BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83930_g1_i1 len=626 path=[1:0-625]

Length=626
                                                                      Score     E

gb|AGE15502.1|  GA-stimulated transcript-like protein 6                 122   4e-32   
ref|XP_006472264.1|  PREDICTED: snakin-1-like                           122   5e-32   
ref|XP_006433597.1|  hypothetical protein CICLE_v10002979mg             121   2e-31   
ref|XP_010059861.1|  PREDICTED: peamaclein                              119   1e-30   
ref|XP_010066166.1|  PREDICTED: peamaclein-like                         116   2e-29   
ref|XP_010066158.1|  PREDICTED: peamaclein-like                         115   2e-29   
gb|KHF99282.1|  Snakin-1                                                114   6e-29   
ref|XP_011069570.1|  PREDICTED: peamaclein                              114   1e-28   
ref|XP_007223838.1|  hypothetical protein PRUPE_ppa014086mg             111   1e-27   
ref|XP_009360284.1|  PREDICTED: peamaclein                              110   2e-27   
ref|XP_010556423.1|  PREDICTED: peamaclein                              110   3e-27   
ref|XP_008360977.1|  PREDICTED: peamaclein                              110   3e-27   
ref|XP_004252297.1|  PREDICTED: peamaclein                              110   3e-27   
ref|XP_002285141.1|  PREDICTED: peamaclein                              109   5e-27   Vitis vinifera
sp|P86888.1|PMLN_PRUPE  RecName: Full=Peamaclein; AltName: Allerg...    108   7e-27   
ref|XP_011029030.1|  PREDICTED: peamaclein-like                         109   8e-27   
gb|AFT92001.1|  gibberellin-regulated protein                           108   9e-27   
gb|AFT92002.1|  gibberellin-regulated protein                           108   1e-26   
ref|XP_010443767.1|  PREDICTED: gibberellin-regulated protein 10-...    108   1e-26   
ref|XP_010105475.1|  hypothetical protein L484_010255                   108   1e-26   
ref|XP_002510126.1|  GAST1 protein precursor, putative                  108   1e-26   Ricinus communis
ref|XP_009773391.1|  PREDICTED: peamaclein-like                         107   2e-26   
ref|XP_006374850.1|  hypothetical protein POPTR_0014s02030g             107   3e-26   
ref|XP_004290947.1|  PREDICTED: peamaclein-like                         107   3e-26   
gb|KHN21405.1|  Snakin-1                                                107   3e-26   
ref|NP_181486.1|  gibberellin-regulated protein                         107   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003550315.1|  PREDICTED: snakin-1                                107   5e-26   
ref|XP_009591073.1|  PREDICTED: peamaclein-like                         106   6e-26   
ref|NP_001236984.1|  uncharacterized protein LOC100500113               107   6e-26   
ref|XP_006400907.1|  hypothetical protein EUTSA_v10015142mg             106   7e-26   
ref|XP_006346656.1|  PREDICTED: peamaclein-like                         105   1e-25   
gb|ACU13365.1|  unknown                                                 105   1e-25   Glycine max [soybeans]
ref|XP_006422868.1|  hypothetical protein CICLE_v10029695mg             105   1e-25   
ref|XP_008377985.1|  PREDICTED: peamaclein                              105   2e-25   
ref|XP_009120506.1|  PREDICTED: gibberellin-regulated protein 10-...    105   2e-25   
gb|KHN42338.1|  Snakin-1                                                105   3e-25   
ref|XP_009354123.1|  PREDICTED: peamaclein-like isoform X1              105   3e-25   
ref|XP_003525918.1|  PREDICTED: snakin-1                                104   3e-25   
gb|KCW68672.1|  hypothetical protein EUGRSUZ_F02269                     104   3e-25   
ref|XP_006346618.1|  PREDICTED: snakin-1-like                           104   4e-25   
ref|XP_010688303.1|  PREDICTED: peamaclein                              104   4e-25   
ref|XP_004252296.1|  PREDICTED: peamaclein-like                         104   6e-25   
ref|XP_007136735.1|  hypothetical protein PHAVU_009G069900g             103   7e-25   
ref|XP_002864654.1|  gibberellin-regulated family protein               103   7e-25   
ref|XP_003636819.1|  Snakin-1                                           103   8e-25   
dbj|BAB08352.1|  unnamed protein product                                103   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009354124.1|  PREDICTED: peamaclein-like isoform X2              103   1e-24   
ref|NP_568914.1|  gibberellin-regulated protein                         103   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006361222.1|  PREDICTED: snakin-1-like                           103   2e-24   
emb|CDY31590.1|  BnaA10g12810D                                          103   2e-24   
ref|XP_006281389.1|  hypothetical protein CARUB_v10027450mg             102   2e-24   
ref|XP_004499015.1|  PREDICTED: snakin-1-like                           102   2e-24   
ref|XP_006486958.1|  PREDICTED: snakin-1-like                           102   3e-24   
emb|CDY31591.1|  BnaA10g12800D                                          102   4e-24   
ref|XP_009120505.1|  PREDICTED: gibberellin-regulated protein 10-...    102   4e-24   
gb|EPS58046.1|  hypothetical protein M569_16773                         102   4e-24   
ref|XP_006417449.1|  hypothetical protein EUTSA_v10009615mg             101   7e-24   
gb|KDP41652.1|  hypothetical protein JCGZ_16059                         101   8e-24   
gb|AFK41274.1|  unknown                                                 100   1e-23   
ref|XP_004501536.1|  PREDICTED: peamaclein-like                         100   1e-23   
ref|XP_009144432.1|  PREDICTED: gibberellin-regulated protein 8-like    100   2e-23   
emb|CDP01230.1|  unnamed protein product                                100   2e-23   
ref|XP_009126643.1|  PREDICTED: gibberellin-regulated protein 10        100   3e-23   
sp|Q948Z4.1|SNAK1_SOLTU  RecName: Full=Snakin-1; Flags: Precursor     99.8    3e-23   Solanum tuberosum [potatoes]
ref|XP_009148397.1|  PREDICTED: gibberellin-regulated protein 8       99.8    3e-23   
ref|XP_009598103.1|  PREDICTED: peamaclein-like                       99.8    4e-23   
ref|XP_006279073.1|  hypothetical protein CARUB_v10012746mg           99.4    4e-23   
gb|KHG20586.1|  Snakin-1                                              99.4    4e-23   
emb|CDX80223.1|  BnaC09g35190D                                        99.4    4e-23   
emb|CDX80222.1|  BnaC09g35200D                                        99.4    5e-23   
gb|ABK94917.1|  unknown                                               99.0    6e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009380091.1|  PREDICTED: peamaclein-like                       99.0    7e-23   
gb|KFK27525.1|  hypothetical protein AALP_AA8G394700                  98.2    8e-23   
gb|ABQ42622.1|  snakin-1                                              98.6    8e-23   Solanum chacoense
ref|XP_009620159.1|  PREDICTED: snakin-1                              98.6    9e-23   
ref|XP_006362074.1|  PREDICTED: snakin-1-like                         98.6    9e-23   
gb|EYU22941.1|  hypothetical protein MIMGU_mgv1a022909mg              98.6    9e-23   
ref|XP_007160892.1|  hypothetical protein PHAVU_001G025800g           98.6    1e-22   
ref|XP_004496906.1|  PREDICTED: snakin-1-like                         98.2    1e-22   
ref|XP_002313889.2|  hypothetical protein POPTR_0009s09560g           98.2    1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_008792652.1|  PREDICTED: peamaclein-like                       98.2    1e-22   
ref|XP_008346370.1|  PREDICTED: peamaclein-like                       98.2    1e-22   
ref|XP_006306379.1|  hypothetical protein CARUB_v10012286mg           97.8    1e-22   
ref|XP_010906256.1|  PREDICTED: peamaclein-like                       97.8    2e-22   
gb|EYU25492.1|  hypothetical protein MIMGU_mgv1a017072mg              97.8    2e-22   
emb|CDX93402.1|  BnaA06g06460D                                        97.8    2e-22   
emb|CDY72009.1|  BnaCnng75550D                                        97.4    2e-22   
ref|XP_002300251.2|  hypothetical protein POPTR_0001s30500g           97.4    2e-22   Populus trichocarpa [western balsam poplar]
gb|AAY51975.1|  GIR1                                                  97.4    2e-22   Vigna radiata [mung bean]
ref|XP_010320309.1|  PREDICTED: LOW QUALITY PROTEIN: snakin-1-like    97.4    2e-22   
ref|XP_009339505.1|  PREDICTED: peamaclein-like                       97.4    2e-22   
ref|XP_006292427.1|  hypothetical protein CARUB_v10018642mg           97.4    2e-22   
ref|XP_009795533.1|  PREDICTED: snakin-1                              96.3    5e-22   
ref|XP_004981680.1|  PREDICTED: snakin-1-like                         96.7    5e-22   
ref|XP_010271646.1|  PREDICTED: peamaclein-like                       96.7    6e-22   
ref|XP_011074384.1|  PREDICTED: peamaclein-like                       96.3    6e-22   
gb|EYU29122.1|  hypothetical protein MIMGU_mgv1a017256mg              96.3    6e-22   
ref|XP_006301392.1|  hypothetical protein CARUB_v10021805mg           96.3    7e-22   
ref|XP_011069770.1|  PREDICTED: peamaclein-like                       96.3    7e-22   
ref|XP_002875456.1|  hypothetical protein ARALYDRAFT_484630           95.9    9e-22   
ref|XP_011069640.1|  PREDICTED: peamaclein-like                       95.9    1e-21   
ref|XP_009404126.1|  PREDICTED: peamaclein-like                       95.9    1e-21   
ref|XP_010679570.1|  PREDICTED: peamaclein-like                       95.9    1e-21   
ref|XP_002271730.2|  PREDICTED: snakin-1                              97.1    1e-21   Vitis vinifera
gb|ABQ42621.1|  snakin-1                                              95.5    1e-21   Solanum bulbocastanum [ornamental nightshade]
ref|NP_001237325.1|  uncharacterized protein LOC100527527 precursor   95.5    1e-21   
ref|XP_002524960.1|  conserved hypothetical protein                   95.9    1e-21   Ricinus communis
gb|EYU29123.1|  hypothetical protein MIMGU_mgv1a017184mg              95.5    1e-21   
ref|XP_008440339.1|  PREDICTED: peamaclein-like                       95.5    1e-21   
gb|EMS63633.1|  hypothetical protein TRIUR3_22813                     95.5    1e-21   
ref|XP_010491469.1|  PREDICTED: gibberellin-regulated protein 8-like  95.1    2e-21   
ref|XP_010099066.1|  hypothetical protein L484_011500                 95.1    2e-21   
ref|XP_002463849.1|  hypothetical protein SORBIDRAFT_01g007360        95.1    2e-21   Sorghum bicolor [broomcorn]
gb|EMS63632.1|  hypothetical protein TRIUR3_22812                     95.1    2e-21   
ref|NP_001149636.1|  gibberellin-regulated protein 2 precursor        94.7    2e-21   Zea mays [maize]
emb|CBI22497.3|  unnamed protein product                              94.7    3e-21   
ref|XP_007143086.1|  hypothetical protein PHAVU_007G042400g           94.7    3e-21   
ref|NP_001077503.1|  Gibberellin-regulated GASA/GAST/Snakin famil...  94.7    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381473.1|  PREDICTED: peamaclein-like                       94.7    3e-21   
ref|XP_003536595.1|  PREDICTED: snakin-1                              94.4    3e-21   
ref|NP_001183511.1|  gibberellin-regulated protein 2 precursor        94.4    4e-21   
gb|ACG44951.1|  gibberellin-regulated protein 2 precursor             94.4    4e-21   Zea mays [maize]
ref|XP_009135633.1|  PREDICTED: peamaclein-like                       94.0    5e-21   
ref|XP_006346334.1|  PREDICTED: snakin-1-like                         94.0    5e-21   
emb|CDP07216.1|  unnamed protein product                              93.6    6e-21   
ref|XP_006301929.1|  hypothetical protein CARUB_v10022405mg           93.6    7e-21   
gb|KEH44041.1|  gibberellin-regulated family protein                  93.6    7e-21   
ref|XP_010467274.1|  PREDICTED: gibberellin-regulated protein 7-like  94.0    7e-21   
ref|XP_007047444.1|  Gibberellin-regulated family protein, putative   94.0    8e-21   
ref|XP_010488933.1|  PREDICTED: gibberellin-regulated protein 7-like  94.0    8e-21   
ref|XP_004289740.1|  PREDICTED: snakin-1-like                         93.2    8e-21   
ref|XP_003559125.1|  PREDICTED: peamaclein-like                       93.2    9e-21   
ref|XP_010315202.1|  PREDICTED: peamaclein                            93.2    9e-21   
gb|EYU37603.1|  hypothetical protein MIMGU_mgv1a024675mg              93.2    1e-20   
ref|XP_003559118.1|  PREDICTED: peamaclein-like                       93.2    1e-20   
ref|XP_010519291.1|  PREDICTED: peamaclein-like                       93.2    1e-20   
ref|NP_001077504.1|  Gibberellin-regulated GASA/GAST/Snakin famil...  92.8    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778332.1|  PREDICTED: peamaclein-like                       92.8    1e-20   
gb|EMT21444.1|  hypothetical protein F775_43887                       92.8    1e-20   
ref|XP_006406493.1|  hypothetical protein EUTSA_v10022254mg           92.0    1e-20   
ref|XP_008787135.1|  PREDICTED: peamaclein-like                       92.4    2e-20   
ref|XP_002283986.1|  PREDICTED: snakin-1-like                         93.6    2e-20   Vitis vinifera
ref|XP_010909081.1|  PREDICTED: peamaclein-like                       92.4    2e-20   
ref|XP_006650629.1|  PREDICTED: snakin-1-like                         92.4    2e-20   
ref|XP_010458413.1|  PREDICTED: gibberellin-regulated protein 8-like  92.0    2e-20   
emb|CBI33733.3|  unnamed protein product                              91.3    3e-20   
ref|XP_004152264.1|  PREDICTED: snakin-1-like                         91.7    3e-20   
ref|XP_010517902.1|  PREDICTED: gibberellin-regulated protein 7       92.0    4e-20   
ref|NP_001051348.1|  Os03g0760800                                     91.7    4e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21443.1|  hypothetical protein F775_31764                       91.7    4e-20   
emb|CDX88727.1|  BnaA03g09220D                                        91.3    5e-20   
ref|XP_006829298.1|  hypothetical protein AMTR_s00001p00273070        90.9    5e-20   
gb|KFK39277.1|  hypothetical protein AALP_AA3G223500                  90.1    7e-20   
ref|XP_010458411.1|  PREDICTED: gibberellin-regulated protein 8-like  90.5    8e-20   
gb|KCW63655.1|  hypothetical protein EUGRSUZ_G01294                   91.7    8e-20   
ref|XP_004141992.1|  PREDICTED: snakin-1-like                         90.9    9e-20   
ref|XP_009403087.1|  PREDICTED: peamaclein-like                       90.5    9e-20   
gb|ACR37248.1|  unknown                                               90.5    1e-19   Zea mays [maize]
emb|CDY22975.1|  BnaC03g40940D                                        90.5    1e-19   
ref|XP_010065940.1|  PREDICTED: peamaclein-like                       90.1    1e-19   
ref|XP_010028136.1|  PREDICTED: peamaclein-like                       89.7    2e-19   
gb|EMS47698.1|  hypothetical protein TRIUR3_08559                     89.4    3e-19   
emb|CDX71072.1|  BnaC03g11560D                                        89.4    3e-19   
gb|ACJ68116.1|  hypothetical protein                                  89.0    3e-19   Brassica napus [oilseed rape]
ref|XP_010920764.1|  PREDICTED: peamaclein-like                       89.0    4e-19   
ref|XP_009131966.1|  PREDICTED: gibberellin-regulated protein 10-...  89.0    4e-19   
gb|AGE15499.1|  GA-stimulated transcript-like protein 3               88.6    5e-19   
ref|XP_002879804.1|  hypothetical protein ARALYDRAFT_482976           88.2    5e-19   
emb|CDY50148.1|  BnaA01g26080D                                        88.6    5e-19   
gb|ABK22434.1|  unknown                                               89.0    5e-19   Picea sitchensis
emb|CDX93153.1|  BnaA03g38750D                                        89.0    6e-19   
ref|XP_010475932.1|  PREDICTED: gibberellin-regulated protein 8-like  88.2    7e-19   
emb|CDX89647.1|  BnaC03g45610D                                        88.6    8e-19   
ref|XP_009136261.1|  PREDICTED: gibberellin-regulated protein 7-like  88.6    8e-19   
ref|XP_010028389.1|  PREDICTED: peamaclein-like                       87.8    1e-18   
ref|XP_002518646.1|  GAST1 protein precursor, putative                87.4    1e-18   Ricinus communis
gb|ABK25287.1|  unknown                                               88.2    1e-18   Picea sitchensis
gb|ABN12953.1|  GASA-like protein                                     87.4    2e-18   Gymnadenia conopsea
ref|XP_007042576.1|  Uncharacterized protein TCM_007177               87.0    2e-18   
ref|XP_004142881.1|  PREDICTED: snakin-1-like                         87.0    2e-18   
gb|KDP32030.1|  hypothetical protein JCGZ_12491                       86.7    2e-18   
ref|XP_009123227.1|  PREDICTED: gibberellin-regulated protein 7 i...  87.4    2e-18   
gb|KFK39992.1|  hypothetical protein AALP_AA3G316000                  87.0    2e-18   
ref|XP_002973082.1|  hypothetical protein SELMODRAFT_99264            85.9    3e-18   
gb|KGN52784.1|  hypothetical protein Csa_4G001520                     91.3    4e-18   
gb|KCW54793.1|  hypothetical protein EUGRSUZ_I00734                   86.3    4e-18   
ref|XP_006409618.1|  hypothetical protein EUTSA_v10022920mg           86.3    6e-18   
ref|XP_006298856.1|  hypothetical protein CARUB_v10014971mg           85.9    7e-18   
ref|XP_006409619.1|  hypothetical protein EUTSA_v10022920mg           85.9    7e-18   
ref|XP_002883868.1|  gibberellin-regulated family protein             85.5    9e-18   
ref|XP_002976786.1|  hypothetical protein SELMODRAFT_105504           84.3    1e-17   
ref|XP_009123225.1|  PREDICTED: gibberellin-regulated protein 7 i...  85.1    1e-17   
gb|AFK36243.1|  unknown                                               84.7    1e-17   
emb|CDY52417.1|  BnaCnng22380D                                        85.1    1e-17   
emb|CDY54472.1|  BnaA09g52760D                                        85.1    1e-17   
ref|NP_179096.1|  gibberellin-regulated protein                       85.1    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444582.1|  PREDICTED: peamaclein-like                       84.3    2e-17   
ref|XP_007018557.1|  Gibberellin-regulated family protein             84.0    3e-17   
ref|XP_009800618.1|  PREDICTED: peamaclein-like                       83.6    3e-17   
ref|NP_001152432.1|  gibberellin-regulated protein 2 precursor        84.0    3e-17   Zea mays [maize]
ref|XP_002969375.1|  hypothetical protein SELMODRAFT_440818           84.0    3e-17   
ref|XP_010685204.1|  PREDICTED: peamaclein-like                       83.6    5e-17   
ref|XP_010475933.1|  PREDICTED: gibberellin-regulated protein 8-like  83.2    5e-17   
ref|XP_009404981.1|  PREDICTED: peamaclein-like                       83.2    6e-17   
ref|XP_009617608.1|  PREDICTED: peamaclein-like                       83.2    6e-17   
ref|XP_008780246.1|  PREDICTED: gibberellin-regulated protein 2-like  81.3    1e-16   
ref|XP_003589114.1|  Snakin-1                                         81.6    2e-16   
gb|ABR25339.1|  giberellin regulated family protein                   80.9    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006649745.1|  PREDICTED: gibberellin-regulated protein 12-...  81.6    2e-16   
ref|XP_002970705.1|  hypothetical protein SELMODRAFT_94072            80.1    4e-16   
gb|ABK21371.1|  unknown                                               81.3    5e-16   Picea sitchensis
gb|AAD01518.1|  Snakin-1                                              79.3    6e-16   Solanum tuberosum [potatoes]
gb|ABK21812.1|  unknown                                               81.3    6e-16   Picea sitchensis
ref|XP_002973289.1|  hypothetical protein SELMODRAFT_99234            79.3    8e-16   
gb|AES96393.2|  GASA/GAST/Snakin                                      79.3    1e-15   
ref|XP_004517034.1|  PREDICTED: gibberellin-regulated protein 12-...  79.0    2e-15   
gb|AFE82743.1|  snakin-1                                              79.0    2e-15   
ref|XP_010665102.1|  PREDICTED: peamaclein-like                       78.6    3e-15   
ref|XP_002970861.1|  hypothetical protein SELMODRAFT_94549            77.8    3e-15   
ref|XP_006342570.1|  PREDICTED: gibberellin-regulated protein 1-like  78.6    4e-15   
ref|XP_002986081.1|  hypothetical protein SELMODRAFT_123391           77.4    4e-15   
ref|XP_002969591.1|  hypothetical protein SELMODRAFT_91546            77.0    5e-15   
ref|XP_010314649.1|  PREDICTED: gibberellin-regulated protein 1-like  78.2    6e-15   
ref|XP_010547967.1|  PREDICTED: peamaclein                            77.8    6e-15   
ref|XP_011038137.1|  PREDICTED: gibberellin-regulated protein 2       77.4    7e-15   
ref|NP_001055630.1|  Os05g0432200                                     77.0    8e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008236410.1|  PREDICTED: peamaclein                            77.0    9e-15   
ref|XP_006846942.1|  hypothetical protein AMTR_s00017p00002980        77.4    9e-15   
ref|XP_006376297.1|  hypothetical protein POPTR_0013s11770g           76.6    1e-14   
ref|XP_003613454.1|  Gibberellin induced protein                      76.6    1e-14   
ref|XP_007200798.1|  hypothetical protein PRUPE_ppa024899mg           76.6    1e-14   
gb|ABF94978.1|  GAST1 protein precursor, putative                     76.3    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002526823.1|  Gibberellin-regulated protein 2 precursor, p...  75.9    3e-14   Ricinus communis
ref|XP_009403760.1|  PREDICTED: peamaclein-like                       75.5    3e-14   
ref|XP_002982001.1|  hypothetical protein SELMODRAFT_115445           74.7    4e-14   
ref|XP_006662142.1|  PREDICTED: gibberellin-regulated protein 12-...  75.5    4e-14   
ref|XP_010063765.1|  PREDICTED: gibberellin-regulated protein 2-like  75.1    4e-14   
ref|XP_002298694.2|  hypothetical protein POPTR_0001s32270g           74.3    5e-14   Populus trichocarpa [western balsam poplar]
ref|XP_002889819.1|  hypothetical protein ARALYDRAFT_471179           74.3    7e-14   
gb|ACU43594.1|  gibberellin stimulated transcript                     74.7    8e-14   Triticum aestivum [Canadian hard winter wheat]
gb|EEE58704.1|  hypothetical protein OsJ_10147                        75.1    8e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002965632.1|  hypothetical protein SELMODRAFT_84095            73.6    8e-14   
ref|XP_006493084.1|  PREDICTED: gibberellin-regulated protein 12-...  74.3    1e-13   
ref|XP_002989280.1|  hypothetical protein SELMODRAFT_129438           73.2    1e-13   
