BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8387_g2_i1 len=381 path=[1201:0-380]

Length=381
                                                                      Score     E

gb|AEH25638.1|  pathogenesis-related protein 1-23                     75.9    2e-14   
gb|AEH25628.1|  pathogenesis-related protein 1-13                     75.9    2e-14   
gb|EMS56527.1|  Pathogenesis-related protein PRMS                     75.5    2e-14   
ref|XP_006657421.1|  PREDICTED: pathogenesis-related protein PRB1...  75.5    3e-14   
emb|CDO97325.1|  unnamed protein product                              74.7    5e-14   
emb|CBJ55935.1|  pathogenesis related gene 1                          72.4    5e-14   
gb|EEC81457.1|  hypothetical protein OsI_24759                        74.3    6e-14   Oryza sativa Indica Group [Indian rice]
gb|EEC81456.1|  hypothetical protein OsI_24758                        74.3    8e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001058815.1|  Os07g0129200                                     73.9    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058814.1|  Os07g0128800                                     73.9    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459310.1|  hypothetical protein SORBIDRAFT_02g002150        73.9    1e-13   Sorghum bicolor [broomcorn]
gb|AAG44566.1|AF251277_1  acidic PR-1 type pathogenesis-related p...  73.6    1e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CDO97324.1|  unnamed protein product                              73.6    1e-13   
gb|AHA56682.1|  pathogenesis related protein                          73.6    1e-13   
emb|CBI25093.3|  unnamed protein product                              73.6    1e-13   
ref|XP_003593358.1|  Pathogenesis-related protein 1a                  73.2    2e-13   
gb|AFK35640.1|  unknown                                               73.2    2e-13   
emb|CDP12737.1|  unnamed protein product                              72.8    2e-13   
gb|ADN43415.1|  pathogenesis-related protein 1                        72.8    2e-13   
ref|XP_003608310.1|  F-box/FBD/LRR-repeat protein                     76.6    2e-13   
gb|ADN43419.1|  pathogenesis-related protein 1                        72.8    2e-13   
ref|XP_002273416.1|  PREDICTED: basic form of pathogenesis-relate...  72.8    2e-13   Vitis vinifera
ref|XP_003593453.1|  Pathogenesis-related protein 1a                  73.2    2e-13   
gb|ADN43427.1|  pathogenesis-related protein 1                        72.8    2e-13   
gb|ADN43428.1|  pathogenesis-related protein 1                        72.8    2e-13   
gb|ADN43417.1|  pathogenesis-related protein 1                        72.4    3e-13   
gb|ADN43418.1|  pathogenesis-related protein 1                        72.4    3e-13   
gb|ADN43416.1|  pathogenesis-related protein 1                        72.4    3e-13   
gb|ADN43436.1|  pathogenesis-related protein 1                        72.4    3e-13   
ref|XP_010691524.1|  PREDICTED: pathogenesis-related protein PR-1...  72.4    3e-13   
gb|AGK89727.1|  pathogenesis-related 1 protein                        72.4    4e-13   
ref|XP_006658252.1|  PREDICTED: pathogenesis-related protein PRB1...  72.4    4e-13   
gb|ADN43435.1|  pathogenesis-related protein 1                        72.0    4e-13   
gb|ADN43434.1|  pathogenesis-related protein 1                        72.0    4e-13   
ref|XP_006486833.1|  PREDICTED: pathogenesis-related leaf protein...  72.0    4e-13   
gb|ADN43433.1|  pathogenesis-related protein 1                        72.0    4e-13   
gb|AEH25637.1|  pathogenesis-related protein 1-22                     72.0    4e-13   
ref|XP_004136927.1|  PREDICTED: basic form of pathogenesis-relate...  71.6    5e-13   
gb|ADN43432.1|  pathogenesis-related protein 1                        71.6    6e-13   
gb|AEP19204.1|  PR-1-A2                                               70.1    6e-13   
gb|ADN43437.1|  pathogenesis-related protein 1                        71.6    7e-13   
ref|XP_002459696.1|  hypothetical protein SORBIDRAFT_02g008970        71.6    8e-13   Sorghum bicolor [broomcorn]
gb|EMS61770.1|  Pathogenesis-related protein 1                        70.9    9e-13   
ref|XP_007148305.1|  hypothetical protein PHAVU_006G197300g           70.9    1e-12   
gb|ACT99721.1|  pathogen-related protein 1                            70.9    1e-12   Nepenthes mirabilis
ref|XP_008455066.1|  PREDICTED: basic form of pathogenesis-relate...  70.9    1e-12   
gb|ACJ62499.1|  pathogenesis-related protein class I                  70.9    1e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|EMT10383.1|  Pathogenesis-related protein 1                        70.5    1e-12   
ref|XP_009335379.1|  PREDICTED: LOW QUALITY PROTEIN: basic form o...  70.9    1e-12   
gb|KDO37905.1|  hypothetical protein CISIN_1g039461mg                 68.9    1e-12   
gb|KGN43831.1|  hypothetical protein Csa_7G070254                     70.9    1e-12   
gb|ACJ62489.1|  pathogenesis-related protein class I                  70.5    1e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62461.1|  pathogenesis-related protein class I                  70.5    1e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62486.1|  pathogenesis-related protein class I                  70.5    1e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62462.1|  pathogenesis-related protein class I                  70.5    1e-12   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004968783.1|  PREDICTED: pathogenesis-related protein PRMS...  70.5    1e-12   
gb|AEH25620.1|  pathogenesis-related protein 1-5                      70.5    1e-12   
ref|XP_004136924.1|  PREDICTED: basic form of pathogenesis-relate...  70.5    1e-12   
ref|XP_009335372.1|  PREDICTED: pathogenesis-related leaf protein...  70.5    2e-12   
ref|XP_008353150.1|  PREDICTED: pathogenesis-related protein PR-1...  70.5    2e-12   
ref|XP_006422719.1|  hypothetical protein CICLE_v10029950mg           70.5    2e-12   
prf||1803521A  pathogenesis-related protein 1                         70.1    2e-12
gb|ABA34060.1|  pathogenesis-related protein 1                        70.5    2e-12   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008652242.1|  PREDICTED: pathogenesis-related protein 1-like   70.5    2e-12   
ref|XP_006422707.1|  hypothetical protein CICLE_v10030029mg           70.5    2e-12   
gb|AHE81264.1|  pathogenesis-related protein 1-21                     70.5    2e-12   
gb|AAK60565.1|AF384143_1  pathogenesis-related protein 1              70.5    2e-12   Triticum aestivum [Canadian hard winter wheat]
gb|AEH25636.1|  pathogenesis-related protein 1-21                     70.5    2e-12   
gb|AHE81254.1|  pathogenesis-related protein 1-11                     70.5    2e-12   
ref|XP_010691521.1|  PREDICTED: pathogenesis-related protein PR-1...  70.5    2e-12   
gb|ADB54822.1|  pathogenesis-related protein 1                        70.5    2e-12   Vitis pseudoreticulata
gb|AAP14676.1|  pathogenesis related-1                                70.1    2e-12   Triticum aestivum [Canadian hard winter wheat]
gb|ABA34056.1|  pathogenesis-related protein 1                        70.1    2e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AHE81275.1|  pathogenesis-related protein 1-11                     70.5    2e-12   
ref|XP_009346545.1|  PREDICTED: pathogenesis-related protein 1A-like  70.1    2e-12   
gb|ABA34062.1|  pathogenesis-related protein 1                        70.1    2e-12   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105399.1|  pathogenesis related protein4 precursor          70.1    2e-12   Zea mays [maize]
ref|XP_010088981.1|  hypothetical protein L484_013561                 70.5    2e-12   
