=218

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 121/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN  + L D A G  SNP+ HG+GHVDP +AL PGLVYD+   +YVA
Sbjct  24   AIKSALMTTAYVSDNTNSPLQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISADEYVA  83

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ + CS +    PG+LNYP+FS+ F     V+Y R + NVG
Sbjct  84   FLCSLDYTIEHVQAIVKRPN-ITCSRK-FNNPGNLNYPSFSVVFTNNRVVRYTRELTNVG  141

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSIAW  535
            +   ++YEV V  P  VQV+V P+KLVF    D L Y +TF   + A     + +G+I W
Sbjct  142  AAG-SIYEVAVTGPQAVQVTVKPSKLVFKNVGDKLRYTVTFVARKGASLTGRSEFGAIVW  200

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  201  RNAQHQVRSPVA  212



>ref|XP_008679257.1| PREDICTED: subtilisin-like protease [Zea mays]
 gb|AFW64267.1| putative subtilase family protein [Zea mays]
Length=780

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 124/193 (64%), Gaps = 3/193 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTA+ +D+AG+ + D +TG  S PF+ GAGHVDPNRAL+PGLVYD G  DYV+
Sbjct  579  AIKSALMTTAFNVDSAGDVIRDMSTGGASTPFVRGAGHVDPNRALNPGLVYDAGTDDYVS  638

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLY-KNQVKYKRSVKNV  358
             LC + Y   +++V  +D S  +CS +  G+ G LNYPAFS+ F    ++V  +R V+NV
Sbjct  639  FLCALGYTARQIAVLTRDGSVTDCSTRP-GSVGDLNYPAFSVVFGSGDDEVTQRRVVRNV  697

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SYGSIAW  535
            GS  RA Y   V +P GV+V+V P  L F+       Y +TF   Q +     ++GSI W
Sbjct  698  GSNARATYTASVASPAGVRVTVEPPTLEFSAAQQTQEYAVTFAPEQGSVAEKYTFGSIVW  757

Query  536  EDGVHIVKSPIAV  574
             DG H V SPIA+
Sbjct  758  SDGEHKVTSPIAI  770



>ref|XP_004954113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=776

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 123/194 (63%), Gaps = 5/194 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DNAG+ + D +TG  S PF+ GAGHVDPN A+DPGLVYD G  DY++
Sbjct  574  AIKSALMTTAYNVDNAGDIIKDMSTGEASTPFVRGAGHVDPNCAVDPGLVYDAGTDDYIS  633

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKN-QVKYKRSVKNV  358
             LC + Y   +++V  +D S  +CS+++ G+ G  NYPAFS+ F   + +V  +R V+NV
Sbjct  634  FLCALGYTAKQIAVLTRDGSVTDCSKRS-GSVGDHNYPAFSVVFSSGDGKVTQRRVVRNV  692

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GSIA  532
            GS   A Y   V +P GV+V+V P  L F+ T     Y ITF  AQ       Y  GSI 
Sbjct  693  GSNAMATYTASVTSPAGVRVTVEPPTLQFSATQKTQEYAITFA-AQQGSVTEKYTFGSIV  751

Query  533  WEDGVHIVKSPIAV  574
            W DG H V SPIA+
Sbjct  752  WSDGKHKVTSPIAI  765



>ref|XP_003570499.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=780

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 125/200 (63%), Gaps = 16/200 (8%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            IKSALMTTAY +DN+G+ + D +TG  S PF  GAGHVDPNRA+DPGLVYD    DYV  
Sbjct  575  IKSALMTTAYNMDNSGSIIGDMSTGKASTPFARGAGHVDPNRAVDPGLVYDADTDDYVTF  634

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTP-GSLNYPAFSLDFLYKN--QVKYKRSVKN  355
            LC + Y  +++++  +D    +CS +N+G   G  NYPAF+  F       +K +R+V+N
Sbjct  635  LCALGYTDEQVAIMTRD--ATSCSTRNMGAAVGDHNYPAFAATFTINKFAVIKQRRTVRN  692

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN------S  517
            VGS  RA Y  KV +P G +V+V P  L F+ET +ML YE+TF      R  +      +
Sbjct  693  VGSNARATYSAKVTSPAGTRVTVKPETLRFSETKEMLEYEVTFAQ----RMFDIVTDKHT  748

Query  518  YGSIAWED-GVHIVKSPIAV  574
            +GSI W D G H V SPIA+
Sbjct  749  FGSIEWSDGGEHKVTSPIAI  768



>dbj|BAD19523.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 gb|EAZ24825.1| hypothetical protein OsJ_08604 [Oryza sativa Japonica Group]
Length=690

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 121/190 (64%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSA+MTTAY +DN GN + D ATG  + PF  G+GHVDPNRALDPGLV +    DY+ 
Sbjct  496  AIKSAMMTTAYNVDNDGNAIKDMATGQAARPFELGSGHVDPNRALDPGLVNNTTADDYIT  555

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKN-QVKYKRSVKNV  358
             LC++ YN  ++++F  D ST +CS +   + G LNYPAFS+ F+    QV  +R+V NV
Sbjct  556  FLCSLGYNSSQIALFTNDGSTTDCSTRPRRSVGDLNYPAFSVVFVRSGEQVTQRRAVTNV  615

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            G+    +Y V + AP G  ++V+PT+L F+     L Y IT +    +   + +GSI W 
Sbjct  616  GANTNVMYNVTITAPPGTTLTVTPTRLAFDAQRRTLDYSITVSAGATSSSEHQWGSIVWS  675

Query  539  DGVHIVKSPI  568
            DG H V+SP+
Sbjct  676  DGQHTVRSPV  685



>ref|XP_010088794.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36977.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 127/200 (64%), Gaps = 12/200 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G  L D ATG  S PF HG+GHVDP+RALDPGL+YD+ V+DYV 
Sbjct  578  AIKSALMTTAYNLDNSGQRLKDLATGKTSTPFAHGSGHVDPSRALDPGLIYDMSVTDYVG  637

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQN---LG---TPGSLNYPAFSLDFLYKNQ----V  331
             LC+I Y+   +S+F     +    E+    LG   TPG LN P+FS+  ++KN     V
Sbjct  638  FLCSIGYSSKLISIFFTQTVSPKICEETYAALGARVTPGDLNLPSFSV--VFKNDQVETV  695

Query  332  KYKRSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL  511
            KY+R+V NVG+   AVY      P GV+++VSP KLVF+      +YEITF+       L
Sbjct  696  KYRRTVTNVGTNVDAVYSATGVQPAGVKITVSPKKLVFDANNLTQTYEITFSPTGGHGKL  755

Query  512  NSYGSIAWEDGVHIVKSPIA  571
              +G I W DG+H V+S IA
Sbjct  756  ARFGWIQWSDGIHSVRSTIA  775



>ref|XP_002452917.1| hypothetical protein SORBIDRAFT_04g034940 [Sorghum bicolor]
 gb|EES05893.1| hypothetical protein SORBIDRAFT_04g034940 [Sorghum bicolor]
Length=736

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 120/195 (62%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +D+AG+ + D +TG  S PF+ GAGHVDPNRA+DPGLVYD G   Y +
Sbjct  531  AIKSALMTTAYNVDSAGDIIKDMSTGKASTPFVRGAGHVDPNRAVDPGLVYDAGADAYFS  590

Query  182  LLCTIAYNMDELSVF-VKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKN  355
             LC I Y  ++++VF  KD   V+CS +     G  NYPAFS+     ++ V  +R V+N
Sbjct  591  FLCAIGYTAEQIAVFRTKDDPVVDCSTRTASV-GDHNYPAFSVVLNSTRDAVTQRRVVRN  649

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GSI  529
            VGS  RA Y     +P GV+V+V+P KL F+ T     YEITF           Y  GSI
Sbjct  650  VGSSARATYRASFTSPAGVRVTVNPRKLRFSVTQKTQEYEITFAARGVVSVTEKYTFGSI  709

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V SPIA+
Sbjct  710  VWSDGKHKVASPIAI  724



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 124/196 (63%), Gaps = 9/196 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQAT----GNQSNPFIHGAGHVDPNRALDPGLVYDLGVS  169
            AIKSALMTTAY +DN    L D  +    G  SNP+ HG+GHVDP++A+ PGLVYD+   
Sbjct  569  AIKSALMTTAYVVDNTHAPLRDAGSTTIPGTLSNPWAHGSGHVDPHKAMSPGLVYDVSTE  628

Query  170  DYVALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSV  349
            DYVA LC++ Y +D + + VK P+ V C+ +    PG LNYP+FS+ F  K  V+Y R +
Sbjct  629  DYVAFLCSLGYTIDHVQLIVKRPN-VTCARK-FSDPGELNYPSFSVVFGNKRVVRYTREL  686

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR--FLNSYG  523
             NVG E  ++YEV+V AP  V VSV PTKLVF    D L Y +TF   +  R    N +G
Sbjct  687  TNVG-EAGSIYEVEVTAPSTVGVSVKPTKLVFRNVGDKLRYTVTFVAKKGIRKAARNGFG  745

Query  524  SIAWEDGVHIVKSPIA  571
            SI W +  H V+SP+A
Sbjct  746  SIVWRNAEHQVRSPVA  761



>dbj|BAJ93872.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=780

 Score =   180 bits (457),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 101/198 (51%), Positives = 123/198 (62%), Gaps = 13/198 (7%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +D+AG  + D +TG  S PF+ GAGHVDPNRA DPGLVYD G  DY+A
Sbjct  579  AIKSALMTTAYNMDSAGAVIEDMSTGKASTPFVRGAGHVDPNRAADPGLVYDAGTEDYIA  638

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQ-NLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKN  355
             LC + Y+ ++++VF   P+T NCS +      G LNYPAFS  F   K  V  +R V+N
Sbjct  639  FLCALGYSAEQMAVF--SPAT-NCSTRAGTAAVGDLNYPAFSAVFGPEKRAVTQRRVVRN  695

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-----SY  520
            VG   RA Y  K+ +P GV V+V P KL F+ T     Y ITF    P  F N     ++
Sbjct  696  VGGNARATYRAKITSPAGVHVTVKPQKLQFSATQGTQQYAITFA---PRMFGNVTEKHTF  752

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H V SPIAV
Sbjct  753  GSIEWSDGEHSVTSPIAV  770



>gb|EMS59706.1| Subtilisin-like protease [Triticum urartu]
Length=510

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 115/195 (59%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +D+AG  + D +TG  S PF  GAGHVDPNRA DPGLVYD G  DY+ 
Sbjct  309  AIKSALMTTAYNVDSAGGVVEDMSTGKASTPFARGAGHVDPNRAADPGLVYDAGTEDYIT  368

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQ-NLGTPGSLNYPAFSLDFLY-KNQVKYKRSVKN  355
             LC + Y  ++++VF    +  NCS +      G LNYPAFS  F   K  +   R V+N
Sbjct  369  FLCALGYTTEQMAVF---SAGTNCSTRVGAAAAGDLNYPAFSALFGPDKRAITQHRVVRN  425

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSI  529
            VGS  RA Y  K+ +P GV V+V P KL F+ T     Y ITF           +++GSI
Sbjct  426  VGSNARATYRPKITSPAGVHVTVKPRKLQFSATQGTQEYAITFAQRTFGNVTEKHTFGSI  485

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V SPI +
Sbjct  486  EWSDGKHSVTSPITI  500



>gb|EAZ24824.1| hypothetical protein OsJ_08603 [Oryza sativa Japonica Group]
Length=720

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 120/191 (63%), Gaps = 5/191 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSA+MTTAY +DN GN ++    G  + PF  G+GHVDPN ALDPGLVY+    DY+A
Sbjct  528  AIKSAMMTTAYEVDNGGNAIMSSVNGRAAGPFELGSGHVDPNNALDPGLVYNATTDDYIA  587

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTP-GSLNYPAFSLDFLYK-NQVKYKRSVKN  355
             LC + Y  +++++F +D +T  CS +    P G LNYPAFS+ F     QV  +R+V N
Sbjct  588  FLCGLGYTPNQIAIFTRDSTTTYCSRR---PPIGDLNYPAFSMVFARSGGQVTQRRTVTN  644

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAW  535
            VG+   AVY+V + AP G +++V+P +L FN     L Y IT +        N++G I W
Sbjct  645  VGANTNAVYDVTITAPPGTRLTVAPMRLTFNAQRKTLDYAITLSAGSSNSPYNAWGDIVW  704

Query  536  EDGVHIVKSPI  568
             DG H+V+SP+
Sbjct  705  SDGQHMVRSPV  715



>gb|EMS46826.1| Subtilisin-like protease [Triticum urartu]
Length=458

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 116/198 (59%), Gaps = 15/198 (8%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            IKSALMTTAY +D+AG  + D +TG  S PF  GAGHVDPNRA+DPGLVYD G  DY+  
Sbjct  258  IKSALMTTAYNMDSAGGVIGDMSTGKASTPFARGAGHVDPNRAVDPGLVYDAGTEDYITF  317

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKNV  358
            LC + Y   +++VF    S+ NCS +   + G  NYPAFS+ F       V+ +R ++NV
Sbjct  318  LCALGYTDKQIAVF---GSSANCSTRAGSSVGDHNYPAFSVVFATNKMAVVRQRRVIRNV  374

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS------Y  520
            G + RA Y  KV AP GV V+VSP  L F  T     Y +TF      R   S      +
Sbjct  375  GGDARATYRAKVTAPDGVLVTVSPRTLRFTATQKTQEYVVTFAQ----RIFGSVTGNHTF  430

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W D  H V SPIA+
Sbjct  431  GSIEWSDRKHTVTSPIAI  448



>ref|NP_001048303.1| Os02g0780200 [Oryza sativa Japonica Group]
 dbj|BAD19528.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF10217.1| Os02g0780200 [Oryza sativa Japonica Group]
 dbj|BAG92086.1| unnamed protein product [Oryza sativa Japonica Group]
Length=790

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 120/191 (63%), Gaps = 5/191 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSA+MTTAY +DN GN ++    G  + PF  G+GHVDPN ALDPGLVY+    DY+A
Sbjct  598  AIKSAMMTTAYEVDNGGNAIMSSVNGRAAGPFELGSGHVDPNNALDPGLVYNATTDDYIA  657

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTP-GSLNYPAFSLDFLYK-NQVKYKRSVKN  355
             LC + Y  +++++F +D +T  CS +    P G LNYPAFS+ F     QV  +R+V N
Sbjct  658  FLCGLGYTPNQIAIFTRDSTTTYCSRR---PPIGDLNYPAFSMVFARSGGQVTQRRTVTN  714

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAW  535
            VG+   AVY+V + AP G +++V+P +L FN     L Y IT +        N++G I W
Sbjct  715  VGANTNAVYDVTITAPPGTRLTVAPMRLTFNAQRKTLDYAITLSAGSSNSPYNAWGDIVW  774

Query  536  EDGVHIVKSPI  568
             DG H+V+SP+
Sbjct  775  SDGQHMVRSPV  785



>gb|EAY87753.1| hypothetical protein OsI_09169 [Oryza sativa Indica Group]
Length=773

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 120/191 (63%), Gaps = 5/191 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSA+MTTAY +DN GN ++    G  + PF  G+GHVDPN ALDPGLVY+    DY+A
Sbjct  581  AIKSAMMTTAYEVDNGGNAIMSSVNGRAAGPFELGSGHVDPNNALDPGLVYNATADDYIA  640

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTP-GSLNYPAFSLDFLYK-NQVKYKRSVKN  355
             LC + Y  +++++F +D +T  CS +    P G LNYPAFS+ F     QV  +R+V N
Sbjct  641  FLCGLGYTPNQIAIFTRDGTTTYCSRR---PPIGDLNYPAFSMVFARSGGQVTQRRTVTN  697

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAW  535
            VG+   AVY+V + AP G +++V+P +L FN     L Y IT +        N++G I W
Sbjct  698  VGANTNAVYDVTITAPPGTRLTVAPMRLTFNAQRKTLDYAITLSAGSSNSPYNAWGDIVW  757

Query  536  EDGVHIVKSPI  568
             DG H+V+SP+
Sbjct  758  SDGQHMVRSPV  768



>dbj|BAJ97136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=779

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 116/195 (59%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN G  + D ++G+ S PF  GAGH+DPN A+DPGLVYD G  DY+ 
Sbjct  578  AIKSALMTTAYNVDNTGGVIGDMSSGDASTPFARGAGHIDPNSAVDPGLVYDAGTEDYIT  637

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC + Y   +++VF    S+++CS +     G  NYPAFS+ F       V  +R V+N
Sbjct  638  FLCALGYTARQVAVFG---SSISCSTRAGSAVGDHNYPAFSVVFTSNKLAVVTQRRVVRN  694

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GSI  529
            VGS+  A Y  KV AP GV+V VSP  L F+ T     Y +TF    P      Y  GSI
Sbjct  695  VGSDAEATYTAKVTAPDGVRVRVSPETLRFSTTQKTQEYVLTFAQGSPGSATAKYTFGSI  754

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V SPIAV
Sbjct  755  EWSDGEHSVTSPIAV  769



>gb|KGN66306.1| hypothetical protein Csa_1G597040 [Cucumis sativus]
Length=566

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 125/194 (64%), Gaps = 9/194 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN  ++L D A G  SNP+ HGAGHVDP++AL PGL+YD+  +DYVA
Sbjct  372  AIKSALMTTAYTQDNTNSSLRDAAGGGFSNPWAHGAGHVDPHKALSPGLLYDISTNDYVA  431

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK  S + CS +    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  432  FLCSLDYGIDHVQAIVKR-SNITCSRK-FADPGQLNYPSFSVVFGSKRVVRYTRIVTNVG  489

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT----NAQPARFLNSYGSI  529
            +   +VY+V   AP  V+V+V P+KLVF +  +   Y +TF      AQ  RF   +GSI
Sbjct  490  AAG-SVYDVATTAPPVVKVTVKPSKLVFTKVGERKRYTVTFVASRDAAQTTRF--GFGSI  546

Query  530  AWEDGVHIVKSPIA  571
             W +  H V+SP++
Sbjct  547  VWSNDQHQVRSPVS  560



>ref|XP_003570496.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=785

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 125/200 (63%), Gaps = 12/200 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY  DN+G  + D ATG +S PF+ GAGHVDPN ALDPGLVYD    DYV 
Sbjct  577  AVKSALMTTAYNEDNSGETIKDLATGVESTPFVRGAGHVDPNNALDPGLVYDADADDYVG  636

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC + Y+   +SVF +D S  +CS++   + G LNYP F+  F   N  V Y R V+NV
Sbjct  637  FLCALGYSPSLISVFTRDGSVADCSKKPARS-GDLNYPTFAAVFGSDNDTVTYHRVVRNV  695

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF---TNAQP----ARFLNS  517
            GS   AVYE +  +P GV V+V+P+KL F+E    L Y+IT    T   P    A++  S
Sbjct  696  GSNANAVYEARFVSPAGVDVTVTPSKLAFDEEHQSLGYKITLAVSTKKNPVIVNAKY--S  753

Query  518  YGSIAWEDGV-HIVKSPIAV  574
            +GS+ W DG  H V S IAV
Sbjct  754  FGSLTWSDGAGHNVTSAIAV  773



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 124/197 (63%), Gaps = 12/197 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQAT---GNQSNPFIHGAGHVDPNRALDPGLVYDLGVSD  172
            AIKSALMTTAY +DN  + L D  +   G  SNP+ HG+GHVDP++AL PGLVYD+   +
Sbjct  567  AIKSALMTTAYVVDNTNSPLRDAGSDVAGAFSNPWAHGSGHVDPHKALTPGLVYDISTQE  626

Query  173  YVALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVK  352
            Y A LC++ Y +D +   VK P+ V CS++    PG LNYP+FS+ F  K  V+Y R + 
Sbjct  627  YEAFLCSLGYTIDHVQAIVKRPN-VTCSKK-FRDPGELNYPSFSVVFASKRVVRYTRELT  684

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNA----QPARFLNSY  520
            NVG E  ++YEV VN P  V V+V PTKLVF    D L Y +TF       Q AR  + +
Sbjct  685  NVG-EAGSIYEVAVNGPSTVGVTVKPTKLVFKNVGDKLRYTVTFVAKKGANQDAR--SEF  741

Query  521  GSIAWEDGVHIVKSPIA  571
            GSI W +  H V+SPIA
Sbjct  742  GSIVWRNAQHQVRSPIA  758



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 125/194 (64%), Gaps = 9/194 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN  ++L D A G  SNP+ HGAGHVDP++AL PGL+YD+  +DYVA
Sbjct  569  AIKSALMTTAYTQDNTNSSLRDAAGGGFSNPWAHGAGHVDPHKALSPGLLYDISTNDYVA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK  S + CS +    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  629  FLCSLDYGIDHVQAIVKR-SNITCSRK-FADPGQLNYPSFSVVFGSKRVVRYTRIVTNVG  686

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT----NAQPARFLNSYGSI  529
            +   +VY+V   AP  V+V+V P+KLVF +  +   Y +TF      AQ  RF   +GSI
Sbjct  687  AAG-SVYDVATTAPPVVKVTVKPSKLVFTKVGERKRYTVTFVASRDAAQTTRF--GFGSI  743

Query  530  AWEDGVHIVKSPIA  571
             W +  H V+SP++
Sbjct  744  VWSNDQHQVRSPVS  757



>dbj|BAD94244.1| serine protease like protein [Arabidopsis thaliana]
Length=334

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 119/192 (62%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN    L D A  + SNP+ HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  140  AIKSALMTTAYVLDNTNAPLHDAADNSLSNPYAHGSGHVDPQKALSPGLVYDISTEEYIR  199