gb|KDO41153.1|  hypothetical protein CISIN_1g041400mg                 73.9    1e-13   
ref|XP_006296776.1|  hypothetical protein CARUB_v10015821mg           73.9    1e-13   
ref|XP_003613435.1|  GAST1                                            73.9    1e-13   
ref|XP_006601874.1|  PREDICTED: gibberellin-regulated protein 12-...  73.9    1e-13   
gb|EEC74871.1|  hypothetical protein OsI_10763                        74.3    1e-13   Oryza sativa Indica Group [Indian rice]
emb|CBI18166.3|  unnamed protein product                              73.2    1e-13   
ref|XP_006416023.1|  hypothetical protein EUTSA_v10009207mg           73.6    1e-13   
gb|EMS48664.1|  hypothetical protein TRIUR3_03907                     73.2    2e-13   
ref|XP_004986740.1|  PREDICTED: gibberellin-regulated protein 12-...  73.6    2e-13   
ref|XP_002977665.1|  hypothetical protein SELMODRAFT_417581           73.9    2e-13   
ref|XP_002979611.1|  hypothetical protein SELMODRAFT_419248           73.9    2e-13   
gb|ABK21087.1|  unknown                                               73.6    2e-13   Picea sitchensis
ref|XP_010274082.1|  PREDICTED: gibberellin-regulated protein 12      73.9    2e-13   
gb|ABK22904.1|  unknown                                               73.6    2e-13   Picea sitchensis
gb|ABK22062.1|  unknown                                               73.6    2e-13   Picea sitchensis
ref|XP_006395777.1|  hypothetical protein EUTSA_v10005321mg           73.2    3e-13   
ref|XP_010909456.1|  PREDICTED: gibberellin-regulated protein 2-like  72.8    3e-13   
ref|XP_003613442.1|  GAST1                                            72.8    3e-13   
emb|CDP21913.1|  unnamed protein product                              72.8    3e-13   
ref|XP_006654443.1|  PREDICTED: gibberellin-regulated protein 2-like  72.4    4e-13   
dbj|BAF00966.1|  GAST1-like protein                                   72.0    5e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDP07399.1|  unnamed protein product                              72.4    5e-13   
ref|XP_007227095.1|  hypothetical protein PRUPE_ppa025589mg           72.0    5e-13   
ref|XP_010236530.1|  PREDICTED: gibberellin-regulated protein 5-like  72.8    5e-13   
ref|XP_004517033.1|  PREDICTED: gibberellin-regulated protein 12-...  72.0    6e-13   
gb|KHN24017.1|  Protein GAST1                                         71.2    6e-13   
ref|XP_003541683.1|  PREDICTED: gibberellin-regulated protein 12-...  71.6    7e-13   
ref|XP_008224510.1|  PREDICTED: gibberellin-regulated protein 12-...  72.0    7e-13   
ref|XP_009415913.1|  PREDICTED: gibberellin-regulated protein 11-...  71.2    8e-13   
ref|XP_011074683.1|  PREDICTED: snakin-2-like                         72.0    8e-13   
ref|XP_004489937.1|  PREDICTED: gibberellin-regulated protein 12-...  71.6    8e-13   
emb|CDY27104.1|  BnaA08g07420D                                        72.0    8e-13   
ref|XP_010690459.1|  PREDICTED: gibberellin-regulated protein 1-like  71.6    9e-13   
gb|ABK21133.1|  unknown                                               72.0    9e-13   Picea sitchensis
emb|CBI25690.3|  unnamed protein product                              71.6    9e-13   
ref|XP_003613456.1|  Gibberellin-regulated protein                    71.2    9e-13   
ref|XP_010532783.1|  PREDICTED: gibberellin-regulated protein 12      71.6    1e-12   
gb|EYU22850.1|  hypothetical protein MIMGU_mgv1a016408mg              72.0    1e-12   
ref|XP_010038994.1|  PREDICTED: gibberellin-regulated protein 12      71.2    1e-12   
ref|XP_009108078.1|  PREDICTED: gibberellin-regulated protein 12-...  71.2    1e-12   
gb|ADE77851.1|  unknown                                               71.2    1e-12   
ref|XP_007163897.1|  hypothetical protein PHAVU_L007200g              70.9    1e-12   
ref|XP_009383413.1|  PREDICTED: gibberellin-regulated protein 12      70.5    2e-12   
ref|XP_010274741.1|  PREDICTED: protein RSI-1-like                    70.9    2e-12   
ref|XP_002530088.1|  GAST1 protein precursor, putative                71.2    2e-12   
ref|XP_010673449.1|  PREDICTED: peamaclein-like                       70.9    2e-12   
ref|XP_007163594.1|  hypothetical protein PHAVU_001G247600g           70.5    2e-12   
ref|XP_006420919.1|  hypothetical protein CICLE_v10006668mg           69.7    2e-12   
ref|XP_010646211.1|  PREDICTED: gibberellin-regulated protein 12-...  70.5    2e-12   
ref|XP_007163834.1|  hypothetical protein PHAVU_001G268100g           70.1    3e-12   
ref|XP_002467388.1|  hypothetical protein SORBIDRAFT_01g026925        70.9    3e-12   
gb|AFK37530.1|  unknown                                               70.1    3e-12   
ref|XP_004158330.1|  PREDICTED: protein GAST1-like                    70.5    3e-12   
emb|CDO97247.1|  unnamed protein product                              69.7    3e-12   
emb|CAN72771.1|  hypothetical protein VITISV_034212                   71.6    3e-12   
gb|KGN59726.1|  hypothetical protein Csa_3G841990                     70.1    4e-12   
emb|CDY46336.1|  BnaC01g30340D                                        69.7    4e-12   
ref|XP_010256373.1|  PREDICTED: gibberellin-regulated protein 2-like  69.3    5e-12   
ref|XP_002439852.1|  hypothetical protein SORBIDRAFT_09g021340        69.3    5e-12   
ref|XP_002518090.1|  Gibberellin-regulated protein 4 precursor, p...  68.9    6e-12   
emb|CDP08494.1|  unnamed protein product                              69.7    6e-12   
emb|CDY71845.1|  BnaAnng38970D                                        69.3    7e-12   
ref|XP_003559685.1|  PREDICTED: peamaclein-like                       69.3    7e-12   
ref|XP_007160666.1|  hypothetical protein PHAVU_001G006700g           69.3    7e-12   
ref|NP_001176009.1|  Os10g0115550                                     69.7    7e-12   
ref|XP_009128056.1|  PREDICTED: gibberellin-regulated protein 6       69.3    7e-12   
ref|XP_004138815.1|  PREDICTED: gibberellin-regulated protein 9-like  69.3    7e-12   
ref|XP_009106131.1|  PREDICTED: gibberellin-regulated protein 12-...  69.3    7e-12   
ref|XP_006295413.1|  hypothetical protein CARUB_v10024510mg           69.3    8e-12   
ref|XP_004291363.1|  PREDICTED: snakin-2-like                         69.3    8e-12   
ref|XP_009797080.1|  PREDICTED: gibberellin-regulated protein 5-like  69.3    8e-12   
gb|ADE77769.1|  unknown                                               69.3    8e-12   
ref|XP_006599930.1|  PREDICTED: gibberellin-regulated protein 1-like  69.7    8e-12   
ref|XP_008656256.1|  PREDICTED: uncharacterized protein LOC100286041  70.9    9e-12   
ref|XP_008659198.1|  PREDICTED: gibberellin-regulated protein 12      68.9    9e-12   
gb|ACG25489.1|  gibberellin-regulated protein 2 precursor             68.6    1e-11   
gb|ACG38131.1|  gibberellin-regulated protein 2 precursor             68.6    1e-11   
ref|XP_011083550.1|  PREDICTED: snakin-2-like                         68.6    1e-11   
ref|XP_011074928.1|  PREDICTED: gibberellin-regulated protein 9       68.9    1e-11   
ref|XP_008441216.1|  PREDICTED: gibberellin-regulated protein 9       68.6    1e-11   
ref|XP_011097237.1|  PREDICTED: peamaclein-like                       68.2    1e-11   
ref|XP_007145489.1|  hypothetical protein PHAVU_007G243400g           68.6    1e-11   
gb|AFK34043.1|  unknown                                               68.2    1e-11   
ref|NP_001240204.1|  uncharacterized protein LOC100788586 precursor   68.6    1e-11   
ref|XP_008355724.1|  PREDICTED: gibberellin-regulated protein 12-...  68.2    2e-11   
ref|XP_007212837.1|  hypothetical protein PRUPE_ppa020764mg           68.2    2e-11   
ref|XP_006589456.1|  PREDICTED: gibberellin-regulated protein 2-like  67.8    2e-11   
gb|EYU37879.1|  hypothetical protein MIMGU_mgv1a016790mg              68.2    2e-11   
ref|XP_010100518.1|  hypothetical protein L484_027833                 72.8    2e-11   
gb|AFK36958.1|  unknown                                               68.2    2e-11   
ref|XP_002881134.1|  gibberellin-regulated family protein             67.8    2e-11   
ref|XP_003589486.1|  Gibberellin-regulated protein                    67.8    2e-11   
ref|XP_004961979.1|  PREDICTED: gibberellin-regulated protein 3-like  67.4    2e-11   
ref|XP_010538071.1|  PREDICTED: gibberellin-regulated protein 6       67.8    2e-11   
ref|XP_002307719.1|  hypothetical protein POPTR_0005s26020g           67.4    2e-11   
ref|XP_002441006.1|  hypothetical protein SORBIDRAFT_09g018790        68.6    2e-11   
ref|XP_010469795.1|  PREDICTED: gibberellin-regulated protein 12-...  67.8    2e-11   
ref|XP_008464949.1|  PREDICTED: protein GAST1-like                    68.2    2e-11   
ref|XP_009803055.1|  PREDICTED: gibberellin-regulated protein 5-l...  67.8    3e-11   
ref|XP_007216796.1|  hypothetical protein PRUPE_ppa023616mg           67.8    3e-11   
gb|AEX55233.1|  cold-regulated gibberellin-regulated protein 1 LT...  67.8    3e-11   
ref|XP_010469794.1|  PREDICTED: gibberellin-regulated protein 12-...  67.8    3e-11   
ref|XP_010685022.1|  PREDICTED: gibberellin-regulated protein 12-...  67.4    3e-11   
ref|XP_006828424.1|  hypothetical protein AMTR_s00060p00095260        67.0    3e-11   
ref|XP_009616241.1|  PREDICTED: gibberellin-regulated protein 5-like  67.4    3e-11   
ref|XP_011045095.1|  PREDICTED: gibberellin-regulated protein 1-like  67.4    3e-11   
ref|XP_010062007.1|  PREDICTED: gibberellin-regulated protein 9       67.4    3e-11   
ref|XP_002887551.1|  hypothetical protein ARALYDRAFT_895333           67.4    3e-11   
ref|XP_009798156.1|  PREDICTED: gibberellin-regulated protein 9-like  67.8    4e-11   
ref|XP_004982447.1|  PREDICTED: snakin-1-like                         67.0    4e-11   
gb|AEC10958.1|  gibberellin induced protein                           67.4    4e-11   
ref|XP_002442726.1|  hypothetical protein SORBIDRAFT_08g001840        67.4    4e-11   
ref|XP_009803054.1|  PREDICTED: gibberellin-regulated protein 5-l...  67.0    4e-11   
ref|XP_009762897.1|  PREDICTED: gibberellin-regulated protein 5-like  67.0    5e-11   
gb|AAC32128.1|  GASA5-like protein                                    67.0    5e-11   
gb|AAW83819.1|  GASA2-like protein                                    67.0    6e-11   
ref|XP_010672958.1|  PREDICTED: gibberellin-regulated protein 13-...  67.0    6e-11   
ref|XP_006473655.1|  PREDICTED: snakin-2-like                         66.6    6e-11   
ref|XP_007028593.1|  Gibberellin-regulated family protein             67.0    6e-11   
ref|XP_006380659.1|  hypothetical protein POPTR_0007s10250g           66.6    6e-11   
ref|NP_177605.2|  gibberellin-regulated protein 6                     66.6    6e-11   
ref|XP_009604514.1|  PREDICTED: gibberellin-regulated protein 9-like  67.4    6e-11   
ref|XP_010510285.1|  PREDICTED: gibberellin-regulated protein 12-...  66.6    6e-11   
ref|XP_010428457.1|  PREDICTED: gibberellin-regulated protein 6-like  66.6    6e-11   
ref|XP_008240742.1|  PREDICTED: protein GAST1                         67.0    6e-11   
ref|XP_010672957.1|  PREDICTED: gibberellin-regulated protein 13-...  66.6    6e-11   
ref|XP_011045097.1|  PREDICTED: gibberellin-regulated protein 11-...  66.2    6e-11   
ref|XP_009613810.1|  PREDICTED: gibberellin-regulated protein 5-like  66.2    6e-11   
ref|XP_003617836.1|  Gibberellin induced protein                      67.4    7e-11   
ref|XP_006421229.1|  hypothetical protein CICLE_v10006243mg           66.6    7e-11   
ref|XP_010414214.1|  PREDICTED: gibberellin-regulated protein 12-...  66.6    7e-11   
ref|XP_010930806.1|  PREDICTED: gibberellin-regulated protein 11 ...  66.6    7e-11   
ref|XP_003598155.1|  Gibberellin induced protein                      67.4    7e-11   
ref|XP_009347627.1|  PREDICTED: protein GAST1-like                    66.6    7e-11   
ref|XP_009410001.1|  PREDICTED: gibberellin-regulated protein 6-like  66.6    7e-11   
ref|XP_006491553.1|  PREDICTED: protein GAST1-like                    66.6    7e-11   
ref|XP_002308912.2|  hypothetical protein POPTR_0006s04300g           66.6    7e-11   
gb|KHN14859.1|  Gibberellin-regulated protein 9                       65.5    8e-11   
gb|KCW44316.1|  hypothetical protein EUGRSUZ_L02235                   66.2    8e-11   
ref|XP_006390402.1|  hypothetical protein EUTSA_v10019355mg           66.2    8e-11   
ref|XP_008392374.1|  PREDICTED: protein GAST1 isoform X2              66.6    8e-11   
ref|XP_010258349.1|  PREDICTED: gibberellin-regulated protein 6 i...  66.2    8e-11   
gb|AES68406.2|  GASA/GAST/Snakin                                      67.4    8e-11   
gb|AEZ00909.1|  putative gibberellin-regulated protein                66.6    8e-11   
ref|XP_011083551.1|  PREDICTED: gibberellin-regulated protein 1-like  66.2    8e-11   
ref|XP_007034358.1|  Gibberellin-regulated family protein             67.0    8e-11   
ref|XP_008392373.1|  PREDICTED: protein GAST1 isoform X1              66.6    8e-11   
ref|XP_010248044.1|  PREDICTED: gibberellin-regulated protein 6-like  66.2    8e-11   
ref|XP_010060204.1|  PREDICTED: snakin-2-like                         66.2    8e-11   
ref|XP_007017799.1|  Gibberellin-regulated family protein isoform 1   66.2    8e-11   
gb|AET00795.2|  GASA/GAST/Snakin                                      67.0    9e-11   
ref|XP_008244953.1|  PREDICTED: protein GAST1-like                    66.2    9e-11   
ref|XP_011027306.1|  PREDICTED: protein GAST1-like                    66.2    9e-11   
ref|XP_010471557.1|  PREDICTED: gibberellin-regulated protein 6-like  65.9    9e-11   
ref|XP_010258350.1|  PREDICTED: gibberellin-regulated protein 6 i...  65.9    9e-11   
gb|KEH43555.1|  Thionin-like protein                                  65.9    9e-11   
ref|XP_010061060.1|  PREDICTED: snakin-2-like isoform X3              65.9    1e-10   
ref|XP_010061058.1|  PREDICTED: snakin-2-like isoform X1              65.9    1e-10   
ref|XP_010416324.1|  PREDICTED: gibberellin-regulated protein 6       65.9    1e-10   
ref|XP_006606218.1|  PREDICTED: gibberellin-regulated protein 2-l...  65.9    1e-10   
gb|EMT22883.1|  hypothetical protein F775_27923                       65.9    1e-10   
gb|EYU23951.1|  hypothetical protein MIMGU_mgv1a024055mg              65.5    1e-10   
ref|XP_010510284.1|  PREDICTED: gibberellin-regulated protein 12-...  65.9    1e-10   
ref|XP_008237395.1|  PREDICTED: gibberellin-regulated protein 9       65.9    1e-10   
ref|XP_004173361.1|  PREDICTED: gibberellin-regulated protein 9-like  65.5    1e-10   
ref|XP_003554146.1|  PREDICTED: protein GAST1-like isoform 1          66.6    1e-10   
gb|KDP26211.1|  hypothetical protein JCGZ_22457                       66.2    1e-10   
gb|AAQ57667.2|  Gasa4-like protein                                    65.9    1e-10   
ref|XP_006421227.1|  hypothetical protein CICLE_v10006243mg           65.5    1e-10   
ref|XP_011080381.1|  PREDICTED: protein GAST1-like                    65.9    1e-10   
ref|NP_001149114.1|  GAST1 protein precursor                          66.2    1e-10   
ref|XP_009592386.1|  PREDICTED: gibberellin-regulated protein 5-like  65.9    1e-10   
ref|XP_004493436.1|  PREDICTED: protein GAST1-like                    65.9    1e-10   
ref|XP_004962265.1|  PREDICTED: protein GAST1-like isoform X2         66.2    1e-10   
gb|KDO38643.1|  hypothetical protein CISIN_1g035679mg                 65.9    1e-10   
ref|XP_006421228.1|  hypothetical protein CICLE_v10006243mg           65.1    1e-10   
ref|XP_004962264.1|  PREDICTED: protein GAST1-like isoform X1         66.2    1e-10   
ref|XP_009403172.1|  PREDICTED: gibberellin-regulated protein 6-like  65.5    2e-10   
tpg|DAA35384.1|  TPA: gibberellin-regulated protein 2                 65.9    2e-10   
ref|XP_010060203.1|  PREDICTED: snakin-2-like                         65.5    2e-10   
ref|XP_010045037.1|  PREDICTED: protein GAST1-like                    65.5    2e-10   
emb|CDP17256.1|  unnamed protein product                              65.5    2e-10   
ref|XP_008803444.1|  PREDICTED: peamaclein-like                       65.5    2e-10   
gb|KDP36926.1|  hypothetical protein JCGZ_08217                       65.1    2e-10   
gb|EEC79111.1|  hypothetical protein OsI_19744                        66.2    2e-10   
gb|EMT22213.1|  hypothetical protein F775_13483                       64.7    2e-10   
gb|AFK49188.1|  unknown                                               65.5    2e-10   
emb|CDP17251.1|  unnamed protein product                              65.1    2e-10   
ref|XP_002448761.1|  hypothetical protein SORBIDRAFT_06g032730        65.5    2e-10   
ref|XP_010060207.1|  PREDICTED: snakin-2-like isoform X2              65.1    2e-10   
ref|XP_010060206.1|  PREDICTED: snakin-2-like isoform X1              65.1    2e-10   
gb|AAT42201.1|  gibberellin-stimulated protein                        65.5    2e-10   
ref|XP_011075384.1|  PREDICTED: protein GAST1-like                    65.5    2e-10   
ref|XP_004140359.1|  PREDICTED: protein RSI-1-like                    65.5    2e-10   
ref|NP_001152602.1|  LOC100286242 precursor                           65.9    2e-10   
gb|KDP27148.1|  hypothetical protein JCGZ_19847                       65.1    2e-10   
ref|XP_003523021.1|  PREDICTED: gibberellin-regulated protein 4       65.1    2e-10   
gb|AGC92009.1|  snakin                                                65.1    2e-10   
ref|NP_001238684.1|  uncharacterized protein LOC100306171 precursor   65.1    2e-10   
gb|EMS62925.1|  hypothetical protein TRIUR3_24623                     64.7    2e-10   
ref|XP_002272568.1|  PREDICTED: gibberellin-regulated protein 9       65.1    2e-10   
ref|XP_007034357.1|  Gibberellin-regulated family protein             65.5    2e-10   
gb|EAZ36571.1|  hypothetical protein OsJ_20910                        65.1    2e-10   
ref|XP_010091518.1|  hypothetical protein L484_015945                 65.1    2e-10   
gb|EAZ00446.1|  hypothetical protein OsI_22466                        65.1    2e-10   
ref|XP_008649585.1|  PREDICTED: gibberellin-regulated protein 6-like  65.9    2e-10   
ref|XP_011098626.1|  PREDICTED: gibberellin-regulated protein 4-like  65.1    2e-10   
gb|ABQ42002.1|  gibberellin induced protein                           65.1    2e-10   
gb|AFH57279.1|  GASA-like protein                                     65.1    2e-10   
ref|NP_001150577.1|  LOC100284210 precursor                           65.9    2e-10   
gb|EMT27427.1|  hypothetical protein F775_24525                       65.1    2e-10   
ref|XP_002464248.1|  hypothetical protein SORBIDRAFT_01g014890        64.7    3e-10   
gb|AFW55883.1|  GAST1 protein                                         65.5    3e-10   
ref|XP_004299361.1|  PREDICTED: gibberellin-regulated protein 6-like  64.7    3e-10   
ref|XP_007162142.1|  hypothetical protein PHAVU_001G127700g           65.5    3e-10   
ref|XP_007143651.1|  hypothetical protein PHAVU_007G089800g           64.7    3e-10   
ref|XP_010105157.1|  hypothetical protein L484_003895                 65.1    3e-10   
gb|ABK22391.1|  unknown                                               64.7    3e-10   
ref|XP_010246225.1|  PREDICTED: protein GAST1-like                    65.1    3e-10   
gb|KDP22135.1|  hypothetical protein JCGZ_25966                       65.1    3e-10   
ref|XP_010673717.1|  PREDICTED: protein GAST1-like isoform X1         64.7    3e-10   
ref|XP_006446220.1|  hypothetical protein CICLE_v10017244mg           65.1    3e-10   
ref|XP_008466485.1|  PREDICTED: gibberellin-regulated protein 1-like  64.7    3e-10   
ref|XP_011074682.1|  PREDICTED: snakin-2-like                         64.7    3e-10   
emb|CBL95259.1|  gasa5 like protein                                   64.7    3e-10   
ref|XP_004162561.1|  PREDICTED: gibberellin-regulated protein 1-like  64.7    3e-10   
ref|XP_006299108.1|  hypothetical protein CARUB_v10015247mg           64.3    3e-10   
ref|XP_006351146.1|  PREDICTED: gibberellin-regulated protein 9-like  64.7    3e-10   
ref|XP_004250385.1|  PREDICTED: snakin-2-like                         65.5    3e-10   
ref|XP_006473657.1|  PREDICTED: gibberellin-regulated protein 1-like  64.7    3e-10   
gb|KDO50409.1|  hypothetical protein CISIN_1g033715mg                 64.7    3e-10   
ref|XP_008221262.1|  PREDICTED: gibberellin-regulated protein 11-...  64.7    3e-10   
gb|AHK24891.1|  cold-regulated LTCOR12                                63.9    3e-10   
gb|AFK42462.1|  unknown                                               64.7    3e-10   
gb|EYU36786.1|  hypothetical protein MIMGU_mgv1a016861mg              64.7    3e-10   
ref|XP_007221450.1|  hypothetical protein PRUPE_ppa014189mg           63.9    3e-10   
gb|ADX36135.1|  gibberellic acid-stimulated protein 1                 64.3    3e-10   
ref|XP_006477453.1|  PREDICTED: gibberellin-regulated protein 6-like  64.7    3e-10   
ref|XP_004136382.1|  PREDICTED: snakin-2-like                         64.3    3e-10   
gb|AIC33061.1|  putative gibberellin-regulated protein                64.7    3e-10   
gb|AGL92232.1|  GASA-like protein GEG2                                64.3    3e-10   
gb|AAG52379.1|AC011765_31  GAST1-like protein; 109761-110213          63.9    3e-10   
ref|XP_010930807.1|  PREDICTED: gibberellin-regulated protein 9 i...  64.7    3e-10   
ref|XP_010060208.1|  PREDICTED: snakin-2-like                         64.3    3e-10   
ref|XP_010673718.1|  PREDICTED: protein GAST1-like isoform X2         64.7    3e-10   
gb|ABQ42001.1|  gibberellin induced protein                           64.7    3e-10   
ref|XP_004496365.1|  PREDICTED: gibberellin-regulated protein 2-l...  64.3    3e-10   
ref|XP_006655989.1|  PREDICTED: gibberellin-regulated protein 6-like  64.3    3e-10   
ref|XP_006434614.1|  hypothetical protein CICLE_v10002796mg           65.1    4e-10   
ref|XP_008344997.1|  PREDICTED: protein GAST1-like                    64.7    4e-10   
gb|KHN48768.1|  Protein GAST1                                         63.5    4e-10   
gb|EMS62924.1|  hypothetical protein TRIUR3_24622                     63.9    4e-10   
ref|XP_006338319.1|  PREDICTED: protein GAST1-like                    64.7    4e-10   
ref|XP_010257391.1|  PREDICTED: gibberellin-regulated protein 6-like  64.3    4e-10   
ref|XP_009408158.1|  PREDICTED: gibberellin-regulated protein 2-like  64.3    4e-10   
ref|XP_010464684.1|  PREDICTED: gibberellin-regulated protein 13-...  64.7    4e-10   