gb|ABA34077.1|  pathogenesis-related protein 1                        70.1    2e-12   Zea diploperennis [chapule]
gb|ABA34066.1|  pathogenesis-related protein 1                        70.1    2e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA34063.1|  pathogenesis-related protein 1                        70.1    2e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA34055.1|  pathogenesis-related protein 1                        70.1    2e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AHA43767.1|  pathogenesis related protein 1 isoform 4              70.1    2e-12   
gb|AAB05225.1|  pathogenesis-related protein-1                        70.1    2e-12   Nicotiana glutinosa
gb|AHW81904.1|  pathogenesis-related protein                          70.1    2e-12   
gb|ADN43439.1|  pathogenesis-related protein 1                        70.1    2e-12   
gb|ADD97801.1|  pathogenesis-related protein 1                        70.1    2e-12   
gb|KDO40549.1|  hypothetical protein CISIN_1g043403mg                 69.3    2e-12   
ref|XP_006486822.1|  PREDICTED: pathogenesis-related protein 1-like   70.1    2e-12   
gb|KDP37600.1|  hypothetical protein JCGZ_06943                       69.7    2e-12   
ref|XP_010691525.1|  PREDICTED: pathogenesis-related protein 1A-like  70.1    2e-12   
dbj|BAO09561.1|  pathogenesis-related protein 1                       70.1    2e-12   
ref|XP_009788194.1|  PREDICTED: pathogenesis-related leaf protein...  70.1    2e-12   
ref|NP_001043089.1|  Os01g0382000                                     70.1    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002436405.1|  hypothetical protein SORBIDRAFT_10g001940        70.1    2e-12   Sorghum bicolor [broomcorn]
ref|XP_010245650.1|  PREDICTED: basic form of pathogenesis-relate...  70.1    3e-12   
ref|XP_006422714.1|  hypothetical protein CICLE_v10029431mg           70.1    3e-12   
ref|XP_009759149.1|  PREDICTED: pathogenesis-related protein PR-1     70.1    3e-12   
ref|XP_010530682.1|  PREDICTED: pathogenesis-related protein 1A-like  70.1    3e-12   
emb|CBI25103.3|  unnamed protein product                              69.7    3e-12   
ref|XP_009618987.1|  PREDICTED: pathogenesis-related protein PR-1...  70.1    3e-12   
ref|XP_006486820.1|  PREDICTED: pathogenesis-related protein 1-like   69.7    3e-12   
ref|XP_002274371.1|  PREDICTED: basic form of pathogenesis-relate...  69.7    3e-12   Vitis vinifera
ref|XP_004485656.1|  PREDICTED: pathogenesis-related protein 1B-like  69.7    3e-12   
gb|ABA34079.1|  pathogenesis-related protein 1                        69.7    3e-12   Zea diploperennis [chapule]
ref|XP_006367102.1|  PREDICTED: basic form of pathogenesis-relate...  69.7    3e-12   
gb|AFK39516.1|  unknown                                               69.7    3e-12   
gb|ABB96918.1|  pathogenesis-related protein 1                        68.6    3e-12   Triticum aestivum [Canadian hard winter wheat]
gb|KDP35900.1|  hypothetical protein JCGZ_09872                       69.7    3e-12   
gb|AEH25625.1|  pathogenesis-related protein 1-10                     69.7    3e-12   
ref|XP_010691522.1|  PREDICTED: pathogenesis-related protein PR-1...  69.7    3e-12   
ref|XP_009336676.1|  PREDICTED: pathogenesis-related protein PR-1...  70.1    3e-12   
gb|AFK36478.1|  unknown                                               69.7    3e-12   
ref|XP_003557607.1|  PREDICTED: pathogenesis-related protein PRB1...  69.7    3e-12   
gb|AHE81248.1|  pathogenesis-related protein 1-5                      69.7    3e-12   
gb|ADN43429.1|  pathogenesis-related protein 1                        69.7    3e-12   
ref|XP_009605694.1|  PREDICTED: pathogenesis-related leaf protein...  69.7    3e-12   
gb|AFK38989.1|  unknown                                               69.7    3e-12   
gb|AEP19203.1|  PR-1-A1                                               68.6    3e-12   
ref|XP_009605697.1|  PREDICTED: pathogenesis-related leaf protein...  69.7    3e-12   
ref|XP_003557605.1|  PREDICTED: pathogenesis-related protein 1-like   69.7    4e-12   
sp|Q41359.1|PR1_SAMNI  RecName: Full=Pathogenesis-related protein...  69.7    4e-12   Sambucus nigra
emb|CDO97328.1|  unnamed protein product                              72.4    4e-12   
ref|XP_007201612.1|  hypothetical protein PRUPE_ppa019807mg           69.3    4e-12   
ref|XP_009398310.1|  PREDICTED: pathogenesis-related protein 1-like   69.3    4e-12   
ref|XP_004955413.1|  PREDICTED: pathogenesis-related protein 1-like   69.3    4e-12   
ref|XP_002274105.1|  PREDICTED: pathogenesis-related leaf protein 6   69.7    4e-12   Vitis vinifera
gb|ADN43442.1|  pathogenesis-related protein 1                        69.3    4e-12   
ref|XP_004296418.1|  PREDICTED: pathogenesis-related protein PR-1...  69.3    4e-12   
gb|ACQ41877.1|  pathogenesis-related protein 1                        69.3    4e-12   Triticum aestivum [Canadian hard winter wheat]
gb|EMS67474.1|  Pathogenesis-related protein PRB1-3                   67.8    4e-12   
gb|ACQ41880.1|  pathogenisis-related protein 1.1                      69.3    4e-12   Triticum aestivum [Canadian hard winter wheat]
gb|AFJ93090.1|  pathogenesis-related protein 1                        69.3    5e-12   
ref|XP_010095626.1|  hypothetical protein L484_003727                 68.9    5e-12   
ref|XP_010539449.1|  PREDICTED: pathogenesis-related protein PR-1...  69.7    5e-12   
ref|XP_008382391.1|  PREDICTED: pathogenesis-related protein 1A-like  69.3    5e-12   
ref|XP_007148303.1|  hypothetical protein PHAVU_006G197100g           69.3    5e-12   
emb|CBI25105.3|  unnamed protein product                              70.1    5e-12   
gb|EMT11012.1|  Pathogenesis-related protein PRMS                     69.3    5e-12   
gb|AEH25632.1|  pathogenesis-related protein 1-17                     69.3    5e-12   
emb|CDO97323.1|  unnamed protein product                              68.9    5e-12   
ref|XP_004955412.1|  PREDICTED: pathogenesis-related protein PRB1...  68.9    5e-12   
gb|AEH25617.1|  pathogenesis-related protein 1-2                      68.9    5e-12   
gb|EAZ02649.1|  hypothetical protein OsI_24760                        68.9    5e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_002522070.1|  STS14 protein precursor, putative                68.9    5e-12   Ricinus communis
dbj|BAK01044.1|  predicted protein                                    69.3    5e-12   
emb|CAA07474.1|  pathogenisis-related protein 1.2                     69.3    6e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006285131.1|  hypothetical protein CARUB_v10006471mg           69.3    6e-12   
gb|AEH25633.1|  pathogenesis-related protein 1-18                     68.9    6e-12   
gb|AEH25629.1|  pathogenesis-related protein 1-14                     68.9    6e-12   
emb|CAA07473.1|  pathogenisis-related protein 1.1                     68.9    6e-12   Triticum aestivum [Canadian hard winter wheat]
gb|ACQ41878.1|  pathogenesis-related protein 1                        68.9    6e-12   Triticum aestivum [Canadian hard winter wheat]
dbj|BAN09077.1|  pathogenesis related protein-1.2                     68.9    6e-12   
gb|ACQ41879.1|  pathogenisis-related protein 1.1                      68.9    6e-12   Triticum aestivum [Canadian hard winter wheat]
sp|P35793.1|PR13_HORVU  RecName: Full=Pathogenesis-related protei...  68.9    6e-12   Hordeum vulgare [barley]
gb|ACJ62530.1|  pathogenesis-related protein class I                  68.9    6e-12   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62513.1|  pathogenesis-related protein class I                  68.9    6e-12   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009378591.1|  PREDICTED: pathogenesis-related leaf protein...  68.9    6e-12   
ref|XP_004242676.1|  PREDICTED: pathogenesis-related protein PR-1...  68.9    6e-12   