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  200  FLCSLDYTVDHIVAIVKRPS-VNCSKK-FSDPGQLNYPSFSVLFGGKRVVRYTRKVTNVG  257

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V +SV P+KL F    +   Y +TF + +     N   +GSI W
Sbjct  258  AAS-SVYKVTVNGAPSVGISVKPSKLSFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITW  316

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  317  SNPQHEVRSPVA  328



>emb|CDP15538.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 133/209 (64%), Gaps = 20/209 (10%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLG------  163
            AIKSA+MTTA  +DN G N++D+AT   S PF HG+GHVDPN+AL+PGLVYD+G      
Sbjct  549  AIKSAIMTTANNVDNNGRNIVDRATDVASTPFAHGSGHVDPNKALNPGLVYDMGTRAAIK  608

Query  164  ------VSDYVALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYK  322
                  + DYV  LC+I Y    ++VFV +P   +C      TPG LNYP+FS+ F   +
Sbjct  609  RYQLKLLGDYVQFLCSIGYTPARIAVFVSNPPE-SCRPGI--TPGDLNYPSFSVVFSRQR  665

Query  323  NQVKYKRSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPA  502
              V + R V+NV S   AVY V+ NAP  V+V V+P KL F++ +D L+Y++TFT+A   
Sbjct  666  TVVTHTRRVRNVESTAAAVYTVRWNAPKFVEVKVTPYKLAFDQYSDTLTYQVTFTSAAIE  725

Query  503  RF---LNSYGSIAWEDG-VHIVKSPIAVL  577
                  +++G + W DG  HIV+SPIAVL
Sbjct  726  TIGDTTSAFGYLEWIDGQQHIVRSPIAVL  754



>gb|EMT01939.1| Subtilisin-like protease [Aegilops tauschii]
Length=698

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 117/199 (59%), Gaps = 15/199 (8%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +D+AG  + D +TG  S PF  GAGH  P RA DPGLVYD G  DY+ 
Sbjct  497  AIKSALMTTAYNVDSAGAVVEDMSTGKASTPFARGAGHRAPTRAADPGLVYDAGTEDYIT  556

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGT--PGSLNYPAFSLDFLY-KNQVKYKRSVK  352
             LC + Y  ++++VF       NCS + LGT   G LNYPAFS  F   K  +  +R VK
Sbjct  557  FLCALGYTTEQMAVFS---GATNCSTR-LGTAAAGDLNYPAFSALFGPDKRAITQRRVVK  612

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-----S  517
            NVGS  RA Y  K+ +P GV V+V P +L F+ T     Y ITF       F N     +
Sbjct  613  NVGSNARATYRPKITSPAGVHVTVKPRRLQFSATQGTQEYAITFAQRT---FGNVTEKHT  669

Query  518  YGSIAWEDGVHIVKSPIAV  574
            +GSI W DG H V SPIA+
Sbjct  670  FGSIEWSDGKHSVTSPIAI  688



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 121/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN  + L D A G  SNP+ HG+GHVDP +AL PGLVYD+   +YVA
Sbjct  574  AIKSALMTTAYVSDNTNSPLQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISADEYVA  633

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ + CS +    PG+LNYP+FS+ F     V+Y R + NVG
Sbjct  634  FLCSLDYTIEHVQAIVKRPN-ITCSRK-FNNPGNLNYPSFSVVFTNNRVVRYTRELTNVG  691

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSIAW  535
            +   ++YEV V  P  VQV+V P+KLVF    D L Y +TF   + A     + +G+I W
Sbjct  692  AAG-SIYEVAVTGPQAVQVTVKPSKLVFKNVGDKLRYTVTFVARKGASLTGRSEFGAIVW  750

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  751  RNAQHQVRSPVA  762



>ref|XP_006407132.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
 gb|ESQ48585.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
Length=1359

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 122/190 (64%), Gaps = 13/190 (7%)
 Frame = +2

Query  2     AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
             AIKSAL+TTAY  +N+G  + D ATG  SN FIHGAGHVDPN+AL+PGLVYD+ V DYVA
Sbjct  1173  AIKSALVTTAYVTENSGEPIEDLATGKTSNSFIHGAGHVDPNKALNPGLVYDIDVKDYVA  1232

Query  182   LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFLYKNQV-KYKRSVKN  355
              LC + Y    + VF++DP+  N C    L T G LNYP+FS+ F     V KY+R VKN
Sbjct  1233  FLCAVGYEFPGILVFLQDPALYNACETSKLRTAGDLNYPSFSVVFGSTVDVLKYRRVVKN  1292

Query  356   VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN--------AQPARFL  511
             VGS   AVYE+ V +P  V++ VSP+KL F++    L +E+TF +        + P    
Sbjct  1293  VGSNVDAVYEIGVKSPANVEIEVSPSKLAFSKEKSELEFEVTFKSVVLGGGDGSMPG---  1349

Query  512   NSYGSIAWED  541
             + +GSI W D
Sbjct  1350  HEFGSIEWTD  1359



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 125/194 (64%), Gaps = 9/194 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN  ++L D A G  SNP+ HGAGHVDP++AL PGL+YD+  +DY+A
Sbjct  571  AIKSALMTTAYTQDNTNSSLRDAAGGGFSNPWAHGAGHVDPHKALSPGLLYDISTNDYIA  630

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK  S + CS +    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  631  FLCSLDYGIDHVQAIVKR-SNITCSRK-FADPGQLNYPSFSVVFGSKRVVRYTRIVTNVG  688

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT----NAQPARFLNSYGSI  529
            +   +VY+V   AP  V+V+V P+KLVF +  +   Y +TF      AQ  RF   +GSI
Sbjct  689  AAG-SVYDVATTAPSVVKVTVKPSKLVFTKVGERKRYTVTFVASRDAAQTTRF--GFGSI  745

Query  530  AWEDGVHIVKSPIA  571
             W +  H V+SP++
Sbjct  746  VWSNDQHQVRSPVS  759



>ref|XP_010088796.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB36979.1| Subtilisin-like protease [Morus notabilis]
Length=789

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 126/198 (64%), Gaps = 9/198 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN G  L D A G +S PF HG+GHVDP+RALDPGL+YD+ V+DYV 
Sbjct  579  AIKSALMTTAYDLDNDGQRLRDLA-GKRSTPFAHGSGHVDPSRALDPGLIYDMNVTDYVG  637

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQN---LG---TPGSLNYPAFSLDFLYK-NQVKYK  340
             LC+I Y+   +S F  +  + N  E+    LG   TPG LN P+FS  F      VKY+
Sbjct  638  FLCSIGYDSTLISKFFTETISSNICEETYAALGGRVTPGDLNVPSFSAVFENGVETVKYR  697

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR-FLNS  517
            R+V NVG+   AVY     AP G ++++SP +LVF+      +YEITF++    R  L +
Sbjct  698  RTVTNVGTNVDAVYSATAVAPEGTKITISPNRLVFDANNPTQTYEITFSSTGGNRDKLAT  757

Query  518  YGSIAWEDGVHIVKSPIA  571
            +G I W DG+H V+S IA
Sbjct  758  FGWIQWSDGIHSVRSTIA  775



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 128/193 (66%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN G+ L+D A G+ + P+ +G+GHVDP +AL PGL+YD+G  DY+A
Sbjct  575  AIKSALMTTAYTDDNTGSPLVDGAGGSPATPWAYGSGHVDPQKALSPGLIYDIGTGDYLA  634

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y+ D +    K  ST     + L  PG+LNYP+FS+ F  +++  VKY R + N
Sbjct  635  FLCSLEYSTDHIQAISK--STNKTCSRRLPNPGNLNYPSFSVVFGRRSRRFVKYNRVLTN  692

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SYGSIA  532
            VG    +VY VKV  P GV+V+V PTKL+FN+    L Y++TFT+ +    ++ ++G I 
Sbjct  693  VGVPG-SVYNVKVGGPPGVKVTVKPTKLIFNQVGQKLRYKVTFTSTKAGDPVDMAFGWIT  751

Query  533  WEDGVHIVKSPIA  571
            W    H V+SP++
Sbjct  752  WSSEQHQVRSPVS  764



>ref|XP_009380035.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380036.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380037.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 120/192 (63%), Gaps = 4/192 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTT+Y +DN  + L D A G+ + PF +GAGHVDP RAL PGLVYD+   DY+A
Sbjct  573  AIKSALMTTSYVLDNTNSPLRDAAGGSYATPFAYGAGHVDPQRALSPGLVYDITADDYIA  632

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC++ Y +  +    K P+   CS +    PG+LNYP+FS+ F  K + VKY+R + NV
Sbjct  633  FLCSLNYTIPHIQAITKRPNVTTCSRR-FSDPGNLNYPSFSVVFGKKWRVVKYRRELTNV  691

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SYGSIAW  535
            GS   + YE KV+ P GV V+V P KL+F      L Y +TF + +  R    ++G I W
Sbjct  692  GSAS-STYEAKVSGPGGVAVTVKPAKLMFKHVNQKLKYSVTFASKERGRSAGTAFGWITW  750

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  751  SNKQHKVRSPVA  762



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 121/192 (63%), Gaps = 6/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN  + L D A G  SNP+ HG+GHVDP +AL PGLVYD+   DYVA
Sbjct  574  AIKSALMTTAYFSDNTNSPLQDAAGGALSNPWAHGSGHVDPQKALSPGLVYDISTDDYVA  633

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ + CS +    PG+LNYP+FS+ F     V+Y R + NVG
Sbjct  634  FLCSLDYTIEHVQAIVKRPN-ITCSRKF--NPGNLNYPSFSVVFTNNRVVRYTRELTNVG  690

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSIAW  535
            +   ++YEV V  P  VQV+V P+KLVF    D L Y +TF   + A     + +G+I W
Sbjct  691  AAG-SIYEVAVTGPQAVQVTVKPSKLVFKNIGDKLRYTVTFVARKGASLTGRSEFGAIMW  749

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  750  RNAQHQVRSPVA  761



>gb|EMT11726.1| Subtilisin-like protease [Aegilops tauschii]
Length=781

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 114/196 (58%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTA  +DNAG  + D +TG  S PF  GAGH+DPN A+DPGLVYD G  DY+ 
Sbjct  579  AIKSALMTTAQNVDNAGGVIGDMSTGEASTPFARGAGHIDPNSAVDPGLVYDAGTEDYIT  638

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFL---YKNQVKYKRSVK  352
             LC + Y   +++VF    S+ +CS     + G  NYPAFS+ F     K  V  +R V+
Sbjct  639  FLCALGYTAKQVAVF---GSSTSCSTHAGSSVGDHNYPAFSVVFTSNKKKAVVTQRRVVR  695

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GS  526
            NVGS+    Y VK+ AP GV V+VSP  L F+ T     Y +TF           Y  GS
Sbjct  696  NVGSDATTTYRVKITAPDGVLVTVSPETLRFSATQKTQGYVVTFAREIGGSVTEKYTFGS  755

Query  527  IAWEDGVHIVKSPIAV  574
            I W DG H V SPIAV
Sbjct  756  IEWSDGEHTVTSPIAV  771



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 124/193 (64%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN+ + L D A G+ S P  HGAGHV+P +AL PGLVYD    DY+ 
Sbjct  582  AIKSALMTTAYNHDNSKSPLRDAADGSFSTPLAHGAGHVNPQKALSPGLVYDASTKDYIT  641

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ YN +++ + VK PS VNC+++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  642  FLCSLNYNSEQIQLIVKRPS-VNCTKK-FANPGQLNYPSFSVVFSSKRVVRYTRIVTNVG  699

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN---AQPARFLNSYGSIA  532
             E  +VY V V+ P  V ++V P++LVF +  +   Y +TF +   A  ++  + +GSI 
Sbjct  700  -EAGSVYNVVVDVPSSVGITVKPSRLVFEKVGERKRYTVTFVSKKGADASKVRSGFGSIL  758

Query  533  WEDGVHIVKSPIA  571
            W +  H V+SPIA
Sbjct  759  WSNAQHQVRSPIA  771



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 119/192 (62%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A  + SNP+ HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  560  AIKSALMTTAYILDNTNSPLRDAADNSLSNPWAHGSGHVDPQKALSPGLVYDISTEEYIR  619

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  620  FLCSLDYTVDHIVAIVKRPS-VNCSKK-FADPGQLNYPSFSVVFGGKRVVRYTREVTNVG  677

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V +SV P KL F    +   Y +TF + +     N   +GSI W
Sbjct  678  AAS-SVYKVTVNGAASVGISVKPAKLAFRRVGEKKRYTVTFVSKKGVSLTNKAEFGSITW  736

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  737  SNPQHEVRSPVA  748



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 122/192 (64%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN  ++L D A G+ SNP+ HGAGHVDP +AL PGLVYD+   +Y++
Sbjct  565  AIKSALMTTAYTEDNTNSSLRDAADGSLSNPWAHGAGHVDPQKALSPGLVYDISTEEYIS  624

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK P+ V CS +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  625  FLCSLGYTIDHVKTIVKRPN-VTCSTK-FKDPGELNYPSFSVLFGDKRVVRYTRELTNVG  682

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSIAW  535
               R++Y+V VN P  V +SV PT L+F    +   Y +TF   +    +  + +GSI W
Sbjct  683  -PSRSIYKVTVNGPSTVGISVRPTTLIFRSAGEKKRYTVTFVAKRGTSPMARSEFGSIVW  741

Query  536  EDGVHIVKSPIA  571
             +  + VKSP++
Sbjct  742  SNAQNQVKSPVS  753



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 119/192 (62%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN    L D A  + SNP  HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  558  AIKSALMTTAYVLDNTNAPLHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIR  617

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  618  FLCSLDYTVDHIVAIVKRPS-VNCSKK-FSDPGQLNYPSFSVLFGGKRVVRYTREVTNVG  675

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +E  +VY+V VN    V +SV P+KL F    +   Y +TF + +     N   +GSI W
Sbjct  676  AEN-SVYKVTVNGAPSVAISVKPSKLAFRSVGEKKRYTVTFVSKKGVSMTNKAEFGSITW  734

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  735  SNPQHEVRSPVA  746



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 120/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN    L D A G+ SNP+ HG+GHV+P +AL PGLVYD+   DYVA
Sbjct  567  AIKSALMTTAYTQDNTKAPLRDAADGSLSNPWAHGSGHVEPQKALSPGLVYDISTDDYVA  626

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ V CS +    PG LNYP+FS+ F  K  V+Y R   NVG
Sbjct  627  FLCSLDYTLEHVQAIVKKPN-VTCSRK-YSDPGQLNYPSFSVVFGKKRVVRYSREFTNVG  684

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPA--RFLNSYGSIAW  535
            +   ++Y V V  P  V+++V PT+LVF    +   Y +TF   + A     + +GSI W
Sbjct  685  AAG-SIYRVAVTGPQMVRIAVKPTRLVFKNVGEKQKYTVTFVANKGADKTARSEFGSIVW  743

Query  536  EDGVHIVKSPIA  571
            ++  H VKSPIA
Sbjct  744  QNPQHQVKSPIA  755



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 118/192 (61%), Gaps = 4/192 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAY  DN G+ + D A G +S PF+ G+GHVDPNRALDPGLVYD+   DYVA
Sbjct  565  AVKSALMTTAYDSDNNGSTIKDLADGKESTPFVRGSGHVDPNRALDPGLVYDIKPEDYVA  624

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNV  358
             LC + Y+   ++VF    S V+C        G LNYP+FS+ F   K   K+ R+V NV
Sbjct  625  YLCALGYDSVRIAVFTGGKS-VDCRVVGFAKSGDLNYPSFSMVFGPGKTVAKFSRTVTNV  683

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS-YGSIAW  535
            G + R+ Y   +N P  V++ V P KLVF      LSY +TF   +    L++ +G + W
Sbjct  684  G-DARSAYAASINGPDSVRIRVDPEKLVFCAQNQSLSYSVTFEYVEGYSPLDTCFGLLTW  742

Query  536  EDGVHIVKSPIA  571
             DG H VKSPIA
Sbjct  743  SDGRHDVKSPIA  754



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 118/192 (61%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A    SNP  HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  560  AIKSALMTTAYVLDNTNSPLHDAADNRLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIR  619

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  620  FLCSLEYTVDHIVAIVKRPS-VNCSKK-FSDPGQLNYPSFSVLFGGKRVVRYTREVTNVG  677

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V +SV PTKL F    +   Y +TF + +     N   +GSI W
Sbjct  678  AAS-SVYKVMVNGAPSVGISVKPTKLAFKRVGEKKRYTVTFVSKKGVSMTNKAEFGSITW  736

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  737  INPQHEVRSPVA  748



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 121/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN  + L D A G+ SNP+ HG+GHV+P +AL PGLVYD+   DYVA
Sbjct  567  AIKSALMTTAYTQDNTKSPLRDAADGSFSNPWAHGSGHVEPQKALSPGLVYDISTDDYVA  626

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ V CS +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  627  FLCSLDYTLEHVQAIVKKPN-VTCSRK-YSDPGQLNYPSFSVVFGNKRVVRYSRELTNVG  684

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPA--RFLNSYGSIAW  535
            +   ++Y V V  P  V+++V PT+LVF    +   Y +TF   + A     + +GSI W
Sbjct  685  AAG-SIYRVAVTGPQMVRIAVKPTRLVFKNVGEKQKYTVTFVANKGADKTARSEFGSIVW  743

Query  536  EDGVHIVKSPIA  571
             +  H VKSPIA
Sbjct  744  ANPQHQVKSPIA  755



>gb|ACL52505.1| unknown [Zea mays]
Length=421

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 121/197 (61%), Gaps = 9/197 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G+ +N F +GAGHVDP RAL PGLVYD+   DY A
Sbjct  222  AIKSALMTTAYTVDNTNSSLRDAADGSVANAFAYGAGHVDPQRALSPGLVYDISTHDYAA  281

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVK------YKR  343
             LC++ Y+   + V  K  S V+C   N   PG LNYP+FS+ F  K + K      ++R
Sbjct  282  FLCSLNYSAPHVQVITKA-SNVSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRR  340

Query  344  SVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF-TNAQPARFLNSY  520
             + NVG    +VY+VKV  P  V V+V+P +L F +    L Y +TF + A+       +
Sbjct  341  ELTNVGPAA-SVYDVKVVGPESVAVTVTPARLTFRQAGQKLRYYVTFASRARQGHAKPDF  399

Query  521  GSIAWEDGVHIVKSPIA  571
            G I+W +  H+V+SP+A
Sbjct  400  GWISWVNDEHVVRSPVA  416



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 121/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  + L D A  + SNP +HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  568  AIKSALMTTAYTLDNTNSPLRDAADNSLSNPHVHGSGHVDPLKALTPGLVYDISTEEYIK  627

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNC ++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  628  FLCSLDYTVDHIVAIVKRPS-VNCLKK-FSNPGQLNYPSFSVLFGGKRVVRYTREVTNVG  685

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   AVY+V V+    V +SV P+KL F +  +   Y +TF + +     N   YGSI W
Sbjct  686  AAN-AVYKVVVSGAPSVGISVKPSKLAFRKVGEKKRYTVTFVSKKGVSLTNKAEYGSITW  744

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  745  TNTQHEVRSPVA  756



>gb|ADE77855.1| unknown [Picea sitchensis]
Length=394

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 120/200 (60%), Gaps = 13/200 (7%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A++SALMTTAYT DN G+ +ID+A+GN S PF  GAGHV P RA+DPGL+YD+G  DYV 
Sbjct  193  AVRSALMTTAYTQDNRGHRMIDEASGNASTPFDFGAGHVHPERAMDPGLIYDMGTEDYVR  252

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVK----YKRSV  349
             LC++ Y    + V  + P+   C  + + +PG++NYP+FS  F      K    + R+V
Sbjct  253  FLCSLNYTSKAIQVITRKPT--RCPARRI-SPGNINYPSFSAVFDLTQPKKLSTVFFRTV  309

Query  350  KNVGSEKRAVYEVKVNAPL-GVQVSVSPTKLVFNETTDMLSYEITFTNAQ----PARFLN  514
             NVG    +VY V+V  P  GV V+V P KLVF E    LSY +T T       P     
Sbjct  310  TNVGPP-LSVYRVRVIHPRGGVTVTVKPRKLVFTEKNQKLSYTVTVTTKHIDLLPGNADT  368

Query  515  SYGSIAWEDGVHIVKSPIAV  574
             +  I+W DG H+V+SPI +
Sbjct  369  RFCFISWTDGKHVVQSPITI  388



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 119/192 (62%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN    L D A  + SNP+ HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  560  AIKSALMTTAYVLDNTNAPLHDAADNSLSNPYAHGSGHVDPQKALSPGLVYDISTEEYIR  619

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  620  FLCSLDYTVDHIVAIVKRPS-VNCSKK-FSDPGQLNYPSFSVLFGGKRVVRYTREVTNVG  677

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V +SV P+KL F    +   Y +TF + +     N   +GSI W
Sbjct  678  AAS-SVYKVTVNGAPSVGISVKPSKLSFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITW  736

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  737  SNPQHEVRSPVA  748



>ref|XP_006661279.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=635

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 125/196 (64%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQS-NPFIHGAGHVDPNRALDPGLVYDLGVSDYV  178
            AIKSALMTTAYT+DN G+ ++D A GN +  P+  GAGHVDP +AL PGLVYD  V DYV
Sbjct  437  AIKSALMTTAYTVDNTGSPILDAAGGNSTATPWSIGAGHVDPVKALSPGLVYDASVDDYV  496

Query  179  ALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLY---KNQVKYKRSV  349
            A LC++  +  ++      P+ V C ++ L +PG LNYP+FS+ F     ++ VKY+R +
Sbjct  497  AFLCSVGTSPQQVQAITAAPN-VTC-QRKLSSPGDLNYPSFSVVFGRRSSRSSVKYRREL  554