>gb|AGE15502.1| GA-stimulated transcript-like protein 6 [Gossypium hirsutum]
Length=88

 Score =   122 bits (307),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
            +++M  +L+S +L+     V + GS FC SKCA RCSKAG   RCLKYCGICCEKCHCVP
Sbjct  3    MVLMLFLLVSLALSSCFFEVSIAGSDFCDSKCAVRCSKAGVQDRCLKYCGICCEKCHCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGTFGHKD+CPCYRDM+NSKG+ KCP
Sbjct  63   SGTFGHKDECPCYRDMKNSKGKSKCP  88



>ref|XP_006472264.1| PREDICTED: snakin-1-like [Citrus sinensis]
 gb|KDO81573.1| hypothetical protein CISIN_1g039784mg [Citrus sinensis]
Length=88

 Score =   122 bits (306),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
            + ++  +L+S  L      V + GS FC SKCA RCSKAGR  RCLKYCGICC+KCHCVP
Sbjct  3    LALVTFLLVSLVLTSTFFEVSMAGSDFCDSKCAVRCSKAGREDRCLKYCGICCDKCHCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+GHKD+CPCYRD++NSKG+PKCP
Sbjct  63   SGTYGHKDECPCYRDLKNSKGKPKCP  88



>ref|XP_006433597.1| hypothetical protein CICLE_v10002979mg [Citrus clementina]
 gb|ESR46837.1| hypothetical protein CICLE_v10002979mg [Citrus clementina]
 gb|KDO36540.1| hypothetical protein CISIN_1g037233mg [Citrus sinensis]
Length=88

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
            + ++  +L+S  +      V + GS FC SKCA RCSKAGR  RCLKYCGICC+KCHCVP
Sbjct  3    LALVTFLLVSLVVTSTFFEVSMAGSDFCDSKCAVRCSKAGREDRCLKYCGICCDKCHCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+GHKD+CPCYRD++NSKG+PKCP
Sbjct  63   SGTYGHKDECPCYRDLKNSKGKPKCP  88



>ref|XP_010059861.1| PREDICTED: peamaclein [Eucalyptus grandis]
 gb|KCW66306.1| hypothetical protein EUGRSUZ_F00131 [Eucalyptus grandis]
Length=89

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGH  390
            +L++  L+       + GSSFC SKCA RCSKAGR  RCL+YCGICCEKC CVPSGT+GH
Sbjct  10   LLVALLLSPAFFDAAMAGSSFCDSKCAVRCSKAGRMDRCLQYCGICCEKCQCVPSGTYGH  69

Query  391  KDDCPCYRDMENSKGRPKCP  450
            KD+CPCYRDM+NSKG PKCP
Sbjct  70   KDECPCYRDMKNSKGEPKCP  89



>ref|XP_010066166.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW63994.1| hypothetical protein EUGRSUZ_G01682 [Eucalyptus grandis]
Length=89

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 5/92 (5%)
 Frame = +1

Query  175  RVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCE  354
            ++AL   L++ + L+S SL +      + GSSFC SKCAARCSKAG+  RCL+YC ICC+
Sbjct  3    KLALTTFLLV-AFLLSSSLFD----ATMAGSSFCDSKCAARCSKAGKKDRCLEYCRICCK  57

Query  355  KCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            KC CVPSGT+G+KD+CPCYRDM+NSKG+PKCP
Sbjct  58   KCQCVPSGTYGNKDECPCYRDMKNSKGQPKCP  89



>ref|XP_010066158.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW63991.1| hypothetical protein EUGRSUZ_G01678 [Eucalyptus grandis]
Length=89

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
            + +   +L+++  +       + GSSFC SKCA RCSKAGR  RCL+YCGI C+KC CVP
Sbjct  4    LTLATFLLVAFLFSSFFFDATMAGSSFCDSKCAVRCSKAGRKDRCLEYCGIFCDKCQCVP  63

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+GHKD+CPCYRDM+NSKG+PKCP
Sbjct  64   SGTYGHKDECPCYRDMKNSKGQPKCP  89



>gb|KHF99282.1| Snakin-1 [Gossypium arboreum]
 gb|KHF99299.1| Snakin-1 [Gossypium arboreum]
Length=88

 Score =   114 bits (286),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS FC SKCA RCSKAG   RCLKYCGICCEKCHCVPSGTFGHKD+CPCYRDM+NS
Sbjct  22   VSIAGSDFCDSKCAVRCSKAGVQDRCLKYCGICCEKCHCVPSGTFGHKDECPCYRDMKNS  81

Query  430  KGRPKCP  450
            KG+ KCP
Sbjct  82   KGKSKCP  88



>ref|XP_011069570.1| PREDICTED: peamaclein [Sesamum indicum]
 ref|XP_011069571.1| PREDICTED: peamaclein [Sesamum indicum]
Length=88

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGH  390
            ++ +  L   ++ +  + SSFC  KC+ RCSKAGR  RCLKYCGICCEKCHCVPSGT+G+
Sbjct  9    LVFAIVLIMITSAMGDDDSSFCDGKCSVRCSKAGRQDRCLKYCGICCEKCHCVPSGTYGN  68

Query  391  KDDCPCYRDMENSKGRPKCP  450
            KD+CPCYRDM+NSKG PKCP
Sbjct  69   KDECPCYRDMKNSKGNPKCP  88



>ref|XP_007223838.1| hypothetical protein PRUPE_ppa014086mg [Prunus persica]
 gb|EMJ25037.1| hypothetical protein PRUPE_ppa014086mg [Prunus persica]
Length=88

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GSSFC SKC  RCSKAG   RCLKYCGICCEKCHCVPSGT+G+KD+CPCYRD++NS
Sbjct  22   ATMAGSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNS  81

Query  430  KGRPKCP  450
            KG PKCP
Sbjct  82   KGNPKCP  88



>ref|XP_009360284.1| PREDICTED: peamaclein [Pyrus x bretschneideri]
Length=88

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 4/86 (5%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
              M+  +++S S  E S    + GS FC SKC  RCSKAG   RCLKYCGICCEKCHCVP
Sbjct  7    TFMLVCLVLSSSFFEAS----MAGSPFCDSKCGVRCSKAGYKERCLKYCGICCEKCHCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRD++NSKG+ KCP
Sbjct  63   SGTYGNKDECPCYRDLKNSKGKDKCP  88



>ref|XP_010556423.1| PREDICTED: peamaclein [Tarenaya hassleriana]
Length=90

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSK  432
               G  FC +KC  RCSKAGR  RCLKYC ICCEKCHCVPSGT+GHKD+CPCYRDM+NSK
Sbjct  25   YTHGDDFCEAKCTERCSKAGRQDRCLKYCNICCEKCHCVPSGTYGHKDECPCYRDMKNSK  84

Query  433  GRPKCP  450
            G PKCP
Sbjct  85   GDPKCP  90



>ref|XP_008360977.1| PREDICTED: peamaclein [Malus domestica]
Length=88

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 4/86 (5%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
              M+  +++S S  E S    + GS FC SKC  RCSKAG   RCLKYCGICCEKCHCVP
Sbjct  7    TFMLVCLVLSSSFFEAS----MAGSPFCDSKCGVRCSKAGYKERCLKYCGICCEKCHCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRD++NSKG  KCP
Sbjct  63   SGTYGNKDECPCYRDLKNSKGEDKCP  88



>ref|XP_004252297.1| PREDICTED: peamaclein [Solanum lycopersicum]
Length=88

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS FC SKC  RCSKAGR  RCLKYCGICCE+CHC+PSGT+GHKD+CPCYRD +NS
Sbjct  22   ATIAGSDFCDSKCNVRCSKAGRQDRCLKYCGICCEECHCLPSGTYGHKDECPCYRDKKNS  81

Query  430  KGRPKCP  450
            KG PKCP
Sbjct  82   KGGPKCP  88



>ref|XP_002285141.1| PREDICTED: peamaclein [Vitis vinifera]
 emb|CBI19434.3| unnamed protein product [Vitis vinifera]
Length=88

 Score =   109 bits (273),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPS  375
            L+   +L+   L+       + GSSFC SKCAARCSKAG   RCLKYCGICCE+C CVPS
Sbjct  4    LLATFLLVFLVLSSSFVQNAMAGSSFCDSKCAARCSKAGMKDRCLKYCGICCEECKCVPS  63

Query  376  GTFGHKDDCPCYRDMENSKGRPKCP  450
            GT+G+K +CPCY+D +NSKG+PKCP
Sbjct  64   GTYGNKHECPCYKDKKNSKGQPKCP  88



>sp|P86888.1|PMLN_PRUPE RecName: Full=Peamaclein; AltName: Allergen=Pru p 7 [Prunus persica]
Length=63

 Score =   108 bits (270),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +1

Query  262  GSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRP  441
            GSSFC SKC  RCSKAG   RCLKYCGICCEKCHCVPSGT+G+KD+CPCYRD++NSKG P
Sbjct  1    GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNP  60

Query  442  KCP  450
            KCP
Sbjct  61   KCP  63



>ref|XP_011029030.1| PREDICTED: peamaclein-like [Populus euphratica]
Length=88

 Score =   109 bits (272),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 4/86 (5%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             + +  ++ S SL E    V V  S FC SKC+ RCSKAG   RCLKYCGICCEKC CVP
Sbjct  7    AIFLLCLVFSSSLFE----VTVAASGFCDSKCSVRCSKAGIKDRCLKYCGICCEKCKCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRDM+NSKG+PKCP
Sbjct  63   SGTYGNKHECPCYRDMKNSKGKPKCP  88



>gb|AFT92001.1| gibberellin-regulated protein [Populus tomentosa]
 gb|AFT92013.1| gibberellin-regulated protein [Populus tomentosa]
Length=88

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGH  390
            ++ S SL E    V +  S FC SKC+ARCSKAG   RCLKYCGICCEKC CVPSGT+G+
Sbjct  13   LVFSSSLFE----VTMAASGFCDSKCSARCSKAGIKDRCLKYCGICCEKCKCVPSGTYGN  68

Query  391  KDDCPCYRDMENSKGRPKCP  450
            K +CPCYRDM+NSKG+PKCP
Sbjct  69   KHECPCYRDMKNSKGKPKCP  88



>gb|AFT92002.1| gibberellin-regulated protein [Populus alba x Populus glandulosa]
 gb|AFT92014.1| gibberellin-regulated protein [Populus alba x Populus glandulosa]
Length=88

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 4/80 (5%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGH  390
            ++ S SL E    V +  S FC SKC+ARCSKAG   RCLKYCGICCEKC CVPSGT+G+
Sbjct  13   LVFSSSLFE----VTMAASGFCDSKCSARCSKAGIKDRCLKYCGICCEKCKCVPSGTYGN  68

Query  391  KDDCPCYRDMENSKGRPKCP  450
            K +CPCYRDM+NSKG+PKCP
Sbjct  69   KLECPCYRDMKNSKGKPKCP  88



>ref|XP_010443767.1| PREDICTED: gibberellin-regulated protein 10-like [Camelina sativa]
Length=87

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 62/85 (73%), Gaps = 5/85 (6%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPS  375
              + S+L++ SL   ST       S CG KC  RCSKAGR  RCLKYC ICCEKC CVPS
Sbjct  8    FFIISLLVTSSLFMLST-----ADSSCGGKCNVRCSKAGRQDRCLKYCNICCEKCQCVPS  62

Query  376  GTFGHKDDCPCYRDMENSKGRPKCP  450
            GT+GHKD+CPCYRDM++SKG PKCP
Sbjct  63   GTYGHKDECPCYRDMKSSKGTPKCP  87



>ref|XP_010105475.1| hypothetical protein L484_010255 [Morus notabilis]
 gb|EXC04831.1| hypothetical protein L484_010255 [Morus notabilis]
Length=87

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPS  375
            L+  + L+   L+       + GS+FC SKC  RCSKAG   RCLKYC +CC KC CVPS
Sbjct  3    LVFAAFLICLVLSSSFVETTMAGSAFCDSKCEVRCSKAGVKDRCLKYCKLCCNKCQCVPS  62

Query  376  GTFGHKDDCPCYRDMENSKGRPKCP  450
            GT+GHKD+CPCYRD++NSKG+ KCP
Sbjct  63   GTYGHKDECPCYRDLKNSKGQSKCP  87



>ref|XP_002510126.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF52313.1| GAST1 protein precursor, putative [Ricinus communis]
Length=88

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 63/86 (73%), Gaps = 4/86 (5%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             L +   +++ SL E    V V GS FC SKC  RC KAG   RCLKYCGICCEKC CVP
Sbjct  7    ALFLVCFVLTSSLFE----VTVAGSGFCDSKCEKRCEKAGVKDRCLKYCGICCEKCKCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRDM+NSKG+PKCP
Sbjct  63   SGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|XP_009773391.1| PREDICTED: peamaclein-like [Nicotiana sylvestris]
Length=88

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              V GS FC SKC  RCSKAGR  RCLKYCGICC +C CVPSGT+G+KD+CPCYRD +NS
Sbjct  22   TTVAGSDFCDSKCKIRCSKAGRQDRCLKYCGICCNECQCVPSGTYGNKDECPCYRDKKNS  81

Query  430  KGRPKCP  450
            KG+PKCP
Sbjct  82   KGKPKCP  88



>ref|XP_006374850.1| hypothetical protein POPTR_0014s02030g [Populus trichocarpa]
 gb|ERP52647.1| hypothetical protein POPTR_0014s02030g [Populus trichocarpa]
Length=88

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 4/86 (5%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             + +  ++ S SL E    V +  S FC SKC+ RCSKAG   RCLKYCGICCEKC CVP
Sbjct  7    AIFLLCLVFSSSLFE----VTMAASGFCDSKCSVRCSKAGIKDRCLKYCGICCEKCKCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRDM+NSKG+PKCP
Sbjct  63   SGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|XP_004290947.1| PREDICTED: peamaclein-like [Fragaria vesca subsp. vesca]
Length=88

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
            ++    +L+   L        + GS FC SKC  RCSKAG   RCLKYCGICC+KC+CVP
Sbjct  3    LVFATFMLVFLVLGSSVFETTMAGSHFCDSKCGVRCSKAGYKERCLKYCGICCDKCNCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRD++NSKG PKCP
Sbjct  63   SGTYGNKDECPCYRDLKNSKGDPKCP  88



>gb|KHN21405.1| Snakin-1 [Glycine soja]
Length=88

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%), Gaps = 5/93 (5%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICC  351
            ++VA   VL++  +++S SL E    V + GS+FC SKCA RCS+AG   RC ++CGICC
Sbjct  1    MKVAFVAVLLI-CLVLSSSLFE----VSMAGSAFCSSKCAKRCSRAGMKDRCTRFCGICC  55

Query  352  EKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             KC CVPSGT+G+K +CPCYRDM+NSKG+PKCP
Sbjct  56   SKCRCVPSGTYGNKHECPCYRDMKNSKGKPKCP  88



>ref|NP_181486.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|O80641.1|GASA8_ARATH RecName: Full=Gibberellin-regulated protein 8; AltName: Full=GAST1 
protein homolog 8; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27845.1| similar to gibberellin-regulated proteins [Arabidopsis thaliana]
 gb|AEC09692.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=87

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPS  375
            L++    +   L   S  V+    S CG KC  RCSKAG+H  CLKYC ICC+KC+CVPS
Sbjct  3    LVVVQFFIISLLLTSSFSVLSSADSSCGGKCNVRCSKAGQHEECLKYCNICCQKCNCVPS  62

Query  376  GTFGHKDDCPCYRDMENSKGRPKCP  450
            GTFGHKD+CPCYRDM+NSKG  KCP
Sbjct  63   GTFGHKDECPCYRDMKNSKGGSKCP  87



>ref|XP_003550315.1| PREDICTED: snakin-1 [Glycine max]
 gb|KHN45269.1| Snakin-1 [Glycine soja]
Length=88

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 5/93 (5%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICC  351
            ++VA   VL++  +++S SL E    V + GS+FC SKC+ RCS+AG   RC+K+CGICC
Sbjct  1    MKVAFAAVLLI-CLVLSSSLFE----VSMAGSAFCSSKCSKRCSRAGMKDRCMKFCGICC  55

Query  352  EKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             KC+CVPSGT+G+K +CPCYRDM+NSKG+ KCP
Sbjct  56   SKCNCVPSGTYGNKHECPCYRDMKNSKGKAKCP  88



>ref|XP_009591073.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=88

 Score =   106 bits (265),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS FC SKC  RCSKAGR  RCLKYCGICC++C CVPSGT+G+KD+CPCYRD +NS
Sbjct  22   TTMAGSDFCDSKCKIRCSKAGRQDRCLKYCGICCKECQCVPSGTYGNKDECPCYRDKKNS  81

Query  430  KGRPKCP  450
            KG+PKCP
Sbjct  82   KGQPKCP  88



>ref|NP_001236984.1| uncharacterized protein LOC100500113 [Glycine max]
 gb|ACU14995.1| unknown [Glycine max]
Length=115

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 5/94 (5%)
 Frame = +1

Query  169  NIRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGIC  348
             ++VA   VL++  +++S SL E    V + GS+FC SKCA RCS+AG   RC ++CGIC
Sbjct  27   KMKVAFVAVLLI-CLVLSSSLFE----VSMAGSAFCSSKCAKRCSRAGMKDRCTRFCGIC  81

Query  349  CEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C KC CVPSGT+G+K +CPCYRDM+NSKG+PKCP
Sbjct  82   CSKCRCVPSGTYGNKHECPCYRDMKNSKGKPKCP  115



>ref|XP_006400907.1| hypothetical protein EUTSA_v10015142mg [Eutrema salsugineum]
 gb|ESQ42360.1| hypothetical protein EUTSA_v10015142mg [Eutrema salsugineum]
Length=91

 Score =   106 bits (265),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 5/86 (6%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCH-CVP  372
              + S+L++ SL   ST      SS CG KC  RCSKAGR  RCLKYC ICCEKC+ CVP
Sbjct  10   FFIISLLLTSSLFMLSTA----DSSPCGGKCNMRCSKAGRQDRCLKYCNICCEKCNNCVP  65

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRDM+NSKG+PKCP
Sbjct  66   SGTYGNKDECPCYRDMKNSKGQPKCP  91



>ref|XP_006346656.1| PREDICTED: peamaclein-like [Solanum tuberosum]
Length=69

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
              FC SKC  RCSKAGR  RCLKYCGICCE+CHCVPSGT+GHKD+CPCYRD +NSKG PK
Sbjct  8    EDFCDSKCNVRCSKAGRQDRCLKYCGICCEECHCVPSGTYGHKDECPCYRDKKNSKGGPK  67

Query  445  CP  450
            CP
Sbjct  68   CP  69



>gb|ACU13365.1| unknown [Glycine max]
Length=88

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 5/93 (5%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICC  351
            ++VA   VL++  +++S SL E    V + GS+FC SKC+ RCS+AG   RC+K+CGICC
Sbjct  1    MKVAFAAVLLI-CLVLSSSLFE----VSMAGSAFCSSKCSKRCSRAGMKDRCMKFCGICC  55

Query  352  EKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             KC+CVPSGT+G+K +CPCYRDM+NSKG+ KCP
Sbjct  56   GKCNCVPSGTYGNKHECPCYRDMKNSKGKAKCP  88



>ref|XP_006422868.1| hypothetical protein CICLE_v10029695mg [Citrus clementina]
 gb|ESR36108.1| hypothetical protein CICLE_v10029695mg [Citrus clementina]
 gb|KDO47927.1| hypothetical protein CISIN_1g034644mg [Citrus sinensis]
Length=88

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 64/86 (74%), Gaps = 4/86 (5%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             +++ S+++S+SL E +T     GS FC SKCA RC +AG   RCLKYCGICCE C CVP
Sbjct  7    TVVVCSLILSFSLLEPATA----GSPFCDSKCAERCKQAGVQDRCLKYCGICCEDCKCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRD  N KG+PKCP
Sbjct  63   SGTYGNKHECPCYRDKVNKKGKPKCP  88



>ref|XP_008377985.1| PREDICTED: peamaclein [Malus domestica]
 ref|XP_009354125.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
Length=88

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 4/86 (5%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
              M+  ++++ S  E S    + GS FC SKC  RCSKAG   RCL++CGICCEKC CVP
Sbjct  7    TFMLVCLVLTSSFFEAS----MAGSPFCDSKCGVRCSKAGFKNRCLRFCGICCEKCQCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRD++NSKG  KCP
Sbjct  63   SGTYGNKDECPCYRDLKNSKGEDKCP  88



>ref|XP_009120506.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=92

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC--HCVPSGTFGHKDDCPCYRDMENSKGR  438
            SS C  KC ARCSKAGR  RCLKYC ICCEKC  HCVPSGT+GHKD+CPCYRDM+NSKG+
Sbjct  29   SSSCNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGTYGHKDECPCYRDMKNSKGQ  88

Query  439  PKCP  450
            PKCP
Sbjct  89   PKCP  92



>gb|KHN42338.1| Snakin-1 [Glycine soja]
Length=90

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             L++ S+L+S+S  E   V+  E SS+C +KCA RCS AG   RC+KYCGICC +C CVP
Sbjct  7    TLILCSLLLSFSFLE--PVIAYEDSSYCSNKCADRCSSAGVKDRCVKYCGICCAECKCVP  64

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRD  N KG+PKCP
Sbjct  65   SGTYGNKHECPCYRDKLNKKGKPKCP  90



>ref|XP_009354123.1| PREDICTED: peamaclein-like isoform X1 [Pyrus x bretschneideri]
Length=88

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 4/86 (5%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
              M   + ++ S  E S    + GS FC SKC  RCSKAG   RCL++CGICCEKC CVP
Sbjct  7    TFMFVCLFLTSSFFEAS----MAGSPFCDSKCGVRCSKAGYKDRCLRFCGICCEKCQCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRD++NSKG  KCP
Sbjct  63   SGTYGNKDECPCYRDLKNSKGEDKCP  88



>ref|XP_003525918.1| PREDICTED: snakin-1 [Glycine max]
 gb|ACU14133.1| unknown [Glycine max]
 gb|KHN45165.1| Snakin-1 [Glycine soja]
Length=88

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            + + GS FC SKCA RC+KAG   RCL++CGICCEKC+CVPSGT+G+KD+CPCYRDM+NS
Sbjct  22   ISMAGSPFCDSKCAQRCAKAGVQDRCLRFCGICCEKCNCVPSGTYGNKDECPCYRDMKNS  81