ref|XP_002532413.1|  STS14 protein precursor, putative                68.9    6e-12   Ricinus communis
gb|ADN43438.1|  pathogenesis-related protein 1                        68.9    6e-12   
ref|XP_006343539.1|  PREDICTED: pathogenesis-related protein PR-1...  68.9    6e-12   
emb|CAA52893.1|  PR-1a pathogenesis related protein (Hv-1a)           68.9    7e-12   Hordeum vulgare [barley]
ref|XP_004290371.1|  PREDICTED: pathogenesis-related protein 1B-like  68.9    7e-12   
ref|NP_001058816.1|  Os07g0129300                                     68.9    7e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008651988.1|  PREDICTED: pathogenesis-related protein PRB1...  68.9    7e-12   
gb|KDP37606.1|  hypothetical protein JCGZ_06949                       68.6    7e-12   
gb|AHE81247.1|  pathogenesis-related protein 1-4                      68.6    7e-12   
dbj|BAA05473.1|  tumor-related protein                                68.2    7e-12   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_003572883.1|  PREDICTED: pathogenesis-related protein PR-1...  68.9    7e-12   
ref|XP_006583787.1|  PREDICTED: basic form of pathogenesis-relate...  68.6    7e-12   
ref|NP_001043091.1|  Os01g0382400                                     68.6    7e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007227657.1|  hypothetical protein PRUPE_ppa015046mg           68.6    8e-12   
ref|XP_002465112.1|  hypothetical protein SORBIDRAFT_01g032200        68.9    8e-12   Sorghum bicolor [broomcorn]
ref|XP_003545770.1|  PREDICTED: basic form of pathogenesis-relate...  68.6    8e-12   
gb|ABA34024.1|  pathogenesis-related maize seed protein               68.6    8e-12   Zea diploperennis [chapule]
ref|XP_002864522.1|  hypothetical protein ARALYDRAFT_495859           68.9    8e-12   
gb|EMS58167.1|  Pathogenesis-related protein PRMS                     68.9    8e-12   
ref|XP_006486819.1|  PREDICTED: pathogenesis-related protein 1-like   68.6    8e-12   
ref|XP_008223670.1|  PREDICTED: pathogenesis-related protein PR-1...  68.6    8e-12   
ref|XP_004955945.1|  PREDICTED: pathogenesis-related protein PRMS...  68.6    8e-12   
sp|P35792.1|PR12_HORVU  RecName: Full=Pathogenesis-related protei...  68.6    9e-12   Hordeum vulgare [barley]
ref|XP_008455068.1|  PREDICTED: basic form of pathogenesis-relate...  68.6    9e-12   
ref|XP_008453637.1|  PREDICTED: pathogenesis-related protein PR-1     68.6    9e-12   
ref|XP_010558299.1|  PREDICTED: pathogenesis-related protein PRB1...  68.6    9e-12   
ref|XP_004136922.1|  PREDICTED: basic form of pathogenesis-relate...  68.2    9e-12   
gb|EMT00919.1|  Pathogenesis-related protein PRB1-2                   68.9    9e-12   
ref|XP_010691519.1|  PREDICTED: pathogenesis-related protein 1A-like  68.6    1e-11   
ref|XP_007041425.1|  Pathogenesis-related protein 1                   68.2    1e-11   
ref|XP_009803803.1|  PREDICTED: pathogenesis-related protein 1C-like  68.6    1e-11   
ref|XP_011092436.1|  PREDICTED: basic form of pathogenesis-relate...  68.2    1e-11   
gb|EEE54618.1|  hypothetical protein OsJ_01863                        68.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ABK55610.1|  pathogenesis-related protein PR1c                     68.2    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_004146301.1|  PREDICTED: pathogenesis-related protein PR-1...  68.2    1e-11   
gb|KFE66075.1|  SCP-like family protein                               68.2    1e-11   
ref|NP_194309.1|  allergen V5/Tpx-1-related family protein            68.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658251.1|  PREDICTED: uncharacterized protein LOC102701282  70.5    1e-11   
emb|CDY10431.1|  BnaCnng03320D                                        68.2    1e-11   
gb|ACJ62494.1|  pathogenesis-related protein class I                  68.2    1e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAZ94266.1|  pathogenesis-related 1b                               68.2    1e-11   Triticum monococcum [einkorn wheat]
sp|Q05968.1|PR1_HORVU  RecName: Full=Pathogenesis-related protein...  68.2    1e-11   Hordeum vulgare [barley]
ref|XP_007199066.1|  hypothetical protein PRUPE_ppa018679mg           67.8    1e-11   
emb|CAA30017.1|  unnamed protein product                              68.2    1e-11   Nicotiana tabacum [American tobacco]
ref|XP_009122760.1|  PREDICTED: pathogenesis-related protein PRB1-3   68.2    1e-11   
ref|XP_008796970.1|  PREDICTED: pathogenesis-related protein PRB1...  68.2    1e-11   
ref|XP_008455064.1|  PREDICTED: pathogenesis-related protein PRB1...  68.2    1e-11   
ref|XP_008796972.1|  PREDICTED: pathogenesis-related protein PRB1...  67.8    1e-11   
ref|XP_010525741.1|  PREDICTED: pathogenesis-related protein PR-1     68.2    1e-11   
ref|XP_002867590.1|  hypothetical protein ARALYDRAFT_492241           68.2    1e-11   
emb|CDX70351.1|  BnaA10g27000D                                        68.2    1e-11   
ref|XP_009139534.1|  PREDICTED: pathogenesis-related protein PR-1     68.2    1e-11   
ref|XP_010483291.1|  PREDICTED: pathogenesis-related protein 1-like   68.2    1e-11   
ref|XP_010943479.1|  PREDICTED: pathogenesis-related protein PRB1...  67.8    1e-11   
ref|XP_006281936.1|  hypothetical protein CARUB_v10028144mg           68.2    1e-11   
ref|XP_004170276.1|  PREDICTED: basic form of pathogenesis-relate...  67.8    1e-11   
ref|XP_010443455.1|  PREDICTED: pathogenesis-related protein 1-like   68.2    1e-11   
ref|XP_006657422.1|  PREDICTED: pathogenesis-related protein 1-like   68.2    1e-11   
ref|XP_010088980.1|  hypothetical protein L484_013560                 67.8    1e-11   
ref|XP_010452554.1|  PREDICTED: pathogenesis-related protein 1-like   68.2    2e-11   
gb|ABC86704.1|  putative pathogenesis-related protein 1               65.9    2e-11   Coffea arabica [arabica coffee]
ref|XP_010943469.1|  PREDICTED: pathogenesis-related protein PRB1...  67.8    2e-11   
ref|XP_003593361.1|  Pathogenesis-related protein 1a                  67.8    2e-11   
emb|CAN68901.1|  hypothetical protein VITISV_019988                   67.8    2e-11   Vitis vinifera
gb|KDP43811.1|  hypothetical protein JCGZ_23019                       67.8    2e-11   
ref|XP_008455062.1|  PREDICTED: pathogenesis-related protein 1-like   67.8    2e-11   
gb|AEL99925.1|  pathogenesis-related protein 1                        67.8    2e-11   
ref|XP_008455071.1|  PREDICTED: basic form of pathogenesis-relate...  67.8    2e-11   
ref|XP_008657154.1|  PREDICTED: pathogenesis-related protein PRB1...  67.8    2e-11   
emb|CAA31008.1|  PR1a preprotein                                      67.8    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_003545771.1|  PREDICTED: pathogenesis-related protein PR-1...  67.8    2e-11   
gb|KDP37603.1|  hypothetical protein JCGZ_06946                       67.4    2e-11   
ref|NP_680450.1|  CAP (Cysteine-rich secretory proteins, Antigen ...  68.2    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941969.1|  PREDICTED: pathogenesis-related protein PRB1...  67.4    2e-11   
gb|ACJ62587.1|  pathogenesis-related maize seed protein               67.8    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62553.1|  pathogenesis-related maize seed protein               67.8    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001140745.1|  uncharacterized protein LOC100272820 precursor   67.8    2e-11   Zea mays [maize]
ref|XP_002274307.1|  PREDICTED: pathogenesis-related leaf protein 6   67.4    2e-11   Vitis vinifera
ref|XP_006413271.1|  hypothetical protein EUTSA_v10026254mg           67.8    2e-11   