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS-YGS  526
             NVG +  +VY V+V  P  + V+V P +L F    D L Y +TF +A P   ++S +G 
Sbjct  555  TNVGGDGGSVYTVRVTGPSDIAVAVKPARLAFKAAGDKLRYTVTFKSATPRGPMDSAFGW  614

Query  527  IAWED-GVHIVKSPIA  571
            + W D G H V+SPI+
Sbjct  615  LTWSDGGEHDVRSPIS  630



>ref|NP_001064523.2| Os10g0394200 [Oryza sativa Japonica Group]
 dbj|BAF26437.2| Os10g0394200, partial [Oryza sativa Japonica Group]
Length=230

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 120/198 (61%), Gaps = 17/198 (9%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G  + PF  GAGHVDP +AL PGL+YD+   DYV+
Sbjct  37   AIKSALMTTAYTVDNTNSSLRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVS  96

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y    + V  K  S + C  +    PG LNYP+FS+ F  K++  ++++R V N
Sbjct  97   FLCSLNYTTPHIQVITKM-SNITCPRKF--RPGDLNYPSFSVVFKKKSKHVMRFRREVTN  153

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF------TNAQPARFLNS  517
            VG    +VY VKV+ P  V V V+P KLVFN+      Y + F      +NA+P      
Sbjct  154  VG-PAMSVYNVKVSGPASVSVKVTPAKLVFNKVGQKQRYYVIFASTVDASNAKP-----D  207

Query  518  YGSIAWEDGVHIVKSPIA  571
            +G I+W    H+V+SPIA
Sbjct  208  FGWISWMSSQHVVRSPIA  225



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 122/194 (63%), Gaps = 9/194 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTT+YT DN  ++L D A G  S P+ HG+GHVDP +AL PGLVYD+   DYVA
Sbjct  573  AIKSALMTTSYTHDNTNSSLRDAAGGTYSTPWAHGSGHVDPEKALSPGLVYDISTDDYVA  632

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D++    K P+ V CS +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  633  FLCSLDYTIDQVRAVAKRPN-VTCSRK-FADPGQLNYPSFSVLFGSKRIVRYTRQLTNVG  690

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNA----QPARFLNSYGSI  529
            +   +VY V V  P  V+V+V P KLVF +  D  SY +TF +     Q  R  + +GSI
Sbjct  691  AAG-SVYAVTVMGPPAVEVTVKPPKLVFAKVGDRRSYTVTFVSKKGMNQTVR--SDFGSI  747

Query  530  AWEDGVHIVKSPIA  571
             W +  + V+SP+A
Sbjct  748  VWSNAQNEVRSPVA  761



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 120/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN G+ L D A G  S P+ HG+GHVDP +AL PGLVYDL   DY+A
Sbjct  581  AIKSALMTTAYNLDNTGSPLRDAAGGTFSTPWAHGSGHVDPQKALSPGLVYDLKAEDYIA  640

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK P+ V CS +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  641  FLCSLDYTIDHVKAIVKRPN-VTCSRK-FSDPGELNYPSFSVVFNDKKVVRYTRELTNVG  698

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR--FLNSYGSIAW  535
            +   ++Y V V  P  V V+V P KL+F +  D + Y +TF + +       + +GSI W
Sbjct  699  AAG-SMYNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVW  757

Query  536  EDGVHIVKSPIA  571
             +  + V+SP+A
Sbjct  758  SNAQNKVRSPVA  769



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 120/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN G+ L D A G  S P+ HG+GHVDP +AL PGLVYDL   DY+A
Sbjct  581  AIKSALMTTAYNLDNTGSPLRDAAGGTFSTPWAHGSGHVDPQKALSPGLVYDLKAEDYIA  640

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK P+ V CS +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  641  FLCSLDYTIDHVKAIVKRPN-VTCSRK-FSDPGELNYPSFSVVFNDKKVVRYTRELTNVG  698

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR--FLNSYGSIAW  535
            +   ++Y V V  P  V V+V P KL+F +  D + Y +TF + +       + +GSI W
Sbjct  699  AAG-SMYNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVW  757

Query  536  EDGVHIVKSPIA  571
             +  + V+SP+A
Sbjct  758  SNAQNKVRSPVA  769



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 118/192 (61%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A  + SNP  HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  543  AIKSALMTTAYNLDNTNSPLRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIR  602

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS +    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  603  FLCSLDYTVDHIVAIVKRPS-VNCSNK-FSNPGQLNYPSFSVLFGGKRVVRYTREVTNVG  660

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V +SV P+KL F    +   Y +TF + +     N   +GSI W
Sbjct  661  AAN-SVYKVVVNGAPSVGISVKPSKLAFRSVGEKKRYTVTFVSKKGVSLTNKAEFGSITW  719

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  720  SNPQHQVRSPVA  731



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score =   167 bits (424),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 119/192 (62%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A  + SNP  HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  557  AIKSALMTTAYNLDNTNSPLRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIR  616

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  617  FLCSLDYTVDHIVAIVKRPS-VNCSKK-FSNPGQLNYPSFSVLFGGKRVVRYTREVTNVG  674

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V +SV P+KL F    +   Y +TF + +     N   +GSI W
Sbjct  675  APN-SVYKVVVNGAPSVGISVKPSKLSFRSVGEKKRYTVTFVSKKGVSLTNKAEFGSITW  733

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  734  SNPQHQVRSPVA  745



>gb|EYU25845.1| hypothetical protein MIMGU_mgv1a013289mg [Erythranthe guttata]
Length=225

 Score =   159 bits (402),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 119/196 (61%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DNA + L D A  + S P+ HGAGHVDP++AL PGLVYD    DYV+
Sbjct  24   AIKSALMTTAYTVDNANSPLRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPDDYVS  83

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF--LYKNQ--VKYKRSV  349
             LC++ Y  D + +  + P+    S +    PG LNYP+FS+ F    KN   V+Y R +
Sbjct  84   FLCSLDYTDDAVQLIARRPNATCSSSRRFRDPGQLNYPSFSVVFGGGKKNSRVVRYTREL  143

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARF--LNSYG  523
             NVG    A Y  ++ AP  V  +V P+KLVF    D L Y +TF + +   +   + +G
Sbjct  144  TNVGPAGSA-YVAEIEAPPTVVATVKPSKLVFGNVGDKLRYTVTFVSKKDVDYSLTSGFG  202

Query  524  SIAWEDGVHIVKSPIA  571
            SI W++  H V+SP++
Sbjct  203  SITWKNAQHQVRSPVS  218



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score =   167 bits (424),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 119/192 (62%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A  + SNP  HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  569  AIKSALMTTAYNLDNTNSPLRDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIR  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  629  FLCSLDYTVDHIVAIVKRPS-VNCSKK-FSNPGQLNYPSFSVLFGGKRVVRYTREVTNVG  686

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V +SV P+KL F    +   Y +TF + +     N   +GSI W
Sbjct  687  APN-SVYKVVVNGAPSVGISVKPSKLSFRSVGEKKRYTVTFVSKKGVSLTNKAEFGSITW  745

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  746  SNPQHQVRSPVA  757



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 121/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN  + L D A G  S P+ HGAGHV+P+RAL PGLVYD  ++DY+ 
Sbjct  567  AIKSALMTTAYVHDNTKSPLRDAAGGAFSTPWAHGAGHVNPHRALSPGLVYDASITDYIK  626

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y  + + + VK    VNC+ +    PG LNYP+FS+ F  K  V+Y R++ NVG
Sbjct  627  FLCSLDYTPEHIQLIVKR-HAVNCTRK-FSDPGQLNYPSFSIHFGGKRVVRYTRTLTNVG  684

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GSIAW  535
             E  +VY+V V+AP  V+V+V P +LVF +  +   Y +TF + +       Y  GSI W
Sbjct  685  -EAGSVYDVTVDAPSTVEVTVRPARLVFGKLGERKRYTVTFVSKKSGGDSGRYGFGSIMW  743

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  744  SNAQHQVRSPVA  755



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 118/191 (62%), Gaps = 5/191 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN    L D A  + SNP+ HG+GHVDP +A+ PGLVYD+   +Y+ 
Sbjct  578  AIKSALMTTAYNVDNTNLPLRDAADNSLSNPWTHGSGHVDPQKAMSPGLVYDISTEEYIR  637

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS +    PG LNYP+FS+ F  K   +Y R + NVG
Sbjct  638  FLCSLDYTVDHIQAIVKRPS-VNCSRK-FSDPGQLNYPSFSVLFGDKRVARYTRELTNVG  695

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS--YGSIAW  535
            +   ++Y+V V+ P  V V+V PT+LVF    +   Y +TF+  +      S  +GSI W
Sbjct  696  TPG-SIYKVAVDGPASVAVTVKPTRLVFGAVGEKKRYTVTFSAKRGMSLATSSEFGSITW  754

Query  536  EDGVHIVKSPI  568
             +  H V+SP+
Sbjct  755  SNSEHSVRSPV  765



>gb|EMS60034.1| Subtilisin-like protease [Triticum urartu]
Length=478

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 122/194 (63%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTT YT+DN  ++L D A  + + PF  GAGHVDP +AL PGLVYD+  SDYVA
Sbjct  284  AIKSALMTTTYTMDNTNSSLRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTSDYVA  343

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y+   + V  K  + V+C  ++   PG LNYP+FS+ F  K +  V+Y+R + N
Sbjct  344  FLCSLDYSAAHIRVITKM-ANVSCPPRS--RPGDLNYPSFSVVFRKKPRHVVRYRRELTN  400

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN--AQPARFLNSYGSI  529
            VG    AVY+VKV+ P    V+V+P +LVF +      Y +TF +  A P R    +G I
Sbjct  401  VGPAM-AVYDVKVSGPASAGVTVTPARLVFKKVGQKQRYYVTFESKAAGPGRAKPDFGWI  459

Query  530  AWEDGVHIVKSPIA  571
            +W    H+V+SP+A
Sbjct  460  SWASDEHVVRSPVA  473



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 121/193 (63%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN  N L D A G+ SNP++HGAGHVDP++A+ PGLVYD+ V DY+A
Sbjct  579  AIKSALMTTAYNHDNMQNPLRDAADGSLSNPWVHGAGHVDPHKAISPGLVYDISVDDYIA  638

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y      +  K P+ + CS + L  PG LNYP+FS+ F     V+Y R + NVG
Sbjct  639  FLCSLDYTPLHRQIIAKRPN-ITCSRK-LSDPGQLNYPSFSIQFGKSRIVRYTRELTNVG  696

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQ---PARFLNSYGSIA  532
            +  R +Y+V+V+AP  V V V P++L+F    +   Y +TF   +   P     ++GS+ 
Sbjct  697  AA-RTLYQVQVDAPRSVGVKVRPSRLLFRSIGEKKKYTVTFVARKGKTPPPTRTAFGSLL  755

Query  533  WEDGVHIVKSPIA  571
            W    + V+SP++
Sbjct  756  WSSKTNQVRSPVS  768



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 121/193 (63%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN+ + L D A  + S P+ HGAGHV+P +A  PGLVYD    DY+ 
Sbjct  579  AIKSALMTTAYTHDNSKSPLRDAAGKSFSTPWAHGAGHVNPQKAFSPGLVYDASTKDYIT  638

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ YN +++ + VK P  VNC+ +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  639  FLCSLNYNPEQIQLIVKRPD-VNCTNK-FANPGQLNYPSFSIMFSSKRVVRYTRILTNVG  696

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQ---PARFLNSYGSIA  532
             E  +VY V V+ P  V ++V P++LVF +  D   Y +TF + +    +   N +GSI 
Sbjct  697  -EAGSVYNVVVDGPSWVDITVKPSRLVFEKVGDRKRYTVTFVSKKGVDTSSVRNGFGSIL  755

Query  533  WEDGVHIVKSPIA  571
            W +  H V+SPIA
Sbjct  756  WSNTQHQVRSPIA  768



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 119/191 (62%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  + L D A  + S P+ HGAGHVDP +AL PGLVYD    DY+A
Sbjct  550  AIKSALMTTAYTLDNTNSPLKDAADYSISTPWAHGAGHVDPQKALSPGLVYDAKPEDYIA  609

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y M+ +   VK P+ V C+ +    PG LNYP+FS+ F     V+Y R + NVG
Sbjct  610  FLCSLDYTMEMIQAIVKHPN-VTCAAK-FRDPGQLNYPSFSVVFGKSRVVRYTRRLTNVG  667

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-NSYGSIAWE  538
            +   +VY V V AP  V VSV P+ LVF    D   Y +TF + +    L N +GSI W+
Sbjct  668  AAG-SVYRVSVEAPPNVVVSVKPSNLVFRNVGDRQRYTVTFVSQKGVDPLHNGFGSITWK  726

Query  539  DGVHIVKSPIA  571
            +  H V+SP+A
Sbjct  727  NEQHQVRSPVA  737



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 118/192 (61%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A  + SNP  HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  562  AIKSALMTTAYVLDNTNSPLHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIR  621

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  622  FLCSLEYTVDHIVAIVKRPS-VNCSKK-FSDPGQLNYPSFSVLFGGKRVVRYTREVTNVG  679

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V +SV P KL F    +   Y +TF + +     N   +GSI W
Sbjct  680  AAS-SVYKVMVNGAPSVGISVKPLKLAFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITW  738

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  739  INPQHEVRSPVA  750



>ref|XP_008782639.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=772

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 119/193 (62%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSAL TTAY IDN  + L D A G+ + PF  GAGHVDP +AL PGLVYD+   DY+A
Sbjct  578  AIKSALTTTAYNIDNTNSPLRDSAGGSLATPFAFGAGHVDPRKALSPGLVYDITTDDYIA  637

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y +  + V VK P+ V CS +    PG LNYP+FS+ F  K++  VKY+R + N
Sbjct  638  FLCSLDYTIQHIQVIVKRPN-VTCSRR-FSNPGDLNYPSFSVIFEKKSRKVVKYRRELTN  695

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SYGSIA  532
            VGS   +VY VK+  P  + V+V P KL+F      L Y + F + +     N ++G I 
Sbjct  696  VGSAG-SVYSVKITGPENISVTVKPAKLIFKHVGQKLKYSVIFASKKGGNPKNAAFGWIT  754

Query  533  WEDGVHIVKSPIA  571
            W +  H V+SP+A
Sbjct  755  WSNKQHKVRSPVA  767



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 118/192 (61%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A  + SNP  HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  561  AIKSALMTTAYVLDNTNSPLHDAADNSLSNPHAHGSGHVDPLKALSPGLVYDISTEEYIR  620

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK PS VNCS++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  621  FLCSLEYTVDHIVAIVKRPS-VNCSKK-FSDPGQLNYPSFSVLFGGKRVVRYTREVTNVG  678

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V VSV P KL F    +   Y +TF + +     N   +GSI W
Sbjct  679  AAS-SVYKVMVNGAPSVGVSVKPLKLAFKSVGEKKRYTVTFVSKKGVSMTNKAEFGSITW  737

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  738  INPQHEVRSPVA  749



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 130/195 (67%), Gaps = 6/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN G+ L D A G+ +NP+I+G+G+VDP +AL PGLVYD+   DY A
Sbjct  572  AIKSALMTTAYTVDNTGSLLRDAAGGSNANPWIYGSGYVDPQKALSPGLVYDIAAEDYTA  631

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y+ + +    + P+T  CS + L  PG+LNYP+FS+ F  K++  V+Y R + N
Sbjct  632  FLCSLDYSTNHILAISQSPNTT-CSRR-LSDPGNLNYPSFSVIFGRKSRRIVRYSRELTN  689

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SYGSIA  532
            VG    +VY +  + P  V V+V PTKLVF +  + L Y +TFT+ +     + ++G I+
Sbjct  690  VGLSG-SVYNLTYSGPPSVSVTVRPTKLVFKQVGEKLKYTVTFTSKKQGNPTDMAFGWIS  748

Query  533  WEDGVHIVKSPIAVL  577
            W++  H V+SPI+ +
Sbjct  749  WKNEQHQVRSPISYM  763



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 120/194 (62%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAYT DN  + L D A G  SNP+ HG+GHVDP++AL PGLVYD    DY+A
Sbjct  566  AVKSALMTTAYTHDNTKSPLRDAADGTLSNPWGHGSGHVDPSKALSPGLVYDTTAEDYIA  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y  + +   VK P+ V C E+    PG LNYP+FS+ F  KN+  V+Y R + N
Sbjct  626  FLCSLEYTNEHVQAIVKRPN-VTC-ERKYSDPGQLNYPSFSIAFGSKNKRVVRYTRELTN  683

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR--FLNSYGSI  529
            VG+   +VY   V +P  V+  V PT+LVFN   +   Y +TF     A     + +GSI
Sbjct  684  VGAAG-SVYRASVTSPSTVRTVVKPTRLVFNNVGEKQKYTVTFMALPGAEKTARSEFGSI  742

Query  530  AWEDGVHIVKSPIA  571
             W +  H+VKSP+A
Sbjct  743  VWANPQHLVKSPVA  756



>ref|XP_010238670.1| PREDICTED: subtilisin-like protease isoform X1 [Brachypodium 
distachyon]
Length=769

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 127/194 (65%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMT++YT+DN  ++  D A  + +NPF  GAGHVDP++AL PGLVYD+  +DYV 
Sbjct  575  AIKSALMTSSYTVDNTNSSFRDTAGSSPANPFAFGAGHVDPHKALSPGLVYDISTNDYVV  634

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y++  + V  K  S ++C +++   PG LNYP+FS+ F  K +  V+Y+R + N
Sbjct  635  FLCSLDYSVSHIRVVTKM-SNISCPQKS--RPGDLNYPSFSVVFRNKPKHVVRYRRELTN  691

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN--AQPARFLNSYGSI  529
            VG    +VY VKV++P  V V VSP KLVF +    L Y +TFT+    P R    +G I
Sbjct  692  VG-PAMSVYNVKVSSPASVSVKVSPEKLVFKKLGQKLRYYVTFTSKVVDPNRAKPDFGWI  750

Query  530  AWEDGVHIVKSPIA  571
            +W +  H+V+SP+A
Sbjct  751  SWVNNQHVVRSPVA  764



>gb|ADE76648.1| unknown [Picea sitchensis]
Length=394

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 119/200 (60%), Gaps = 13/200 (7%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A++SALMTTAYT DN G+ +ID+A+GN S PF  GAGHV P RA+DPGL+YD+   DYV 
Sbjct  193  AVRSALMTTAYTQDNRGHRMIDEASGNASTPFDFGAGHVHPERAMDPGLIYDMDTEDYVR  252

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVK----YKRSV  349
             LC++ Y    + V  + P+   C  + + +PG++NYP+FS  F      K    + R+V
Sbjct  253  FLCSLNYTSKAIQVITRKPT--RCPARRI-SPGNINYPSFSAVFDLTQPKKLSTVFFRTV  309

Query  350  KNVGSEKRAVYEVKVNAPL-GVQVSVSPTKLVFNETTDMLSYEITFTNAQ----PARFLN  514
             NVG    +VY V+V  P  GV V+V P KLVF E    LSY +T T       P     
Sbjct  310  TNVGPP-LSVYRVRVIHPRGGVTVTVKPRKLVFTEKNQKLSYTVTVTTKHIDLLPGNADT  368

Query  515  SYGSIAWEDGVHIVKSPIAV  574
             +  I+W DG H+V+SPI +
Sbjct  369  RFCFISWTDGKHVVQSPITI  388



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 120/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A  + SNP  HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  563  AIKSALMTTAYVLDNTNSPLHDAADNSLSNPHAHGSGHVDPQKALSPGLVYDISTEEYIR  622

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK  S+VNC+++    PG LNYP+FS+ F  K  V+Y R V NVG
Sbjct  623  FLCSLEYTVDHIVAIVKR-SSVNCTKK-FSDPGQLNYPSFSVLFGGKRVVRYTREVTNVG  680

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   +VY+V VN    V++SV P+KL F    +   Y +TF + +     N   +GSI W
Sbjct  681  AAN-SVYKVMVNGAPTVEISVKPSKLTFKRVGEKKRYTVTFVSKKGVSMTNKAEFGSITW  739

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  740  INPQHEVRSPVA  751



>tpg|DAA50071.1| TPA: putative subtilase family protein [Zea mays]
Length=773

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 121/197 (61%), Gaps = 9/197 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G+ +N F +GAGHVDP RAL PGLVYD+   DY A
Sbjct  574  AIKSALMTTAYTVDNTNSSLRDAADGSVANAFAYGAGHVDPQRALSPGLVYDISTHDYAA  633

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVK------YKR  343
             LC++ Y+   + V  K  S V+C   N   PG LNYP+FS+ F  K + K      ++R
Sbjct  634  FLCSLNYSAPHVQVITKA-SNVSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRR  692

Query  344  SVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF-TNAQPARFLNSY  520
             + NVG    +VY+VKV  P  V V+V+P +L F +    L Y +TF + A+       +
Sbjct  693  ELTNVGPAA-SVYDVKVVGPESVAVTVTPARLTFRQAGQKLRYYVTFASRARQGHAKPDF  751

Query  521  GSIAWEDGVHIVKSPIA  571
            G I+W +  H+V+SP+A
Sbjct  752  GWISWVNDEHVVRSPVA  768



>ref|NP_001145743.1| uncharacterized protein LOC100279250 precursor [Zea mays]
 gb|ACN33223.1| unknown [Zea mays]
Length=773

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 121/197 (61%), Gaps = 9/197 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G+ +N F +GAGHVDP RAL PGLVYD+   DY A
Sbjct  574  AIKSALMTTAYTVDNTNSSLRDAADGSVANAFAYGAGHVDPQRALSPGLVYDISTHDYAA  633