Query  430  KGRPKCP  450
            KG+ KCP
Sbjct  82   KGKDKCP  88



>gb|KCW68672.1| hypothetical protein EUGRSUZ_F02269 [Eucalyptus grandis]
Length=89

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSK  432
             + GSSFCGSKC+ARC+KAG   RCLKYC ICC+KC CVPSGT+G+K +CPCYRD+ NSK
Sbjct  24   AMAGSSFCGSKCSARCAKAGLKDRCLKYCQICCDKCKCVPSGTYGNKHECPCYRDLRNSK  83

Query  433  GRPKCP  450
            G+PKCP
Sbjct  84   GKPKCP  89



>ref|XP_006346618.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS FC SKC  RCSKAGR  RCLKYCGICC +CHCVPSGT G+KD+CPCYRD +NS
Sbjct  23   ATIAGSDFCDSKCNYRCSKAGRQDRCLKYCGICCTECHCVPSGTSGNKDECPCYRDKKNS  82

Query  430  KGRPKCP  450
            KG PKCP
Sbjct  83   KGGPKCP  89



>ref|XP_010688303.1| PREDICTED: peamaclein [Beta vulgaris subsp. vulgaris]
Length=87

 Score =   104 bits (259),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  262  GSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRP  441
            GS FC SKC  RCSKAG   RCLKYCGICCE C CVPSGT+G+KD+CPCYRD +NSKG+P
Sbjct  25   GSDFCDSKCNVRCSKAGYQDRCLKYCGICCEACQCVPSGTYGNKDECPCYRDKKNSKGKP  84

Query  442  KCP  450
            KCP
Sbjct  85   KCP  87



>ref|XP_004252296.1| PREDICTED: peamaclein-like [Solanum lycopersicum]
Length=89

 Score =   104 bits (259),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS FC SKC  RCSKAGR  RCLKYCGICC +CHCVPSGT G+KD+CPCYRD +NS
Sbjct  23   ATIAGSEFCDSKCNFRCSKAGRQDRCLKYCGICCAECHCVPSGTSGNKDECPCYRDKKNS  82

Query  430  KGRPKCP  450
            KG PKCP
Sbjct  83   KGGPKCP  89



>ref|XP_007136735.1| hypothetical protein PHAVU_009G069900g [Phaseolus vulgaris]
 gb|ESW08729.1| hypothetical protein PHAVU_009G069900g [Phaseolus vulgaris]
Length=89

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  256  VEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKG  435
            + GS FC SKCA RC+KAG   RCLK+CGICCEKCHCVPSGT+G+KD+CPCYRD++NSKG
Sbjct  25   MAGSGFCDSKCARRCAKAGVKDRCLKFCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKG  84

Query  436  RPKCP  450
            + KCP
Sbjct  85   KGKCP  89



>ref|XP_002864654.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40913.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=89

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKC-HCVPSGTFG  387
            I++S  L     ++    SS CG KC  RCSKAGR  RCLKYC ICCEKC +CVPSGT+G
Sbjct  9    IIISLLLTSSLFMLSTADSSPCGGKCNVRCSKAGRQDRCLKYCNICCEKCNYCVPSGTYG  68

Query  388  HKDDCPCYRDMENSKGRPKCP  450
            +KD+CPCYRDM+NSKG  KCP
Sbjct  69   NKDECPCYRDMKNSKGTSKCP  89



>ref|XP_003636819.1| Snakin-1 [Medicago truncatula]
 ref|XP_003638468.1| Snakin-1 [Medicago truncatula]
 gb|KEH35780.1| GASA/GAST/Snakin [Medicago truncatula]
Length=85

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  262  GSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRP  441
            GS FC SKCA RCSKA    RCLK+CGICCEKC+CVPSGT+G+KD+CPCYRDM+NSKG+ 
Sbjct  23   GSDFCNSKCAVRCSKASIQDRCLKFCGICCEKCNCVPSGTYGNKDECPCYRDMKNSKGKG  82

Query  442  KCP  450
            KCP
Sbjct  83   KCP  85



>dbj|BAB08352.1| unnamed protein product [Arabidopsis thaliana]
Length=88

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKC-HCVPSGTFG  387
            +L+   L   S  ++    S CG KC  RCSKAGR  RCLKYC ICCEKC +CVPSGT+G
Sbjct  8    VLIISLLITSSLFILSTADSSCGGKCNVRCSKAGRQDRCLKYCNICCEKCNYCVPSGTYG  67

Query  388  HKDDCPCYRDMENSKGRPKCP  450
            +KD+CPCYRDM+NSKG  KCP
Sbjct  68   NKDECPCYRDMKNSKGTSKCP  88



>ref|XP_009354124.1| PREDICTED: peamaclein-like isoform X2 [Pyrus x bretschneideri]
Length=86

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +1

Query  199  MMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSG  378
            ++ +  M   L   S+      ++FC SKC  RCSKAG   RCL++CGICCEKC CVPSG
Sbjct  3    LIFATFMFVCLFLTSSFFEASMAAFCDSKCGVRCSKAGYKDRCLRFCGICCEKCQCVPSG  62

Query  379  TFGHKDDCPCYRDMENSKGRPKCP  450
            T+G+KD+CPCYRD++NSKG  KCP
Sbjct  63   TYGNKDECPCYRDLKNSKGEDKCP  86



>ref|NP_568914.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|Q8LFM2.1|GASAA_ARATH RecName: Full=Gibberellin-regulated protein 10; AltName: Full=GAST1 
protein homolog 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM61329.1| contains similarity to gibberellin-stimulated transcript 1 like 
protein [Arabidopsis thaliana]
 dbj|BAC42796.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00469.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97241.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=89

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 5/86 (6%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKC-HCVP  372
            +++ S+L++ SL   ST      SS CG KC  RCSKAGR  RCLKYC ICCEKC +CVP
Sbjct  8    VLIISLLITSSLFILSTA----DSSPCGGKCNVRCSKAGRQDRCLKYCNICCEKCNYCVP  63

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRDM+NSKG  KCP
Sbjct  64   SGTYGNKDECPCYRDMKNSKGTSKCP  89



>ref|XP_006361222.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
            VL +  IL S S  E + +     SS+C  KC+ARC KAG   RCLKYCGICC  C+CVP
Sbjct  7    VLFLVVILFSSSFIENAAMAT---SSYCDQKCSARCWKAGLKKRCLKYCGICCVACNCVP  63

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRD  NSKG+PKCP
Sbjct  64   SGTYGNKSECPCYRDKLNSKGKPKCP  89



>emb|CDY31590.1| BnaA10g12810D [Brassica napus]
Length=92

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (86%), Gaps = 2/64 (3%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC--HCVPSGTFGHKDDCPCYRDMENSKGR  438
            SS C  KC ARCSKAGR  RCLKYC ICCEKC  HCVPSGT+G+KD+CPCYRDM+NSKG+
Sbjct  29   SSSCNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGTYGNKDECPCYRDMKNSKGQ  88

Query  439  PKCP  450
            PKCP
Sbjct  89   PKCP  92



>ref|XP_006281389.1| hypothetical protein CARUB_v10027450mg [Capsella rubella]
 gb|EOA14287.1| hypothetical protein CARUB_v10027450mg [Capsella rubella]
Length=88

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = +1

Query  208  SILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFG  387
            S+L++ SL   ST      +S CG +C  RCSKAGR  RCLKYC ICC+KC CVPSGT+G
Sbjct  12   SLLLTSSLFMLSTA----DTSTCGGRCNVRCSKAGRQDRCLKYCNICCQKCDCVPSGTYG  67

Query  388  HKDDCPCYRDMENSKGRPKCP  450
            +K++CPCYRDM+NSKG  KCP
Sbjct  68   NKNECPCYRDMKNSKGTSKCP  88



>ref|XP_004499015.1| PREDICTED: snakin-1-like [Cicer arietinum]
Length=89

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             L++  +++S S+ E S +   EG  FC  KCA RCSKAG   RCLK+CGICC KC CVP
Sbjct  7    TLLLVCLILSSSMFEIS-LAGYEG--FCSPKCAMRCSKAGMRDRCLKFCGICCSKCKCVP  63

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRDM+NSKG+PKCP
Sbjct  64   SGTYGNKHECPCYRDMKNSKGKPKCP  89



>ref|XP_006486958.1| PREDICTED: snakin-1-like [Citrus sinensis]
Length=88

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 4/86 (5%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             +++ S+++S+SL E +    + GS FC SKCA RC  AG   RCLKYCGICCE C CVP
Sbjct  7    TVVVCSLILSFSLLEPA----MAGSPFCDSKCAERCKLAGVQDRCLKYCGICCEDCKCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRD  N KG+PKCP
Sbjct  63   SGTYGNKHECPCYRDKVNKKGKPKCP  88



>emb|CDY31591.1| BnaA10g12800D [Brassica napus]
Length=92

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC--HCVPSGTFGHKDDCPCYRDMENSKGR  438
            SS C  KC ARCSKAGR  RCLKYC ICCEKC  HCVPSGT+G+KD+CPCYRDM+NSKG 
Sbjct  29   SSPCNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGTYGNKDECPCYRDMKNSKGE  88

Query  439  PKCP  450
            PKCP
Sbjct  89   PKCP  92



>ref|XP_009120505.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=92

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC--HCVPSGTFGHKDDCPCYRDMENSKGR  438
            SS C  KC ARCSKAGR  RCLKYC ICCEKC  HCVPSGT+G+KD+CPCYRDM+NSKG 
Sbjct  29   SSPCNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGTYGNKDECPCYRDMKNSKGE  88

Query  439  PKCP  450
            PKCP
Sbjct  89   PKCP  92



>gb|EPS58046.1| hypothetical protein M569_16773 [Genlisea aurea]
Length=94

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 64/89 (72%), Gaps = 6/89 (7%)
 Frame = +1

Query  184  LRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCH  363
            ++C  ++  IL+++ +A+      V G+  C   C +RCS+AG   RCLKYCGICC KC+
Sbjct  12   MKCFYLLSLILVAFLVAD------VAGAGLCDGSCRSRCSRAGVVDRCLKYCGICCAKCN  65

Query  364  CVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CVPSGTFG+K  CPCYRD+ NSKG+PKCP
Sbjct  66   CVPSGTFGNKHQCPCYRDLRNSKGKPKCP  94



>ref|XP_006417449.1| hypothetical protein EUTSA_v10009615mg [Eutrema salsugineum]
 gb|ESQ35802.1| hypothetical protein EUTSA_v10009615mg [Eutrema salsugineum]
Length=88

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 62/86 (72%), Gaps = 6/86 (7%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCH-CVP  372
            L +  IL++ S  E ST       S CG KC  RCSKA +H  CLKYC ICCEKC+ CVP
Sbjct  8    LSIIFILLTSSFCELST-----ADSSCGGKCDVRCSKASQHEECLKYCNICCEKCNGCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGTFG+KD+CPCYRD++NSKG PKCP
Sbjct  63   SGTFGNKDECPCYRDLKNSKGGPKCP  88



>gb|KDP41652.1| hypothetical protein JCGZ_16059 [Jatropha curcas]
Length=88

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            +   GS+FC SKC ARC+ AG   RCLKYCGICCEKC CVPSGT+G+K +CPCYRD +NS
Sbjct  22   LTKAGSAFCDSKCGARCANAGVKDRCLKYCGICCEKCKCVPSGTYGNKHECPCYRDYKNS  81

Query  430  KGRPKCP  450
            KG+PKCP
Sbjct  82   KGKPKCP  88



>gb|AFK41274.1| unknown [Lotus japonicus]
Length=90

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICC  351
            +++A   VL++  +++S S  E   V +   S FC +KC  RCSKA    RCLK+CGICC
Sbjct  1    MKLAFANVLLVMCLVLSSSWFE---VSMASSSGFCDTKCEQRCSKASIQDRCLKFCGICC  57

Query  352  EKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +KC CVPSGT+G+K +CPCYRD++NSKG+ KCP
Sbjct  58   DKCKCVPSGTYGNKHECPCYRDLKNSKGKIKCP  90



>ref|XP_004501536.1| PREDICTED: peamaclein-like [Cicer arietinum]
Length=86

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +1

Query  262  GSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRP  441
            GS+FC ++C  RCSKA    RCLKYCGICCEKC+CVPSGT+G+KD+CPCYRDM+NSKG+ 
Sbjct  24   GSTFCDTRCGERCSKASFQDRCLKYCGICCEKCNCVPSGTYGNKDECPCYRDMKNSKGQG  83

Query  442  KCP  450
            KCP
Sbjct  84   KCP  86



>ref|XP_009144432.1| PREDICTED: gibberellin-regulated protein 8-like [Brassica rapa]
 emb|CDY20958.1| BnaA08g25670D [Brassica napus]
 emb|CDY20617.1| BnaC08g14410D [Brassica napus]
Length=88

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCH-CVP  372
            LM+    + + L   S  V     S CG KC  RCSKA +H  CLKYC ICCEKC+ CVP
Sbjct  3    LMVVQFCIIFFLLTSSFFVPSTADSSCGGKCNVRCSKASQHEECLKYCNICCEKCNGCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRD++NSKG PKCP
Sbjct  63   SGTYGNKDECPCYRDIKNSKGGPKCP  88



>emb|CDP01230.1| unnamed protein product [Coffea canephora]
Length=88

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GSSFC SKC  RCSKAG   RCLKYC ICC++C+CVPSGT+G+K +CPCYRD +NS
Sbjct  22   ATMAGSSFCDSKCGVRCSKAGVQDRCLKYCKICCQECNCVPSGTYGNKHECPCYRDKKNS  81

Query  430  KGRPKCP  450
            KG+PKCP
Sbjct  82   KGKPKCP  88



>ref|XP_009126643.1| PREDICTED: gibberellin-regulated protein 10 [Brassica rapa]
 emb|CDY09248.1| BnaA02g06740D [Brassica napus]
Length=89

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKC-HCVPSGTFGHKDDCPCYRDMEN  426
             ++  +S C  KC ARCSKAGR  RCLKYC ICCEKC +CVPSGT+G+KD+CPCYRDM+N
Sbjct  22   FMLSEASPCDGKCNARCSKAGRKDRCLKYCNICCEKCNYCVPSGTYGNKDECPCYRDMKN  81

Query  427  SKGRPKCP  450
            SKG+PKCP
Sbjct  82   SKGQPKCP  89



>sp|Q948Z4.1|SNAK1_SOLTU RecName: Full=Snakin-1; Flags: Precursor [Solanum tuberosum]
 emb|CAC44032.1| snakin-1 [Solanum tuberosum]
Length=88

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GSSFC SKC  RCSKAG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +NS
Sbjct  22   TTMAGSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNS  81

Query  430  KGRPKCP  450
            KG+ KCP
Sbjct  82   KGKSKCP  88



>ref|XP_009148397.1| PREDICTED: gibberellin-regulated protein 8 [Brassica rapa]
Length=88

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = +1

Query  184  LRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCH  363
            ++ V++  SI+  + L   S  V+    S CG KC  RCSKA +H  C+K C ICC+KC+
Sbjct  1    MKLVIVQFSII--FILLTSSFFVLSTADSSCGGKCNVRCSKASQHDLCIKDCNICCQKCN  58

Query  364  -CVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             CVPSGTFGH+D+CPCYRDM+NSKG PKCP
Sbjct  59   GCVPSGTFGHRDECPCYRDMKNSKGGPKCP  88



>ref|XP_009598103.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=90

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 2/86 (2%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             L++ S++++ S  + S  V  +  S C SKCA RC KAG   RCL YCGICC KC+CVP
Sbjct  7    TLLIVSLVLTSSFLQSS--VAYDDPSSCDSKCAVRCGKAGIAKRCLTYCGICCNKCNCVP  64

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SG +G+K +CPCYRDM NSKG+ KCP
Sbjct  65   SGNYGNKSECPCYRDMLNSKGKSKCP  90



>ref|XP_006279073.1| hypothetical protein CARUB_v10012746mg [Capsella rubella]
 gb|EOA11971.1| hypothetical protein CARUB_v10012746mg [Capsella rubella]
Length=88

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCVP  372
            LM+    M   L   S  V+    S C  KC  RC+KA R HG CLK C ICCEKC+CVP
Sbjct  3    LMVAQFFMISLLLTSSLFVLSNAGSACDGKCNVRCAKADRTHGECLKDCNICCEKCNCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGTFG+KD+CPCYRD+ NSKG  KCP
Sbjct  63   SGTFGNKDECPCYRDLINSKGGSKCP  88



>gb|KHG20586.1| Snakin-1 [Gossypium arboreum]
Length=86

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  256  VEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKG  435
            V  + FC SKC  RCSKAG   RCLKYCGICC KC CVPSGT+G+K +CPCYRD++NSKG
Sbjct  22   VSMAGFCNSKCKIRCSKAGIRARCLKYCGICCAKCKCVPSGTYGNKHECPCYRDLKNSKG  81

Query  436  RPKCP  450
            +PKCP
Sbjct  82   KPKCP  86



>emb|CDX80223.1| BnaC09g35190D [Brassica napus]
Length=92

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC--HCVPSGTFGHKDDCPCYRDMENSKGR  438
            SS C  KC ARCSKAGR  RCLKYC ICCEKC  HCVPSGT+G+KD+CPCYRD +NS G+
Sbjct  29   SSPCNGKCNARCSKAGRQDRCLKYCNICCEKCDDHCVPSGTYGNKDECPCYRDTKNSNGK  88

Query  439  PKCP  450
            PKCP
Sbjct  89   PKCP  92



>emb|CDX80222.1| BnaC09g35200D [Brassica napus]
Length=92

 Score = 99.4 bits (246),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 2/64 (3%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC--HCVPSGTFGHKDDCPCYRDMENSKGR  438
            SS C  KC  RCSKAGR  RCL+YC ICCEKC  HCVPSGT+G++D+CPCYRDM+NSKG+
Sbjct  29   SSPCNGKCNVRCSKAGRQDRCLQYCNICCEKCDDHCVPSGTYGNRDECPCYRDMKNSKGQ  88

Query  439  PKCP  450
            PKCP
Sbjct  89   PKCP  92



>gb|ABK94917.1| unknown [Populus trichocarpa]
Length=87

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGH  390
            + +   L     +V+  G +FC  KC  RC+ AG   RCLKYCGICCE+C CVPSGT+G+
Sbjct  8    VFIYLVLEILIMLVISCGVAFCTKKCNTRCANAGIQDRCLKYCGICCEQCKCVPSGTYGN  67

Query  391  KDDCPCYRDMENSKGRPKCP  450
            K +CPCYRD  NSKG+PKCP
Sbjct  68   KHECPCYRDKRNSKGKPKCP  87



>ref|XP_009380091.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 99.0 bits (245),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 60/94 (64%), Gaps = 13/94 (14%)
 Frame = +1

Query  178  VALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEK  357
            VAL  +L   S L +           + GS+FCGSKC  RCSKA    RCLKYCG+CCE+
Sbjct  8    VALLLILFTSSYLQA----------TMAGSAFCGSKCKVRCSKASVKDRCLKYCGLCCEQ  57

Query  358  CHCVPSGTFGHKDDCPCYRDMENSKG---RPKCP  450
            C CVPSGT+GHKD+CPCYRD     G   RPKCP
Sbjct  58   CRCVPSGTYGHKDECPCYRDKYTGSGKRRRPKCP  91



>gb|KFK27525.1| hypothetical protein AALP_AA8G394700 [Arabis alpina]
Length=69

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +1

Query  247  VVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKC-HCVPSGTFGHKDDCPCYRDME  423
            ++    SS C  KC  RCSKAGR  RCLKYC ICC+KC +CVPSGT+G+KD+CPCYRDM+
Sbjct  1    MLSTADSSPCDGKCNMRCSKAGRQDRCLKYCNICCQKCDNCVPSGTYGNKDECPCYRDMK  60

Query  424  NSKGRPKCP  450
            NSKG+PKCP
Sbjct  61   NSKGQPKCP  69



>gb|ABQ42622.1| snakin-1 [Solanum chacoense]
Length=88

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS+FC SKC  RCSKAG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +NS
Sbjct  22   TTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNS  81

Query  430  KGRPKCP  450
            KG+ KCP
Sbjct  82   KGKSKCP  88



>ref|XP_009620159.1| PREDICTED: snakin-1 [Nicotiana tomentosiformis]
Length=88

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GSS+C SKC  RC+KAG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +N+
Sbjct  22   TTMAGSSYCDSKCKLRCAKAGVMDRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNN  81

Query  430  KGRPKCP  450
            KG+PKCP
Sbjct  82   KGKPKCP  88



>ref|XP_006362074.1| PREDICTED: snakin-1-like [Solanum tuberosum]
 gb|ABQ42623.1| snakin-1 [Solanum chacoense]
 gb|ABQ42624.1| snakin-1 [Solanum tuberosum]
 gb|ABQ42625.1| snakin-1 [Solanum commersonii]
 gb|ACI23371.1| snakin-1 [Solanum tuberosum]
 gb|ACI23372.1| snakin-1 [Solanum tuberosum]
 gb|ACI23373.1| snakin-1 [Solanum tuberosum]
 gb|ACI23374.1| snakin-1 [Solanum tuberosum]
 gb|ACL79835.1| Snakin-1 [Solanum tuberosum]
 gb|ACZ04322.1| snakin-1 [Solanum tuberosum]
 gb|AFQ40003.1| snakin-1 [Solanum chacoense]
 gb|AFQ40008.1| snakin-1 [Capsicum annuum]
 gb|AFQ40009.1| snakin-1 [Solanum nigrum]
 gb|AFQ40010.1| snakin-1 [Petunia x hybrida]
 gb|AFQ40011.1| snakin-1 [Nicotiana tabacum]
 gb|AFQ40012.1| snakin-1 [Solanum lycopersicum]
 gb|AFQ40013.1| snakin-1 [Solanum bulbocastanum]
 gb|AFQ40014.1| snakin-1 [Solanum palustre]
 gb|AFQ40015.1| snakin-1 [Solanum bulbocastanum]
 gb|AFQ40016.1| snakin-1 [Solanum nigrum]
Length=88

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS+FC SKC  RCSKAG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +NS
Sbjct  22   TTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNS  81

Query  430  KGRPKCP  450
            KG+ KCP
Sbjct  82   KGKSKCP  88



>gb|EYU22941.1| hypothetical protein MIMGU_mgv1a022909mg [Erythranthe guttata]
Length=93

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             L++   L+             + S FC  KCA RCSKAGR  RCL+YC ICC KC+CVP
Sbjct  8    TLVLALFLVGTFAESGPAEAPSDISGFCDEKCAVRCSKAGRQNRCLQYCRICCAKCNCVP  67

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G++D+CPCYRD +N KG PKCP
Sbjct  68   SGTYGNRDECPCYRDWKNPKGGPKCP  93



>ref|XP_007160892.1| hypothetical protein PHAVU_001G025800g [Phaseolus vulgaris]
 gb|ESW32886.1| hypothetical protein PHAVU_001G025800g [Phaseolus vulgaris]
Length=88

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  262  GSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRP  441
            GS FC SKCA RCSKAG   RCLK+CGICC KC CVPSGT+G+K +CPCYRDM+NSKG+ 
Sbjct  26   GSGFCASKCAQRCSKAGMKDRCLKFCGICCSKCKCVPSGTYGNKHECPCYRDMKNSKGKG  85

Query  442  KCP  450
            KCP
Sbjct  86   KCP  88



>ref|XP_004496906.1| PREDICTED: snakin-1-like [Cicer arietinum]
Length=89

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 61/93 (66%), Gaps = 8/93 (9%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICC  351
              V L C L+  SIL           +  E SS+C +KC+ RCSKAG   RC+KYC ICC
Sbjct  5    FTVLLFCSLLCSSIL--------EPAIAYEDSSYCSNKCSDRCSKAGVQDRCVKYCEICC  56