gb|ACJ62589.1|  pathogenesis-related maize seed protein               67.4    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62559.1|  pathogenesis-related maize seed protein               67.4    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_011092435.1|  PREDICTED: basic form of pathogenesis-relate...  67.4    2e-11   
sp|P08299.1|PR1A_TOBAC  RecName: Full=Pathogenesis-related protei...  67.4    2e-11   Nicotiana tabacum [American tobacco]
gb|ABA34011.1|  pathogenesis-related maize seed protein               67.4    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006486832.1|  PREDICTED: pathogenesis-related protein PR-1...  67.4    2e-11   
ref|XP_006422718.1|  hypothetical protein CICLE_v10029873mg           67.4    2e-11   
ref|XP_009397726.1|  PREDICTED: pathogenesis-related protein PRB1...  68.2    2e-11   
ref|XP_010688504.1|  PREDICTED: pathogenesis-related protein PR-1...  67.8    2e-11   
gb|ABA34014.1|  pathogenesis-related maize seed protein               67.4    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62562.1|  pathogenesis-related maize seed protein               67.4    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
sp|Q00008.1|PRMS_MAIZE  RecName: Full=Pathogenesis-related protei...  67.4    2e-11   Zea mays [maize]
ref|XP_003561249.1|  PREDICTED: pathogenesis-related protein 1-like   67.4    2e-11   
dbj|BAA14220.1|  PR1a protein precursor                               67.4    2e-11   Nicotiana tabacum [American tobacco]
gb|ACJ62554.1|  pathogenesis-related maize seed protein               67.4    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62604.1|  pathogenesis-related maize seed protein               67.4    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADN43443.1|  pathogenesis-related protein 1                        67.4    2e-11   
emb|CDP02944.1|  unnamed protein product                              67.4    2e-11   
ref|XP_002993585.1|  hypothetical protein SELMODRAFT_451245           67.4    2e-11   
gb|ACJ62573.1|  pathogenesis-related maize seed protein               67.4    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|EMT29968.1|  Pathogenesis-related protein PR-1                     67.4    2e-11   
gb|ADN43440.1|  pathogenesis-related protein 1                        67.4    2e-11   
ref|NP_195893.1|  allergen V5/Tpx-1-related family protein            67.8    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992723.1|  hypothetical protein SELMODRAFT_135802           67.4    2e-11   
gb|KDP37611.1|  hypothetical protein JCGZ_06954                       67.4    2e-11   
gb|ACJ62544.1|  pathogenesis-related maize seed protein               67.4    2e-11   Zea mays subsp. parviglumis [Balsas teosinte]
gb|KFK29089.1|  hypothetical protein AALP_AA7G087400                  67.8    2e-11   
ref|XP_007148306.1|  hypothetical protein PHAVU_006G197400g           67.4    2e-11   
emb|CDX89632.1|  BnaC03g45460D                                        67.0    2e-11   
ref|XP_002522066.1|  STS14 protein precursor, putative                67.4    2e-11   Ricinus communis
dbj|BAF95881.1|  putative pathogenesis-related protein 1              67.0    2e-11   Vitis hybrid cultivar
gb|ABK41053.2|  pathogenesis-related protein 1                        67.0    2e-11   Musa acuminata [banana]
ref|XP_006367096.1|  PREDICTED: pathogenesis-related leaf protein...  67.0    3e-11   
gb|AEH25624.1|  pathogenesis-related protein 1-9                      67.0    3e-11   
ref|XP_002313932.2|  pathogenesis-related family protein              67.0    3e-11   Populus trichocarpa [western balsam poplar]
gb|ADN43441.1|  pathogenesis-related protein 1                        67.0    3e-11   
gb|AHE81273.1|  pathogenesis-related protein 1-9                      67.0    3e-11   
gb|EMS62872.1|  Pathogenesis-related protein PRMS                     67.0    3e-11   
ref|XP_006367094.1|  PREDICTED: pathogenesis-related leaf protein...  67.0    3e-11   
gb|AFK93500.1|  pathogenesis related protein 1 isoform 1              67.0    3e-11   
emb|CAA31009.1|  PR1b preprotein                                      67.0    3e-11   Nicotiana tabacum [American tobacco]
gb|AHE81252.1|  pathogenesis-related protein 1-9                      67.0    3e-11   
ref|XP_008236237.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...  67.0    3e-11   
emb|CAA29023.1|  PR-1c protein                                        67.0    3e-11   
ref|XP_007027162.1|  CAP, putative                                    67.4    3e-11   
ref|XP_010102995.1|  hypothetical protein L484_022874                 67.0    3e-11   
ref|NP_179589.1|  pathogenesis-related protein-1-like protein         67.0    3e-11   
ref|XP_009769213.1|  PREDICTED: pathogenesis-related protein 1C       67.0    3e-11   
ref|XP_004230669.1|  PREDICTED: pathogenesis-related leaf protein 6   67.0    3e-11   
ref|XP_009388943.1|  PREDICTED: pathogenesis-related protein 1-like   67.0    3e-11   
emb|CAA31010.1|  PR1c preprotein                                      67.0    3e-11   
ref|XP_003593363.1|  Pathogenesis-related protein 1B                  67.0    3e-11   
ref|XP_006658248.1|  PREDICTED: pathogenesis-related protein PRB1...  66.6    3e-11   
ref|XP_011092471.1|  PREDICTED: basic form of pathogenesis-relate...  66.6    3e-11   
ref|XP_010672685.1|  PREDICTED: pathogenesis-related protein PRB1...  67.4    3e-11   
ref|XP_010525646.1|  PREDICTED: pathogenesis-related leaf protein...  67.0    3e-11   
ref|XP_010448371.1|  PREDICTED: pathogenesis-related protein PR-1...  67.0    3e-11   
ref|XP_010433592.1|  PREDICTED: pathogenesis-related protein PR-1...  67.0    3e-11   
emb|CAA29022.1|  PR-1b protein                                        66.6    3e-11   
ref|XP_011091978.1|  PREDICTED: basic form of pathogenesis-relate...  66.6    3e-11   
gb|EYU34278.1|  hypothetical protein MIMGU_mgv1a025824mg              65.9    3e-11   
ref|XP_004955414.1|  PREDICTED: pathogenesis-related protein 1-like   67.0    3e-11   
ref|XP_008245926.1|  PREDICTED: basic form of pathogenesis-relate...  66.6    4e-11   
gb|ACJ62603.1|  pathogenesis-related maize seed protein               66.6    4e-11   
ref|XP_004230668.1|  PREDICTED: pathogenesis-related leaf protein...  66.6    4e-11   
ref|XP_008236236.1|  PREDICTED: basic form of pathogenesis-relate...  66.6    4e-11   
gb|EEE50692.1|  hypothetical protein OsJ_30952                        66.6    4e-11   
ref|XP_010095625.1|  hypothetical protein L484_003726                 66.6    4e-11   
ref|XP_010943437.1|  PREDICTED: pathogenesis-related protein 1B-like  67.0    4e-11   
emb|CDY69090.1|  BnaAnng29270D                                        66.6    4e-11   
ref|XP_010438832.1|  PREDICTED: pathogenesis-related protein PR-1...  67.0    4e-11   
ref|XP_011079315.1|  PREDICTED: pathogenesis-related protein PR-1...  66.6    4e-11   
ref|XP_009610821.1|  PREDICTED: pathogenesis-related protein 1B       66.6    4e-11   
ref|XP_010252393.1|  PREDICTED: basic form of pathogenesis-relate...  66.6    4e-11   
ref|XP_003593359.1|  Pathogenesis-related protein 1a                  66.2    4e-11   
ref|XP_002522065.1|  STS14 protein precursor, putative                66.6    4e-11   
ref|XP_006848057.1|  hypothetical protein AMTR_s00029p00197310        66.6    4e-11   
ref|XP_009147855.1|  PREDICTED: pathogenesis-related leaf protein 6   66.6    4e-11   
gb|EMS45142.1|  Pathogenesis-related protein 1                        66.6    4e-11   
ref|XP_011092473.1|  PREDICTED: pathogenesis-related leaf protein...  66.6    4e-11   
dbj|BAC84725.1|  putative pathogenesis-related protein 1              66.6    4e-11   
ref|XP_004136929.1|  PREDICTED: pathogenesis-related protein 1-like   66.2    4e-11   
ref|NP_187570.1|  putative pathogenesis-related protein               66.6    4e-11   
ref|XP_009605825.1|  PREDICTED: pathogenesis-related protein 1B-like  66.6    4e-11   