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVK------YKR  343
             LC++ Y+   + V  K  S V+C   N   PG LNYP+FS+ F  K + K      ++R
Sbjct  634  FLCSLNYSAPHVQVITKA-SNVSCGAPNKSRPGDLNYPSFSVVFGQKRKTKPAAALRFRR  692

Query  344  SVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF-TNAQPARFLNSY  520
             + NVG    +VY+VKV  P  V V+V+P +L F +    L Y +TF + A+       +
Sbjct  693  ELTNVGPAA-SVYDVKVVGPESVAVTVTPARLTFRQAGQKLRYYVTFASRARQGHAKPDF  751

Query  521  GSIAWEDGVHIVKSPIA  571
            G I+W +  H+V+SP+A
Sbjct  752  GWISWVNDEHVVRSPVA  768



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=765

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 121/192 (63%), Gaps = 6/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN    L D A G  SNP+ HG+GHVDP+RA+ PGLVYD+   +YVA
Sbjct  572  AIKSALMTTAYTHDNTKAPLSDAAGGQFSNPWAHGSGHVDPSRAVSPGLVYDISSVEYVA  631

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y + ++    K  S V C+ +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  632  FLCSLGYTIQQVQSIAK--SNVTCARK-YSDPGQLNYPSFSVVFGNKRVVRYTRELTNVG  688

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +  R++Y+V V+ P GV+  V P+ L F    +   Y +TF +A+     +   +GSI W
Sbjct  689  TA-RSLYKVIVSGPPGVRTIVKPSSLFFATVGEKKKYTVTFVSAKSGSRTSRAEFGSIVW  747

Query  536  EDGVHIVKSPIA  571
             + +H+VKSP+A
Sbjct  748  ANTLHLVKSPVA  759



>ref|XP_010232411.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=815

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 120/193 (62%), Gaps = 4/193 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +D +G  + D  T  ++ PF  GAGHVDPN ALDPGLV+D G  DY++
Sbjct  605  AIKSALMTTAYNMDRSGGAIKDTNTSMEAGPFDLGAGHVDPNSALDPGLVFDAGEDDYIS  664

Query  182  LLCTIAYNMDELSVFVKDPSTVN-CSEQNLGTPGSLNYPAFSLDFL-YKNQVKYKRSVKN  355
             LC + Y   ++++F K    V+ CS+    + G LNYPAFS+ F  Y ++V  +R V+N
Sbjct  665  FLCALGYTPRQIAIFTKASPVVDVCSKHKGASVGDLNYPAFSVAFKSYTDKVTQRRVVRN  724

Query  356  VGSEKRAVYEVKVNAPLG-VQVSVSPTKLVFNETTDMLSYEITFTNAQPA-RFLNSYGSI  529
            VGS   AVY +    P+G V V+V+P +LVF+       Y +TF+   P+ +    +G++
Sbjct  725  VGSNVNAVYTISRRGPVGNVGVTVTPDRLVFDAQHQTREYTVTFSTLNPSVKSTEEHGAL  784

Query  530  AWEDGVHIVKSPI  568
             W DG H V SP+
Sbjct  785  VWSDGKHEVASPM  797



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 119/192 (62%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A G  S P+ HG+GHVDP +AL PGLVYDL   DY+A
Sbjct  585  AIKSALMTTAYDLDNTRSPLRDAAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAEDYIA  644

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK P+ V CS +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  645  FLCSLDYTIDHVKTIVKRPN-VTCSRK-FSDPGELNYPSFSVVFNDKKVVRYTRELTNVG  702

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR--FLNSYGSIAW  535
            +   ++Y V V  P  V V+V P KL+F +  D + Y +TF + +       + +GSI W
Sbjct  703  AAG-SMYNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVW  761

Query  536  EDGVHIVKSPIA  571
             +  + V+SP+A
Sbjct  762  SNAQNKVRSPVA  773



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 119/192 (62%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A G  S P+ HG+GHVDP +AL PGLVYDL   DY+A
Sbjct  582  AIKSALMTTAYDLDNTRSPLRDAAGGTVSTPWAHGSGHVDPQKALSPGLVYDLTAEDYIA  641

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK P+ V CS +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  642  FLCSLDYTIDHVKTIVKRPN-VTCSRK-FSDPGELNYPSFSVVFNDKKVVRYTRELTNVG  699

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR--FLNSYGSIAW  535
            +   ++Y V V  P  V V+V P KL+F +  D + Y +TF + +       + +GSI W
Sbjct  700  AAG-SMYNVSVTGPSTVGVTVKPMKLIFPKVGDKMRYTVTFVSKKGTNPTTRSEFGSIVW  758

Query  536  EDGVHIVKSPIA  571
             +  + V+SP+A
Sbjct  759  SNAQNKVRSPVA  770



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   164 bits (416),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 119/194 (61%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAYT DN    L D A G  SNP+ HG+GHVDP++AL PGLVYD+   DY+A
Sbjct  566  AVKSALMTTAYTHDNTKAPLRDAADGTISNPWAHGSGHVDPSKALSPGLVYDIATEDYIA  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y  + +   VK P+ V C+ +    PG LNYP+FS+ F  K +  V Y R + N
Sbjct  626  FLCSLEYTNEHVQAIVKRPN-VTCARK-YSDPGQLNYPSFSVMFWNKKKRVVSYTRELTN  683

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR--FLNSYGSI  529
            VG    +VY V V +P  V+  V PT+LVFN   +   Y +TF  +Q A     + +GSI
Sbjct  684  VGPAG-SVYRVAVTSPSMVRTIVKPTRLVFNNVGEKQKYTVTFVASQGAEKTSRSEFGSI  742

Query  530  AWEDGVHIVKSPIA  571
             W +  H VKSP+A
Sbjct  743  MWSNPQHQVKSPVA  756



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 122/191 (64%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DNA + L D A  + S P+ HGAGHV+P++AL PGLVYD    DYVA
Sbjct  565  AIKSALMTTAYTLDNANSPLRDAADYSLSTPWAHGAGHVNPHKALSPGLVYDATPEDYVA  624

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +    K P+ + C+ +    PG LNYP+FS+ F     VKY R + NVG
Sbjct  625  FLCSLRYTVEMIQAIAKRPN-ITCARK-FRDPGQLNYPSFSVLFGKSRIVKYSRELTNVG  682

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL-NSYGSIAWE  538
            +   +VY V V AP  V VSV P+KLVF    D   Y +TFT+ +    + +++GSI W+
Sbjct  683  AAG-SVYLVSVEAPPTVAVSVKPSKLVFKNVGDKQRYTVTFTSKKSVNPVSHAFGSITWK  741

Query  539  DGVHIVKSPIA  571
            +    VKSP+A
Sbjct  742  NAQDQVKSPVA  752



>gb|EMT11725.1| Subtilisin-like protease [Aegilops tauschii]
Length=525

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 116/195 (59%), Gaps = 8/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +D++G  + D +T + S PF  GAGH+ PN A+DPGLVYD    DY+ 
Sbjct  325  AIKSALMTTAYNVDSSGGVIGDMSTSDASTPFARGAGHIHPNSAVDPGLVYDASTEDYIN  384

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKN--QVKYKRSVKN  355
             LC + Y   +++VF    S+++CS++  G+ G  +YPAFS+ F       V  +R V+N
Sbjct  385  FLCALGYTAKQVAVF---GSSISCSKR-AGSVGDHSYPAFSVVFTSNKVAAVTQRRVVRN  440

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GSI  529
            VGS+  A Y  KV AP GV+V+VSP  L  + T     Y +TF           Y  GSI
Sbjct  441  VGSDTAAAYTAKVTAPDGVRVTVSPETLRVSSTEKTQEYVVTFAQRTTGSVTEKYTFGSI  500

Query  530  AWEDGVHIVKSPIAV  574
             W DG H V SPIA+
Sbjct  501  EWSDGEHSVTSPIAI  515



>tpg|DAA61658.1| TPA: putative subtilase family protein [Zea mays]
Length=548

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 115/195 (59%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN G+ L+D AT   + P+  GAGHVDP  AL PGLVYD  V DYVA
Sbjct  351  AIKSALMTTAYTTDNTGSPLLDAATNTTATPWAFGAGHVDPVSALSPGLVYDASVDDYVA  410

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF---LYKNQVKYKRSVK  352
             LCT+     ++     +   V C+ + L +PG LNYP+FS+ F     ++ VKY+R + 
Sbjct  411  FLCTVGVAPRQIQAITAEGPNVTCTRK-LSSPGDLNYPSFSVVFDRRSSRSTVKYRRDLT  469

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGS  526
            NVGS     Y VKV  P  + V V P +L F    D L Y +TF +A     ++  ++G 
Sbjct  470  NVGSAGD-TYTVKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANARGPMDPAAFGW  528

Query  527  IAWEDGVHIVKSPIA  571
            + W  G H V+SPI+
Sbjct  529  LTWSSGEHDVRSPIS  543



>ref|XP_010937330.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=772

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 117/193 (61%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SALMTTAY ID+  + L D A G+ + PF  GAGHVDP +AL PGL+YD+   DY+A
Sbjct  578  AIRSALMTTAYNIDDTNSPLRDSAGGSVATPFAFGAGHVDPRKALSPGLIYDITTEDYIA  637

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK--NQVKYKRSVKN  355
             LC++ Y +  + V VK P+ V CS ++   PG LNYP+FS+ F  K  N VKY R + N
Sbjct  638  FLCSLDYTIQHIQVIVKRPN-VTCS-RSFSNPGELNYPSFSVVFKKKSRNVVKYIRELTN  695

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARF-LNSYGSIA  532
            VGS   +VY V++  P  V V+V P KL+F      L Y I F +         ++G I 
Sbjct  696  VGSAG-SVYNVRIRGPENVSVTVKPAKLIFKHVGQKLKYSIIFASKNGGHLKTTAFGWIT  754

Query  533  WEDGVHIVKSPIA  571
            W +  H V+SP+A
Sbjct  755  WSNKQHEVRSPVA  767



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 119/194 (61%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAYT DN    L D A G  SNP+ HG+GH+DP++AL PGLVYD+   DY+A
Sbjct  566  AVKSALMTTAYTHDNTKAPLRDAADGTISNPWAHGSGHIDPSKALSPGLVYDIATEDYIA  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y  + +   VK P+ V C+ +    PG LNYP+FS+ F  K +  V Y R + N
Sbjct  626  FLCSLEYTKEHVQAIVKRPN-VTCARK-YSDPGQLNYPSFSVVFWNKKKRVVSYTRELTN  683

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR--FLNSYGSI  529
            VG    +VY V V +P  V+  V PT+LVFN   +   Y +TF  ++ A     + +GSI
Sbjct  684  VGPAG-SVYRVAVTSPSMVRTIVKPTRLVFNNVGEKQKYRVTFVASRGAEKTSRSEFGSI  742

Query  530  AWEDGVHIVKSPIA  571
             W +  H VKSP+A
Sbjct  743  MWSNPQHQVKSPVA  756



>ref|NP_001130775.1| uncharacterized protein LOC100191879 precursor [Zea mays]
 gb|ACG30165.1| subtilisin-like protease precursor [Zea mays]
Length=766

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 116/195 (59%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN G+ L+D AT   + P+  GAGHVDP  AL PGLVYD  V DYVA
Sbjct  569  AIKSALMTTAYTTDNTGSPLLDAATNTTATPWAFGAGHVDPVSALSPGLVYDASVDDYVA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ---VKYKRSVK  352
             LCT+     ++ V   +   V C+ + L +PG LNYP+FS+ F  ++    VKY+R + 
Sbjct  629  FLCTVGVAPRQIQVITAEGPNVTCTRK-LSSPGDLNYPSFSVVFDRRSSRSTVKYRRDLT  687

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGS  526
            NVGS     Y VKV  P  + V V P +L F    D L Y +TF +A     ++  ++G 
Sbjct  688  NVGSAGD-TYTVKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANARGPMDPAAFGW  746

Query  527  IAWEDGVHIVKSPIA  571
            + W  G H V+SPI+
Sbjct  747  LTWSSGEHDVRSPIS  761



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 123/192 (64%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  D   + L D   G  S P+ HG+GHVDP++AL PGL+YD+   DY+ 
Sbjct  568  AIKSALMTTAYVRDTTNSPLRDAEGGQLSTPWAHGSGHVDPHKALSPGLIYDITPEDYIK  627

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ V C+++    PG +NYP+FS+ F     V+Y R+V NVG
Sbjct  628  FLCSLDYELNHIQAIVKRPN-VTCTKK-FADPGQINYPSFSVLFGKSRVVRYTRAVTNVG  685

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSIAW  535
            +   +VYEV V+AP  V V+V P+KLVF    + L Y +TF + +    +  +++GSI+W
Sbjct  686  AAG-SVYEVTVDAPPSVTVTVKPSKLVFKRVGERLRYTVTFVSKKGVNMMRKSAFGSISW  744

Query  536  EDGVHIVKSPIA  571
             +  + V+SP++
Sbjct  745  NNAQNQVRSPVS  756



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 118/192 (61%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN  + L D A G+ SN + HGAGHVDP +AL PGL+YD+   +Y+ 
Sbjct  566  AIKSALMTTAYTQDNTNSTLRDAADGSLSNRWAHGAGHVDPQKALSPGLIYDISTDEYIT  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D +   VK P+ V CS++    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  626  FLCSLGYTVDHVKTIVKRPN-VTCSKK-FKDPGELNYPSFSVMFGGKRVVRYTRELTNVG  683

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
               R++Y+V VN P  V +SV P  L+F    +   Y +TF   +    +    +GSI W
Sbjct  684  -PARSMYKVTVNGPSTVGISVRPKTLIFRTVGEKKRYTVTFVAKRGTSPMAKPEFGSIVW  742

Query  536  EDGVHIVKSPIA  571
             +  + VKSP++
Sbjct  743  GNAQNQVKSPVS  754



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 115/195 (59%), Gaps = 8/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAYT DN  + L D A G  S P  HG+GHVDP +AL PGLVYD+   DYVA
Sbjct  564  AVKSALMTTAYTRDNTKSPLRDAADGGLSTPLAHGSGHVDPQKALSPGLVYDISTQDYVA  623

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK    + CS +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  624  FLCSLDYTIEHVRAIVKR-QNITCSRK-FSDPGELNYPSFSVLFGSKGFVRYTRELTNVG  681

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-----SYGS  526
            +   +VY+V V  P  V V V P+ LVF    +   Y +TF   +  +  N     ++GS
Sbjct  682  AAD-SVYQVAVTGPPSVGVVVRPSTLVFKNVGEKKRYTVTFVAKKGKKVQNRMTRSAFGS  740

Query  527  IAWEDGVHIVKSPIA  571
            I W +  H VKSP+A
Sbjct  741  IVWSNTQHQVKSPVA  755



>gb|EMT24678.1| Subtilisin-like protease [Aegilops tauschii]
Length=596

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 117/194 (60%), Gaps = 7/194 (4%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            IKSALMTTAY +DNAG  + D +TG  S PF  GAGHVDPNRA+DPGLVYD G  DY+  
Sbjct  325  IKSALMTTAYNMDNAGAVIGDMSTGKASTPFARGAGHVDPNRAVDPGLVYDAGTEDYITF  384

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKN--QVKYKRSVKNV  358
            LC + Y   +++VF    S+ NCS +   + G  NYPAFS+ F       V+ +R V+NV
Sbjct  385  LCALGYTDKQIAVF---SSSTNCSTRAGSSVGDHNYPAFSVVFTTNKLAVVRQRRVVRNV  441

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNA--QPARFLNSYGSIA  532
            G + RA Y  KV AP GV V+VSP  L F  T     Y +TF        +  +++GSI 
Sbjct  442  GGDARATYRAKVTAPDGVLVTVSPRTLRFTATQKTQEYVVTFAQRIFGGVKGNHTFGSIE  501

Query  533  WEDGVHIVKSPIAV  574
            W D  H V SPIA+
Sbjct  502  WSDRKHTVTSPIAI  515



>dbj|BAD36156.1| putative serine protease [Oryza sativa Japonica Group]
 gb|EAZ09256.1| hypothetical protein OsI_31529 [Oryza sativa Indica Group]
 gb|EAZ44882.1| hypothetical protein OsJ_29522 [Oryza sativa Japonica Group]
Length=770

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 121/197 (61%), Gaps = 10/197 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN G+ ++D A+   + P+  GAGHVDP +AL PGLVYD  V DYVA
Sbjct  572  AIKSALMTTAYTVDNTGSPIVDAASNTTATPWSIGAGHVDPVKALSPGLVYDTSVDDYVA  631

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF------LYKNQVKYKR  343
             LC++  +  ++      P+ V C ++ L +PG LNYP+FS+ F           VKY+R
Sbjct  632  FLCSVGTSPPQVQAITAAPN-VTC-QRKLSSPGDLNYPSFSVVFGRRSSSSRSTTVKYRR  689

Query  344  SVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SY  520
             + NVG + R+VY  +V  P  + V+V P +L F +  D L Y +TF +  P    + ++
Sbjct  690  ELTNVG-DGRSVYTARVTGPSDIAVAVKPARLAFKKAGDKLRYTVTFKSTTPGGPTDAAF  748

Query  521  GSIAWEDGVHIVKSPIA  571
            G + W +G H V+SPI+
Sbjct  749  GWLTWSNGEHDVRSPIS  765



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 116/192 (60%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN  + L D      S P+ HGAGHVDP +AL PGLVYD+ V +Y+ 
Sbjct  567  AIKSALMTTAYVTDNTKSPLRDAEGDQVSTPWAHGAGHVDPQKALSPGLVYDISVDEYIN  626

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y  D +   VK      CS++    PG+LNYP+FS+ F  K  V+Y R + NVG
Sbjct  627  FLCSLDYTTDHIQTIVKH-RNFTCSKK-FSDPGALNYPSFSVLFANKRVVRYTRRLTNVG  684

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQ-PARFLNS-YGSIAW  535
            +   +VY V VNAP  V+V+V P KL F    + L Y +TF  ++  AR   S +GSI W
Sbjct  685  AAA-SVYTVAVNAPPTVKVTVKPAKLAFKSVGERLRYTVTFVASRGAARTSRSEFGSIVW  743

Query  536  EDGVHIVKSPIA  571
             +  H V+SP A
Sbjct  744  SNAEHQVRSPAA  755



>gb|ACF79126.1| unknown [Zea mays]
 tpg|DAA61657.1| TPA: putative subtilase family protein [Zea mays]
Length=766

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 115/195 (59%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN G+ L+D AT   + P+  GAGHVDP  AL PGLVYD  V DYVA
Sbjct  569  AIKSALMTTAYTTDNTGSPLLDAATNTTATPWAFGAGHVDPVSALSPGLVYDASVDDYVA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ---VKYKRSVK  352
             LCT+     ++     +   V C+ + L +PG LNYP+FS+ F  ++    VKY+R + 
Sbjct  629  FLCTVGVAPRQIQAITAEGPNVTCTRK-LSSPGDLNYPSFSVVFDRRSSRSTVKYRRDLT  687

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGS  526
            NVGS     Y VKV  P  + V V P +L F    D L Y +TF +A     ++  ++G 
Sbjct  688  NVGSAGD-TYTVKVTGPSDISVRVKPARLEFRRAGDKLRYTVTFRSANARGPMDPAAFGW  746

Query  527  IAWEDGVHIVKSPIA  571
            + W  G H V+SPI+
Sbjct  747  LTWSSGEHDVRSPIS  761



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 117/192 (61%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DNA + L D A  + S P+ HGAGHVDP++AL PGLVYD    DYV+
Sbjct  571  AIKSALMTTAYTHDNANSPLRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPEDYVS  630

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y  + + +  K P+ + CS++    PG LNYP+FS+ F     V+Y R + NVG
Sbjct  631  FLCSLGYTKEMVQIVAKHPN-ITCSKR-FHDPGQLNYPSFSVMFRKTGVVRYSRELTNVG  688

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR--FLNSYGSIAW  535
                  Y V V+AP  V+VSVSP+ LVF    D   + +TF   +       + +GSI W
Sbjct  689  PAG-LTYRVSVDAPPNVEVSVSPSTLVFKNVGDKRRFRVTFVWKKEVGPVVRHGFGSIVW  747

Query  536  EDGVHIVKSPIA  571
             + +H V SP+A
Sbjct  748  SNALHRVSSPVA  759



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 117/192 (61%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A G  S P+ HG+GHV+P +A+ PGLVYD    DY+A
Sbjct  569  AIKSALMTTAYVVDNTKSPLHDAADGRLSTPWAHGSGHVNPQKAISPGLVYDASTEDYIA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ + C+ +   TPG LNYP+FS+ F  +  V+Y R + NVG
Sbjct  629  FLCSLGYTIEHVKAIVKRPN-ITCTRK-FNTPGELNYPSFSVLFGDQRVVRYTRELTNVG  686

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT--NAQPARFLNSYGSIAW  535
               R++Y V V+ P  V +SV P +L+F    +   Y +TF   N        ++GSI W
Sbjct  687  -PARSLYNVTVDGPSTVGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVW  745

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  746  GNAQHQVRSPVA  757



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 120/195 (62%), Gaps = 11/195 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A+KSALMTTAYT DN  + L D A G  SNP+ HG+GHVDP++AL PGLVYD    DY+A
Sbjct  566  AVKSALMTTAYTHDNTNSPLRDAADGTLSNPWAHGSGHVDPSKALSPGLVYDTTAEDYIA  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y  + +   VK P+ V C+ +    PG LNYP+FS+ F  KN+  V+Y R + N
Sbjct  626  FLCSLEYTNEHVQAIVKRPN-VTCARK-YSDPGQLNYPSFSIVFGSKNKRVVRYTRELTN  683