Query  352  EKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             +C CVPSGT+G+K +CPCYRD  N+KG+PKCP
Sbjct  57   AQCKCVPSGTYGNKHECPCYRDKLNNKGKPKCP  89



>ref|XP_002313889.2| hypothetical protein POPTR_0009s09560g [Populus trichocarpa]
 gb|EEE87844.2| hypothetical protein POPTR_0009s09560g [Populus trichocarpa]
Length=89

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSK  432
            V+  SSFC  KC  RC+ AG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD  NSK
Sbjct  24   VMAKSSFCAKKCETRCANAGIQDRCLKYCGICCEQCKCVPSGTYGNKHECPCYRDKRNSK  83

Query  433  GRPKCP  450
            G+PKCP
Sbjct  84   GKPKCP  89



>ref|XP_008792652.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=91

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS FC SKC  RCSKAG   RCLKYCGICCE+CHCVPSGT+GHKD+CPCYRD    
Sbjct  22   ATMAGSPFCNSKCKVRCSKAGVRDRCLKYCGICCEECHCVPSGTYGHKDECPCYRDKYTG  81

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  82   SGKRRRPKCP  91



>ref|XP_008346370.1| PREDICTED: peamaclein-like [Malus domestica]
Length=88

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 7/94 (7%)
 Frame = +1

Query  169  NIRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGIC  348
             +   L C L++ S  M  ++A       +  S +C  KC+ RC+ AG   RC+KYCGIC
Sbjct  2    KLYFPLLCFLLLTSSFMDPAMA-------LATSPYCSDKCSTRCAVAGVQDRCMKYCGIC  54

Query  349  CEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CE C CVPSGT+G+K +CPCYRD +N KG+PKCP
Sbjct  55   CEACKCVPSGTYGNKHECPCYRDKKNDKGKPKCP  88



>ref|XP_006306379.1| hypothetical protein CARUB_v10012286mg [Capsella rubella]
 gb|EOA39277.1| hypothetical protein CARUB_v10012286mg [Capsella rubella]
Length=89

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCV  369
            ++++   +++  L     V     S+ CG KC  RC+KA R HG CLK C ICCEKC+CV
Sbjct  3    LIVVQFFMITLLLTSSLFVFSNADSAACGGKCNVRCAKADRTHGECLKDCNICCEKCNCV  62

Query  370  PSGTFGHKDDCPCYRDMENSKGRPKCP  450
            PSGTFG+KD+CPCYRDM NSKG  KCP
Sbjct  63   PSGTFGNKDECPCYRDMTNSKGGSKCP  89



>ref|XP_010906256.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=91

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS FC SKC  RCSKAG   RCLKYCGICCE+CHCVPSGT+GHKD+CPCYRD    
Sbjct  22   ATMAGSPFCDSKCKVRCSKAGVQDRCLKYCGICCEECHCVPSGTYGHKDECPCYRDKYTG  81

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  82   SGKRRRPKCP  91



>gb|EYU25492.1| hypothetical protein MIMGU_mgv1a017072mg [Erythranthe guttata]
Length=94

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSK  432
             V G  +CG KCA RCSKAG   RCLKYCGICC +C CVPSGT+G+K +CPCYRD +NSK
Sbjct  29   AVLGEGYCGKKCAVRCSKAGVKDRCLKYCGICCNECKCVPSGTYGNKHECPCYRDKKNSK  88

Query  433  GRPKCP  450
            G PKCP
Sbjct  89   GHPKCP  94



>emb|CDX93402.1| BnaA06g06460D [Brassica napus]
Length=94

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCH-CVP  372
            L++    + + L   S  V+    S CG KC  RCSKA +H  C+K C ICC+KC+ CVP
Sbjct  9    LVIVQFSIIFILLTSSFFVLSTADSSCGGKCNVRCSKASQHDLCIKDCNICCQKCNGCVP  68

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGTFGH+D+CPCYRDM+NSKG PKCP
Sbjct  69   SGTFGHRDECPCYRDMKNSKGGPKCP  94



>emb|CDY72009.1| BnaCnng75550D [Brassica napus]
Length=88

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 3/90 (3%)
 Frame = +1

Query  184  LRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCH  363
            ++ V++  SI+  + L   S  V+    S CG KC  RCSKA +H  C+K C ICC+KC+
Sbjct  1    MKLVIVQFSII--FLLVTSSLFVLSTADSSCGGKCNVRCSKASQHDLCIKDCNICCQKCN  58

Query  364  -CVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             CVPSGT+GH+D+CPCYRD++NSKG PKCP
Sbjct  59   GCVPSGTYGHRDECPCYRDIKNSKGGPKCP  88



>ref|XP_002300251.2| hypothetical protein POPTR_0001s30500g [Populus trichocarpa]
 gb|EEE85056.2| hypothetical protein POPTR_0001s30500g [Populus trichocarpa]
Length=88

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSK  432
            V+  SSFC  KC  RC+ AG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD  NSK
Sbjct  23   VMAKSSFCTKKCNTRCANAGIQDRCLKYCGICCEQCKCVPSGTYGNKHECPCYRDKRNSK  82

Query  433  GRPKCP  450
            G+PKCP
Sbjct  83   GKPKCP  88



>gb|AAY51975.1| GIR1 [Vigna radiata]
Length=88

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  262  GSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRP  441
             S FC SKCA RCSKAGR  RCLK CGICC KC CVPSGT+G+K +CPCYRD++NSKG+ 
Sbjct  26   ASGFCSSKCANRCSKAGRKDRCLKLCGICCSKCKCVPSGTYGNKHECPCYRDLKNSKGKG  85

Query  442  KCP  450
            KCP
Sbjct  86   KCP  88



>ref|XP_010320309.1| PREDICTED: LOW QUALITY PROTEIN: snakin-1-like [Solanum lycopersicum]
Length=88

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS FC SKC  RCSKAG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +NS
Sbjct  22   TTMAGSYFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNS  81

Query  430  KGRPKCP  450
            KG+ KCP
Sbjct  82   KGKSKCP  88



>ref|XP_009339505.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
 ref|XP_009339508.1| PREDICTED: peamaclein-like [Pyrus x bretschneideri]
Length=88

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 7/94 (7%)
 Frame = +1

Query  169  NIRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGIC  348
             +   L C L++ S  M  ++A       +  S +C  KC+ RC+ AG   RC+KYCGIC
Sbjct  2    KLYFPLLCFLLLTSSFMDPAMA-------LATSPYCSDKCSTRCAVAGVRDRCIKYCGIC  54

Query  349  CEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CE C CVPSGT+G+K +CPCYRD +N KG+PKCP
Sbjct  55   CEACKCVPSGTYGNKHECPCYRDKKNDKGKPKCP  88



>ref|XP_006292427.1| hypothetical protein CARUB_v10018642mg [Capsella rubella]
 gb|EOA25325.1| hypothetical protein CARUB_v10018642mg [Capsella rubella]
Length=88

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCVP  372
            LM+    M   L   S  V     S C  KC  RC+KA R HG CLK C ICCEKC+CVP
Sbjct  3    LMVAQFFMISLLLTSSLFVHSNAGSACDGKCNVRCAKADRTHGECLKDCNICCEKCNCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGTFG+KD+CPCYRD+ NSKG  KCP
Sbjct  63   SGTFGNKDECPCYRDLINSKGGSKCP  88



>ref|XP_009795533.1| PREDICTED: snakin-1 [Nicotiana sylvestris]
Length=88

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GSS+C SKC  RC+KAG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +++
Sbjct  22   TTMAGSSYCDSKCKLRCAKAGVMDRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKSN  81

Query  430  KGRPKCP  450
            KG+PKCP
Sbjct  82   KGKPKCP  88



>ref|XP_004981680.1| PREDICTED: snakin-1-like [Setaria italica]
Length=94

 Score = 96.7 bits (239),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = +1

Query  244  TVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDME  423
            +V +  GS FC S CA RCSKA RH  CLKYCGICC  C+CVPSGT GHKD+CPCYRDM 
Sbjct  23   SVSMAVGSEFCDSNCARRCSKASRHDDCLKYCGICCADCNCVPSGTAGHKDECPCYRDMT  82

Query  424  NSKG---RPKCP  450
               G   RPKCP
Sbjct  83   TGTGNRTRPKCP  94



>ref|XP_010271646.1| PREDICTED: peamaclein-like [Nelumbo nucifera]
Length=94

 Score = 96.7 bits (239),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSL-AERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGIC  348
            +++ L   L++  IL S+ L A      + + +  C  KC  RCSKAG   RC+KYC IC
Sbjct  1    MKLVLAVFLLVSLILSSYLLEATAQGPSLPDYTGLCTPKCNGRCSKAGYQDRCMKYCMIC  60

Query  349  CEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C+ C CVPSGT+G+K +CPCYRD +N+KG+PKCP
Sbjct  61   CQDCKCVPSGTYGNKHECPCYRDKKNNKGKPKCP  94



>ref|XP_011074384.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=93

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +1

Query  241  STVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDM  420
            S++ +   SS C  KC  RCSKAG   RCLKYCGICC +C CVPSGT+G+K +CPCYRD 
Sbjct  24   SSITLPAASSDCDEKCGVRCSKAGVKDRCLKYCGICCAECKCVPSGTYGNKHECPCYRDK  83

Query  421  ENSKGRPKCP  450
            +NSKG+PKCP
Sbjct  84   KNSKGKPKCP  93



>gb|EYU29122.1| hypothetical protein MIMGU_mgv1a017256mg [Erythranthe guttata]
Length=86

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  229  LAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPC  408
            L   S    +  +  C  KC  RCSKA     CLKYCGICC KC CVPSGT+G+KD+CPC
Sbjct  13   LVTSSGFFELTAAIQCSPKCEVRCSKASAKENCLKYCGICCAKCQCVPSGTYGNKDECPC  72

Query  409  YRDMENSKGRPKCP  450
            YRDM+NSKG PKCP
Sbjct  73   YRDMKNSKGNPKCP  86



>ref|XP_006301392.1| hypothetical protein CARUB_v10021805mg [Capsella rubella]
 gb|EOA34290.1| hypothetical protein CARUB_v10021805mg [Capsella rubella]
Length=88

 Score = 96.3 bits (238),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCVP  372
            L++    +   L   S  V+      CG KC  RC+KA R HG CL+ C ICCEKC+CVP
Sbjct  3    LIVVQFFIISLLLTSSLFVLSNAGLECGGKCNVRCAKADRTHGECLQDCNICCEKCNCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGTFG+KD+CPCYRD++NSKG  KCP
Sbjct  63   SGTFGNKDECPCYRDLQNSKGGSKCP  88



>ref|XP_011069770.1| PREDICTED: peamaclein-like [Sesamum indicum]
 ref|XP_011069771.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=88

 Score = 96.3 bits (238),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            +S+C  KC  RCSKAG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +NSKG+PK
Sbjct  27   ASYCEEKCGVRCSKAGVKDRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKPK  86

Query  445  CP  450
            CP
Sbjct  87   CP  88



>ref|XP_002875456.1| hypothetical protein ARALYDRAFT_484630 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51715.1| hypothetical protein ARALYDRAFT_484630 [Arabidopsis lyrata subsp. 
lyrata]
Length=89

 Score = 95.9 bits (237),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCV  369
            +L++    +   L   S  V+    S CG KC  RCSKA R H  CLK C ICC+KC+CV
Sbjct  3    MLVVVQFFIISLLLTSSFFVLSSADSSCGGKCDVRCSKADRQHEECLKDCNICCQKCNCV  62

Query  370  PSGTFGHKDDCPCYRDMENSKGRPKCP  450
            PSGT+G+KD+CPCYRD++NSKG  KCP
Sbjct  63   PSGTYGNKDECPCYRDLKNSKGESKCP  89



>ref|XP_011069640.1| PREDICTED: peamaclein-like [Sesamum indicum]
Length=91

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            S+FC  KC  RCS A R  RCLKYCGICC KC+CVPSGTFG+KD+CPCYRD++NSKG  K
Sbjct  30   SAFCKGKCDVRCSLASRKDRCLKYCGICCTKCNCVPSGTFGNKDECPCYRDLKNSKGESK  89

Query  445  CP  450
            CP
Sbjct  90   CP  91



>ref|XP_009404126.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  214  LMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHK  393
            L+    A       + GS+FC SKC  RCSKA    RCLKYCG+CCE+C CVPSGT+GHK
Sbjct  10   LLLVLFASSCLQATMAGSAFCESKCKVRCSKASVQDRCLKYCGLCCEQCRCVPSGTYGHK  69

Query  394  DDCPCYRDMENSKG---RPKCP  450
            D+CPCYRD     G   RPKCP
Sbjct  70   DECPCYRDKYTGSGKRRRPKCP  91



>ref|XP_010679570.1| PREDICTED: peamaclein-like [Beta vulgaris subsp. vulgaris]
Length=95

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             L++ S  +  SLA  +  V    +SFCGSKC  RCSK+G H  C+K+C +CCEKC+CVP
Sbjct  12   FLVLASSFVHPSLA-LADAVKSNTNSFCGSKCGIRCSKSG-HEDCMKFCLLCCEKCNCVP  69

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRDM NSKG  KCP
Sbjct  70   SGTYGNKHECPCYRDMRNSKGTSKCP  95



>ref|XP_002271730.2| PREDICTED: snakin-1 [Vitis vinifera]
Length=139

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSK  432
              +G+ FCG KC+ RCS+A    RC+KYCGICC++C CVPSGT+G+K +CPCYRD +NSK
Sbjct  74   TTDGAGFCGLKCSKRCSQAAVLDRCMKYCGICCQECKCVPSGTYGNKHECPCYRDKKNSK  133

Query  433  GRPKCP  450
            G+PKCP
Sbjct  134  GKPKCP  139



>gb|ABQ42621.1| snakin-1 [Solanum bulbocastanum]
Length=88

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS+FC SKC  RCSKAG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +NS
Sbjct  22   TTMAGSNFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNS  81

Query  430  KGRPKC  447
            KG+ KC
Sbjct  82   KGKSKC  87



>ref|NP_001237325.1| uncharacterized protein LOC100527527 precursor [Glycine max]
 gb|ACU16624.1| unknown [Glycine max]
Length=90

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  247  VVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMEN  426
            V+  E SS+C +KCA RCS AG   RC+KYCGICC +C CVPSGT+G+K +CPCYRD  N
Sbjct  23   VIAYEDSSYCSNKCADRCSSAGVKDRCVKYCGICCAECKCVPSGTYGNKHECPCYRDKLN  82

Query  427  SKGRPKCP  450
             KG+PKCP
Sbjct  83   KKGKPKCP  90



>ref|XP_002524960.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37457.1| conserved hypothetical protein [Ricinus communis]
Length=101

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTVVVVEG----SSFCGSKCAARCSKAGRHGRCLKYC  339
            +   L  VL++ S  +  ++A       +      +S+C  KC ARC+ AG   RC+KYC
Sbjct  5    LSTFLLIVLIVSSSFLQSTMAAPPPTGPLTAPSPTASYCELKCGARCANAGYKDRCMKYC  64

Query  340  GICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            GICC +C CVPSGT+G+K +CPCYRD +NSKG PKCP
Sbjct  65   GICCAECKCVPSGTYGNKSECPCYRDKKNSKGNPKCP  101



>gb|EYU29123.1| hypothetical protein MIMGU_mgv1a017184mg [Erythranthe guttata]
Length=89

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 59/86 (69%), Gaps = 3/86 (3%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
             L++ ++++  +  E +        SFC SKC  RCSKAG   RC+KYCGICC  C+CVP
Sbjct  7    TLLLVTLILGSAFLESTEATY---PSFCDSKCGERCSKAGLKKRCIKYCGICCAACNCVP  63

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRD  NSKG+ KCP
Sbjct  64   SGTYGNKSECPCYRDKLNSKGKSKCP  89



>ref|XP_008440339.1| PREDICTED: peamaclein-like [Cucumis melo]
Length=94

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPS  375
             ++ S  + +  A+ ST       S C SKC  RC  AG   RCLKYCG+CC++C CVPS
Sbjct  13   FILSSFFLQYGTADSSTTY---APSVCDSKCGVRCLNAGVKDRCLKYCGLCCQQCKCVPS  69

Query  376  GTFGHKDDCPCYRDMENSKGRPKCP  450
            GT+G+K +CPCYRD  NSKG+ KCP
Sbjct  70   GTYGNKSECPCYRDKLNSKGKSKCP  94



>gb|EMS63633.1| hypothetical protein TRIUR3_22813 [Triticum urartu]
Length=98

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 54/73 (74%), Gaps = 3/73 (4%)
 Frame = +1

Query  241  STVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDM  420
            S  V + GS+FC SKC  RCSKAGRH  CLKYCGICC +C+CVPSGT G+KD+CPCYRD 
Sbjct  26   SLRVAMAGSAFCDSKCGVRCSKAGRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDK  85

Query  421  ENSKG---RPKCP  450
                G   RPKCP
Sbjct  86   TTGHGARTRPKCP  98



>ref|XP_010491469.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
 ref|XP_010491484.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=89

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 5/86 (6%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCVP  372
              + S+L++ SL E S+      SS CG KC  RCSK  R H  C+K C ICC KC+CVP
Sbjct  8    FFIISLLLTTSLTEISSA----DSSACGGKCNVRCSKNDRKHEECIKDCNICCGKCNCVP  63

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRD++NSKG PKCP
Sbjct  64   SGTYGNKDECPCYRDIKNSKGGPKCP  89



>ref|XP_010099066.1| hypothetical protein L484_011500 [Morus notabilis]
 gb|EXB76655.1| hypothetical protein L484_011500 [Morus notabilis]
Length=91

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVP  372
              ++ ++ +S S    ST     G  FC  KC  RCSKAG   RC+KYCGICCE+C CVP
Sbjct  8    AFLLCALHLSSSFFYPSTAYFQSG--FCEDKCTTRCSKAGVLDRCMKYCGICCEQCMCVP  65

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+K +CPCYRD  + KG+PKCP
Sbjct  66   SGTYGNKHECPCYRDKRSKKGKPKCP  91



>ref|XP_002463849.1| hypothetical protein SORBIDRAFT_01g007360 [Sorghum bicolor]
 gb|EER90847.1| hypothetical protein SORBIDRAFT_01g007360 [Sorghum bicolor]
Length=93

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +1

Query  241  STVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDM  420
            S  V + GS+FC  KC  RCSKA RH  CLKYCGICC  C+CVPSGT GHKD+CPCYRDM
Sbjct  21   SLRVSMAGSAFCDGKCGVRCSKASRHDDCLKYCGICCASCNCVPSGTAGHKDECPCYRDM  80

Query  421  ENSKG---RPKCP  450
                G   RPKCP
Sbjct  81   TTGHGNRTRPKCP  93



>gb|EMS63632.1| hypothetical protein TRIUR3_22812 [Triticum urartu]
Length=94

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 53/68 (78%), Gaps = 3/68 (4%)
 Frame = +1

Query  256  VEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKG  435
            + GS+FC SKC  RCSKAGRH  CLKYCGICC +C+CVPSGT G+KD+CPCYRD    +G
Sbjct  27   MAGSAFCDSKCGVRCSKAGRHDDCLKYCGICCAQCNCVPSGTAGNKDECPCYRDKTTGQG  86

Query  436  ---RPKCP  450
               RPKCP
Sbjct  87   ARKRPKCP  94



>ref|NP_001149636.1| gibberellin-regulated protein 2 precursor [Zea mays]
 gb|ACG36191.1| gibberellin-regulated protein 2 precursor [Zea mays]
Length=95

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS FC  KCA RCSKA RH  CLKYCGICC  C+CVPSGT G+KD+CPCYRDM   
Sbjct  26   VSMAGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGTAGNKDECPCYRDMTTG  85

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  86   HGNRTRPKCP  95



>emb|CBI22497.3| unnamed protein product [Vitis vinifera]
Length=88

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSK  432
              +G+ FCG KC+ RCS+A    RC+KYCGICC++C CVPSGT+G+K +CPCYRD +NSK
Sbjct  23   TTDGAGFCGLKCSKRCSQAAVLDRCMKYCGICCQECKCVPSGTYGNKHECPCYRDKKNSK  82

Query  433  GRPKCP  450
            G+PKCP
Sbjct  83   GKPKCP  88



>ref|XP_007143086.1| hypothetical protein PHAVU_007G042400g [Phaseolus vulgaris]
 gb|ESW15080.1| hypothetical protein PHAVU_007G042400g [Phaseolus vulgaris]
Length=90

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  247  VVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMEN  426
             +  E SS+C SKC+ RCS AG   RCLKYCGICC +C CVPSGT+G+K +CPCYRD  N
Sbjct  23   AMAYEESSYCSSKCSDRCSAAGVKDRCLKYCGICCAECKCVPSGTYGNKHECPCYRDKLN  82

Query  427  SKGRPKCP  450
             KG+PKCP
Sbjct  83   KKGKPKCP  90



>ref|NP_001077503.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
 gb|ABF59173.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28601.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
Length=90

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +1

Query  184  LRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKC  360
            ++  +++   ++S  L     V+    SS CG KC+ RCSKA R H  CL+ C ICC+KC
Sbjct  1    MKMPVVVQFFIISLLLTSSFYVLSSADSSACGGKCSVRCSKADRTHEECLEDCDICCQKC  60

Query  361  HCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +CVPSGT+G+KD+CPCYRDM+NSKG  KCP
Sbjct  61   NCVPSGTYGNKDECPCYRDMKNSKGGSKCP  90



>ref|XP_009381473.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=94

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 60/92 (65%), Gaps = 6/92 (7%)
 Frame = +1

Query  184  LRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCH  363
            L   L +  IL + S  +   V +  GS+FCGSKC  RCSKA    RC+K CG+CCE C 
Sbjct  6    LFATLTLVLILFTSSCQQ---VTMAAGSAFCGSKCKVRCSKASLQDRCIKVCGLCCEACR  62

Query  364  CVPSGTFGHKDDCPCYRDMENSKG---RPKCP  450
            CVPSGT+G+KD+CPCYRD    +G   RPKCP
Sbjct  63   CVPSGTYGNKDECPCYRDKYTGEGVRRRPKCP  94



>ref|XP_003536595.1| PREDICTED: snakin-1 [Glycine max]
 gb|KHN06785.1| Snakin-1 [Glycine soja]
Length=90

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  247  VVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMEN  426
            V+  E SS+C +KC+ RCS AG   RCL+YCGICC +C CVPSGT+G+K  CPCYRD  N
Sbjct  23   VIAYEDSSYCSNKCSDRCSSAGVKDRCLRYCGICCAECKCVPSGTYGNKHQCPCYRDKLN  82

Query  427  SKGRPKCP  450
             KG+PKCP
Sbjct  83   KKGKPKCP  90



>ref|NP_001183511.1| gibberellin-regulated protein 2 precursor [Zea mays]
 gb|ACR33840.1| unknown [Zea mays]
 gb|ACR37199.1| unknown [Zea mays]
 gb|ACR37238.1| unknown [Zea mays]
 gb|AFW67550.1| gibberellin-regulated protein 2 [Zea mays]
Length=96

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS FC  KCA RCSKA RH  CLKYCGICC  C+CVPSGT G+KD+CPCYRDM   
Sbjct  27   VSMAGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGTAGNKDECPCYRDMTTG  86

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  87   HGNRTRPKCP  96



>gb|ACG44951.1| gibberellin-regulated protein 2 precursor [Zea mays]
Length=96

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS FC  KCA RCSKA RH  CLKYCGICC  C+CVPSGT G+KD+CPCYRDM   
Sbjct  27   VSMAGSGFCDGKCAVRCSKASRHDDCLKYCGICCATCNCVPSGTAGNKDECPCYRDMTTG  86