ref|XP_006661674.1|  PREDICTED: pathogenesis-related protein PRB1...  66.6    5e-11   
gb|AAZ94265.1|  pathogenesis-related 1a                               66.6    5e-11   
gb|AFF57760.1|  pathogenesis-related protein1                         65.5    5e-11   
ref|XP_006288714.1|  hypothetical protein CARUB_v10002025mg           66.6    5e-11   
gb|KGN43833.1|  hypothetical protein Csa_7G070255                     66.2    5e-11   
emb|CAA36790.1|  unnamed protein product                              66.6    5e-11   
ref|NP_001064278.1|  Os10g0191300                                     66.6    5e-11   
ref|XP_010270273.1|  PREDICTED: pathogenesis-related leaf protein...  66.2    5e-11   
emb|CDY28317.1|  BnaC03g66420D                                        64.7    5e-11   
ref|XP_002882625.1|  hypothetical protein ARALYDRAFT_897117           66.6    5e-11   
ref|XP_010252394.1|  PREDICTED: basic form of pathogenesis-relate...  66.2    5e-11   
ref|XP_011092472.1|  PREDICTED: basic form of pathogenesis-relate...  66.2    5e-11   
ref|XP_007199090.1|  hypothetical protein PRUPE_ppa020367mg           65.9    5e-11   
gb|AFK93502.1|  pathogenesis related protein 1 isoform 3              66.2    5e-11   
ref|XP_007148304.1|  hypothetical protein PHAVU_006G197200g           66.2    5e-11   
ref|XP_010672687.1|  PREDICTED: pathogenesis-related protein PRB1...  66.6    5e-11   
ref|XP_010461857.1|  PREDICTED: pathogenesis-related protein 1B-like  66.2    5e-11   
ref|XP_010914120.1|  PREDICTED: pathogenesis-related protein PR-1     66.2    6e-11   
ref|XP_010500560.1|  PREDICTED: pathogenesis-related protein 1B-like  66.2    6e-11   
emb|CAN77102.1|  hypothetical protein VITISV_021166                   66.2    6e-11   
gb|AFK93503.1|  pathogenesis related protein 1 isoform 4              66.2    6e-11   
ref|XP_002273788.2|  PREDICTED: pathogenesis-related protein 1        66.2    6e-11   
ref|XP_010941967.1|  PREDICTED: pathogenesis-related protein PRB1...  66.2    6e-11   
ref|XP_003610169.1|  Pathogenesis-related protein PR-1                66.2    6e-11   
ref|XP_002883954.1|  hypothetical protein ARALYDRAFT_480471           66.2    6e-11   
ref|XP_004983398.1|  PREDICTED: pathogenesis-related protein PRMS...  66.2    6e-11   
ref|XP_009788195.1|  PREDICTED: basic form of pathogenesis-relate...  66.2    6e-11   
ref|XP_002265050.1|  PREDICTED: basic form of pathogenesis-relate...  65.9    6e-11   
ref|XP_002522071.1|  STS14 protein precursor, putative                65.9    7e-11   
gb|ABK23936.1|  unknown                                               65.9    7e-11   
ref|XP_006398726.1|  hypothetical protein EUTSA_v10015461mg           66.2    7e-11   
ref|XP_006367090.1|  PREDICTED: pathogenesis-related protein 1-like   65.9    7e-11   
ref|XP_003545772.1|  PREDICTED: basic form of pathogenesis-relate...  65.9    7e-11   
gb|KFK35951.1|  hypothetical protein AALP_AA4G059500                  65.9    7e-11   
ref|XP_008372945.1|  PREDICTED: pathogenesis-related protein 1-like   65.9    7e-11   
ref|XP_010527028.1|  PREDICTED: pathogenesis-related protein PR-1...  65.9    8e-11   
ref|XP_011018173.1|  PREDICTED: pathogenesis-related protein PR-1...  65.9    8e-11   
ref|XP_010452118.1|  PREDICTED: pathogenesis-related protein PRB1...  65.9    8e-11   
ref|XP_010424808.1|  PREDICTED: pathogenesis-related protein PRB1...  65.9    8e-11   
ref|XP_009126825.1|  PREDICTED: pathogenesis-related protein PR-1...  65.9    8e-11   
ref|XP_009342193.1|  PREDICTED: pathogenesis-related protein PRMS...  65.9    8e-11   
ref|XP_009798466.1|  PREDICTED: pathogenesis-related protein 1A       65.9    8e-11   
ref|XP_008805422.1|  PREDICTED: pathogenesis-related protein PR-1...  65.9    9e-11   
ref|XP_010490733.1|  PREDICTED: pathogenesis-related protein PRB1-3   65.9    9e-11   
ref|XP_004136921.1|  PREDICTED: basic form of pathogenesis-relate...  65.5    9e-11   
gb|AFK64734.1|  pathogenesis related protein 1a                       65.5    9e-11   
emb|CDY58847.1|  BnaA02g35230D                                        65.9    9e-11   
emb|CDY68552.1|  BnaCnng59490D                                        65.9    9e-11   
gb|AFM77011.1|  pathogenesis related protein 1a                       65.5    9e-11   
gb|KFK27304.1|  hypothetical protein AALP_AA8G365000                  65.9    9e-11   
ref|XP_010054699.1|  PREDICTED: probable LRR receptor-like serine...  68.6    9e-11   
ref|XP_003606006.1|  Maturase K                                       68.9    9e-11   
ref|XP_002870985.1|  hypothetical protein ARALYDRAFT_487046           65.9    9e-11   
ref|XP_011002583.1|  PREDICTED: pathogenesis-related leaf protein...  65.5    9e-11   
ref|XP_009787159.1|  PREDICTED: basic form of pathogenesis-relate...  65.9    9e-11   
ref|NP_001234358.1|  PR1 protein precursor                            65.9    1e-10   
ref|XP_006367093.1|  PREDICTED: basic form of pathogenesis-relate...  65.9    1e-10   
ref|XP_009605696.1|  PREDICTED: basic form of pathogenesis-relate...  65.5    1e-10   
ref|XP_002452941.1|  hypothetical protein SORBIDRAFT_04g035320        65.5    1e-10   
emb|CAA47374.1|  prb-1b                                               65.5    1e-10   
ref|XP_007199595.1|  hypothetical protein PRUPE_ppa023001mg           64.7    1e-10   
gb|ABR18381.1|  unknown                                               65.5    1e-10   
ref|XP_006401187.1|  hypothetical protein EUTSA_v10014709mg           65.9    1e-10   
gb|AAK30143.1|AF348141_1  pathogenesis-related protein PR-1 precu...  65.5    1e-10   
gb|AFK37568.1|  unknown                                               65.5    1e-10   
ref|XP_006299797.1|  hypothetical protein CARUB_v10015993mg           65.5    1e-10   
ref|XP_003631695.1|  PREDICTED: basic form of pathogenesis-relate...  65.5    1e-10   
ref|XP_006367091.1|  PREDICTED: basic form of pathogenesis-relate...  65.5    1e-10   
ref|XP_002974459.1|  hypothetical protein SELMODRAFT_101024           65.5    1e-10   
ref|XP_009388942.1|  PREDICTED: pathogenesis-related protein 1-like   65.5    1e-10   
ref|XP_006285079.1|  hypothetical protein CARUB_v10006411mg           65.5    1e-10   
ref|XP_010467953.1|  PREDICTED: pathogenesis-related protein 1-like   65.5    1e-10   
gb|KFK29088.1|  hypothetical protein AALP_AA7G087300                  65.5    1e-10   
ref|XP_006408913.1|  hypothetical protein EUTSA_v10002159mg           65.5    1e-10   
ref|XP_002985765.1|  hypothetical protein SELMODRAFT_122880           65.5    1e-10   
ref|XP_010467950.1|  PREDICTED: pathogenesis-related protein 1-like   65.5    1e-10   
ref|XP_010489114.1|  PREDICTED: pathogenesis-related protein 1-like   65.5    1e-10   
ref|XP_002994637.1|  hypothetical protein SELMODRAFT_138925           65.5    1e-10   
emb|CDX93140.1|  BnaA03g38620D                                        65.1    1e-10   
ref|XP_009136246.1|  PREDICTED: pathogenesis-related protein 1-like   65.1    1e-10   
gb|AFG62618.1|  hypothetical protein 0_8964_01                        63.5    1e-10   
ref|XP_006299650.1|  hypothetical protein CARUB_v10015837mg           65.5    1e-10   
ref|XP_010065832.1|  PREDICTED: pathogenesis-related protein 1-like   65.1    1e-10   
emb|CDY59219.1|  BnaCnng34480D                                        65.5    1e-10   
ref|XP_002985764.1|  hypothetical protein SELMODRAFT_234874           65.5    1e-10   
ref|XP_007041421.1|  CAP (Cysteine-rich secretory proteins, Antig...  65.1    1e-10   
gb|KCW63502.1|  hypothetical protein EUGRSUZ_G01132                   65.1    1e-10   
ref|XP_004507821.1|  PREDICTED: pathogenesis-related protein PR-1...  65.1    1e-10   
gb|AFG62625.1|  hypothetical protein 0_8964_01                        63.2    1e-10   