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT----NAQPARFLNSYG  523
            VG+   +VY   V +P  V+  V PT+LVFN   +   Y +TF       + AR  + +G
Sbjct  684  VGAAG-SVYRASVTSPSTVRTIVKPTRLVFNNVGEKQKYTVTFVALPGAXKTAR--SEFG  740

Query  524  SIAWEDGVHIVKSPI  568
            SI W +  H VKSP+
Sbjct  741  SIVWANPQHQVKSPV  755



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 116/192 (60%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A G  S P+ HG+GHV+P +A+ PGLVYD    DYVA
Sbjct  569  AIKSALMTTAYVVDNTKSPLHDAADGRLSTPWAHGSGHVNPQKAISPGLVYDASTEDYVA  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ + C+ +   TPG LNYP+FS+ F  +  V+Y R + NVG
Sbjct  629  FLCSLGYTIEHVQAIVKRPN-ITCTRK-FNTPGELNYPSFSVLFGDQRVVRYTRELTNVG  686

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT--NAQPARFLNSYGSIAW  535
               R++Y V  + P  V +SV P +L+F    +   Y +TF   N        ++GSI W
Sbjct  687  -PARSLYNVTADGPSTVGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVW  745

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  746  GNAQHQVRSPVA  757



>ref|XP_004983113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=766

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 125/193 (65%), Gaps = 7/193 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G+ +N F +GAGHVDP +AL PGLVYD+  +DYVA
Sbjct  573  AIKSALMTTAYTVDNTNSSLRDAADGSLANVFAYGAGHVDPQKALSPGLVYDISTNDYVA  632

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y+   + V  K  S  +C ++    PG LNYP+FS+ F  K++  ++++R V N
Sbjct  633  FLCSLDYSAPHIQVITKM-SNFSCPKKF--RPGDLNYPSFSVVFKQKSKRVMRFRREVTN  689

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF-TNAQPARFLNSYGSIA  532
            VG    +VY VKV +P  V V+V+PTKL F +      Y +TF + A   +    +G I+
Sbjct  690  VGPAT-SVYNVKVTSPASVSVTVTPTKLTFKKVGQKQRYYVTFASKAGQGQAKPDFGWIS  748

Query  533  WEDGVHIVKSPIA  571
            W +  H+V+SP+A
Sbjct  749  WANDDHVVRSPVA  761



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 122/192 (64%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  D   + L D   G  S PF HG+GHVDP++AL PGL+YD+   DY+ 
Sbjct  568  AIKSALMTTAYVHDTTNSPLRDAEGGQLSTPFAHGSGHVDPHKALSPGLIYDITPEDYIK  627

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ V C+++    PG +NYP+FS+ F     V+Y R+V NV 
Sbjct  628  FLCSLDYELNHIQAIVKRPN-VTCAKK-FADPGQINYPSFSVLFGKSRVVRYTRAVTNVA  685

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSIAW  535
            +   +VYEV V+AP  V V+V P+KLVF    + L Y +TF + +    +  +++GSI+W
Sbjct  686  AAG-SVYEVVVDAPPSVLVTVKPSKLVFKRVGERLRYTVTFVSNKGVNMMRKSAFGSISW  744

Query  536  EDGVHIVKSPIA  571
             +  + V+SP++
Sbjct  745  NNAQNQVRSPVS  756



>dbj|BAK06243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 121/194 (62%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTT YT+DN  ++L D A  + + PF  GAGHVDP +AL PGLVYD+  +DY A
Sbjct  575  AIKSALMTTTYTMDNTNSSLRDAAGSSPATPFGFGAGHVDPQKALSPGLVYDISTNDYAA  634

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK--NQVKYKRSVKN  355
             LC++ Y+   + V  K  S V+C  ++   PG LNYP+FS+ F  K  + V+Y+R + N
Sbjct  635  FLCSLDYSATHIRVITKM-SNVSCPPRS--RPGDLNYPSFSVVFRKKARHAVRYRRELTN  691

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN--AQPARFLNSYGSI  529
            VG    AVY+VKV+ P  V V+V+P KLVF +      Y +TF +  A   R    +G I
Sbjct  692  VG-PAMAVYDVKVSGPASVGVTVTPAKLVFKKVGQKQRYYVTFESKAAGAGRAKPDFGWI  750

Query  530  AWEDGVHIVKSPIA  571
            +W    H+V+SP+A
Sbjct  751  SWVSDEHVVRSPVA  764



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score =   160 bits (405),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 116/192 (60%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A G  S P+ HG+GHV+P +A+ PGLVYD    DYVA
Sbjct  588  AIKSALMTTAYVVDNTKSPLHDAADGRLSTPWAHGSGHVNPQKAISPGLVYDASTEDYVA  647

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   VK P+ + C+ +   TPG LNYP+FS+ F  +  V+Y R + NVG
Sbjct  648  FLCSLGYTIEHVQAIVKRPN-ITCTRK-FNTPGELNYPSFSVLFGDQRVVRYTRELTNVG  705

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT--NAQPARFLNSYGSIAW  535
               R++Y V  + P  V +SV P +L+F    +   Y +TF   N        ++GSI W
Sbjct  706  -PARSLYNVTADGPSTVGISVRPKRLLFRTVGEKKRYTVTFVAKNGDQKMGGAAFGSIVW  764

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  765  GNAQHQVRSPVA  776



>ref|XP_007051971.1| Subtilase family protein [Theobroma cacao]
 gb|EOX96128.1| Subtilase family protein [Theobroma cacao]
Length=768

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 120/194 (62%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN G+ ++D A  + + PF  G+GHVDP RA DPGL+YD+   DY+ 
Sbjct  575  AIKSALMTTAYVTDNKGSPILDVAFSSSATPFALGSGHVDPERASDPGLIYDISPKDYIY  634

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK--NQVKYKRSVKN  355
             LC++ YN  ++S+FV +     C +  +  PG LNYP+F+++F       V YKR+V N
Sbjct  635  YLCSLKYNASQISLFVDN---FTCPKHAIMQPGDLNYPSFAVNFKSSAAENVTYKRTVTN  691

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSI  529
            VG+ K + Y+V V  P GV V V P  L F      LSY++TF   +  + +  +S+GS+
Sbjct  692  VGTPK-STYKVLVEEPKGVSVIVKPEILTFKMLGKKLSYKVTFIGLKRTKPVAASSFGSL  750

Query  530  AWEDGVHIVKSPIA  571
             W  G + V+SPIA
Sbjct  751  VWVSGKYRVRSPIA  764



>gb|KHN07895.1| Subtilisin-like protease [Glycine soja]
Length=519

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 122/194 (63%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQS--NPFIHGAGHVDPNRALDPGLVYDLGVSDY  175
            AIKSALMTTAYT DN  + L D ATG +S   P+ +GAGHV+P +AL PGL+YD    DY
Sbjct  324  AIKSALMTTAYTYDNTESPLRD-ATGEESLSTPWAYGAGHVNPQKALSPGLLYDASTQDY  382

Query  176  VALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKN  355
            +  LC++ Y +D L + VK P   NCS++    PG LNYP+FS+ F     V+Y R++ N
Sbjct  383  IYFLCSLNYTLDHLRLLVKHPD-ANCSKK-FADPGDLNYPSFSVVFGSNKVVRYTRTLTN  440

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPA--RFLNSYGSI  529
            VG E  + Y V V+AP  V ++V+P KL F E  +  +Y +TF + +       + +GSI
Sbjct  441  VG-EPGSAYNVAVSAPSTVDITVNPNKLEFGEVGERQTYTVTFVSNRSVNDSATSGFGSI  499

Query  530  AWEDGVHIVKSPIA  571
             W +  H+V+SP+A
Sbjct  500  MWSNEQHLVRSPVA  513



>gb|AHA84190.1| subtilisin-like protease [Phaseolus vulgaris]
Length=760

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 116/187 (62%), Gaps = 5/187 (3%)
 Frame = +2

Query  17   LMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVALLCTI  196
            LMTTAY  DN  + L D A G  S P+ HGAGHV+P+RAL PGLVYD  ++DY+  LC++
Sbjct  571  LMTTAYVHDNTKSPLRDAAGGAFSTPWAHGAGHVNPHRALSPGLVYDASITDYIKFLCSL  630

Query  197  AYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVGSEKRA  376
             Y  + + + VK    VNC+ +    PG LNYP+FS+ F  K  V+Y R++ NVG E  +
Sbjct  631  DYTPEHIQLIVKR-HAVNCTRK-FSDPGQLNYPSFSIHFGGKRVVRYTRTLTNVG-EAGS  687

Query  377  VYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GSIAWEDGVH  550
            VY+V V+AP  V+V+V P +LVF +  +   Y +TF + +       Y  GSI W +  H
Sbjct  688  VYDVTVDAPSTVEVTVRPARLVFGKLGERKRYTVTFVSKKSGGDSGRYGFGSIMWSNAQH  747

Query  551  IVKSPIA  571
             V+SP+A
Sbjct  748  QVRSPVA  754



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 121/194 (62%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN  + L D A G+ S P+ HG+GHVDP++AL+PGLVYD    DY+ 
Sbjct  565  AIKSALMTTAYTSDNTKSPLRDAAGGDISTPWAHGSGHVDPHKALNPGLVYDATPDDYIT  624

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC++ Y++D++    K    + CS +    PG LNYP+FS+ F  K + V+Y R + NV
Sbjct  625  FLCSLDYSIDQVKAITKR-QNITCSRR-FADPGELNYPSFSVLFGTKKRVVRYTRELTNV  682

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQP-ARFLNS--YGSI  529
            G    +VY V +  P  V V+V PTKLVF E  +M  Y +TF   +  +R L +  +G I
Sbjct  683  GPTG-SVYNVAIGGPSSVGVTVKPTKLVFKEVGEMKKYTVTFVAKKGLSRMLGTAEFGWI  741

Query  530  AWEDGVHIVKSPIA  571
             W +  + V+SP++
Sbjct  742  VWRNEQYQVRSPVS  755



>ref|XP_010917484.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=767

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 127/195 (65%), Gaps = 6/195 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMT+AYT+DN G+ L+D A G+ +NP+ +G+G+V+P +AL PGLVYD+   DY+ 
Sbjct  572  AIKSALMTSAYTVDNTGSPLLDAAGGSNANPWAYGSGYVNPQKALSPGLVYDIATEDYIG  631

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y+ D +    + P+T  CS + L  PG+LNYP+FS+ F  K++  V+Y R + N
Sbjct  632  FLCSLDYSADHIQAISQSPNT-TCSRK-LSDPGNLNYPSFSVVFGGKSRRPVRYSRELTN  689

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-SYGSIA  532
            VG    +VY +  + P  V V+V P KLVF +  + L Y + FT+ +     + ++G I+
Sbjct  690  VGLAG-SVYNLTYSGPPSVSVTVRPKKLVFKQVGEKLKYTVIFTSKKEGNPTDVAFGWIS  748

Query  533  WEDGVHIVKSPIAVL  577
            W +  H V+SPI+ +
Sbjct  749  WNNEQHQVQSPISYM  763



>ref|XP_006841510.1| hypothetical protein AMTR_s00003p00138760 [Amborella trichopoda]
 gb|ERN03185.1| hypothetical protein AMTR_s00003p00138760 [Amborella trichopoda]
Length=728

 Score =   159 bits (401),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 113/205 (55%), Gaps = 18/205 (9%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            ++SALMTTAYT DN G  L D+A GN S P   GAGHVDP +ALDPGLVYD+   DY+A 
Sbjct  522  VRSALMTTAYTRDNIGGTLHDEANGNLSTPLASGAGHVDPQKALDPGLVYDINTEDYIAF  581

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVGS  364
            LC   Y+   +    K    V+C  +  G  G LNYPAF++ F  +   + +R VKNVG 
Sbjct  582  LCNSNYSETSIRTITK--REVHCGTK--GWVGDLNYPAFTVVFEGERVAEMRRVVKNVGD  637

Query  365  EKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN----------  514
             + A Y V V  P GV+VSV P +LVF    + LSY +                      
Sbjct  638  NEVATYRVGVIEPKGVRVSVVPQELVFRRKGEELSYRVRVEKVGAEAVAEAEEMIHFPGP  697

Query  515  ----SYGSIAWEDGVHIVKSPIAVL  577
                S+G++ W DG H+V+SP+ V+
Sbjct  698  ESKVSHGTVTWTDGKHVVRSPVTVV  722



>ref|XP_003609994.1| Subtilisin-like protease [Medicago truncatula]
Length=756

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 125/194 (64%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  + L D      S P+ +G+GHV+P +AL PGLVYD  + DY+A
Sbjct  560  AIKSALMTTAYTLDNTESPLRDAMGEALSTPWAYGSGHVNPQKALSPGLVYDADIEDYIA  619

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC++ Y++D + + VK P+ VNCS   L  PG LNYP+FS+ F   +  V+YKR++ NV
Sbjct  620  FLCSLNYSLDHVKLIVKRPN-VNCSTY-LSGPGDLNYPSFSVVFGNNSGVVQYKRTLTNV  677

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPA---RFLNSYGSI  529
            G E  +VY+V V+ P  V + V+PTKLVF +  +  +Y + F + +        + +GSI
Sbjct  678  G-EAESVYDVAVSGPSTVGIIVNPTKLVFEQVGERQTYMVKFISNKDIVDDSVTSEFGSI  736

Query  530  AWEDGVHIVKSPIA  571
             W +  H V+SPIA
Sbjct  737  TWSNKQHQVRSPIA  750



>gb|AES92191.2| subtilisin-like serine protease [Medicago truncatula]
Length=756

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 125/194 (64%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  + L D      S P+ +G+GHV+P +AL PGLVYD  + DY+A
Sbjct  560  AIKSALMTTAYTLDNTESPLRDAMGEALSTPWAYGSGHVNPQKALSPGLVYDADIEDYIA  619

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC++ Y++D + + VK P+ VNCS   L  PG LNYP+FS+ F   +  V+YKR++ NV
Sbjct  620  FLCSLNYSLDHVKLIVKRPN-VNCSTY-LSGPGDLNYPSFSVVFGNNSGVVQYKRTLTNV  677

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPA---RFLNSYGSI  529
            G E  +VY+V V+ P  V + V+PTKLVF +  +  +Y + F + +        + +GSI
Sbjct  678  G-EAESVYDVAVSGPSTVGIIVNPTKLVFEQVGERQTYMVKFISNKDIVDDSVTSEFGSI  736

Query  530  AWEDGVHIVKSPIA  571
             W +  H V+SPIA
Sbjct  737  TWSNKQHQVRSPIA  750



>gb|EEE50901.1| hypothetical protein OsJ_31407 [Oryza sativa Japonica Group]
Length=758

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 120/198 (61%), Gaps = 17/198 (9%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G  + PF  GAGHVDP +AL PGL+YD+   DYV+
Sbjct  565  AIKSALMTTAYTVDNTNSSLRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVS  624

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y    + V  K  S + C  +    PG LNYP+FS+ F  K++  ++++R V N
Sbjct  625  FLCSLNYTTPHIQVITKM-SNITCPRKF--RPGDLNYPSFSVVFKKKSKHVMRFRREVTN  681

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF------TNAQPARFLNS  517
            VG    +VY VKV+ P  V V V+P KLVFN+      Y + F      +NA+P      
Sbjct  682  VG-PAMSVYNVKVSGPASVSVKVTPAKLVFNKVGQKQRYYVIFASTVDASNAKP-----D  735

Query  518  YGSIAWEDGVHIVKSPIA  571
            +G I+W    H+V+SPIA
Sbjct  736  FGWISWMSSQHVVRSPIA  753



>gb|KHN17728.1| Subtilisin-like protease [Glycine soja]
Length=224

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 124/197 (63%), Gaps = 14/197 (7%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQ--SNPFIHGAGHVDPNRALDPGLVYDLGVSDY  175
            AIKSALMTTAYT DN  + + D A G +  S P+ +GAGHV+P +AL PGLVY+    DY
Sbjct  29   AIKSALMTTAYTNDNTESPIRD-AKGEETISTPWAYGAGHVNPQKALSPGLVYEASTQDY  87

Query  176  VALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKN  355
            +A LC++ Y +D L + VKDP   NCS++    P  LNYP+FSL F     ++Y R++ N
Sbjct  88   IAFLCSLNYTLDHLRLVVKDPD-ANCSKK-FADPAELNYPSFSLVFGSNKLLRYTRTLTN  145

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN-----SY  520
            VG E  +VY++ ++ P  V V+V+P +L F +  +  +Y +TF +    R LN      +
Sbjct  146  VG-EPGSVYDLVLSVPSTVHVTVNPRRLQFRQLGESQTYTVTFLS---NRTLNDSVTSDF  201

Query  521  GSIAWEDGVHIVKSPIA  571
            G+I W + +H V++P+A
Sbjct  202  GTIMWTNQLHQVRTPLA  218



>gb|AAM22744.1|AC092388_28 putative cucumisin-like serine protease [Oryza sativa Japonica 
Group]
 gb|AAP53584.1| Subtilisin N-terminal Region family protein, expressed [Oryza 
sativa Japonica Group]
Length=773

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 120/198 (61%), Gaps = 17/198 (9%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G  + PF  GAGHVDP +AL PGL+YD+   DYV+
Sbjct  580  AIKSALMTTAYTVDNTNSSLRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVS  639

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y    + V  K  S + C  +    PG LNYP+FS+ F  K++  ++++R V N
Sbjct  640  FLCSLNYTTPHIQVITKM-SNITCPRKF--RPGDLNYPSFSVVFKKKSKHVMRFRREVTN  696

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF------TNAQPARFLNS  517
            VG    +VY VKV+ P  V V V+P KLVFN+      Y + F      +NA+P      
Sbjct  697  VG-PAMSVYNVKVSGPASVSVKVTPAKLVFNKVGQKQRYYVIFASTVDASNAKP-----D  750

Query  518  YGSIAWEDGVHIVKSPIA  571
            +G I+W    H+V+SPIA
Sbjct  751  FGWISWMSSQHVVRSPIA  768



>gb|EAY78354.1| hypothetical protein OsI_33442 [Oryza sativa Indica Group]
Length=773

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 120/198 (61%), Gaps = 17/198 (9%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G  + PF  GAGHVDP +AL PGL+YD+   DYV+
Sbjct  580  AIKSALMTTAYTVDNTNSSLRDAAGGLLATPFAFGAGHVDPQKALSPGLLYDISTKDYVS  639

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LC++ Y    + V  K  S + C  +    PG LNYP+FS+ F  K++  ++++R V N
Sbjct  640  FLCSLNYTTPHIQVITKM-SNITCPRKF--RPGDLNYPSFSVVFKKKSKHVMRFRREVTN  696

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF------TNAQPARFLNS  517
            VG    +VY VKV+ P  V V V+P KLVFN+      Y + F      +NA+P      
Sbjct  697  VG-PAMSVYNVKVSGPASVSVKVTPAKLVFNKVGQKQRYYVIFASTVDASNAKP-----D  750

Query  518  YGSIAWEDGVHIVKSPIA  571
            +G I+W    H+V+SPIA
Sbjct  751  FGWISWMSSQHVVRSPIA  768



>gb|KHN12283.1| Subtilisin-like protease, partial [Glycine soja]
Length=438

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 115/192 (60%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTA   DN  + L D A G  SNP+ HGAGHV+P++AL PGLVYD   SDY+ 
Sbjct  244  AIKSALMTTADVHDNTKSQLRDAAGGAFSNPWAHGAGHVNPHKALSPGLVYDATPSDYIK  303

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y  + + +  K  S VNC+++    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  304  FLCSLEYTPERIQLITKR-SGVNCTKR-FSDPGQLNYPSFSVLFGGKRVVRYTRVLTNVG  361

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT--NAQPARFLNSYGSIAW  535
             E  +VY V V+AP  V V+V P  LVF +  +   Y  TF   N         +GSI W
Sbjct  362  -EAGSVYNVTVDAPSTVTVTVKPVALVFGKVGERQRYTATFVSKNGVGDSVRYGFGSILW  420

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  421  SNAQHQVRSPVA  432



>ref|XP_006849717.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
 gb|ERN11298.1| hypothetical protein AMTR_s00024p00243520 [Amborella trichopoda]
Length=780

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 115/191 (60%), Gaps = 3/191 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT D  G+ L D ATG  S P  HG+GHVDP  ALDPGL+YDL  SDY+ 
Sbjct  585  AIKSALMTTAYTRDTTGSPLRDAATGGLSTPLAHGSGHVDPQNALDPGLIYDLSTSDYLD  644

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFL-YKNQVKYKRSVKNV  358
             LC++ Y+  ++ +  K  S  +C    +   G+LNYP+FS+ F  Y+  V+Y R + NV
Sbjct  645  FLCSLNYSDTQVRIVSKH-SNFSCPRDKVLDTGNLNYPSFSVIFRGYEKVVRYSRVLTNV  703

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            G E  +VY V V+AP GV ++V P +LVF    +   Y + F +         +G I W 
Sbjct  704  G-EPSSVYTVSVSAPEGVGITVKPQRLVFKGVGNKQGYTVEFASKIKTSGPMDFGWILWS  762

Query  539  DGVHIVKSPIA  571
            +  H V+SPIA
Sbjct  763  NQKHKVRSPIA  773



>ref|XP_006356658.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=768

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 123/193 (64%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQAT-GNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYV  178
            AIKSA+MTTAYT DN  ++  D A  G  SNPF+HG+GHV+P +A  PGLVY++ + D++
Sbjct  567  AIKSAIMTTAYTQDNTNSSFHDSALYGTFSNPFVHGSGHVNPQKAFSPGLVYNIRIHDHI  626