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  87   HGNRIRPKCP  96



>ref|XP_009135633.1| PREDICTED: peamaclein-like [Brassica rapa]
Length=97

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +CGS+C  RCSKAG   RC+KYCGICC +C CVPSGTFG+K  CPCYRDM +SKG+PKCP
Sbjct  38   YCGSRCRGRCSKAGFRDRCIKYCGICCRQCKCVPSGTFGNKHQCPCYRDMLSSKGKPKCP  97



>ref|XP_006346334.1| PREDICTED: snakin-1-like [Solanum tuberosum]
Length=89

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            S +C  KC ARCSKAG   RC+KYC +CC KC CVP+GT+G+K  CPCYRDM+NSKG+PK
Sbjct  28   SVYCAQKCEARCSKAGLKDRCVKYCELCCAKCKCVPNGTYGNKHQCPCYRDMKNSKGKPK  87

Query  445  CP  450
            CP
Sbjct  88   CP  89



>emb|CDP07216.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            + +  +SFC SKC  RCSKAG   RCLKYCGICC  C CVPSGT+G+K +C CYRD  NS
Sbjct  22   IAMANTSFCDSKCGVRCSKAGLMKRCLKYCGICCAACSCVPSGTYGNKSECRCYRDKLNS  81

Query  430  KGRPKCP  450
            KG+PKCP
Sbjct  82   KGKPKCP  88



>ref|XP_006301929.1| hypothetical protein CARUB_v10022405mg [Capsella rubella]
 gb|EOA34827.1| hypothetical protein CARUB_v10022405mg [Capsella rubella]
Length=86

 Score = 93.6 bits (231),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 6/86 (7%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCVP  372
              + S+L++ SL      V+    S C  KC  RC+KA R HG CL+ C ICCEKC CVP
Sbjct  6    FFVISLLLTSSL-----FVLSNAGSECNGKCNVRCAKADRTHGECLQDCNICCEKCKCVP  60

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGTFG+KD+CPCYRD++NSKG  KCP
Sbjct  61   SGTFGNKDECPCYRDLKNSKGGSKCP  86



>gb|KEH44041.1| gibberellin-regulated family protein [Medicago truncatula]
Length=90

 Score = 93.6 bits (231),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  247  VVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMEN  426
             +  E SS C SKC+ RCSKAG   RC+KYC ICC +C CVPSGT+G+K +CPCYRD  N
Sbjct  23   AIAYEDSSNCSSKCSDRCSKAGVQDRCVKYCEICCNECKCVPSGTYGNKHECPCYRDKVN  82

Query  427  SKGRPKCP  450
            +KG+PKCP
Sbjct  83   NKGKPKCP  90



>ref|XP_010467274.1| PREDICTED: gibberellin-regulated protein 7-like [Camelina sativa]
Length=108

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 16/102 (16%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGS----------------SFCGSKCAARCSKAGRHGR  324
            +L++ S+L+  S    +TV    GS                ++CG KC ARC +AG   R
Sbjct  7    ILVLASLLLVTSSLASATVSDAFGSGAAAPAPQIKDGPALETWCGQKCEARCKEAGLKDR  66

Query  325  CLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CLKYCGICC+ C CVPSGT+G+K +CPCYRD   +KG PKCP
Sbjct  67   CLKYCGICCKDCQCVPSGTYGNKHECPCYRDKLTNKGTPKCP  108



>ref|XP_007047444.1| Gibberellin-regulated family protein, putative [Theobroma cacao]
 gb|EOX91601.1| Gibberellin-regulated family protein, putative [Theobroma cacao]
Length=107

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C SKC  RCSKAG   RCLKYCGICC +C+CVPSGT+G+K +CPCYRD  NSKG+PKCP
Sbjct  49   CDSKCGERCSKAGIKDRCLKYCGICCRECNCVPSGTYGNKSECPCYRDKLNSKGKPKCP  107



>ref|XP_010488933.1| PREDICTED: gibberellin-regulated protein 7-like [Camelina sativa]
Length=108

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 16/102 (16%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGS----------------SFCGSKCAARCSKAGRHGR  324
            +L++ S+L+  S    +TV    GS                ++CG KC ARC +AG   R
Sbjct  7    ILVLASLLLVTSSLASATVSDAFGSGAAAPAPQIKGGPALETWCGQKCEARCKEAGLKDR  66

Query  325  CLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CLKYCGICC+ C CVPSGT+G+K +CPCYRD   +KG PKCP
Sbjct  67   CLKYCGICCKDCQCVPSGTYGNKHECPCYRDKLTNKGTPKCP  108



>ref|XP_004289740.1| PREDICTED: snakin-1-like [Fragaria vesca subsp. vesca]
Length=88

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            SS C +KC+ RC+ AG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +N+KGRPK
Sbjct  27   SSNCSNKCSNRCAVAGVQDRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNNKGRPK  86

Query  445  CP  450
            CP
Sbjct  87   CP  88



>ref|XP_003559125.1| PREDICTED: peamaclein-like [Brachypodium distachyon]
Length=93

 Score = 93.2 bits (230),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS+FC SKC+ RCSKAGRH  CLKYCGICC +C+CVPSGT G+KD+CPCYRD    
Sbjct  24   VSMSGSAFCDSKCSFRCSKAGRHDDCLKYCGICCAECNCVPSGTSGNKDECPCYRDKTTG  83

Query  430  KG---RPKCP  450
            KG   R KCP
Sbjct  84   KGSRKRSKCP  93



>ref|XP_010315202.1| PREDICTED: peamaclein [Solanum lycopersicum]
Length=89

 Score = 93.2 bits (230),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            S +C  KC ARCSKAG   RC+KYC +CC KC CVP+GT+G+K  CPCYRDM+NSKG+PK
Sbjct  28   SVYCTQKCEARCSKAGLKDRCVKYCELCCAKCKCVPNGTYGNKHQCPCYRDMKNSKGKPK  87

Query  445  CP  450
            CP
Sbjct  88   CP  89



>gb|EYU37603.1| hypothetical protein MIMGU_mgv1a024675mg [Erythranthe guttata]
Length=93

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +1

Query  220  SWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDD  399
            S +  E +     +  ++C S C  RC++AG   RCLKYCGICC+KC CVPSGT+G+K  
Sbjct  17   SNTSIEATADQSYDSVNYCASSCDLRCARAGVKDRCLKYCGICCDKCKCVPSGTYGNKHQ  76

Query  400  CPCYRDMENSKGRPKCP  450
            CPCYRDM +SKG+PKCP
Sbjct  77   CPCYRDMRSSKGKPKCP  93



>ref|XP_003559118.1| PREDICTED: peamaclein-like [Brachypodium distachyon]
Length=93

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V V GS FC SKC+ RCSKA RH  CLKYCGICC +C+CVPSGT G+KD+CPCYRD    
Sbjct  24   VSVAGSEFCDSKCSFRCSKASRHDDCLKYCGICCAECNCVPSGTSGNKDECPCYRDKTTG  83

Query  430  KG---RPKCP  450
            KG   R KCP
Sbjct  84   KGSRKRSKCP  93



>ref|XP_010519291.1| PREDICTED: peamaclein-like [Tarenaya hassleriana]
Length=99

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
             ++CG +C  RC+KAG   RCLKYCGICC +C CVPSGT+GHK +CPCYRD  +SKGRPK
Sbjct  38   DAYCGKRCNGRCAKAGFQDRCLKYCGICCRECKCVPSGTYGHKHECPCYRDKMSSKGRPK  97

Query  445  CP  450
            CP
Sbjct  98   CP  99



>ref|NP_001077504.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
 gb|ABF59285.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28602.1| Gibberellin-regulated GASA/GAST/Snakin family protein [Arabidopsis 
thaliana]
Length=89

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +1

Query  229  LAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCVPSGTFGHKDDCP  405
            L   S  V+    S CG KC+ RCSKA R H  CL+ C ICC+KC+CVPSGT+G+KD+CP
Sbjct  15   LLTSSFYVLSSADSSCGGKCSVRCSKADRTHEECLEDCDICCQKCNCVPSGTYGNKDECP  74

Query  406  CYRDMENSKGRPKCP  450
            CYRDM+NSKG  KCP
Sbjct  75   CYRDMKNSKGGSKCP  89



>ref|XP_008778332.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=91

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS FC SKC  RCSKA    RCLKYCG+CCE+CHCVPSGT+G+KD+CPCYRD    
Sbjct  22   ATIAGSPFCDSKCKVRCSKASFQDRCLKYCGVCCEECHCVPSGTYGNKDECPCYRDKYTG  81

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  82   FGKRRRPKCP  91



>gb|EMT21444.1| hypothetical protein F775_43887 [Aegilops tauschii]
Length=98

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS+FC SKC  RCSKA RH  CLKYCGICC +C+CVPSGT G+KD+CPCYRD    
Sbjct  29   VAMAGSAFCDSKCGVRCSKASRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTG  88

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  89   HGARTRPKCP  98



>ref|XP_006406493.1| hypothetical protein EUTSA_v10022254mg, partial [Eutrema salsugineum]
 gb|ESQ47946.1| hypothetical protein EUTSA_v10022254mg, partial [Eutrema salsugineum]
Length=67

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
             ++CGS+C  RC+KAG   RC+KYCGICC +C CVPSGTFG+K  CPCYRDM +SKG+PK
Sbjct  6    EAYCGSRCRERCAKAGFQDRCIKYCGICCRECKCVPSGTFGNKHQCPCYRDMLSSKGKPK  65

Query  445  CP  450
            CP
Sbjct  66   CP  67



>ref|XP_008787135.1| PREDICTED: peamaclein-like [Phoenix dactylifera]
Length=92

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 2/72 (3%)
 Frame = +1

Query  241  STVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRD-  417
              V  + GS+FC SKC  RC+KAG   RCL YCG+CCE+C CVPSGT+G+KD+CPCYRD 
Sbjct  21   QAVHAMAGSAFCDSKCKVRCAKAGVMDRCLHYCGVCCEECKCVPSGTYGNKDECPCYRDK  80

Query  418  -MENSKGRPKCP  450
              +N K +PKCP
Sbjct  81   VTKNDKKKPKCP  92



>ref|XP_002283986.1| PREDICTED: snakin-1-like [Vitis vinifera]
Length=127

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            FC SKC  RC+ AG + RC+KYCGICC++C CVPSGT+G+K +CPCYRD  NSKG+PKCP
Sbjct  68   FCDSKCGVRCANAGVYDRCVKYCGICCQECKCVPSGTYGNKSECPCYRDKLNSKGKPKCP  127



>ref|XP_010909081.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=91

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
              + GS FC SKC  RCSKA    RCLKYCG+CCE+C CVPSGT+GHKD+CPCYRD    
Sbjct  22   ATMAGSPFCDSKCKVRCSKASYQDRCLKYCGLCCEECRCVPSGTYGHKDECPCYRDKYTG  81

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  82   FGKKRRPKCP  91



>ref|XP_006650629.1| PREDICTED: snakin-1-like [Oryza brachyantha]
Length=94

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS FC  KC  RCSKA RH  CL+YCG+CC  C+CVPSGT G+KD+CPCYRDM   
Sbjct  25   VAMAGSDFCDGKCKVRCSKASRHDDCLRYCGVCCASCNCVPSGTAGNKDECPCYRDMTTG  84

Query  430  KG---RPKCP  450
            +G   RPKCP
Sbjct  85   QGTRKRPKCP  94



>ref|XP_010458413.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=89

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCV  369
            ++++   ++S  L     V+    SS CG KC  RCSK  R H  C+K C ICC+KC CV
Sbjct  3    LIVIQFFIISLLLMSSFFVLSSADSSACGGKCNVRCSKNDRQHEECIKDCNICCQKCKCV  62

Query  370  PSGTFGHKDDCPCYRDMENSKGRPKCP  450
            PSGT+G+KD+CPCYRDM+NS+G  KCP
Sbjct  63   PSGTYGNKDECPCYRDMKNSQGGSKCP  89



>emb|CBI33733.3| unnamed protein product [Vitis vinifera]
Length=67

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            FC SKC  RC+ AG + RC+KYCGICC++C CVPSGT+G+K +CPCYRD  NSKG+PKCP
Sbjct  8    FCDSKCGVRCANAGVYDRCVKYCGICCQECKCVPSGTYGNKSECPCYRDKLNSKGKPKCP  67



>ref|XP_004152264.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004156848.1| PREDICTED: snakin-1-like [Cucumis sativus]
Length=89

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            +V     FC  KC  RCSKAG   RC+KYCGICC  C CVPSGT+G+K +CPCYRDM +S
Sbjct  23   IVNAKPVFCDKKCKKRCSKAGVKDRCIKYCGICCGYCKCVPSGTYGNKHECPCYRDMRSS  82

Query  430  KGRPKCP  450
            KGRPKCP
Sbjct  83   KGRPKCP  89



>ref|XP_010517902.1| PREDICTED: gibberellin-regulated protein 7 [Camelina sativa]
Length=108

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 61/102 (60%), Gaps = 16/102 (16%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGS----------------SFCGSKCAARCSKAGRHGR  324
            +L++ S+L+  S    +TV    GS                ++CG KC  RC +AG   R
Sbjct  7    ILVLASLLLVTSSLASATVSDAFGSGAAAPAPQIKDGPALETWCGQKCEGRCKEAGLKDR  66

Query  325  CLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CLKYCGICC+ C CVPSGT+G+K +CPCYRD   +KG PKCP
Sbjct  67   CLKYCGICCKDCQCVPSGTYGNKHECPCYRDKLTNKGTPKCP  108



>ref|NP_001051348.1| Os03g0760800 [Oryza sativa Japonica Group]
 gb|AAK63933.1|AC084282_14 putative protein of gibberellin-stimulated transcript [Oryza 
sativa Japonica Group]
 dbj|BAD67542.1| Gibberellin stimulated transcript related protein 1 [Oryza sativa 
Japonica Group]
 gb|ABF99002.1| Gibberellin-regulated protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13262.1| Os03g0760800 [Oryza sativa Japonica Group]
 gb|EAY91938.1| hypothetical protein OsI_13625 [Oryza sativa Indica Group]
 gb|EAZ28663.1| hypothetical protein OsJ_12674 [Oryza sativa Japonica Group]
 dbj|BAH00426.1| unnamed protein product [Oryza sativa Japonica Group]
Length=93

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS FC  KC  RCSKA RH  CLKYCG+CC  C+CVPSGT G+KD+CPCYRDM   
Sbjct  24   VSMAGSDFCDGKCKVRCSKASRHDDCLKYCGVCCASCNCVPSGTAGNKDECPCYRDMTTG  83

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  84   HGARKRPKCP  93



>gb|EMT21443.1| hypothetical protein F775_31764 [Aegilops tauschii]
Length=94

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 51/68 (75%), Gaps = 3/68 (4%)
 Frame = +1

Query  256  VEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKG  435
            + GS+FC  KC  RCSKAGRH  CLKYCGICC +C+CVPSGT G+KD+CPCYRD     G
Sbjct  27   MAGSAFCDGKCGVRCSKAGRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTGHG  86

Query  436  ---RPKCP  450
               RPKCP
Sbjct  87   ARKRPKCP  94



>emb|CDX88727.1| BnaA03g09220D [Brassica napus]
Length=91

 Score = 91.3 bits (225),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC-HCVPSGTFGHKDDCPCYRDMENSKGRP  441
            SS C  KC  RCSKA  H RCLKYC ICC KC +CVPSGT+G+KD+CPCYRDM+NSKG P
Sbjct  29   SSPCNGKCNVRCSKARIHDRCLKYCNICCGKCDYCVPSGTYGNKDECPCYRDMKNSKGGP  88

Query  442  KCP  450
            KCP
Sbjct  89   KCP  91



>ref|XP_006829298.1| hypothetical protein AMTR_s00001p00273070 [Amborella trichopoda]
 gb|ERM96714.1| hypothetical protein AMTR_s00001p00273070 [Amborella trichopoda]
Length=87

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +1

Query  208  SILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFG  387
            +I +   L   S  V + GS FC +KC  RCSKA    RC+KYC +CCE+C+CVPSGT+G
Sbjct  7    AIFLLALLCLSSVPVSLGGSPFCNAKCGVRCSKAAVMDRCIKYCRLCCEECNCVPSGTYG  66

Query  388  HKDDCPCYRDMENSKGRPKCP  450
            +KD CPCYRD  +    PKCP
Sbjct  67   NKDQCPCYRDKLSKNRNPKCP  87



>gb|KFK39277.1| hypothetical protein AALP_AA3G223500 [Arabis alpina]
Length=63

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +CGS+C  RC+KAG   RCLKYCGICC +C CVPSGTFG+K  CPCYRD  +SKG+PKCP
Sbjct  4    YCGSRCRGRCAKAGFQDRCLKYCGICCRQCKCVPSGTFGNKHQCPCYRDKLSSKGKPKCP  63



>ref|XP_010458411.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=88

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCHCVP  372
            L++    +   L   S   +    S CG KC  RCSK  R H  C+K C ICC KC+CVP
Sbjct  3    LIVIQFFIISLLFTSSFFALSSADSSCGEKCNVRCSKNDRKHEECIKDCNICCGKCNCVP  62

Query  373  SGTFGHKDDCPCYRDMENSKGRPKCP  450
            SGT+G+KD+CPCYRD++NSKG PKCP
Sbjct  63   SGTYGNKDECPCYRDIKNSKGGPKCP  88



>gb|KCW63655.1| hypothetical protein EUGRSUZ_G01294 [Eucalyptus grandis]
Length=124

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            S FCG+KC  RC+KAG   RC+KYC ICC++C CVPSGT+G+K +CPCYRD  +SKG+PK
Sbjct  63   SPFCGNKCKGRCAKAGVMDRCVKYCNICCQECGCVPSGTYGNKHECPCYRDKRSSKGKPK  122

Query  445  CP  450
            CP
Sbjct  123  CP  124



>ref|XP_004141992.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004163840.1| PREDICTED: snakin-1-like [Cucumis sativus]
 gb|KGN48576.1| hypothetical protein Csa_6G493840 [Cucumis sativus]
Length=95

 Score = 90.9 bits (224),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  223  WSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDC  402
            ++ A+ ST    +G   C SKC  RC  AG   RCLKYCG+CC++C CVPSGT+G+K +C
Sbjct  22   YATADSSTTYAPKG--VCDSKCGVRCLNAGVKDRCLKYCGLCCQQCKCVPSGTYGNKSEC  79

Query  403  PCYRDMENSKGRPKCP  450
            PCYRD  NSKG+ KCP
Sbjct  80   PCYRDKLNSKGKSKCP  95



>ref|XP_009403087.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 90.5 bits (223),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 7/88 (8%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPS  375
            L++  IL + S A+    + +  S+FC SKC  RCSKA    RCLK+CG+CCE C CVPS
Sbjct  8    LVILLILFTSSCAQ----LAMARSAFCDSKCKVRCSKASLQDRCLKFCGLCCETCRCVPS  63

Query  376  GTFGHKDDCPCYRDMENSKG---RPKCP  450
            GT+G+KD+CPCYRD     G   RPKCP
Sbjct  64   GTYGNKDECPCYRDKYTGVGKRRRPKCP  91



>gb|ACR37248.1| unknown [Zea mays]
 gb|ACR37359.1| unknown [Zea mays]
Length=96

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS FC  KCA RCSKA RH   LKYCGICC  C+CVPSGT G+KD+CPCYRDM   
Sbjct  27   VSMAGSGFCDGKCAVRCSKASRHDDRLKYCGICCATCNCVPSGTAGNKDECPCYRDMTTG  86

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  87   HGNRTRPKCP  96



>emb|CDY22975.1| BnaC03g40940D [Brassica napus]
Length=97

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +C S+C  RCSKAG   RC+KYCGICC +C CVPSGTFG+K  CPCYRDM +SKG+PKCP
Sbjct  38   YCVSRCRGRCSKAGFRDRCIKYCGICCRQCKCVPSGTFGNKHQCPCYRDMLSSKGKPKCP  97



>ref|XP_010065940.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
Length=88

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            S FCG+KC  RC+KAG   RC+KYC ICC++C CVPSGT+G+K +CPCYRD  +SKG+PK
Sbjct  27   SPFCGNKCKGRCAKAGVMDRCVKYCNICCQECGCVPSGTYGNKHECPCYRDKRSSKGKPK  86

Query  445  CP  450
            CP
Sbjct  87   CP  88



>ref|XP_010028136.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW54794.1| hypothetical protein EUGRSUZ_I00735 [Eucalyptus grandis]
Length=93

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C +KC  RC  AG   RCLKYCG+CC+KC CVPSGT+G+K +CPCYRDM+NSKG  KCP
Sbjct  35   CDAKCGVRCQNAGVKDRCLKYCGLCCQKCQCVPSGTYGNKSECPCYRDMKNSKGTAKCP  93



>gb|EMS47698.1| hypothetical protein TRIUR3_08559 [Triticum urartu]
Length=94

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
                GS+FC  KC  RCSKA RH  CLKYCGICC +C+CVPSGT G+KD+CPCYRD    
Sbjct  25   AATAGSAFCDGKCGVRCSKASRHDDCLKYCGICCAECNCVPSGTAGNKDECPCYRDKTTG  84

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  85   HGARKRPKCP  94



>emb|CDX71072.1| BnaC03g11560D [Brassica napus]
Length=91

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC-HCVPSGTFGHKDDCPCYRDMENSKGRP  441
            SS C  KC  RCSKA    RCLKYC ICC KC +CVPSGT+G+KD+CPCYRDM+NSKG P
Sbjct  29   SSPCNGKCNVRCSKARIQDRCLKYCNICCGKCDYCVPSGTYGNKDECPCYRDMKNSKGGP  88

Query  442  KCP  450
            KCP
Sbjct  89   KCP  91



>gb|ACJ68116.1| hypothetical protein [Brassica napus]
Length=89

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC-HCVPSGTFGHKDDCPCYRDMENSKGRP  441
            SS C  KC  RCSKA    RCLKYC ICC KC +CVPSGT+G+KD+CPCYRDM+NSKG P
Sbjct  27   SSPCNGKCNVRCSKARIQDRCLKYCNICCGKCDYCVPSGTYGNKDECPCYRDMKNSKGGP  86

Query  442  KCP  450
            KCP
Sbjct  87   KCP  89



>ref|XP_010920764.1| PREDICTED: peamaclein-like [Elaeis guineensis]
Length=90

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 2/69 (3%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRD--ME  423
              + GS++C SKC  RC+KAG   RCLKYCG+CCE+C CVPSGT+G+KD+CPCYRD   +
Sbjct  22   AAMAGSAYCDSKCKVRCAKAGVMDRCLKYCGMCCEECKCVPSGTYGNKDECPCYRDKVTK  81

Query  424  NSKGRPKCP  450
                +PKCP
Sbjct  82   GDSKKPKCP  90



>ref|XP_009131966.1| PREDICTED: gibberellin-regulated protein 10-like [Brassica rapa]
Length=89

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKC-HCVPSGTFGHKDDCPCYRDMENSKGRP  441
            SS C  KC  RCSKA    RCLKYC ICC KC +CVPSGT+G+KD+CPCYRDM+NSKG P
Sbjct  27   SSPCNGKCNVRCSKARIQDRCLKYCNICCGKCDNCVPSGTYGNKDECPCYRDMKNSKGGP  86

Query  442  KCP  450
            KCP
Sbjct  87   KCP  89



>gb|AGE15499.1| GA-stimulated transcript-like protein 3 [Gossypium hirsutum]
Length=90