ref|XP_010266628.1|  PREDICTED: pathogenesis-related protein 1A-like  65.1    1e-10   
ref|XP_006306376.1|  hypothetical protein CARUB_v10012281mg           65.1    1e-10   
ref|XP_002962721.1|  hypothetical protein SELMODRAFT_230161           65.1    1e-10   
gb|ADE75973.1|  unknown                                               65.1    1e-10   
ref|XP_002974460.1|  hypothetical protein SELMODRAFT_101100           65.1    1e-10   
ref|XP_006644187.1|  PREDICTED: pathogenesis-related protein PRB1...  65.1    1e-10   
emb|CAA88618.1|  type-1 pathogenesis-related protein                  65.1    1e-10   
ref|XP_002974458.1|  hypothetical protein SELMODRAFT_101466           65.1    1e-10   
ref|XP_002459308.1|  hypothetical protein SORBIDRAFT_02g002130        65.1    1e-10   
ref|XP_010265467.1|  PREDICTED: pathogenesis-related protein PR-1     65.1    1e-10   
ref|XP_008798893.1|  PREDICTED: pathogenesis-related protein 1B-like  65.1    1e-10   
gb|KCW63507.1|  hypothetical protein EUGRSUZ_G01138                   64.7    1e-10   
gb|ADP69172.1|  pathogenesis related protein-1                        65.1    1e-10   
ref|XP_010041202.1|  PREDICTED: basic form of pathogenesis-relate...  65.1    1e-10   
ref|XP_007199955.1|  hypothetical protein PRUPE_ppa1027191mg          65.1    1e-10   
ref|XP_010536929.1|  PREDICTED: pathogenesis-related protein PR-1     65.1    1e-10   
ref|XP_002276768.1|  PREDICTED: pathogenesis-related protein PR-1     65.1    1e-10   
ref|XP_004504945.1|  PREDICTED: basic form of pathogenesis-relate...  65.1    1e-10   
ref|XP_004289701.1|  PREDICTED: pathogenesis-related protein 1B-like  65.1    1e-10   
ref|XP_010065837.1|  PREDICTED: pathogenesis-related protein 1A-like  65.1    2e-10   
gb|ADB54823.1|  pathogenesis-related protein 1                        65.1    2e-10   
ref|XP_010530683.1|  PREDICTED: pathogenesis-related protein 1-like   64.7    2e-10   
emb|CDY11859.1|  BnaC03g12850D                                        65.1    2e-10   
ref|NP_001048336.1|  Os02g0786500                                     65.1    2e-10   
ref|XP_008346349.1|  PREDICTED: pathogenesis-related protein 1-like   64.7    2e-10   
gb|AEJ88253.1|  putative pathogenesis-related protein 1               64.7    2e-10   
ref|XP_010688259.1|  PREDICTED: pathogenesis-related protein PR-1...  65.5    2e-10   
ref|XP_009605695.1|  PREDICTED: basic form of pathogenesis-relate...  65.1    2e-10   
ref|XP_006387932.1|  hypothetical protein POPTR_0473s00220g           64.7    2e-10   
ref|XP_006369711.1|  Pathogenesis-related family protein              64.7    2e-10   
ref|XP_002274275.1|  PREDICTED: basic form of pathogenesis-relate...  64.7    2e-10   
ref|XP_009132116.1|  PREDICTED: pathogenesis-related protein PR-1...  65.1    2e-10   
gb|AFM76999.1|  pathogenesis related protein 1a                       64.7    2e-10   
ref|XP_011002601.1|  PREDICTED: pathogenesis-related protein 1-like   64.7    2e-10   
gb|AEQ33601.1|  pathogenesis-related protein 1a                       64.7    2e-10   
ref|XP_004289699.1|  PREDICTED: pathogenesis-related protein 1B-like  64.7    2e-10   
ref|XP_006393183.1|  hypothetical protein EUTSA_v10011955mg           64.7    2e-10   
ref|XP_006379156.1|  pathogenesis-related family protein              64.7    2e-10   
gb|AEH25626.1|  pathogenesis-related protein 1-11                     64.7    2e-10   
ref|XP_002324487.1|  hypothetical protein POPTR_0018s10410g           64.7    2e-10   
ref|XP_011069885.1|  PREDICTED: pathogenesis-related protein PR-1...  64.7    2e-10   
ref|XP_006407663.1|  hypothetical protein EUTSA_v10022343mg           65.1    2e-10   
ref|XP_006298656.1|  hypothetical protein CARUB_v10014746mg           64.7    2e-10   
gb|EAU68003.1|  conserved hypothetical protein                        67.8    2e-10   
ref|XP_009342365.1|  PREDICTED: pathogenesis-related protein 1-like   64.7    2e-10   
ref|XP_007201461.1|  hypothetical protein PRUPE_ppa014001mg           63.5    2e-10   
gb|AEW07802.1|  hypothetical protein 0_11938_01                       63.9    2e-10   
gb|KHN19053.1|  Basic form of pathogenesis-related protein 1          63.2    2e-10   
gb|KCW44547.1|  hypothetical protein EUGRSUZ_L01945                   64.7    2e-10   
gb|ABK94784.1|  unknown                                               64.7    2e-10   
gb|ACU15426.1|  unknown                                               64.7    2e-10   
gb|AFG70674.1|  hypothetical protein 0_11938_01                       63.5    2e-10   
ref|XP_007041422.1|  Pathogenesis-related protein 1                   64.3    2e-10   
ref|NP_194308.1|  putative pathogenesis-related protein               64.7    2e-10   
ref|XP_008455069.1|  PREDICTED: basic form of pathogenesis-relate...  64.7    2e-10   
ref|XP_010525645.1|  PREDICTED: pathogenesis-related protein 1B-like  64.7    2e-10   
ref|XP_010548693.1|  PREDICTED: basic form of pathogenesis-relate...  64.7    2e-10   
ref|XP_010911073.1|  PREDICTED: pathogenesis-related protein PRB1...  64.3    2e-10   
ref|XP_007200624.1|  hypothetical protein PRUPE_ppa013370mg           63.9    2e-10   
gb|EYU42415.1|  hypothetical protein MIMGU_mgv1a018981mg              64.3    2e-10   
emb|CAN64209.1|  hypothetical protein VITISV_015312                   64.3    2e-10   
gb|KDO37255.1|  hypothetical protein CISIN_1g048151mg                 64.3    2e-10   
ref|XP_002270128.1|  PREDICTED: pathogenesis-related leaf protein 4   64.3    2e-10   
ref|XP_002300292.2|  Pathogenesis-related family protein              64.3    3e-10   
gb|EEE60683.1|  hypothetical protein OsJ_14158                        63.9    3e-10   
ref|XP_004152970.1|  PREDICTED: basic form of pathogenesis-relate...  64.3    3e-10   
gb|AHE81280.1|  pathogenesis-related protein 1-16                     64.3    3e-10   
gb|AHE81259.1|  pathogenesis-related protein 1-16                     64.3    3e-10   
gb|AEH25631.1|  pathogenesis-related protein 1-16                     64.3    3e-10   
ref|XP_007205909.1|  hypothetical protein PRUPE_ppa011521mg           64.7    3e-10   
ref|XP_008236225.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...  64.3    3e-10   
gb|KCW77204.1|  hypothetical protein EUGRSUZ_D01555                   63.9    3e-10   
gb|AGH14179.1|  putative pathogenesis-related protein 1b              62.4    3e-10   
gb|KDP37604.1|  hypothetical protein JCGZ_06947                       64.3    3e-10   
ref|XP_006387930.1|  hypothetical protein POPTR_0473s002001g          62.4    3e-10   
ref|XP_004168739.1|  PREDICTED: basic form of pathogenesis-relate...  64.3    3e-10   
dbj|BAF03626.1|  pathogenesis related protein 1                       64.3    3e-10   
ref|XP_009787160.1|  PREDICTED: pathogenesis-related leaf protein...  64.3    3e-10   
ref|XP_008798894.1|  PREDICTED: pathogenesis-related protein PRB1...  64.3    3e-10   
ref|XP_004138862.1|  PREDICTED: basic form of pathogenesis-relate...  63.9    3e-10   
ref|XP_010687897.1|  PREDICTED: pathogenesis-related protein PR-1...  64.3    3e-10   
ref|XP_002869656.1|  hypothetical protein ARALYDRAFT_492242           64.3    3e-10   
ref|XP_004954162.1|  PREDICTED: pathogenesis-related protein PR-1...  64.3    3e-10   
ref|XP_008454501.1|  PREDICTED: basic form of pathogenesis-relate...  63.9    3e-10   
ref|XP_010052998.1|  PREDICTED: basic form of pathogenesis-relate...  63.9    3e-10   
ref|XP_010065835.1|  PREDICTED: pathogenesis-related protein PR-1...  63.9    3e-10   
gb|KCW63526.1|  hypothetical protein EUGRSUZ_G01161                   63.9    3e-10   
ref|XP_006422713.1|  hypothetical protein CICLE_v10029459mg           63.9    3e-10   
gb|KDP35899.1|  hypothetical protein JCGZ_09871                       64.3    3e-10   