Query  179  ALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLY--KNQVKYKRSVK  352
              LC++ Y +D++   VK  +   C+ +     G +NYP+FS+ F    K  V+Y R V 
Sbjct  627  KFLCSLNYTIDQIQSIVKRLN-FTCANK-FADAGQINYPSFSVLFEINSKRVVRYTREVT  684

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIA  532
            NVG+   +VYEV  +AP  V V+V PTKLVF +  + L Y +TF + +  +  N++G I+
Sbjct  685  NVGAAS-SVYEVATDAPPSVTVTVKPTKLVFKKVGEKLHYTVTFVSKKDVKPGNAFGWIS  743

Query  533  WEDGVHIVKSPIA  571
            W +  H V+SP+A
Sbjct  744  WNNAKHEVRSPVA  756



>ref|XP_002467295.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
 gb|EER94293.1| hypothetical protein SORBIDRAFT_01g023190 [Sorghum bicolor]
Length=767

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 124/193 (64%), Gaps = 7/193 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G+ +N F +GAGHVDP +AL PGLVYD+  +DY A
Sbjct  574  AIKSALMTTAYTVDNTNSSLRDAADGSLANAFAYGAGHVDPQKALSPGLVYDISTNDYAA  633

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQV--KYKRSVKN  355
             LC++ Y+   + V  K  S V+C ++    PG LNYP+FS+ F  K++   +++R + N
Sbjct  634  FLCSLNYSAPHIQVITKT-SNVSCPKKF--RPGDLNYPSFSVVFNQKSKPVQRFRRELTN  690

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF-TNAQPARFLNSYGSIA  532
            VG    +VY VKV +P  V V+V+P KL F +    L Y +TF + A  +     +G I+
Sbjct  691  VGPAT-SVYNVKVISPESVAVTVTPAKLTFKKAGQKLRYHVTFASKAGQSHAKPDFGWIS  749

Query  533  WEDGVHIVKSPIA  571
            W +  H+V+SP+A
Sbjct  750  WVNDEHVVRSPVA  762



>ref|XP_004245414.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=768

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 124/193 (64%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQAT-GNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYV  178
            A KSA+MTTAYT DN  ++  D A  G  SNPF HG+GHV+P +A  PGLVYD+ + D++
Sbjct  567  ATKSAIMTTAYTQDNTNSSFHDSALYGTFSNPFAHGSGHVNPQKAFSPGLVYDIRIQDHI  626

Query  179  ALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLY--KNQVKYKRSVK  352
              LC++ Y +D++   V+  +   C+++     G +NYP+FS+ F    K  V+Y R V 
Sbjct  627  KFLCSLNYTIDQIQSIVRRLN-FTCAKK-FADVGQINYPSFSVLFEINSKRVVRYTREVT  684

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIA  532
            NVG+   +VYEV ++AP  V V+V PTKLVF +  + L Y +TF + +  +  N++G I+
Sbjct  685  NVGAAS-SVYEVAIDAPPSVTVTVKPTKLVFKKVGEKLHYTVTFVSMKDVKPGNAFGWIS  743

Query  533  WEDGVHIVKSPIA  571
            W++  H V+SP+A
Sbjct  744  WKNAKHEVRSPVA  756



>ref|XP_010931682.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=794

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 120/199 (60%), Gaps = 12/199 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SA+MTTAYT DN G +++D+ TGN+S  + + +GHVDP +A+DPGLVYDL V DY+ 
Sbjct  594  AIRSAMMTTAYTTDNMGQDMVDERTGNRSTEWAYSSGHVDPEKAVDPGLVYDLTVDDYLD  653

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKY----KRSV  349
             LC+  Y+   + +  + P  VNCS + +G P  LNYP+ ++     N  K     +R+V
Sbjct  654  FLCSSNYSSATIGMIARRP--VNCSNK-IGRPWDLNYPSIAVVLEGSNTRKLEAVVRRTV  710

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEI-TFTNAQ---PARFLNS  517
            +NVG EK A Y V +  P GV++ V P KLVF        + +  FT  +   P      
Sbjct  711  RNVGEEK-AEYSVGIKEPEGVRLVVEPRKLVFRGKGQKQEFAVKVFTEPKKLLPWNSWTE  769

Query  518  YGSIAWEDGVHIVKSPIAV  574
            +GS+ W DG H V+SPIAV
Sbjct  770  FGSVTWSDGKHTVRSPIAV  788



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 122/194 (63%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQS--NPFIHGAGHVDPNRALDPGLVYDLGVSDY  175
            AIKSALMTTAYT DN  + L D ATG +S   P+ +GAGHV+P +AL PGL+YD    DY
Sbjct  556  AIKSALMTTAYTYDNTESPLRD-ATGEESLSTPWAYGAGHVNPQKALSPGLLYDASTQDY  614

Query  176  VALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKN  355
            +  LC++ Y +D L + VK P   NCS++    PG LNYP+FS+ F     V+Y R++ N
Sbjct  615  IYFLCSLNYTLDHLRLLVKHPD-ANCSKK-FADPGDLNYPSFSVVFGSNKVVRYTRTLTN  672

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPA--RFLNSYGSI  529
            VG E  + Y+V V+AP  V ++V+P KL F E  +  +Y +TF + +       + +GSI
Sbjct  673  VG-EPGSAYDVAVSAPSTVDITVNPNKLEFGEVGERQTYTVTFVSNRSVNDSATSGFGSI  731

Query  530  AWEDGVHIVKSPIA  571
             W +  H V+SP+A
Sbjct  732  MWSNEQHQVRSPVA  745



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 115/194 (59%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKS+LMTTAY  DN  N L D +TG  SNPF HGAGH++P +ALDPGL+YD+GV DY  
Sbjct  587  AIKSSLMTTAYIHDNTRNPLKDASTGKPSNPFGHGAGHLNPLKALDPGLIYDMGVQDYFE  646

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVK---YKRSVK  352
             LCT      +L VF K  S  +C    L  PG LNYPA S  F  ++ +      R+V 
Sbjct  647  FLCTQKLTPMQLKVFTKS-SNRSC-HHTLANPGDLNYPAISAVFPEQHSISLLTLHRTVT  704

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIA  532
            NVGS   + Y  +V+   G  VSV P  L F      L+Y+ITFT  +  + +  +G++ 
Sbjct  705  NVGSPV-STYHARVSQFKGASVSVEPKTLQFTSKHRKLAYKITFTT-KSRQSMPEFGNLI  762

Query  533  WEDGVHIVKSPIAV  574
            W DG+H V+SPI +
Sbjct  763  WSDGIHKVRSPIVI  776



>ref|XP_006648004.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=813

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 112/195 (57%), Gaps = 16/195 (8%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            I SALMTTAY  DNAG+ + D ATG  + PF  GAGHVDPN ALDPGLVYD G  DY+  
Sbjct  618  IMSALMTTAYGTDNAGDEIGDMATGKAAGPFELGAGHVDPNSALDPGLVYDAGEDDYIDF  677

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LYKNQVKYKRSVKNVG  361
            +C+I           K  S  NCS +   T   LN P+FS+ F  Y   +  +R+V+NVG
Sbjct  678  MCSI-----------KASSPYNCSTRVSITGAELNRPSFSVKFKAYGENITLQRTVRNVG  726

Query  362  SEKRAVYEV--KVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GSI  529
            S   AVY V  +   P G ++ +SP KLVF+      +Y I F +  P      Y  GSI
Sbjct  727  SNVDAVYTVGKRTGFPPGTRLIISPGKLVFDAEHQTRTYTIVFQSTLPPGNFTEYTHGSI  786

Query  530  AWEDGVHIVKSPIAV  574
             W DGVH V+SPIAV
Sbjct  787  VWSDGVHNVRSPIAV  801



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 121/192 (63%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  D   + L D      S P+ HGAGHVDP++AL PGLVYD+   +Y+ 
Sbjct  571  AIKSALMTTAYNRDTTNSPLRDAEGDQLSTPWAHGAGHVDPHKALSPGLVYDIRPEEYIK  630

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y MD +   VK P+ V C+++    PG +NYP+F++ F     V+Y R++ NVG
Sbjct  631  FLCSLDYEMDHIQAIVKRPN-VTCAKK-FSDPGQINYPSFAVLFGKSRVVRYTRTLTNVG  688

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   + YEV ++AP  V V+V P+KLVF    + L Y +TF + +    ++  ++GSI+W
Sbjct  689  AAG-STYEVVIDAPPSVTVTVKPSKLVFKRVGERLRYTVTFVSKKGVSTMSKTTFGSISW  747

Query  536  EDGVHIVKSPIA  571
             +  + V+SP++
Sbjct  748  NNAQNQVRSPVS  759



>gb|EMS67351.1| Subtilisin-like protease [Triticum urartu]
Length=704

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 107/193 (55%), Gaps = 8/193 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTA  +D+AG  +   +TG  S PF  GAGH+DPN A+DPGLVYD G  DY+ 
Sbjct  490  AIKSALMTTAQNVDSAGGLIGAMSTGEASTPFARGAGHIDPNSAVDPGLVYDAGTEDYIT  549

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFL---YKNQVKYKRSVK  352
             LC + Y   +++VF    S+ +CS +   + G  NYPAFS+       K  V  +R V+
Sbjct  550  FLCALGYTAKQVAVF---GSSTSCSTRAGSSVGDHNYPAFSVVITSNKKKAAVTQRRVVR  606

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSY--GS  526
            NVG +    Y  K+ AP GV V+VSP  L F+ T     Y +TF           Y  GS
Sbjct  607  NVGGDATTTYRAKITAPDGVLVTVSPETLRFSATQKTQGYAVTFAREIGGSVTGKYTFGS  666

Query  527  IAWEDGVHIVKSP  565
            I W DG H V  P
Sbjct  667  IEWSDGEHTVSFP  679



>dbj|BAJ97849.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=669

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 116/195 (59%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +D+ G  + D +TG  S PF  GAGH+DP+RA++PG VYD G  DYV 
Sbjct  468  AIKSALMTTAYNVDSTGGVIGDMSTGAASTPFARGAGHIDPHRAVNPGFVYDAGTEDYVG  527

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVK--YKRSVKN  355
             LC + Y  ++++VF    S+ NCS + + + G  NYPAFS+ F          +R V+N
Sbjct  528  FLCALGYTAEQVAVF---GSSANCSVRAVSSVGDHNYPAFSVVFTADKTAAVRQRRVVRN  584

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSI  529
            VG + RA Y  KV AP GV+V+V+P  L F+       Y +TF           +++GSI
Sbjct  585  VGGDARATYRAKVTAPDGVRVTVTPRTLRFSARRRTRKYVVTFARRSFGSVTKNHTFGSI  644

Query  530  AWEDGVHIVKSPIAV  574
             W D  H V SPIA+
Sbjct  645  EWTDRKHSVTSPIAI  659



>ref|XP_004956934.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=773

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 115/195 (59%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  + L+D AT   + P+  GAGHVDP RAL PGLVYD  V DYVA
Sbjct  576  AIKSALMTTAYTVDNTDSPLLDAATNATATPWAFGAGHVDPVRALSPGLVYDATVDDYVA  635

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ---VKYKRSVK  352
             LCT+  +  ++         V C+ + L +PG LNYP+FS+ F  ++    VKY+R + 
Sbjct  636  FLCTVGVSPRQVQAVAAAGPNVTCTRK-LSSPGDLNYPSFSVVFGRRSSRSTVKYRRELT  694

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGS  526
            NVG +  A Y VKV  P  V VSV P  L F    D L Y +TF +      ++  ++G 
Sbjct  695  NVG-DTGATYTVKVTGPSDVGVSVKPAMLQFRRPGDKLRYTVTFRSKSAKGPMDPAAFGW  753

Query  527  IAWEDGVHIVKSPIA  571
            + W    H V+SPI+
Sbjct  754  LTWSSDEHEVRSPIS  768



>ref|XP_006662325.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=535

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 117/194 (60%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  ++L D A G  +NPF  GAGHVDP +AL PGLVYD+   DYV+
Sbjct  341  AIKSALMTTAYTVDNTNSSLRDAAGGLLANPFAFGAGHVDPQKALSPGLVYDISTKDYVS  400

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLY--KNQVKYKRSVKN  355
             LC++ Y+   + V  K  S + C  +    PG LNYP+FS+ F    ++ ++++R V N
Sbjct  401  FLCSLNYSTPHIQVITKM-SNITCPRKF--RPGDLNYPSFSVVFKKNSRHVMRFRREVTN  457

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNA--QPARFLNSYGSI  529
            VG    +VY VKV +P  V V V+P+++VFN       Y +TF             +G I
Sbjct  458  VG-PAMSVYNVKVTSPASVSVKVTPSRIVFNRVGQKQRYYVTFAAKVDDTGSVKPDFGWI  516

Query  530  AWEDGVHIVKSPIA  571
            +W    H+V+SP+A
Sbjct  517  SWLSNEHVVRSPVA  530



>ref|XP_004507999.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=753

 Score =   156 bits (394),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 118/193 (61%), Gaps = 5/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN  + L D      S P+ +G+GHV P +AL PGL+YD    DY+A
Sbjct  557  AIKSALMTTAYTRDNTESPLRDATGEALSIPWAYGSGHVSPQKALSPGLLYDTDTQDYIA  616

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y +D + + VK    VNCS+     PG LNYP+FS+ F   + V+Y R + NVG
Sbjct  617  FLCSLNYTLDHVQLIVKR-HDVNCSKYYFADPGDLNYPSFSVVFGNNSVVQYTRRLTNVG  675

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPA---RFLNSYGSIA  532
             E ++VY+V V+ P  V ++V PT+LVF +  +  +Y +TF + +          +GSI 
Sbjct  676  -EAKSVYDVVVSGPSTVGITVKPTRLVFEQVGERQTYTVTFISNKDTVDDSVTYEFGSIT  734

Query  533  WEDGVHIVKSPIA  571
            W +  H V+SP+A
Sbjct  735  WSNKRHQVRSPVA  747



>ref|XP_002519362.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42979.1| conserved hypothetical protein [Ricinus communis]
Length=208

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 113/194 (58%), Gaps = 17/194 (9%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A++SALMTTAYT+D+    L D  T   SNP+ +G+GHVDP RAL PGLVYD+   DYV 
Sbjct  24   ALRSALMTTAYTVDSTNTPLQDAVTAKFSNPWAYGSGHVDPKRALSPGLVYDISPQDYVT  83

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK-NQVKYKRSVKNV  358
             LC++ Y+++           + C  +     G LNYP+FS+ F  K   V+Y R + NV
Sbjct  84   FLCSLNYDLN-----------LTC-PRKFSDLGELNYPSFSVLFGKKTTAVRYSRELTNV  131

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT---NAQPARFLNSYGSI  529
            G+  RA Y V V AP  V V+V+P KLVF +  + L Y  TF    NA+      ++GSI
Sbjct  132  GTA-RATYRVAVTAPSEVAVTVAPAKLVFKKVGEKLRYTATFAAKRNAKKPAGGAAFGSI  190

Query  530  AWEDGVHIVKSPIA  571
             W +  + V SP+A
Sbjct  191  VWSNAKYKVSSPVA  204



>ref|XP_003533787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 115/192 (60%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTA   DN  + L D A G  SNP+ HGAGHV+P++AL PGLVYD   SDY+ 
Sbjct  576  AIKSALMTTADVHDNTKSQLRDAAGGAFSNPWAHGAGHVNPHKALSPGLVYDATPSDYIK  635

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y  + + +  K  S VNC+++    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  636  FLCSLEYTPERIQLITKR-SGVNCTKR-FSDPGQLNYPSFSVLFGGKRVVRYTRVLTNVG  693

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT--NAQPARFLNSYGSIAW  535
             E  +VY V V+AP  V V+V P  LVF +  +   Y  TF   N         +GSI W
Sbjct  694  -EAGSVYNVTVDAPSTVTVTVKPAALVFGKVGERQRYTATFVSKNGVGDSVRYGFGSIMW  752

Query  536  EDGVHIVKSPIA  571
             +  H V+SP+A
Sbjct  753  SNAQHQVRSPVA  764



>ref|XP_010919193.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=784

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 112/193 (58%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN    L D ATG  SNP+ HGAGH+ P +A+DPGL+YD+   DY  
Sbjct  590  AIKSALMTTAYTHDNTFRPLKDAATGAPSNPYDHGAGHIRPAKAVDPGLIYDISPDDYFE  649

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ--VKYKRSVKN  355
             LCT      +L VF K  S+    +Q L +PG LNYPA S  F  +    +   R+V N
Sbjct  650  FLCTQKLTPSQLKVFTK--SSNRTCKQRLASPGDLNYPAISAVFREQPAPVLTLHRTVTN  707

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAW  535
            VG    + Y VKV    GV V+V P  L F      LSY++TF    P + +   G++ W
Sbjct  708  VGPPV-STYHVKVTPFRGVDVAVEPKTLHFTHQNQKLSYKVTFRTKSP-QPIPDLGALIW  765

Query  536  EDGVHIVKSPIAV  574
             DG+H+V+SP+ +
Sbjct  766  SDGIHLVRSPVVI  778



>dbj|BAJ87169.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 116/195 (59%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +D+ G  + D +TG  S PF  GAGH+DP+RA++PG VYD G  DYV 
Sbjct  582  AIKSALMTTAYNVDSTGGVIGDMSTGAASTPFARGAGHIDPHRAVNPGFVYDAGTEDYVG  641

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVK--YKRSVKN  355
             LC + Y  ++++VF    S+ NCS + + + G  NYPAFS+ F          +R V+N
Sbjct  642  FLCALGYTAEQVAVF---GSSANCSVRAVSSVGDHNYPAFSVVFTADKTAAVRQRRVVRN  698

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGSI  529
            VG + RA Y  KV AP GV+V+V+P  L F+       Y +TF           +++GSI
Sbjct  699  VGGDARATYRAKVTAPDGVRVTVTPRTLRFSARRRTRKYVVTFARRSFGSVTKNHTFGSI  758

Query  530  AWEDGVHIVKSPIAV  574
             W D  H V SPIA+
Sbjct  759  EWTDRKHSVTSPIAI  773



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 122/192 (64%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  D   + L D      S P+ HGAGHVDP++AL PGLVYD+   +Y+ 
Sbjct  566  AIKSALMTTAYNRDTTNSPLRDAEGDQLSTPWAHGAGHVDPHKALSPGLVYDIRPKEYIK  625

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y M+ +   VK P+ V C+++    PG +NYP+F++ F     V+Y R++ NVG
Sbjct  626  FLCSLDYEMEHIQAIVKRPN-VTCAKK-FSDPGQINYPSFAVLFGKSRVVRYTRTLTNVG  683

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGSIAW  535
            +   + YEV ++AP  V V+V P+KLVF +  + L Y +TF + +    ++  ++GSI+W
Sbjct  684  AAG-STYEVVIDAPPSVTVTVKPSKLVFKKVGERLRYTVTFVSKKGVSTMSKTTFGSISW  742

Query  536  EDGVHIVKSPIA  571
             +  + V+SP++
Sbjct  743  NNAQNQVRSPVS  754



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 119/196 (61%), Gaps = 9/196 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN  + L D A G  SNP+ HG+GHVDP +AL PGLVYD    DY+A
Sbjct  575  AIKSALMTTAYTRDNTKSPLRDAAGGAISNPWAHGSGHVDPQKALSPGLVYDATPEDYIA  634

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ-VKYKRSVKNV  358
             LC++ Y++ ++ +  K P+ + CS +    PG LNYP+FS+ F  + + V+Y R + NV
Sbjct  635  FLCSLDYSIAQIQMITKRPN-ITCSRR-FADPGHLNYPSFSVLFSAETRMVRYTRELTNV  692

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPAR-----FLNSYG  523
            G    +VY+V V+ P  V ++V P +LVF E  +   Y + F   +           ++G
Sbjct  693  GPAG-SVYDVSVSGPASVGITVKPRRLVFREVGEKQKYSVMFVARKEGTGGRRVGTTAFG  751

Query  524  SIAWEDGVHIVKSPIA  571
             ++W +  H V+SPI+
Sbjct  752  WLSWSNAQHQVRSPIS  767



>ref|XP_002460273.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
 gb|EER96794.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
Length=774

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 114/195 (58%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  + L+D AT   + P+  GAGHVDP  AL PGLVYD  V DYVA
Sbjct  577  AIKSALMTTAYTVDNTESPLLDAATNATATPWAFGAGHVDPVSALSPGLVYDASVDDYVA  636

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ---VKYKRSVK  352
             LC +     ++         V C+ + L +PG LNYP+FS+ F  ++    VKY+R + 
Sbjct  637  FLCAVGVAPRQIQAITAAGPNVTCTRK-LSSPGDLNYPSFSVVFGRRSSRSTVKYRRELT  695

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGS  526
            NVG+     Y VKV  P  + VSV P +L F    D L Y +TF +A     ++  ++G 
Sbjct  696  NVGNAGD-TYTVKVTGPSDISVSVKPARLQFRRAGDKLRYTVTFRSANARGPMDPAAFGW  754

Query  527  IAWEDGVHIVKSPIA  571
            + W    H+V+SPI+
Sbjct  755  LTWSSDEHVVRSPIS  769



>emb|CDO96926.1| unnamed protein product [Coffea canephora]
Length=775

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 119/199 (60%), Gaps = 12/199 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SA+MTTA TIDN  + +ID+ATG  S P+ +GAGHV+   A+DPGLVYDL  SDYV 
Sbjct  575  AIRSAMMTTATTIDNNFHPMIDEATGKPSTPYDYGAGHVNLGLAMDPGLVYDLTNSDYVN  634