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            S FC  KC  RC+KA    RC KYCGICCE+C CVPSGT+G+K +CPCYRD  N+KG+PK
Sbjct  29   SPFCEGKCKGRCNKAAVWDRCFKYCGICCEECKCVPSGTYGNKHECPCYRDKVNNKGKPK  88

Query  445  CP  450
            CP
Sbjct  89   CP  90



>ref|XP_002879804.1| hypothetical protein ARALYDRAFT_482976 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56063.1| hypothetical protein ARALYDRAFT_482976 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = +1

Query  217  MSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCV---PSGTFG  387
            MS  LA    V+       CG KC  RCSKAG+H  CLKY  ICC KC+C    PS TFG
Sbjct  1    MSLLLASTFFVLSSADCVTCGGKCNVRCSKAGQHEECLKYYNICCHKCNCTRHCPSDTFG  60

Query  388  HKDDCPCYRDMENSKGRPKCP  450
            +KD+CPCYRDM+NSKG  KCP
Sbjct  61   NKDECPCYRDMKNSKGGSKCP  81



>emb|CDY50148.1| BnaA01g26080D [Brassica napus]
Length=96

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +C S+C  RC+KAG   RCLKYCGICC +C CVPSGTFG+K  CPCYRD  +SKG+PKCP
Sbjct  37   YCRSRCRGRCAKAGFQDRCLKYCGICCRQCKCVPSGTFGNKHQCPCYRDKLSSKGKPKCP  96



>gb|ABK22434.1| unknown [Picea sitchensis]
 gb|ABK25425.1| unknown [Picea sitchensis]
Length=111

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CGS C  RC+ A    RCLKYCGICC  C CVP GT+G+K+ CPCYRDM+N+KG+PKCP
Sbjct  53   CGSACGKRCALASVKDRCLKYCGICCSSCQCVPPGTYGNKNACPCYRDMKNAKGKPKCP  111



>emb|CDX93153.1| BnaA03g38750D [Brassica napus]
Length=106

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 60/100 (60%), Gaps = 14/100 (14%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTV--------------VVVEGSSFCGSKCAARCSKAGRHGRCL  330
            +L + S+L+  S    +T+              V  E   +CG KC  RC  AG + RCL
Sbjct  7    ILFVASLLLITSSLASATISGGGGAAAPAPEIKVGPELDKWCGGKCVVRCKDAGMNDRCL  66

Query  331  KYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            KYCGICC++C CVPSGT+G+K +CPCYRD  +SK  PKCP
Sbjct  67   KYCGICCKECKCVPSGTYGNKHECPCYRDKLSSKKTPKCP  106



>ref|XP_010475932.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=90

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKCH-CV  369
              + S+L++ S  E S+      SS CG KC  RCSK  R H  C+K C ICC+KC+ CV
Sbjct  8    FFIISLLLTSSFFEISSA----DSSACGGKCTVRCSKNDRQHEECIKDCNICCQKCNNCV  63

Query  370  PSGTFGHKDDCPCYRDMENSKGRPKCP  450
            PSGT+G++D+CPCYRDM+NSKG  KCP
Sbjct  64   PSGTYGNRDECPCYRDMKNSKGGSKCP  90



>emb|CDX89647.1| BnaC03g45610D [Brassica napus]
Length=106

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 13/106 (12%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTV-------------VVVEGSSFCGSKCAARCSKAG  312
            +R+ +  + +   +L++ SLA  +               V  E   +CG KC  RC  AG
Sbjct  1    MRIIVSILFVASLLLITSSLASATISGGGGAAALAPEIKVGPELDKWCGGKCEVRCKDAG  60

Query  313  RHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             + RCLKYCGICC++C CVPSGT+G+K +CPCYRD  +SK  PKCP
Sbjct  61   MNDRCLKYCGICCKECKCVPSGTYGNKHECPCYRDKLSSKKTPKCP  106



>ref|XP_009136261.1| PREDICTED: gibberellin-regulated protein 7-like [Brassica rapa]
Length=106

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 13/106 (12%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTV-------------VVVEGSSFCGSKCAARCSKAG  312
            +R+ +  + +   +L++ SLA  +               V  E   +CG KC  RC  AG
Sbjct  1    MRIIVSILFVASLLLITSSLASATISGGGGAAAPAPEIKVGPELDKWCGGKCEVRCKDAG  60

Query  313  RHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             + RCLKYCGICC++C CVPSGT+G+K +CPCYRD  +SK  PKCP
Sbjct  61   MNDRCLKYCGICCKECKCVPSGTYGNKHECPCYRDKLSSKKTPKCP  106



>ref|XP_010028389.1| PREDICTED: peamaclein-like [Eucalyptus grandis]
 gb|KCW55129.1| hypothetical protein EUGRSUZ_I01086 [Eucalyptus grandis]
Length=87

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSK  432
            V+   +FC  KC ARC+KA   GRC KYC ICC +C CVPSGT+G+K  CPCYR+ +NSK
Sbjct  22   VLGKPAFCEGKCRARCAKAKVKGRCAKYCNICCAECKCVPSGTYGNKHQCPCYRNKKNSK  81

Query  433  GRPKCP  450
            G+PKCP
Sbjct  82   GKPKCP  87



>ref|XP_002518646.1| GAST1 protein precursor, putative [Ricinus communis]
 gb|EEF43571.1| GAST1 protein precursor, putative [Ricinus communis]
Length=88

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  247  VVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMEN  426
            V V+  S FC +KC  RC++AG   RC+KYC ICC +C CVPSGT+G+K +CPCYRD +N
Sbjct  21   VPVMAKSLFCANKCNDRCARAGVKDRCIKYCEICCAECKCVPSGTYGNKLECPCYRDKKN  80

Query  427  SKGRPKCP  450
            SKG+ KCP
Sbjct  81   SKGKSKCP  88



>gb|ABK25287.1| unknown [Picea sitchensis]
Length=111

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CGS C  RC+ A    RCLKYCGICC  C CVP GT+G+K+ CPCYRD++N+KG+PKCP
Sbjct  53   CGSACGKRCALASVKDRCLKYCGICCSSCQCVPPGTYGNKNACPCYRDLKNAKGKPKCP  111



>gb|ABN12953.1| GASA-like protein [Gymnadenia conopsea]
Length=97

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 3/72 (4%)
 Frame = +1

Query  244  TVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDME  423
            + +    S+FCG KC  RCSKA  H RCL+YCG+CC  C CVPSGT+G+KD+CPCYRD  
Sbjct  26   SQMASSQSAFCGEKCKVRCSKASDHDRCLRYCGVCCNLCGCVPSGTYGNKDECPCYRDKY  85

Query  424  NSKG---RPKCP  450
               G   RPKCP
Sbjct  86   TGVGQRRRPKCP  97



>ref|XP_007042576.1| Uncharacterized protein TCM_007177 [Theobroma cacao]
 gb|EOX98407.1| Uncharacterized protein TCM_007177 [Theobroma cacao]
Length=90

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            S FC  KC ARC KA    RC+KYCG+CCE+C CVPSGT+G+K +CPCYRD ++ KG PK
Sbjct  29   SPFCVGKCDARCKKAAVWDRCIKYCGLCCEQCKCVPSGTYGNKHECPCYRDKKSKKGTPK  88

Query  445  CP  450
            CP
Sbjct  89   CP  90



>ref|XP_004142881.1| PREDICTED: snakin-1-like [Cucumis sativus]
 ref|XP_004156376.1| PREDICTED: snakin-1-like [Cucumis sativus]
 gb|KGN62465.1| hypothetical protein Csa_2G354910 [Cucumis sativus]
Length=85

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            FCG KC  RCSKAG   RC+KYCGICCEKC CVPSGT+G+K +CPCY +++NSKG  KCP
Sbjct  26   FCGWKCRRRCSKAGVRDRCMKYCGICCEKCGCVPSGTYGNKHECPCYGNLKNSKGNSKCP  85



>gb|KDP32030.1| hypothetical protein JCGZ_12491 [Jatropha curcas]
Length=79

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  268  SFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKC  447
            S C  KC  RCS AG   RCLKYCGICC++C CVPSGT+G+K +CPCYRD +NSKG+ KC
Sbjct  19   SDCDLKCGTRCSNAGYKDRCLKYCGICCQECKCVPSGTYGNKSECPCYRDKKNSKGQSKC  78

Query  448  P  450
            P
Sbjct  79   P  79



>ref|XP_009123227.1| PREDICTED: gibberellin-regulated protein 7 isoform X2 [Brassica 
rapa]
Length=100

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 7/100 (7%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTVVVV-------EGSSFCGSKCAARCSKAGRHGRCL  330
            +++ L    +   +L++ SLA  +            E   +CG KC  RC +AG   RCL
Sbjct  1    MKIILSIFFVASFLLITSSLASATISAPAPEIKDGAELEKWCGGKCEVRCEEAGMKDRCL  60

Query  331  KYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            KYCGICC++C CVPSGT+G+K +C CYRD  +SK  PKCP
Sbjct  61   KYCGICCKECKCVPSGTYGNKHECACYRDKLSSKKTPKCP  100



>gb|KFK39992.1| hypothetical protein AALP_AA3G316000 [Arabis alpina]
Length=105

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  232  AERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCY  411
            AE     V+E  ++CG KC  RC +AG   RCLKYCGICC++C CVPSGT+G+K +C CY
Sbjct  35   AESKDAAVLE--NWCGGKCEGRCKEAGMKDRCLKYCGICCKECKCVPSGTYGNKHECACY  92

Query  412  RDMENSKGRPKCP  450
            RD   SK  PKCP
Sbjct  93   RDKLTSKKTPKCP  105



>ref|XP_002973082.1| hypothetical protein SELMODRAFT_99264 [Selaginella moellendorffii]
 gb|EFJ25456.1| hypothetical protein SELMODRAFT_99264 [Selaginella moellendorffii]
Length=68

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +1

Query  247  VVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMEN  426
            ++V    + CGS C  RCSKA  H RC+KYC ICC KC+CVP GT+G+K+ CPCY +++N
Sbjct  1    MIVWSIFADCGSACDYRCSKADAHDRCIKYCNICCGKCNCVPPGTYGNKETCPCYNNLKN  60

Query  427  SKGRPKCP  450
            SKG PKCP
Sbjct  61   SKGGPKCP  68



>gb|KGN52784.1| hypothetical protein Csa_4G001520 [Cucumis sativus]
Length=422

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRP  441
            FC  KC  RCSKAG   RC+KYCGICC  C CVPSGT+G+K +CPCYRDM +SKGRP
Sbjct  30   FCDKKCKKRCSKAGVKDRCIKYCGICCGYCKCVPSGTYGNKHECPCYRDMRSSKGRP  86



>gb|KCW54793.1| hypothetical protein EUGRSUZ_I00734 [Eucalyptus grandis]
Length=93

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  268  SFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKC  447
            S C +KCA RC K+ R  +CLKYCGICC+KCHCVPSG +  K +CPCYRDM++ +G+ KC
Sbjct  33   SSCDAKCAVRCQKSWRKDKCLKYCGICCQKCHCVPSGPYADKSECPCYRDMKSPQGKDKC  92

Query  448  P  450
            P
Sbjct  93   P  93



>ref|XP_006409618.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
 gb|ESQ51071.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
Length=107

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +CG KC  RC K+G   RCL YCGICC++C CVPSGT+G+KD+C CYRD  +SK  PKCP
Sbjct  48   WCGGKCEVRCKKSGMKDRCLNYCGICCKECKCVPSGTYGNKDECACYRDKLSSKMTPKCP  107



>ref|XP_006298856.1| hypothetical protein CARUB_v10014971mg [Capsella rubella]
 gb|EOA31754.1| hypothetical protein CARUB_v10014971mg [Capsella rubella]
Length=108

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 57/102 (56%), Gaps = 16/102 (16%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGS----------------SFCGSKCAARCSKAGRHGR  324
            +L++ S+L+  S    +T     GS                 +CG KC  RC  AG   R
Sbjct  7    ILVLASLLLVTSSLASATFSDAFGSGAVAPAPQMKDGPVLEKWCGQKCEGRCKAAGMKDR  66

Query  325  CLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CLKYCGICC+ C CVPSGT+G+K +C CYRD   +KG PKCP
Sbjct  67   CLKYCGICCKDCQCVPSGTYGNKHECACYRDKLTNKGTPKCP  108



>ref|XP_006409619.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
 gb|ESQ51072.1| hypothetical protein EUTSA_v10022920mg [Eutrema salsugineum]
Length=112

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +CG KC  RC K+G   RCL YCGICC++C CVPSGT+G+KD+C CYRD  +SK  PKCP
Sbjct  53   WCGGKCEVRCKKSGMKDRCLNYCGICCKECKCVPSGTYGNKDECACYRDKLSSKMTPKCP  112



>ref|XP_002883868.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60127.1| gibberellin-regulated family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=108

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 57/102 (56%), Gaps = 16/102 (16%)
 Frame = +1

Query  193  VLMMGSILMSWSLAERSTVVVVEGS----------------SFCGSKCAARCSKAGRHGR  324
            +L + S+L+  S    +TV    GS                 +CG KC  RC  AG   R
Sbjct  7    ILFLASVLLITSSLASATVSDAIGSGAVAPAPEIKYGPALEKWCGQKCEGRCKAAGMKDR  66

Query  325  CLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CLKYC ICC+ C CVPSGT+G+K +C CYRD  +SKG PKCP
Sbjct  67   CLKYCVICCKDCQCVPSGTYGNKHECACYRDKLSSKGTPKCP  108



>ref|XP_002976786.1| hypothetical protein SELMODRAFT_105504, partial [Selaginella 
moellendorffii]
 gb|EFJ22455.1| hypothetical protein SELMODRAFT_105504, partial [Selaginella 
moellendorffii]
Length=61

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CGS C  RCSKA  H RC+KYC ICC KC+CVP GT+G+K+ CPCY +++NSKG PKCP
Sbjct  3    CGSACDYRCSKADAHDRCIKYCNICCGKCNCVPPGTYGNKETCPCYNNLKNSKGGPKCP  61



>ref|XP_009123225.1| PREDICTED: gibberellin-regulated protein 7 isoform X1 [Brassica 
rapa]
Length=107

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  256  VEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKG  435
             E   +CG KC  RC +AG   RCLKYCGICC++C CVPSGT+G+K +C CYRD  +SK 
Sbjct  43   AELEKWCGGKCEVRCEEAGMKDRCLKYCGICCKECKCVPSGTYGNKHECACYRDKLSSKK  102

Query  436  RPKCP  450
             PKCP
Sbjct  103  TPKCP  107



>gb|AFK36243.1| unknown [Lotus japonicus]
 gb|AFK45019.1| unknown [Lotus japonicus]
Length=94

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSK  432
            VV+ S FCGSKCA RCSKAG   RC+++CGICC KC CVPSGT+G+K +CPCYRDM+NSK
Sbjct  29   VVKESGFCGSKCAQRCSKAGMQDRCIRFCGICCGKCKCVPSGTYGNKHECPCYRDMKNSK  88

Query  433  GRPKCP  450
            G+PKCP
Sbjct  89   GKPKCP  94



>emb|CDY52417.1| BnaCnng22380D [Brassica napus]
Length=108

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  256  VEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKG  435
             E   +CG KC  RC +AG   RCLKYCGICC++C CVPSGT+G+K +C CYRD  +SK 
Sbjct  44   AELEKWCGGKCEVRCEEAGMKDRCLKYCGICCKECKCVPSGTYGNKHECACYRDKLSSKK  103

Query  436  RPKCP  450
             PKCP
Sbjct  104  TPKCP  108



>emb|CDY54472.1| BnaA09g52760D [Brassica napus]
Length=109

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  256  VEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKG  435
             E   +CG KC  RC +AG   RCLKYCGICC++C CVPSGT+G+K +C CYRD  +SK 
Sbjct  45   AELEKWCGGKCEVRCEEAGMKDRCLKYCGICCKECKCVPSGTYGNKHECACYRDKLSSKK  104

Query  436  RPKCP  450
             PKCP
Sbjct  105  TPKCP  109



>ref|NP_179096.1| gibberellin-regulated protein [Arabidopsis thaliana]
 sp|O82328.1|GASA7_ARATH RecName: Full=Gibberellin-regulated protein 7; AltName: Full=GAST1 
protein homolog 7; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC61287.1| similar to gibberellin-regulated proteins [Arabidopsis thaliana]
 gb|AAO22720.1| putative gibberellin-regulated protein [Arabidopsis thaliana]
 gb|AAO42417.1| putative gibberellin-regulated protein [Arabidopsis thaliana]
 gb|AEC06348.1| gibberellin-regulated protein [Arabidopsis thaliana]
Length=108

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  271  FCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +CG KC  RC +AG   RCLKYCGICC+ C CVPSGT+G+K +C CYRD  +SKG PKCP
Sbjct  49   WCGQKCEGRCKEAGMKDRCLKYCGICCKDCQCVPSGTYGNKHECACYRDKLSSKGTPKCP  108



>ref|XP_008444582.1| PREDICTED: peamaclein-like [Cucumis melo]
Length=85

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  268  SFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKC  447
             FCG KC  RCSKAG   RC+KYCGICC KC CVPSGT+G+K +CPCY +++NSKG  KC
Sbjct  25   GFCGWKCRRRCSKAGVRDRCMKYCGICCVKCGCVPSGTYGNKHECPCYGNLKNSKGNSKC  84

Query  448  P  450
            P
Sbjct  85   P  85



>ref|XP_007018557.1| Gibberellin-regulated family protein [Theobroma cacao]
 gb|EOY15782.1| Gibberellin-regulated family protein [Theobroma cacao]
Length=95

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS FC SKC  RCSKAG   RCLKYCGICC+KC CVPSGT+G+K +CPCYRDM+NS
Sbjct  22   VSMAGSGFCDSKCKVRCSKAGAKDRCLKYCGICCKKCKCVPSGTYGNKQECPCYRDMKNS  81

Query  430  KGR  438
            KG+
Sbjct  82   KGQ  84



>ref|XP_009800618.1| PREDICTED: peamaclein-like, partial [Nicotiana sylvestris]
Length=72

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            + + G   C SKCA R  KAG   RCL YCGI C KC+CVPSG +G+K +CPCYRDM NS
Sbjct  6    MYLYGVGSCDSKCAVRRGKAGIAKRCLTYCGIYCNKCNCVPSGNYGNKSECPCYRDMLNS  65

Query  430  KGRPKCP  450
            KG+ KCP
Sbjct  66   KGKSKCP  72



>ref|NP_001152432.1| gibberellin-regulated protein 2 precursor [Zea mays]
 gb|ACG47587.1| gibberellin-regulated protein 2 precursor [Zea mays]
Length=96

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  250  VVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS  429
            V + GS  C  KCA RCSKA RH  CLK CGICC  C+CV SGT G+KD+CPCYRDM   
Sbjct  27   VSMAGSXXCDGKCAVRCSKASRHDDCLKXCGICCATCNCVLSGTAGNKDECPCYRDMTTG  86

Query  430  KG---RPKCP  450
             G   RPKCP
Sbjct  87   HGNRTRPKCP  96



>ref|XP_002969375.1| hypothetical protein SELMODRAFT_440818 [Selaginella moellendorffii]
 gb|EFJ29463.1| hypothetical protein SELMODRAFT_440818 [Selaginella moellendorffii]
Length=101

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C   C +RC  A  H RC+ YCGICC+ C+CVPSG +G+KD+C CYRD +NSKG+ KCP
Sbjct  43   CAQACTSRCEVASVHDRCMNYCGICCQSCNCVPSGHYGNKDECSCYRDKKNSKGKAKCP  101



>ref|XP_010685204.1| PREDICTED: peamaclein-like [Beta vulgaris subsp. vulgaris]
Length=101

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 59/96 (61%), Gaps = 5/96 (5%)
 Frame = +1

Query  178  VALRCVLMMGSILMSWSLAE-----RSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCG  342
            V L   L++ S L+  + A+     +S   V   + FC +KC  RC+  G + RC+KYC 
Sbjct  6    VVLFISLILCSALLDINNAQPLSPSQSPDTVESTTGFCSNKCGVRCALKGVNSRCMKYCM  65

Query  343  ICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +CC KC CVPSGT G+ ++CPCYRD +   GRPKCP
Sbjct  66   MCCGKCSCVPSGTSGNLNECPCYRDWKAPNGRPKCP  101



>ref|XP_010475933.1| PREDICTED: gibberellin-regulated protein 8-like [Camelina sativa]
Length=89

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRH-GRCLKYCGICCEKCH-CV  369
            L++    +   L   S   +    S C  KC  RCSK  R   +C K C ICC KC+ CV
Sbjct  3    LIVIQFFIISLLLTSSFFKISSADSLCDGKCKVRCSKNDREPDKCFKLCNICCHKCNNCV  62

Query  370  PSGTFGHKDDCPCYRDMENSKGRPKCP  450
            PSGT+G+KD+CPCYRDM+NSKG  KCP
Sbjct  63   PSGTYGNKDECPCYRDMKNSKGGSKCP  89



>ref|XP_009404981.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=89

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +1

Query  208  SILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFG  387
            ++L+   L E     V E    C +KC+ RCSKA RH  C++ C  CC KCHCVP GT+G
Sbjct  9    AVLLLLLLVEMDISAVAEREINCEAKCSHRCSKASRHKMCMRACVDCCHKCHCVPPGTYG  68

Query  388  HKDDCPCYRDMENSKGRPKCP  450
            HK++CPCY  M+   G+PKCP
Sbjct  69   HKEECPCYAHMKTRHGKPKCP  89



>ref|XP_009617608.1| PREDICTED: peamaclein-like [Nicotiana tomentosiformis]
Length=91

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 60/94 (64%), Gaps = 6/94 (6%)
 Frame = +1

Query  169  NIRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGIC  348
             I+  L   +++ ++L++ S  E +T      S +C  K  A  +K G   +C+KYC +C
Sbjct  4    KIKRLLVAFMLVFALLLTSSFLETATA----KSVYCAHK--ATNAKLGVPSQCVKYCELC  57

Query  349  CEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C KC CVP+GT+G+K   PCYRDM+NSKG+PKCP
Sbjct  58   CAKCKCVPTGTYGNKHQYPCYRDMKNSKGKPKCP  91



>ref|XP_008780246.1| PREDICTED: gibberellin-regulated protein 2-like, partial [Phoenix 
dactylifera]
Length=68

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C S+CA RCSKA RH  C++ C  CC++CHCVP GTFG+KD CPCY +M+   GRPKCP
Sbjct  10   CSSRCAYRCSKASRHKMCIRACNTCCQRCHCVPPGTFGNKDVCPCYANMKTHGGRPKCP  68



>ref|XP_003589114.1| Snakin-1 [Medicago truncatula]
 gb|ABD33278.1| Gibberellin regulated protein [Medicago truncatula]
 gb|ACJ86188.1| unknown [Medicago truncatula]
 gb|AES59365.1| gibberellin-regulated family protein [Medicago truncatula]
 gb|AFK38793.1| unknown [Medicago truncatula]
Length=91

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 65/93 (70%), Gaps = 2/93 (2%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICC  351
            ++ A   +L++  IL S+      ++   +   FC SKC  RCSKAG   RC+K+CGICC
Sbjct  1    MKPAFAAMLLVCLILSSFMF--EMSIAGTDSGRFCSSKCGQRCSKAGMKDRCMKFCGICC  58

Query  352  EKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             KC CVPSGT+G+K +CPCYRDM+NSKG+PKCP
Sbjct  59   GKCKCVPSGTYGNKHECPCYRDMKNSKGKPKCP  91



>gb|ABR25339.1| giberellin regulated family protein [Oryza sativa Indica Group]
Length=61

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 44/59 (75%), Gaps = 3/59 (5%)
 Frame = +1