>gb|AEH25638.1| pathogenesis-related protein 1-23 [Triticum aestivum]
Length=164

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR+ST +GCAR+ C +N G F+ CNYSPPGNY+GQRPY
Sbjct  122  YTQIVWRNSTHIGCARLLCDHNAGVFITCNYSPPGNYIGQRPY  164



>gb|AEH25628.1| pathogenesis-related protein 1-13 [Triticum aestivum]
 gb|AHE81256.1| pathogenesis-related protein 1-13 [Triticum aestivum]
 gb|AHE81277.1| pathogenesis-related protein 1-13 [Triticum aestivum]
Length=164

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR+ST +GCAR+ C +N G F+ CNYSPPGNY+GQRPY
Sbjct  122  YTQIVWRNSTHIGCARLLCDHNAGVFITCNYSPPGNYIGQRPY  164



>gb|EMS56527.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=164

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR+ST +GCAR+ C +N G F+ CNYSPPGNY+GQRPY
Sbjct  122  YTQIVWRNSTHIGCARLLCDHNAGVFITCNYSPPGNYIGQRPY  164



>ref|XP_006657421.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Oryza brachyantha]
Length=171

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C N+LG F+ CNYSPPGN+ GQ PY
Sbjct  129  YTQVVWRDSTAIGCARVDCDNDLGVFITCNYSPPGNFEGQSPY  171



>emb|CDO97325.1| unnamed protein product [Coffea canephora]
Length=162

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S ++GCAR+QC NN  +FVIC+Y PPGNYVGQRPY
Sbjct  120  YTQVVWRDSVRLGCARVQCTNNGWWFVICSYDPPGNYVGQRPY  162



>emb|CBJ55935.1| pathogenesis related gene 1 [Bupleurum kaoi]
Length=63

 Score = 72.4 bits (176),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S K+GCAR+QC+NN  +F+ CNYSPPGN+VG++PY
Sbjct  21   YTQVVWRESVKLGCARVQCKNNGWWFITCNYSPPGNFVGRKPY  63



>gb|EEC81457.1| hypothetical protein OsI_24759 [Oryza sativa Indica Group]
 gb|EEE66502.1| hypothetical protein OsJ_22957 [Oryza sativa Japonica Group]
Length=149