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK----NQVKYKRSV  349
             LC I Y    + V  + P  VNC  +    P +LNYP+ +  F       +   + R+V
Sbjct  635  FLCAIEYGPKTIQVITRSP--VNCPARKP-LPENLNYPSIAAPFSSASTGVSSKTFFRTV  691

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS----  517
             NVG E  AVY VKV AP GV V+V P+KLVF E    LSY +T T       +      
Sbjct  692  TNVG-EANAVYSVKVEAPKGVGVAVKPSKLVFTEKVRKLSYFVTVTADSKNLVIGDSGAV  750

Query  518  YGSIAWEDGVHIVKSPIAV  574
            +GS++W DG H+V+SPI V
Sbjct  751  FGSLSWVDGKHVVRSPIVV  769



>ref|XP_010111995.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32306.1| Subtilisin-like protease [Morus notabilis]
Length=733

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 107/154 (69%), Gaps = 7/154 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN+G ++ D ATG +S PF+HG+GHVDPNRAL+PGL+YD+GVSDYV 
Sbjct  577  AIKSALMTTAYDLDNSGQSIKDLATGKKSTPFVHGSGHVDPNRALNPGLIYDMGVSDYVG  636

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQ---NLG---TPGSLNYPAFSLDFLYKNQ-VKYK  340
             LC+I Y+ +++SVF +     +  E+   +LG   TPG LN P+FS+ F  + + VKY+
Sbjct  637  FLCSIGYDSEQISVFFRKLVRSDICEKTYDHLGARVTPGDLNLPSFSVVFDNEGETVKYR  696

Query  341  RSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLV  442
            R+V NVGS   AVY V   AP G   S + T  V
Sbjct  697  RTVTNVGSNVDAVYVVSGEAPAGFSWSATATDSV  730



>gb|AGT17100.1| serine protease [Saccharum hybrid cultivar R570]
Length=750

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 114/195 (58%), Gaps = 7/195 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN  + L+D AT   + P+  GAGHVDP  AL PGLVYD  V DYVA
Sbjct  547  AIKSALMTTAYTVDNTESPLLDAATNATATPWAFGAGHVDPVSALSPGLVYDNSVDDYVA  606

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ---VKYKRSVK  352
             LCT+     ++         V C+ + L +PG LNYP+FS+ F  ++    VKY+R + 
Sbjct  607  FLCTVGVAPRQIQAITAAGPNVTCTRK-LSSPGDLNYPSFSVVFGQRSSRSTVKYRRELT  665

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--SYGS  526
            NVG+     Y VKV  P  + VSV P +L F    D L Y +TF +A     ++  ++G 
Sbjct  666  NVGNAGD-TYTVKVTGPSDISVSVKPARLQFRRAGDKLRYTVTFRSANARGRMDPAAFGW  724

Query  527  IAWEDGVHIVKSPIA  571
            + W    H V+SPI+
Sbjct  725  LTWSSDEHDVRSPIS  739



>gb|KHN06066.1| Subtilisin-like protease [Glycine soja]
Length=598

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 118/194 (61%), Gaps = 9/194 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN    L D A G  SNP+ HGA H++P++AL PGLVYD    DYV 
Sbjct  404  AIKSALMTTAYVHDNTKFPLRDAAGGAFSNPWAHGACHMNPHKALSPGLVYDAIAWDYVK  463

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y  + + +  K    VNC+++    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  464  FLCSLEYTPEHIQLITKR-HGVNCTKK-FSDPGQLNYPSFSILFGGKRVVRYTRVLINVG  521

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQ----PARFLNSYGSI  529
             E  ++Y V V+AP  + + V PT+LVF +  +   Y +TF + +     AR+   +GSI
Sbjct  522  -ETGSIYNVTVDAPSTMTIKVKPTRLVFEKVGERQRYTVTFVSKRGVGDSARY--GFGSI  578

Query  530  AWEDGVHIVKSPIA  571
             W +  H V+SP+A
Sbjct  579  MWSNAQHQVRSPVA  592



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 124/194 (64%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQ--SNPFIHGAGHVDPNRALDPGLVYDLGVSDY  175
            AIKSALMTTAYT DN  + L D ATG +  S P+ +GAGHV+P +AL PGLVYD    DY
Sbjct  566  AIKSALMTTAYTHDNTESPLRD-ATGEEALSTPWAYGAGHVNPQKALSPGLVYDASTQDY  624

Query  176  VALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKN  355
            +A LC++ Y +D L + VK  S  NCS +    PG LNYP+FS+ F     V+Y R++ N
Sbjct  625  IAFLCSLNYTLDHLRLVVKH-SDANCSTK-FADPGDLNYPSFSVVFGSNKVVQYTRTLTN  682

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPA--RFLNSYGSI  529
            VG +  +VY+V V+ P  V+++V+P ++ F E  +  +Y++TF + +       + +GSI
Sbjct  683  VG-KAASVYDVVVSTPSTVEITVNPNRVSFAEVGECQTYKVTFVSNRSVSDSVASEFGSI  741

Query  530  AWEDGVHIVKSPIA  571
             W +  H V+SP+A
Sbjct  742  MWSNEEHEVRSPVA  755



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 117/196 (60%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DNA + L D A  + S P+ HGAGHVDP++AL PGLVYD    DYV+
Sbjct  569  AIKSALMTTAYTVDNANSPLRDAADYSLSTPWAHGAGHVDPHKALSPGLVYDATPDDYVS  628

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ----VKYKRSV  349
             LC++ Y  D + +  + P+    S +    PG LNYP+FS+ F    +    V+Y R +
Sbjct  629  FLCSLDYTDDAVQLIARRPNATCSSSRRFRDPGQLNYPSFSVVFGGGKKNSRVVRYTREL  688

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARF--LNSYG  523
             NVG    A Y  ++  P  V  +V P+KLVF    + L Y +TF + +   +   + +G
Sbjct  689  TNVGPAGSA-YVAELEVPPTVGATVKPSKLVFGNVGEKLRYTVTFVSKKDVDYSLTSGFG  747

Query  524  SIAWEDGVHIVKSPIA  571
            SI W++  H V+SP++
Sbjct  748  SITWKNAQHQVRSPVS  763



>ref|XP_007051969.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX96126.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=773

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 120/196 (61%), Gaps = 10/196 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN G  ++D A+G+ + PF  G+GH DP RA DPGL+YD+   DY+ 
Sbjct  575  AIKSALMTTAYVADNKGTPILDVASGSSATPFGLGSGHADPERASDPGLIYDISPKDYIY  634

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKN----QVKYKRSV  349
             LC++ Y   ++S FV +     C +  +  PG LNYP+F ++F         + Y R+V
Sbjct  635  YLCSLKYTDSQISGFVYN---FTCPKDAIMQPGDLNYPSFVVNFKSSAAENITLTYHRTV  691

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYG  523
             NVG+ K + Y+V V  P GV V V+P  L FN   + LSY++TFT  +  + +  +S+G
Sbjct  692  TNVGTPK-STYDVLVEEPEGVSVVVTPKVLTFNMLGEKLSYKVTFTGLKRTKPVAASSFG  750

Query  524  SIAWEDGVHIVKSPIA  571
            S+ W  G + V+SPIA
Sbjct  751  SLVWVSGNYRVRSPIA  766



>ref|XP_004308418.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=743

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 122/198 (62%), Gaps = 7/198 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQ--SNPFIHGAGHVDPNRALDPGLVYDLGVSDY  175
            AIKSALMTTAYT++N G+ + D  + N   +NPF  G+GH DP  A DPGL+YD+  +DY
Sbjct  545  AIKSALMTTAYTLNNKGSPISDFGSNNSQPANPFAFGSGHADPESAADPGLIYDITTNDY  604

Query  176  VALLCTIAYNMDELSVFVKDPSTVNC-SEQNLGTPGSLNYPAFSLDFL---YKNQVKYKR  343
            +  LC++ Y   ++++F    S   C S   +  PG+LNYP+ S+ F     K    Y R
Sbjct  605  LLYLCSLNYTSPQIALFSSGISNFTCPSNSTVLQPGNLNYPSLSVVFRRDGRKMSATYTR  664

Query  344  SVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYG  523
            +V NVG+   + Y V+V AP+GV V+V P KLVF +  + LSY+++F     A   +S+G
Sbjct  665  TVTNVGAINPSTYAVQVEAPIGVSVTVEPRKLVFKKMGEKLSYKVSFVGMS-ATTNSSFG  723

Query  524  SIAWEDGVHIVKSPIAVL  577
            S+ W    + V+SPIAV+
Sbjct  724  SLVWVSEKYRVRSPIAVI  741



>gb|KHG02130.1| Subtilisin-like protease [Gossypium arboreum]
 gb|KHG03377.1| Subtilisin-like protease [Gossypium arboreum]
Length=775

 Score =   154 bits (388),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 125/196 (64%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN G  + D A    + PF  G+GHVDP +A DPGL+Y++   DY++
Sbjct  580  AIKSALMTTAYTLDNKGKPIADLAFYTSAAPFAIGSGHVDPIKATDPGLIYNITAEDYIS  639

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ---VKYKRSVK  352
             LC++ Y+  ++S+F ++      +E+ +  PG LNYP+F+++F  K +     YKR+V 
Sbjct  640  YLCSLHYSDSQVSMF-EEGYQCTPTERRM-QPGDLNYPSFAVNFKQKARNVTFTYKRTVT  697

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFL--NSYGS  526
            NVG  K + Y+V V  P GV V VSP  L F E  + LSYE++FT     + +  +S+GS
Sbjct  698  NVGIPK-STYKVSVEVPKGVSVIVSPKVLSFTELNEELSYEVSFTGLSRNKTVAGSSFGS  756

Query  527  IAWEDGVHIVKSPIAV  574
            + W  G + V+SPIAV
Sbjct  757  LVWVSGNYRVRSPIAV  772



>ref|XP_008780099.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=813

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 112/193 (58%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN    L D ATG  S P+ HGAGH+ P +A+DPGL+YD+   DY  
Sbjct  619  AIKSALMTTAYTHDNTFRPLKDAATGAPSTPYDHGAGHIRPAKAVDPGLIYDISPDDYFE  678

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK--NQVKYKRSVKN  355
             LCT      +L VF K  S+    +  L +PG LNYPA S  F  +    +   R+V N
Sbjct  679  FLCTQKLTPLQLKVFSK--SSNRTCKHRLASPGDLNYPAISAVFREQPAPALTLHRTVTN  736

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAW  535
            VG    + Y V+V    GV V+V P  L F      LSY++TF    P + +  +G++ W
Sbjct  737  VGPPV-STYHVRVTPFRGVDVAVEPKTLHFTHQNQKLSYKVTFRTKSP-QPMPGFGALIW  794

Query  536  EDGVHIVKSPIAV  574
             DG+H+V+SP+AV
Sbjct  795  SDGIHLVRSPVAV  807



>gb|ACN35690.1| unknown [Zea mays]
Length=279

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 115/192 (60%), Gaps = 6/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATG-NQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYV  178
            A+KSAL+TTA   D  G  ++ +A   NQ+NPF +G GHVDPN A  PGLVYD+G SDYV
Sbjct  82   AVKSALVTTASVHDTYGFEIVSEAAPYNQANPFDYGGGHVDPNSAAHPGLVYDMGTSDYV  141

Query  179  ALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNV  358
              LC++ YN+  +S   +   T   + +   T  +LN P+ S+  L + ++   R+V NV
Sbjct  142  RFLCSMGYNVSAISSLAQQHETCQHTPK---TQLNLNLPSISIPEL-RGRLTVSRTVTNV  197

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            GS     Y  +V AP GV V+VSP+ L FN T   L++++TF      +    +GS+ WE
Sbjct  198  GSALTK-YRARVEAPPGVDVTVSPSLLTFNSTVRKLTFKVTFQAKLKVQGRYYFGSLTWE  256

Query  539  DGVHIVKSPIAV  574
            DGVH V+ P+ V
Sbjct  257  DGVHAVRIPLVV  268



>ref|XP_009767539.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=761

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 122/194 (63%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQAT-GNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYV  178
            AIKSA+MTTAY  DN  ++  D A  G  SNP  HG+GHV+P +AL PGLVYD+ + D++
Sbjct  564  AIKSAIMTTAYNQDNTNSSFRDSAEDGIFSNPLAHGSGHVNPQKALSPGLVYDIRIQDHI  623

Query  179  ALLCTIAYNMDELSVFVKDPSTVNCSEQN-LGTPGSLNYPAFSLDFLYKNQ--VKYKRSV  349
              LC++ Y MD++   VK    VN +  N     G +NYP+FS+ F   +   V+Y R V
Sbjct  624  KFLCSLDYPMDQIQAIVK---RVNFTCANKFADAGQINYPSFSVLFGINSTRVVRYTREV  680

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSI  529
             NVG+ + +VYEV ++AP  V  +V P KLVF +  + L Y +TF + +  +  N++G I
Sbjct  681  TNVGAAE-SVYEVAIDAPSSVTATVKPPKLVFKKVGEKLHYTVTFVSKKGVKTGNAFGWI  739

Query  530  AWEDGVHIVKSPIA  571
            +WE+  + V+SP+A
Sbjct  740  SWENAENQVRSPVA  753



>gb|EYU32830.1| hypothetical protein MIMGU_mgv1a020631mg, partial [Erythranthe 
guttata]
Length=752

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 118/193 (61%), Gaps = 4/193 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SALMTTAY  D  G+ ++ Q +   S+PF  GAGH++P  A DPGLVYD+   DY+ 
Sbjct  542  AIRSALMTTAYNKDINGDGILVQGSTKSSDPFDIGAGHINPLGAFDPGLVYDMTTRDYIL  601

Query  182  LLCTIAYNMDELSVFVKDP--STVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKN  355
             LC   Y+ D++   V  P  +   C ++ L    S+NYP+ ++  L K     KR+V+N
Sbjct  602  FLCNRGYSEDQIQTMVICPLATPARCPDR-LEPDSSINYPSITVSNL-KCTKTVKRTVRN  659

Query  356  VGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAW  535
            VG  K AVY V V +P GV+V+V PT L+F+   + L+Y +TF   + AR    +GSI W
Sbjct  660  VGPAKTAVYFVSVVSPNGVEVAVWPTILIFSPLKEELTYYVTFKPVKVARGRYEFGSITW  719

Query  536  EDGVHIVKSPIAV  574
             DGVH V+SP+ V
Sbjct  720  SDGVHHVRSPMVV  732



>gb|ACN28035.1| unknown [Zea mays]
Length=380

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 108/198 (55%), Gaps = 9/198 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            A++SALMTTAY   + G++L+D ATG  + PF +GAGHVDP RALDPGLVYDLG  DYV 
Sbjct  180  AVRSALMTTAYASYSGGSSLLDAATGGMATPFDYGAGHVDPARALDPGLVYDLGTRDYVD  239

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKN--------QVKY  337
             LC + Y+   ++   +      C+E    + G+LNYP+FS+ +   N         V +
Sbjct  240  FLCALKYSSTMIAAVARS-REYACAENKTYSVGALNYPSFSVAYSTANGDGGGDSATVTH  298

Query  338  KRSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS  517
             R++ NVG          + A  GV V V P +L F    +  SY + FT+         
Sbjct  299  TRTLTNVGGAGTYKASTSLAAAKGVAVDVEPAELEFTSVGEKKSYTVRFTSKSQPSGTAG  358

Query  518  YGSIAWEDGVHIVKSPIA  571
            +G + W DG H V SPIA
Sbjct  359  FGRLVWSDGKHSVASPIA  376



>ref|XP_006857965.1| hypothetical protein AMTR_s00069p00175260 [Amborella trichopoda]
 gb|ERN19432.1| hypothetical protein AMTR_s00069p00175260 [Amborella trichopoda]
Length=770

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 112/196 (57%), Gaps = 7/196 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT DN G  + D     Q+ PF  G+GHV+P RA +PGLVYD+   DY+ 
Sbjct  576  AIKSALMTTAYTFDNKGKPITDMGKKAQATPFAFGSGHVNPERATNPGLVYDISTDDYLN  635

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF----LYKNQVKYKRSV  349
             LC++ Y+  ++++      T  C  Q    PG LNYP+FSLDF       + V Y R V
Sbjct  636  YLCSLNYSSSQMAIMAGQSYT--CPTQKALLPGDLNYPSFSLDFSNGGFNNSSVTYSRVV  693

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSI  529
             NVG++  + YE +V AP GV V V P  L F +  +  SY++TF          S+G +
Sbjct  694  TNVGTQG-SKYEARVVAPEGVVVKVDPLVLAFGKKGEKNSYKVTFMVVSSKTKGASFGEL  752

Query  530  AWEDGVHIVKSPIAVL  577
             W    + V+SPIAVL
Sbjct  753  VWVSNGYSVRSPIAVL  768



>ref|XP_008238402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 117/201 (58%), Gaps = 13/201 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SALMTTAYT    G  L D ATG  S PF HGAGHVDP  AL+PGLVYDL V DY+ 
Sbjct  576  AIRSALMTTAYTAYKNGQKLQDVATGKPSTPFDHGAGHVDPISALNPGLVYDLTVDDYLN  635

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK--------NQVKY  337
             LC + Y+  E++   K   T  C E+   +   LNYP+F+++F  +        N VKY
Sbjct  636  FLCALNYSASEINSLAKRSYT--CDEKKKYSVRDLNYPSFAVNFESRYGGGTTSSNVVKY  693

Query  338  KRSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFT--NAQPARFL  511
             R++ NVG        V   + L V++SV P  L F++  +   Y +TF+   + PA  +
Sbjct  694  TRTLTNVGPPGTYKASVTSESQL-VKISVEPETLSFSQANEKKVYTVTFSAVGSVPANAV  752

Query  512  NSYGSIAWEDGVHIVKSPIAV  574
            NS+G + W DG HIV SPIA+
Sbjct  753  NSFGRVEWSDGKHIVGSPIAI  773



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 122/192 (64%), Gaps = 6/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGN-QSNPFIHGAGHVDPNRALDPGLVYDLGVSDYV  178
            AIKSAL+TTA T D  G + + + + + Q++PF +G GHVDPN+A DPGL+YD+G++D+V
Sbjct  577  AIKSALVTTASTKDKYGQSAVAEGSPHKQADPFDYGGGHVDPNKAADPGLIYDMGITDHV  636

Query  179  ALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNV  358
              LC + YN   +S+  + P+  + + ++L     LN P+ S+  L K  +   R+V NV
Sbjct  637  RFLCLMGYNDSSVSLMTRHPTVCSKTSKSL---ADLNLPSISIPEL-KKSLAVSRTVTNV  692

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            G    +VY V V AP GV V V+P+ L FN T   L +++TF +    +   S+GS++WE
Sbjct  693  G-PVNSVYSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTFQSQLSVQGRYSFGSLSWE  751

Query  539  DGVHIVKSPIAV  574
            DG+H+V+ P+ V
Sbjct  752  DGIHVVRIPLIV  763



>ref|XP_010109072.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20872.1| Subtilisin-like protease [Morus notabilis]
Length=770

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 115/194 (59%), Gaps = 7/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY  DN  N L D +T   SNP+ HGAGHV+P +ALDPGLVYD+   DY  
Sbjct  575  AIKSALMTTAYVHDNTLNPLKDASTAVPSNPYDHGAGHVNPRKALDPGLVYDIRPQDYYE  634

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQV---KYKRSVK  352
             LCT +    +L VF K  +   C + +L  PG LNYPA S+ F  K  V     +R+V 
Sbjct  635  FLCTQSLTPTQLKVFSKY-ANRTC-KHSLAGPGELNYPAISVVFPEKASVSVISVRRTVT  692

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIA  532
            NVG    + Y V V+   G  V V P  L FN+    LSY++TFT  +  +    +G + 
Sbjct  693  NVGPPV-SNYHVSVSPFRGASVKVEPKSLSFNKAGQKLSYKVTFTT-KSLQTAPEFGDLV  750

Query  533  WEDGVHIVKSPIAV  574
            W+DGVH V+SPIA+
Sbjct  751  WKDGVHKVRSPIAI  764



>ref|XP_010271498.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 122/192 (64%), Gaps = 6/192 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGN-QSNPFIHGAGHVDPNRALDPGLVYDLGVSDYV  178
            AIKSAL+TTA T D  G + + + + + Q++PF +G GHVDPN+A DPGL+YD+G++D+V
Sbjct  580  AIKSALVTTASTKDKYGQSAVAEGSPHKQADPFDYGGGHVDPNKAADPGLIYDMGITDHV  639

Query  179  ALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNV  358
              LC + YN   +S+  + P+  + + ++L     LN P+ S+  L K  +   R+V NV
Sbjct  640  RFLCLMGYNDSSVSLMTRHPTVCSKTSKSL---ADLNLPSISIPEL-KKSLAVSRTVTNV  695

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            G    +VY V V AP GV V V+P+ L FN T   L +++TF +    +   S+GS++WE
Sbjct  696  G-PVNSVYSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTFQSQLSVQGRYSFGSLSWE  754

Query  539  DGVHIVKSPIAV  574
            DG+H+V+ P+ V
Sbjct  755  DGIHVVRIPLIV  766



>ref|XP_008232840.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008232841.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=765

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 123/200 (62%), Gaps = 13/200 (7%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLID---QATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSD  172
            AIKSALMTTAYT++N G  + D    +T   + PF  G+GHVDP  A DPGLVYD+   D
Sbjct  567  AIKSALMTTAYTLNNKGAPIADIGSTSTSKSATPFAFGSGHVDPENAADPGLVYDITAED  626

Query  173  YVALLCTIAYNMDELSVFVKDPSTVN--CSEQNLGTPGSLNYPAFSLDFLYKNQ---VKY  337
            Y+  LC+++YN  ++++F    S VN  C +  +  PG LNYP+FS+ F    +   V Y
Sbjct  627  YLFYLCSLSYNSSQIALF---SSGVNFTCPKNAVLQPGDLNYPSFSVLFSKDARNMSVTY  683