Query  283  KCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKG---RPKCP  450
            KC  RCSKA RH  CLKYCG+CC  C+CVPSGT G+KD+CPCYRDM    G   RPKCP
Sbjct  3    KCKVRCSKASRHDDCLKYCGVCCASCNCVPSGTAGNKDECPCYRDMTTGHGARKRPKCP  61



>ref|XP_006649745.1| PREDICTED: gibberellin-regulated protein 12-like [Oryza brachyantha]
Length=101

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C  KC  RCS       CLKYC ICC+KC CVPSGT+GHK++CPCY +M++S+G PKCP
Sbjct  43   CPQKCDYRCSATKHREPCLKYCNICCQKCLCVPSGTYGHKEECPCYNNMKSSQGNPKCP  101



>ref|XP_002970705.1| hypothetical protein SELMODRAFT_94072, partial [Selaginella moellendorffii]
 gb|EFJ28031.1| hypothetical protein SELMODRAFT_94072, partial [Selaginella moellendorffii]
Length=59

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C   C +RC+ A  H RC+ YCGICC+ C+CVPSG +G+KD+C CYRD +NSKG+ KCP
Sbjct  1    CAQACTSRCAVASVHDRCMNYCGICCQSCNCVPSGHYGNKDECSCYRDKKNSKGKAKCP  59



>gb|ABK21371.1| unknown [Picea sitchensis]
Length=117

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C S+C  RC  A R   CLK+CGICC  C CVPSGT G+KD+CPCYRD  +S+G+PKCP
Sbjct  59   CKSECDRRCKVAPRQKACLKFCGICCNACKCVPSGTRGNKDECPCYRDKRSSQGKPKCP  117



>gb|AAD01518.1| Snakin-1 [Solanum tuberosum]
Length=50

 Score = 79.3 bits (194),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  301  SKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            SKAG   RCLKYCGICCE+C CVPSGT+G+K +CPCYRD +NSKG+ KCP
Sbjct  1    SKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP  50



>gb|ABK21812.1| unknown [Picea sitchensis]
Length=121

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C S+C  RC  A R   CLK+CGICC  C CVPSGT G+KD+CPCYRD  +S+G+PKCP
Sbjct  63   CKSECDRRCKVAPRQKACLKFCGICCNACKCVPSGTRGNKDECPCYRDKRSSQGKPKCP  121



>ref|XP_002973289.1| hypothetical protein SELMODRAFT_99234, partial [Selaginella moellendorffii]
 ref|XP_002976615.1| hypothetical protein SELMODRAFT_105312, partial [Selaginella 
moellendorffii]
 gb|EFJ22284.1| hypothetical protein SELMODRAFT_105312, partial [Selaginella 
moellendorffii]
 gb|EFJ25663.1| hypothetical protein SELMODRAFT_99234, partial [Selaginella moellendorffii]
Length=60

 Score = 79.3 bits (194),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C S C  RCSKA  H RC+K+C ICC KC+CVP GT G+K+ CPCY +++NSKG PKCP
Sbjct  2    CPSACDYRCSKASLHNRCIKFCNICCRKCNCVPPGTAGNKEKCPCYNNIKNSKGGPKCP  60



>gb|AES96393.2| GASA/GAST/Snakin [Medicago truncatula]
Length=83

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +1

Query  202  MGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGT  381
            M   + ++      T V+ E    C  KC  RCSK      CL YC +CC KC CVPSGT
Sbjct  1    MAKFICAFLFMLVITFVIQETYVNCAPKCDYRCSKTSHRKACLTYCNLCCAKCLCVPSGT  60

Query  382  FGHKDDCPCYRDMENSKGRPKCP  450
            +G+K +CPCY +  N  G PKCP
Sbjct  61   YGNKQECPCYDNWRNKNGGPKCP  83



>ref|XP_004517034.1| PREDICTED: gibberellin-regulated protein 12-like [Cicer arietinum]
Length=92

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGS---SFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGT  381
            +++  + A + T    EGS     C + CA RCS       CL YC +CC KC CVPSGT
Sbjct  10   LMLVMAFAIKDTYAGKEGSLRPKECATACALRCSATQYKEACLTYCNLCCAKCLCVPSGT  69

Query  382  FGHKDDCPCYRDMENSKGRPKCP  450
            +GHK++CPCY + +  KG PKCP
Sbjct  70   YGHKEECPCYNNWKTKKGGPKCP  92



>gb|AFE82743.1| snakin-1 [Medicago sativa]
 gb|AFJ54172.1| snakin-1 [Medicago sativa]
Length=91

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = +1

Query  172  IRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICC  351
            ++ A   +L++  IL S+      ++   +   FC S C  RCSKAG   RC+K+CGICC
Sbjct  1    MKPAFAAMLLVCLILSSFMF--EMSIAGTDSGRFCSSICGQRCSKAGMKDRCMKFCGICC  58

Query  352  EKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             KC CVPSGT+G+K +CPCYRDM+NSKG+PKCP
Sbjct  59   GKCKCVPSGTYGNKHECPCYRDMKNSKGKPKCP  91



>ref|XP_010665102.1| PREDICTED: peamaclein-like [Vitis vinifera]
Length=97

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = +1

Query  181  ALRCVLMMGSILMSWSLAERSTVVVVEGSS--FCGSKCAARCSKAGRHGRCLKYCGICCE  354
            AL  VL++   ++   L  +S  +V   +    C SKCA RCSKAG H  CL+ C  CCE
Sbjct  6    ALTLVLVILCFVLVHELETKSGHLVTANAEKIDCKSKCAYRCSKAGWHKLCLRACNTCCE  65

Query  355  KCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +C+CVP GT G++D CPCY  M    GR KCP
Sbjct  66   RCNCVPPGTAGNEDVCPCYAKMTTHGGRHKCP  97



>ref|XP_002970861.1| hypothetical protein SELMODRAFT_94549, partial [Selaginella moellendorffii]
 gb|EFJ28187.1| hypothetical protein SELMODRAFT_94549, partial [Selaginella moellendorffii]
Length=67

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C S C  RC  A  H RCLKYC ICC +CHCVPSG  G++D+CPCYRD +NS+G  KCP
Sbjct  9    CTSACETRCLVANLHKRCLKYCNICCVECHCVPSGHSGNEDECPCYRDKKNSRGGDKCP  67



>ref|XP_006342570.1| PREDICTED: gibberellin-regulated protein 1-like [Solanum tuberosum]
Length=113

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            +S CG+ C ARCS A RH  CL+ CG CC +C+CVP GT G++D CPCYRDM    G+ K
Sbjct  52   TSECGTACEARCSLASRHKMCLRACGTCCTRCNCVPPGTSGNQDLCPCYRDMLTHHGKHK  111

Query  445  CP  450
            CP
Sbjct  112  CP  113



>ref|XP_002986081.1| hypothetical protein SELMODRAFT_123391 [Selaginella moellendorffii]
 gb|EFJ12900.1| hypothetical protein SELMODRAFT_123391 [Selaginella moellendorffii]
Length=69

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C + C  RCSKAG H RCLKYC ICC KC CVP GT G+++ CPCY +M+NS+G  KCP
Sbjct  11   CAAACDYRCSKAGLHKRCLKYCNICCGKCQCVPPGTAGNREVCPCYNEMKNSRGGHKCP  69



>ref|XP_002969591.1| hypothetical protein SELMODRAFT_91546, partial [Selaginella moellendorffii]
 gb|EFJ29679.1| hypothetical protein SELMODRAFT_91546, partial [Selaginella moellendorffii]
Length=67

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C S C  RC  A  H RCLKYC ICC  CHCVPSG  G++D+CPCYRD +NS+G  KCP
Sbjct  9    CTSACETRCLVANLHKRCLKYCNICCVACHCVPSGHSGNEDECPCYRDKKNSRGGDKCP  67



>ref|XP_010314649.1| PREDICTED: gibberellin-regulated protein 1-like [Solanum lycopersicum]
Length=112

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            +S CG+ C ARCS A RH  CL+ CG CC +C+CVP GT G++D CPCYRDM    G+ K
Sbjct  51   TSECGTACEARCSLASRHKMCLRACGTCCTRCNCVPPGTSGNQDLCPCYRDMLTHHGKHK  110

Query  445  CP  450
            CP
Sbjct  111  CP  112



>ref|XP_010547967.1| PREDICTED: peamaclein [Tarenaya hassleriana]
Length=105

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +1

Query  259  EGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGR  438
            E   +C  +C  RC  AG H RCL YCGICC  C CVPSGT G+K +C CYRD  +SKG 
Sbjct  42   EVERWCEDRCEVRCRVAGMHDRCLNYCGICCRDCKCVPSGTSGNKHECACYRDKLSSKGT  101

Query  439  PKCP  450
            PKCP
Sbjct  102  PKCP  105



>ref|XP_011038137.1| PREDICTED: gibberellin-regulated protein 2 [Populus euphratica]
Length=91

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +1

Query  208  SILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFG  387
            +IL    + E     V  G   C SKC  RCSKA RH  C++ C  CC++C+CVP GT G
Sbjct  11   AILCLVLMHELQIYAVEAGDINCKSKCEYRCSKASRHKMCIRACNTCCQRCNCVPPGTSG  70

Query  388  HKDDCPCYRDMENSKGRPKCP  450
            ++D CPCY +M    GR KCP
Sbjct  71   NEDTCPCYANMTTHGGRHKCP  91



>ref|NP_001055630.1| Os05g0432200 [Oryza sativa Japonica Group]
 gb|AAT47046.1| putative gibberellin regulated protein [Oryza sativa Japonica 
Group]
 gb|AAT58749.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17544.1| Os05g0432200 [Oryza sativa Japonica Group]
 gb|EAY98159.1| hypothetical protein OsI_20074 [Oryza sativa Indica Group]
 gb|EEE63822.1| hypothetical protein OsJ_18646 [Oryza sativa Japonica Group]
Length=92

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +1

Query  181  ALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKC  360
            +L C+ ++  +L+  + A       ++    CG+KC  RCSK+GR   CL+ CG CC++C
Sbjct  7    SLLCISLVAILLLVETTAPHGQAYAID----CGAKCGYRCSKSGRPKMCLRACGTCCQRC  62

Query  361  HCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
             CVP GT G+++ CPCY +M    GR KCP
Sbjct  63   GCVPPGTSGNENVCPCYANMTTHNGRHKCP  92



>ref|XP_008236410.1| PREDICTED: peamaclein [Prunus mume]
Length=90

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            S +C  KC++RC+ AG   RC+KYCGICCE+C CVPSGT+G+K +CPCYRD +N KG+PK
Sbjct  29   SKYCSDKCSSRCAVAGVQDRCIKYCGICCEECKCVPSGTYGNKHECPCYRDKKNKKGKPK  88

Query  445  CP  450
            CP
Sbjct  89   CP  90



>ref|XP_006846942.1| hypothetical protein AMTR_s00017p00002980 [Amborella trichopoda]
 gb|ERN08523.1| hypothetical protein AMTR_s00017p00002980 [Amborella trichopoda]
Length=106

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CGS C  RCSKA RH  C++ CG CC +CHCVP GT G++D CPCY +M    GR KCP
Sbjct  48   CGSACEYRCSKASRHKMCIRACGTCCARCHCVPPGTSGNEDVCPCYANMTTHGGRHKCP  106



>ref|XP_006376297.1| hypothetical protein POPTR_0013s11770g [Populus trichocarpa]
 gb|ERP54094.1| hypothetical protein POPTR_0013s11770g [Populus trichocarpa]
Length=91

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +1

Query  208  SILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFG  387
            +IL    + E     V  G   C SKC  RCSKA RH  C++ C  CC++C+CVP GT G
Sbjct  11   AILCLALMHELQIRTVEAGKINCKSKCEYRCSKASRHKMCIRACNTCCQRCNCVPPGTSG  70

Query  388  HKDDCPCYRDMENSKGRPKCP  450
            ++D CPCY +M    GR KCP
Sbjct  71   NEDTCPCYANMTTHGGRHKCP  91



>ref|XP_003613454.1| Gibberellin induced protein [Medicago truncatula]
 gb|AES96412.1| Thionin-like protein [Medicago truncatula]
Length=92

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGS---SFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGT  381
             ++  S   +      EGS   + C  KC  RCSK      CL YC +CC KC CVPSGT
Sbjct  10   FMLVTSFVIQDVYAGGEGSLKPAECAPKCDYRCSKTAYKKACLTYCNLCCAKCLCVPSGT  69

Query  382  FGHKDDCPCYRDMENSKGRPKCP  450
            +G+K++CPCY + +N KG PKCP
Sbjct  70   YGNKEECPCYNNWKNKKGGPKCP  92



>ref|XP_007200798.1| hypothetical protein PRUPE_ppa024899mg [Prunus persica]
 gb|EMJ01997.1| hypothetical protein PRUPE_ppa024899mg [Prunus persica]
Length=91

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  265  SSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPK  444
            S +C  KC+ RC+ AG   RC+KYCGICCE+C CVPSGT+G+K +CPCYRD +N KG+PK
Sbjct  30   SKYCSDKCSTRCAVAGVQDRCIKYCGICCEECKCVPSGTYGNKHECPCYRDKKNKKGKPK  89

Query  445  CP  450
            CP
Sbjct  90   CP  91



>gb|ABF94978.1| GAST1 protein precursor, putative [Oryza sativa Japonica Group]
Length=101

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C  KC  RCS   R   CLKYC ICC+KC CVPSGT G+K++CPCY ++++S+G  KCP
Sbjct  43   CPQKCDYRCSATKRQEPCLKYCNICCQKCLCVPSGTSGNKEECPCYNNLKSSQGNSKCP  101



>ref|XP_002526823.1| Gibberellin-regulated protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF35558.1| Gibberellin-regulated protein 2 precursor, putative [Ricinus 
communis]
Length=90

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 10/91 (11%)
 Frame = +1

Query  178  VALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEK  357
             A+ C+L+M  +     +AE   +        C SKC  RCSKA RH  C++ C  CCE+
Sbjct  10   FAILCILLMHEL---QPIAEAQEI-------DCKSKCEYRCSKASRHKMCIRACNSCCER  59

Query  358  CHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            CHCVP GT G++D CPCY  ++   GR KCP
Sbjct  60   CHCVPPGTSGNRDVCPCYAHLKTHGGRLKCP  90



>ref|XP_009403760.1| PREDICTED: peamaclein-like [Musa acuminata subsp. malaccensis]
Length=91

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +1

Query  253  VVEGSSFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYR  414
            +   S++C SKC  RC+KAG   RCL YCG+CCE+C CVPSGT+G+KD+CPCYR
Sbjct  24   MAADSAYCKSKCKVRCAKAGVMDRCLYYCGMCCEECKCVPSGTYGNKDECPCYR  77



>ref|XP_002982001.1| hypothetical protein SELMODRAFT_115445 [Selaginella moellendorffii]
 gb|EFJ17094.1| hypothetical protein SELMODRAFT_115445 [Selaginella moellendorffii]
Length=69

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C + C  RCSKAG H RCLKYC ICC KC CVP GT G+++ C CY +M+NS+G  KCP
Sbjct  11   CAAACDYRCSKAGLHKRCLKYCNICCGKCQCVPPGTAGNREVCACYNEMKNSRGGHKCP  69



>ref|XP_006662142.1| PREDICTED: gibberellin-regulated protein 12-like [Oryza brachyantha]
Length=104

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 52/98 (53%), Gaps = 17/98 (17%)
 Frame = +1

Query  208  SILMSWSLAERSTVVVVEGS-----------------SFCGSKCAARCSKAGRHGRCLKY  336
            S+ + + L   S VVVV G                    C  KC  RCS       CL Y
Sbjct  7    SLPIVFFLVAMSFVVVVSGQKNGAIYHLFGGEGSVTIEECPDKCNYRCSATSHTKACLTY  66

Query  337  CGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C  CCE+C CVPSGT+G+K++CPCY +++  +G+PKCP
Sbjct  67   CNYCCERCLCVPSGTYGNKEECPCYNNLKTQEGKPKCP  104



>ref|XP_010063765.1| PREDICTED: gibberellin-regulated protein 2-like [Eucalyptus grandis]
 gb|KCW71022.1| hypothetical protein EUGRSUZ_F04125 [Eucalyptus grandis]
Length=96

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 4/94 (4%)
 Frame = +1

Query  169  NIRVALRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGRHGRCLKYCGIC  348
            +I   + CV+++  +L+      ++    ++    C SKC  RCSKA RH  C++ C  C
Sbjct  7    SILFVILCVVLVHEVLVFGGEQLQAEAQTID----CKSKCNYRCSKASRHKMCIRACNTC  62

Query  349  CEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C++C+CVP GT G++D CPCY +M    GR KCP
Sbjct  63   CKRCNCVPPGTSGNEDVCPCYANMTTHGGRHKCP  96



>ref|XP_002298694.2| hypothetical protein POPTR_0001s32270g, partial [Populus trichocarpa]
 gb|EEE83499.2| hypothetical protein POPTR_0001s32270g, partial [Populus trichocarpa]
Length=70

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C   C  RCS       C  +C  CC+KC CVPSGT+GHKD+CPCYRDM+  +G+PKCP
Sbjct  12   CPEACDVRCSATSHKSACTFFCNYCCKKCLCVPSGTYGHKDECPCYRDMKTQEGKPKCP  70



>ref|XP_002889819.1| hypothetical protein ARALYDRAFT_471179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66078.1| hypothetical protein ARALYDRAFT_471179 [Arabidopsis lyrata subsp. 
lyrata]
Length=90

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +1

Query  184  LRCVLMMGSILMSWSLAERSTVVVVEGSSFCGSKCAARCSKAGR-HGRCLKYCGICCEKC  360
            ++ ++ +   ++S  L     V+    SS CG KC  RCSKA R H  CL+ C ICC++C
Sbjct  1    MKMLVAVQFFIISLLLTSSYFVLSSADSSACGGKCNVRCSKADRTHEECLEDCNICCQQC  60

Query  361  HCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            +CVPSGT+G+KD+CPCYRDM+NSKG  KCP
Sbjct  61   NCVPSGTYGNKDECPCYRDMKNSKGGSKCP  90



>gb|ACU43594.1| gibberellin stimulated transcript [Triticum aestivum]
Length=98

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = +1

Query  265  SSFCGSKCAARCSKA-GRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENS--KG  435
            S FC  KCA RC ++  + G C+KYCG+CCE+C CVP+G  G +D+CPCYRDM  +  + 
Sbjct  34   SGFCAGKCAVRCGRSRAKRGACMKYCGLCCEECACVPTGRSGSRDECPCYRDMLTAGPRK  93

Query  436  RPKCP  450
            RPKCP
Sbjct  94   RPKCP  98



>gb|EEE58704.1| hypothetical protein OsJ_10147 [Oryza sativa Japonica Group]
Length=119

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C  KC  RCS   R   CLKYC ICC+KC CVPSGT G+K++CPCY ++++S+G  KCP
Sbjct  61   CPQKCDYRCSATKRQEPCLKYCNICCQKCLCVPSGTSGNKEECPCYNNLKSSQGNSKCP  119



>ref|XP_002965632.1| hypothetical protein SELMODRAFT_84095, partial [Selaginella moellendorffii]
 gb|EFJ33052.1| hypothetical protein SELMODRAFT_84095, partial [Selaginella moellendorffii]
Length=61

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C  +C  RCSKAGR  RCLK C ICC KCHCVP GT+G+++ CPCY  M N +G  KCP
Sbjct  3    CSKECNRRCSKAGRPKRCLKCCNICCAKCHCVPPGTYGNRETCPCYATMTNHRGGLKCP  61



>ref|XP_006493084.1| PREDICTED: gibberellin-regulated protein 12-like [Citrus sinensis]
Length=95

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C S C  RCS       C+++C +CC+KC CVPSGT+GHK++CPCY + +  +G PKCP
Sbjct  37   CASACNYRCSATSHRNPCIEFCNMCCKKCLCVPSGTYGHKEECPCYNNWKTKEGTPKCP  95



>ref|XP_002989280.1| hypothetical protein SELMODRAFT_129438, partial [Selaginella 
moellendorffii]
 gb|EFJ09718.1| hypothetical protein SELMODRAFT_129438, partial [Selaginella 
moellendorffii]
Length=61

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C  +C  RCSKAGR  RCLK C ICC KCHCVP GT+G+++ CPCY  M N +G  KCP
Sbjct  3    CTKECNRRCSKAGRPKRCLKCCNICCAKCHCVPPGTYGNRETCPCYATMTNHRGGLKCP  61



>gb|KDO41153.1| hypothetical protein CISIN_1g041400mg [Citrus sinensis]
Length=95

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C S C  RCS       C+++C +CC+KC CVPSGT+GHK++CPCY + +  +G PKCP
Sbjct  37   CASACNYRCSATSHRNPCIEFCNMCCKKCLCVPSGTYGHKEECPCYNNWKTKEGTPKCP  95



>ref|XP_006296776.1| hypothetical protein CARUB_v10015821mg [Capsella rubella]
 gb|EOA29674.1| hypothetical protein CARUB_v10015821mg [Capsella rubella]
Length=91

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = +1

Query  196  LMMGSILMSWSLAERSTVVVVEGS---SFCGSKCAARCSKAGRHGRCLKYCGICCEKCHC  366
             ++  I++S+  A + +    EGS   + C + C  RCS       CL YC  CC+KC C
Sbjct  4    FIVIFIVLSFLFATQFSNDGGEGSLTIAECPAACNVRCSATSHKKPCLFYCNYCCKKCLC  63

Query  367  VPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            VPSGT+GHK++CPCY + +  +G PKCP
Sbjct  64   VPSGTYGHKEECPCYNNWKTQEGGPKCP  91



>ref|XP_003613435.1| GAST1 [Medicago truncatula]
Length=92

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = +1

Query  211  ILMSWSLAERSTVVVVEGS---SFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGT  381
             ++  +   + T    EGS     C  KC  RCSK      CL YC +CC KC CVPSGT
Sbjct  10   FMLVITFVIQETYAGGEGSLRPQDCAPKCDYRCSKTSHRKACLTYCNLCCAKCLCVPSGT  69

Query  382  FGHKDDCPCYRDMENSKGRPKCP  450
            +G+K +CPCY +  N  G PKCP
Sbjct  70   YGNKQECPCYDNWRNKNGGPKCP  92



>ref|XP_006601874.1| PREDICTED: gibberellin-regulated protein 12-like [Glycine max]
Length=92

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C   C  RCSKA     CL +C +CC KC CVPSGT+GHK++CPCY + + +KG PKCP
Sbjct  34   CPGACDYRCSKARARKACLYFCNLCCAKCLCVPSGTYGHKEECPCYNNWKTNKGTPKCP  92



>gb|EEC74871.1| hypothetical protein OsI_10763 [Oryza sativa Indica Group]
Length=119

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  274  CGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKCP  450
            C  KC  RCS   R   CLKYC +CC+KC CVPSGT G+K++CPCY ++++S+G  KCP
Sbjct  61   CPQKCDYRCSATKRQEPCLKYCNVCCQKCLCVPSGTSGNKEECPCYNNLKSSQGNSKCP  119



>emb|CBI18166.3| unnamed protein product [Vitis vinifera]
Length=74

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  268  SFCGSKCAARCSKAGRHGRCLKYCGICCEKCHCVPSGTFGHKDDCPCYRDMENSKGRPKC  447
            S C SKCA RCSKAG H  CL+ C  CCE+C+CVP GT G++D CPCY  M    GR KC
Sbjct  14   SDCKSKCAYRCSKAGWHKLCLRACNTCCERCNCVPPGTAGNEDVCPCYAKMTTHGGRHKC  73

Query  448  P  450
            P
Sbjct  74   P  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 826660453344