Query  338  KRSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN-AQPARFLN  514
            KR+VKNVG +  + Y V+V  P GV V+V P  L F +  + LSY+++F     PA   +
Sbjct  684  KRTVKNVG-KIPSTYAVQVKEPTGVSVTVEPRSLGFKKMGEKLSYKVSFVALGGPALTNS  742

Query  515  SYGSIAWEDGVHIVKSPIAV  574
            S+G++ W  G + V SPIAV
Sbjct  743  SFGTLTWVSGKYRVGSPIAV  762



>ref|XP_009112378.1| PREDICTED: subtilisin-like protease, partial [Brassica rapa]
Length=619

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 116/194 (60%), Gaps = 8/194 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SALMTTAY     GN +ID ATG  S PF HGAGHV P  A++PGL+YDL  +DY+ 
Sbjct  428  AIRSALMTTAYNTYKDGNPIIDIATGIPSTPFEHGAGHVSPTTAVNPGLIYDLTTADYLG  487

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC + YN   + +  +   T  C      +   LNYP+F+++    +  KY R+V NVG
Sbjct  488  FLCALKYNSSLIRIISRGNYT--CDPSKTYSVADLNYPSFAVNVDGSSTYKYTRTVTNVG  545

Query  362  SEKRAVYEVKVNAP-LGVQVSVSPTKLVFNETTDMLSYEITFT--NAQPARFLNSYGSIA  532
                  Y VKV +    V++SV P  L F E  +  SYE+TFT  +++P+   NS+GSI 
Sbjct  546  GA--GSYSVKVTSETTAVKISVEPAILNFKEVNEKKSYEVTFTVDSSKPSG-SNSFGSIE  602

Query  533  WEDGVHIVKSPIAV  574
            W DG H+V SP+A+
Sbjct  603  WSDGKHVVASPVAI  616



>ref|XP_008454764.1| PREDICTED: subtilisin-like protease [Cucumis melo]
 ref|XP_008454765.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=768

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 127/199 (64%), Gaps = 12/199 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLID---QATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSD  172
            AIKSALMTTAY  DN  N+LI    +A+G  ++PF  G+GHVDP +A DPGLVYD+   D
Sbjct  571  AIKSALMTTAYVTDNK-NHLISDVGRASGGPADPFAFGSGHVDPEKASDPGLVYDIAPQD  629

Query  173  YVALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ---VKYKR  343
            Y+  LC++ YN  ++++  +   T + S++    PG LNYP+FS+ F+ K +     +KR
Sbjct  630  YITYLCSLKYNSTQIALVSRGKFTCS-SKRTFFQPGDLNYPSFSV-FMKKGKNVNSTFKR  687

Query  344  SVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLN--S  517
            +V NVG   R+ Y V++  P G+++ V P KL F +  + LSY+++F      + L+  S
Sbjct  688  TVTNVGIP-RSDYTVRIYNPKGIRIIVKPEKLSFVKLGEKLSYKVSFVALGKRKSLDDFS  746

Query  518  YGSIAWEDGVHIVKSPIAV  574
            +GS+ W  G ++V+SPIAV
Sbjct  747  FGSLVWHSGTYVVRSPIAV  765



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 115/196 (59%), Gaps = 12/196 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAYT+DN    L D +  + S PF HGAGHVDP+RAL PGLVYD   +DYVA
Sbjct  542  AIKSALMTTAYTVDNTNAPLRDASDYSISTPFAHGAGHVDPHRALSPGLVYDASPADYVA  601

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y+ + L + V   S   CS +    PG LNYP+FS+ F     V+Y R + NV 
Sbjct  602  FLCSLDYSDEMLQMIV---SNATCSRK-FADPGQLNYPSFSVVFGKSRVVRYTRELTNVD  657

Query  362  SEKRAV-YEVKVNAPLG-VQVSVSPTKLVFNETTDMLSYEITFT----NAQPARFLNSYG  523
                +V Y   V AP   V  +V P+ L F    D   Y +TF     N +P +  N++G
Sbjct  658  PRGGSVIYRASVEAPPELVAATVKPSILEFRNAGDKRRYTVTFVSRRQNVKPMK--NAFG  715

Query  524  SIAWEDGVHIVKSPIA  571
            S+ W++  H VKSP+A
Sbjct  716  SVVWKNSEHQVKSPVA  731



>gb|EPS68206.1| hypothetical protein M569_06564, partial [Genlisea aurea]
Length=203

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 109/198 (55%), Gaps = 9/198 (5%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            I+SALMTTAY+ D+ G  ++D++TGN S+    GAG+V+P +A+ PGLVYDL   DYV  
Sbjct  1    IRSALMTTAYSSDSRGETMLDESTGNTSSVMDFGAGYVNPQKAMSPGLVYDLDAYDYVDF  60

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF-LY---KNQVKYKRSVK  352
            LC   Y    +    + P+    + +  G  G+LNYP+ +  F LY   K    + R V 
Sbjct  61   LCNSNYTAKNIQAVTRRPADCGAARRRAGHVGNLNYPSMAAVFQLYGKRKMSTHFIRRVT  120

Query  353  NVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSY----EITFTNAQPARFLNSY  520
            NVGS  R+VY V+VN P G  V+V P  L F      L++    ++T     P   +   
Sbjct  121  NVGSP-RSVYRVRVNPPAGTTVTVEPETLAFRRVGQKLNFLVRVQVTALKLSPGNSVVKS  179

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W DG H V SP+ V
Sbjct  180  GSIVWSDGKHSVSSPVVV  197



>emb|CDY43568.1| BnaC02g16650D [Brassica napus]
Length=215

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 109/193 (56%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SALMTTAY     G  ++D  TG  S PF HGAGHV P  A++PGL+YDL   DY+ 
Sbjct  24   AIRSALMTTAYKTYKDGKPILDVTTGKPSTPFEHGAGHVSPTTAINPGLIYDLTTVDYLG  83

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC + Y   ++    +   T  C      +   LNYP+F+++       KY R+V +VG
Sbjct  84   FLCALNYTPSQIRSVSRRNYT--CDPSKSYSVADLNYPSFAVNVDGSGVFKYTRTVTSVG  141

Query  362  SEKRAVYEVKVNAPLG-VQVSVSPTKLVFNETTDMLSYEITFT-NAQPARFLNSYGSIAW  535
                  Y VKVN+    V++SV P  L F E  +  SY +TFT N+  A   NS+GSI W
Sbjct  142  GA--GSYSVKVNSETTEVKISVEPAVLNFKEINEKKSYTVTFTVNSSKASRSNSFGSIEW  199

Query  536  EDGVHIVKSPIAV  574
             DG H+V SP+A+
Sbjct  200  SDGKHVVASPVAI  212



>gb|EMT24677.1| hypothetical protein F775_42866 [Aegilops tauschii]
Length=719

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 113/198 (57%), Gaps = 15/198 (8%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            IKSALMTTAY +DN G  + D + G+ S PF  GAGH+ PNRA++PGLVYD G  +Y+  
Sbjct  519  IKSALMTTAYNVDNVGAVIGDMSIGDASTPFARGAGHIHPNRAVNPGLVYDAGAEEYITF  578

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKN--QVKYKRSVKNV  358
            LC + Y  ++++VF    S+ NCS     + G  NYPAFS+ F       V+ +R V+NV
Sbjct  579  LCALGYTAEQIAVF---DSSTNCSTHAGSSVGDHNYPAFSVVFTTNKLAVVRQRRVVRNV  635

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS------Y  520
            G   RA Y  KV AP GV+V+V P  L F  T     Y +TF      R   S      +
Sbjct  636  GGAARATYRAKVTAPDGVRVTVIPRTLRFTATQKTREYVVTFAQ----RIFGSVTKNHTF  691

Query  521  GSIAWEDGVHIVKSPIAV  574
            GSI W D  H V SPIA+
Sbjct  692  GSIEWSDRKHSVMSPIAI  709



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 120/191 (63%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AIKSALMTTAY +DN  + L D A  + SNP+ HG+GHVDP +AL PGLVYD+   +Y+ 
Sbjct  572  AIKSALMTTAYNLDNTNSPLRDAADNSLSNPWAHGSGHVDPKKALSPGLVYDISTEEYIR  631

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC++ Y ++ +   +K P+ VNCS +    PG LNYP+FS+ F  K  V+Y R + NVG
Sbjct  632  FLCSLDYTLNHIQAIIKRPN-VNCSRK-FSDPGQLNYPSFSVLFRDKRVVRYTRELTNVG  689

Query  362  SEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS-YGSIAWE  538
            +   +VY+V V+  + V V+V P +LVF    +   Y +TF+  +      + +GSI W 
Sbjct  690  APG-SVYKVTVDVSVSVSVTVRPKRLVFRTAGEKKRYTVTFSAKRGVSGATAEFGSITWS  748

Query  539  DGVHIVKSPIA  571
            +  H V+SP+A
Sbjct  749  NSQHQVRSPVA  759



>ref|XP_007220042.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
 gb|EMJ21241.1| hypothetical protein PRUPE_ppa027143mg [Prunus persica]
Length=765

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 122/200 (61%), Gaps = 13/200 (7%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLID---QATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSD  172
            AIKSALMTTAYT++N G  + D    +T   + PF  G+GHVDP  A DPGLVYD+   D
Sbjct  567  AIKSALMTTAYTLNNKGAPIADIGSTSTSKSATPFAFGSGHVDPENAADPGLVYDITAED  626

Query  173  YVALLCTIAYNMDELSVFVKDPSTVN--CSEQNLGTPGSLNYPAFSLDFLYKNQ---VKY  337
            Y+  LC+++YN  ++++F    S VN  C +  +  PG LNYP+FS+ F    +   V Y
Sbjct  627  YLFYLCSLSYNSSQIALF---SSGVNFTCPKNAVLQPGDLNYPSFSVLFSKDARNMSVTY  683

Query  338  KRSVKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTN-AQPARFLN  514
            KR+VKNVG +  + Y V+V  P GV V+V P  L F +  + LSY+++F     P    +
Sbjct  684  KRTVKNVG-KIPSTYAVQVKEPTGVSVTVEPRSLRFKKMGEKLSYKVSFVALGGPTLTNS  742

Query  515  SYGSIAWEDGVHIVKSPIAV  574
            S+G++ W  G + V SPIAV
Sbjct  743  SFGTLTWVSGKYRVGSPIAV  762



>emb|CDY63869.1| BnaCnng42760D [Brassica napus]
Length=215

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 112/193 (58%), Gaps = 6/193 (3%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SALMTTAY   N G  +ID  TG  S PF HGAGHV P  A++PGL+YDL   DY+ 
Sbjct  24   AIRSALMTTAYKTYNDGKPIIDVTTGKPSTPFDHGAGHVLPTTAINPGLIYDLTTVDYLG  83

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC + Y   +++   +   T  C      +   LNYP+F+++    +  KY R+V +VG
Sbjct  84   FLCALNYTPSQITSVSRRNYT--CDPSKSYSVAHLNYPSFAVNVDGSSVFKYTRTVTSVG  141

Query  362  SEKRAVYEVKVNAP-LGVQVSVSPTKLVFNETTDMLSYEITFT-NAQPARFLNSYGSIAW  535
                  Y VKVN+    V++SV P  L F +  +  S+ +TFT N+  A   NS+GSI W
Sbjct  142  GA--GSYSVKVNSETTDVKISVEPAVLNFKDINEKKSHSVTFTVNSSKASRSNSFGSIEW  199

Query  536  EDGVHIVKSPIAV  574
             DG H+V SP+A+
Sbjct  200  SDGKHVVASPVAI  212



>emb|CDY18651.1| BnaA09g07440D [Brassica napus]
Length=751

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 114/201 (57%), Gaps = 14/201 (7%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SALMTTAY+    G  L+D AT   S PF HGAGHV P  A+ PGL+YDL   DY+ 
Sbjct  552  AIRSALMTTAYSTYKDGQPLLDIATVKPSTPFGHGAGHVSPAMAISPGLIYDLTTEDYID  611

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC + YN  ++    +   T  C      +   LNYP+F+++    +  KY R+V NVG
Sbjct  612  FLCALKYNQSQIIKVSRGDYT--CDPSKTYSVADLNYPSFAVNVDKSDTYKYTRTVTNVG  669

Query  362  SEKRAVYEVKV-NAPLGVQVSVSPTKLVFNETTDMLSYEITFT--NAQPARF-------L  511
                  Y VKV +    V++SV P  L F E  +  SYE+TFT  +++P RF        
Sbjct  670  GA--GSYSVKVISETTEVKISVEPAVLTFKEVNEKKSYEVTFTVNSSKPPRFSSFRPSGF  727

Query  512  NSYGSIAWEDGVHIVKSPIAV  574
            NS+GSI W DG H+V SP+A+
Sbjct  728  NSFGSIEWSDGKHVVASPVAI  748



>ref|XP_009112373.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=766

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 114/201 (57%), Gaps = 14/201 (7%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SALMTTAY+    G  L+D AT   S PF HGAGHV P  A+ PGL+YDL   DY+ 
Sbjct  567  AIRSALMTTAYSTYKDGQPLLDIATVKPSTPFGHGAGHVSPAMAISPGLIYDLTTEDYID  626

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKYKRSVKNVG  361
             LC + YN  ++    +   T  C      +   LNYP+F+++    +  KY R+V NVG
Sbjct  627  FLCALKYNQSQIIKVSRGDYT--CDPSKTYSVADLNYPSFAVNVDKSDTYKYTRTVTNVG  684

Query  362  SEKRAVYEVKV-NAPLGVQVSVSPTKLVFNETTDMLSYEITFT--NAQPARF-------L  511
                  Y VKV +    V++SV P  L F E  +  SYE+TFT  +++P RF        
Sbjct  685  GA--GSYSVKVISETTEVKISVEPAVLTFKEVNEKKSYEVTFTVNSSKPPRFSSFRPSGF  742

Query  512  NSYGSIAWEDGVHIVKSPIAV  574
            NS+GSI W DG H+V SP+A+
Sbjct  743  NSFGSIEWSDGKHVVASPVAI  763



>ref|XP_011035007.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=769

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 117/198 (59%), Gaps = 10/198 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSN--PFIHGAGHVDPNRALDPGLVYDLGVSDY  175
            AIKSALMTTAY  DN G+ + D  + N ++  PF  G+GHVDP RA DPGL+YD+ + DY
Sbjct  572  AIKSALMTTAYATDNRGSPIADAGSSNSASATPFAFGSGHVDPERASDPGLIYDITIEDY  631

Query  176  VALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDF---LYKNQVKYKRS  346
            +   C++ Y   +++   +    V C +     PG LNYP+F+++F      N+VKYKR+
Sbjct  632  LNYFCSLDYTSSQIAQVSR--RNVTCPDNKALQPGDLNYPSFAVNFEGNARNNRVKYKRT  689

Query  347  VKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF--TNAQPARFLNSY  520
            + NVG+   + Y VKV  P GV V + P  L F +    LSY +TF  +  +     +S 
Sbjct  690  LTNVGTPS-STYAVKVEEPNGVSVILEPKSLSFEKLGQKLSYNVTFVSSGGKGREGSSSI  748

Query  521  GSIAWEDGVHIVKSPIAV  574
            GS+ W  G + V+SPIAV
Sbjct  749  GSLVWLSGKYSVRSPIAV  766



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 114/196 (58%), Gaps = 8/196 (4%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SALMTTAYT    G  L D ATG  S PF HGAGHVDP  AL+PGLVYDL V DY+ 
Sbjct  576  AIRSALMTTAYTAYKNGQKLQDVATGKPSTPFDHGAGHVDPISALNPGLVYDLTVDDYLN  635

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK----NQVKYKRSV  349
             LC + Y+  E+S   K   T  C E+   +   LNYP+F+++F  +    N  KY R+V
Sbjct  636  FLCALNYSASEISSLAKRSYT--CDEKRRYSVRDLNYPSFAVNFEDRTTSTNVAKYTRTV  693

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARF-LNSYGS  526
             NVG        V  + P  V+++V P  L F +  +  +Y +TF+ +  A    NS+G 
Sbjct  694  TNVGRAGTYKATVTSDNP-SVKITVEPDTLSFGQVNEKKAYTVTFSASGSAPLNANSFGR  752

Query  527  IAWEDGVHIVKSPIAV  574
            + W DG H+V SPIA+
Sbjct  753  LEWSDGKHVVGSPIAM  768



>ref|XP_010240288.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=778

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 113/192 (59%), Gaps = 6/192 (3%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            IKSALMTTAY  DN  + L D ATG  S PF HGAGH+ P RAL PGLVYD+G  DY+  
Sbjct  585  IKSALMTTAYVHDNTYSLLKDAATGKASTPFQHGAGHIHPLRALSPGLVYDIGQGDYLEF  644

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQVKY--KRSVKNV  358
            LCT      +L  F K+ S + C + +L +PG LNYPA S  F  +  V     R+V NV
Sbjct  645  LCTQDLTPMQLKAFTKN-SNMTC-KHSLSSPGDLNYPAISAVFTDQPSVPLTVHRTVTNV  702

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            G    + Y VKV    G  V V P  L F+ +   L+Y++T    + A+    +G+++W 
Sbjct  703  GPPS-STYHVKVTKFKGADVVVEPNTLHFSSSNQKLAYKVTL-RTKAAQKTPEFGALSWS  760

Query  539  DGVHIVKSPIAV  574
            DGVHIV+SP+ +
Sbjct  761  DGVHIVRSPLVL  772



>ref|XP_004229864.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326049.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
 ref|XP_010326050.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=764

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 121/197 (61%), Gaps = 9/197 (5%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLID--QATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDY  175
            AIKSALMTTAYT+D     + D    T   + PF+ G+GHVDP RA DPGL+YD+   DY
Sbjct  568  AIKSALMTTAYTLDKKRTPIADAVSETSLSATPFVFGSGHVDPERASDPGLIYDISTEDY  627

Query  176  VALLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYKNQ---VKYKRS  346
            +  +C++ YN  ++++ +++  T  C   +  + G+LNYP+FS+ F   NQ     +KR+
Sbjct  628  LHYICSLNYNSSQIALLLRENYT--CPSHSFQSLGNLNYPSFSVLFDSNNQHLIQTFKRT  685

Query  347  VKNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITF-TNAQPARFLNSYG  523
            V NVG+  R+ Y V+V  P GV V+V P  L F++    L Y++ F T  + +   +++G
Sbjct  686  VTNVGTP-RSTYIVQVKTPYGVSVTVKPKILKFHKKGQKLRYKVRFVTKGKRSPADSTFG  744

Query  524  SIAWEDGVHIVKSPIAV  574
            S+ W    HIV+SPIAV
Sbjct  745  SLTWISRTHIVRSPIAV  761



>ref|XP_009593174.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 118/199 (59%), Gaps = 12/199 (6%)
 Frame = +2

Query  2    AIKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVA  181
            AI+SA+MTTA  +DN    + D+ATG  + P+ +GAGH++ + ALDPGLVYDL   DYV+
Sbjct  574  AIRSAMMTTASLVDNRLQPMTDEATGKPATPYDYGAGHLNLDLALDPGLVYDLANEDYVS  633

Query  182  LLCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPA----FSLDFLYKNQVKYKRSV  349
             LC I Y    + V  K P  VNC  +    P +LNYP+    FS      +   + R+V
Sbjct  634  FLCAIEYGPKTIQVITKSP--VNCPMKKP-LPENLNYPSIAALFSTAARGVSSKTFFRTV  690

Query  350  KNVGSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNS----  517
             NVG +  A Y VK+ AP GV+VSV P KLVF+E    LSY +T T       LN     
Sbjct  691  TNVG-DTNAEYRVKIEAPKGVRVSVKPDKLVFSEKVRKLSYYVTITVDSKNLVLNDSGAV  749

Query  518  YGSIAWEDGVHIVKSPIAV  574
            +GS++W DG H+V+SPI V
Sbjct  750  FGSLSWIDGKHVVRSPIVV  768



>gb|EMT07781.1| Subtilisin-like protease [Aegilops tauschii]
Length=602

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 116/192 (60%), Gaps = 6/192 (3%)
 Frame = +2

Query  5    IKSALMTTAYTIDNAGNNLIDQATGNQSNPFIHGAGHVDPNRALDPGLVYDLGVSDYVAL  184
            IKSALMTTAY  DN  + L D ATG+ S PF HGAGH+ P RAL+PGLVYD+G ++Y+  
Sbjct  409  IKSALMTTAYVHDNTYHVLKDAATGDASTPFEHGAGHIHPVRALNPGLVYDIGQNEYLEF  468

Query  185  LCTIAYNMDELSVFVKDPSTVNCSEQNLGTPGSLNYPAFSLDFLYK--NQVKYKRSVKNV  358
            LCT      +L  F K+ S + C + +  +PG LNYPA S  F  +    +  +R+V NV
Sbjct  469  LCTQNLTRTQLKGFTKN-SNMTC-KGSFSSPGDLNYPAISAVFSDQPATPLMVRRTVTNV  526

Query  359  GSEKRAVYEVKVNAPLGVQVSVSPTKLVFNETTDMLSYEITFTNAQPARFLNSYGSIAWE  538
            G    + Y VKV    G  V V P+ L F+     L+Y++T    + A+    YG+++W 
Sbjct  527  GPPS-STYHVKVTKFKGADVVVEPSTLHFSSANQKLAYKVTL-RTKAAQKTPEYGALSWS  584

Query  539  DGVHIVKSPIAV  574
            DGVH+V+SP+ +
Sbjct  585  DGVHVVRSPLVL  596



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1364606714424