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C  +LG F+ CNYSPPGN+VGQ PY
Sbjct  107  YTQVVWRDSTAIGCARVVCDGDLGVFITCNYSPPGNFVGQSPY  149



>gb|EEC81456.1| hypothetical protein OsI_24758 [Oryza sativa Indica Group]
Length=173

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSST +GCAR+ C  +LG F+ CNYSPPGNY+GQ PY
Sbjct  131  YTQVVWRSSTAIGCARVVCNGSLGVFITCNYSPPGNYIGQSPY  173



>ref|NP_001058815.1| Os07g0129200 [Oryza sativa Japonica Group]
 dbj|BAC84842.1| PR-1 type pathogenesis-related protein PR-1a [Oryza sativa Japonica 
Group]
 dbj|BAD31924.1| PR-1 type pathogenesis-related protein PR-1a [Oryza sativa Japonica 
Group]
 dbj|BAF20729.1| Os07g0129200 [Oryza sativa Japonica Group]
 gb|ABK55608.1| pathogenesis-related protein PR1a [Oryza sativa Indica Group]
Length=168

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C  +LG F+ CNYSPPGN+VGQ PY
Sbjct  126  YTQVVWRDSTAIGCARVVCDGDLGVFITCNYSPPGNFVGQSPY  168



>ref|NP_001058814.1| Os07g0128800 [Oryza sativa Japonica Group]
 dbj|BAC84837.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAD31919.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAF20728.1| Os07g0128800 [Oryza sativa Japonica Group]
Length=172

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSST +GCAR+ C  +LG F+ CNYSPPGNY+GQ PY
Sbjct  130  YTQVVWRSSTAIGCARVVCNGSLGVFITCNYSPPGNYIGQSPY  172



>ref|XP_002459310.1| hypothetical protein SORBIDRAFT_02g002150 [Sorghum bicolor]
 gb|EER95831.1| hypothetical protein SORBIDRAFT_02g002150 [Sorghum bicolor]
Length=172

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGNYVGQ PY
Sbjct  130  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNYVGQSPY  172



>gb|AAG44566.1|AF251277_1 acidic PR-1 type pathogenesis-related protein PR-1a [Oryza sativa 
Japonica Group]
 emb|CAC03571.1| PR1a protein [Oryza sativa Japonica Group]
Length=168

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C  +LG F+ CNYSPPGN+VGQ PY
Sbjct  126  YTQVVWRDSTAIGCARVVCDGDLGVFITCNYSPPGNFVGQSPY  168



>emb|CDO97324.1| unnamed protein product [Coffea canephora]
Length=166

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S ++GCAR+QC N L +FVICNY P GNYVG+RPY
Sbjct  124  YTQVVWRDSVRLGCARVQCLNKLWWFVICNYDPTGNYVGERPY  166



>gb|AHA56682.1| pathogenesis related protein [Camellia sinensis]
Length=162

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN  +FVIC+Y PPGNY+GQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQCTNNGWWFVICSYDPPGNYIGQRPY  162



>emb|CBI25093.3| unnamed protein product [Vitis vinifera]
Length=163

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+FV CNY PPGNYVGQRPY
Sbjct  122  YTQVVWRNSVRLGCARVQC-NNGGWFVTCNYDPPGNYVGQRPY  163



>ref|XP_003593358.1| Pathogenesis-related protein 1a [Medicago truncatula]
 gb|AES63609.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=162

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCA+++C NN G F+ CNY PPGNYVG++PY
Sbjct  120  YTQVVWRNSQRVGCAKVRCDNNRGTFITCNYDPPGNYVGEKPY  162



>gb|AFK35640.1| unknown [Medicago truncatula]
Length=186

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCA+++C NN G F+ CNY PPGNYVG++PY
Sbjct  125  YTQVVWRNSQRVGCAKVRCDNNRGTFITCNYDPPGNYVGEKPY  167



>emb|CDP12737.1| unnamed protein product [Coffea canephora]
Length=162

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S + GCAR+QC N+  +FVIC+Y PPGNY+GQRPY
Sbjct  120  YTQVVWRNSARTGCARVQCTNSPSWFVICSYDPPGNYIGQRPY  162



>gb|ADN43415.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+FV CNY PPGNYVGQRPY
Sbjct  119  YTQVVWRNSVRLGCARVQC-NNGGWFVTCNYDPPGNYVGQRPY  160



>ref|XP_003608310.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
Length=908

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC N   +FV CNY PPGNYVGQ+PY
Sbjct  123  YTQVVWRNSVRLGCARVQCTNGW-WFVTCNYDPPGNYVGQKPY  164



>gb|ADN43419.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+FV CNY PPGNYVGQRPY
Sbjct  119  YTQVVWRNSVRLGCARVQC-NNGGWFVTCNYDPPGNYVGQRPY  160



>ref|XP_002273416.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 gb|ADN43420.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43421.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43422.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43423.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43424.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43425.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=160

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+FV CNY PPGNYVGQRPY
Sbjct  119  YTQVVWRNSVRLGCARVQC-NNGGWFVTCNYDPPGNYVGQRPY  160



>ref|XP_003593453.1| Pathogenesis-related protein 1a [Medicago truncatula]
 gb|AES63704.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
 gb|KEH29735.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=181

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCA+++C NN G F+ CNY PPGNYVG++PY
Sbjct  120  YTQVVWRNSQRVGCAKVRCDNNRGTFITCNYDPPGNYVGEKPY  162



>gb|ADN43427.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=159

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+FV CNY PPGNYVGQRPY
Sbjct  118  YTQVVWRNSVRLGCARVQC-NNGGWFVTCNYDPPGNYVGQRPY  159



>gb|ADN43428.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=160

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+FV CNY PPGNYVGQRPY
Sbjct  119  YTQVVWRNSVRLGCARVQC-NNGGWFVTCNYDPPGNYVGQRPY  160



>gb|ADN43417.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+F+ CNY PPGNYVGQRPY
Sbjct  119  YTQVVWRNSVRLGCARVQC-NNGGWFITCNYDPPGNYVGQRPY  160



>gb|ADN43418.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43426.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+F+ CNY PPGNYVGQRPY
Sbjct  119  YTQVVWRNSVRLGCARVQC-NNGGWFITCNYDPPGNYVGQRPY  160



>gb|ADN43416.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+F+ CNY PPGNYVGQRPY
Sbjct  119  YTQVVWRNSVRLGCARVQC-NNGGWFITCNYDPPGNYVGQRPY  160



>gb|ADN43436.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQC-NNGGWFVTCNYDPPGNYVGQRPY  161



>ref|XP_010691524.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
Length=166

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G FV CNYSPPGNY+GQ+PY
Sbjct  125  YTQVVWRNSNRLGCARVQC-NNGGVFVTCNYSPPGNYIGQKPY  166



>gb|AGK89727.1| pathogenesis-related 1 protein [Coffea canephora]
Length=162

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN  +FVIC+Y PPGNY GQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQCTNNGWWFVICSYDPPGNYDGQRPY  162



>ref|XP_006658252.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Oryza brachyantha]
Length=177

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSST +GCAR+ C   LG F+ CNYSPPGNY+GQ PY
Sbjct  135  YTQVVWRSSTAIGCARVVCNGTLGVFITCNYSPPGNYIGQSPY  177



>gb|ADN43435.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+F+ CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQC-NNGGWFITCNYDPPGNYVGQRPY  161



>gb|ADN43434.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G+F+ CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQC-NNGGWFITCNYDPPGNYVGQRPY  161



>ref|XP_006486833.1| PREDICTED: pathogenesis-related leaf protein 6-like [Citrus sinensis]
Length=159

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GC R++C NN G FVICNY PPGN  GQRPY
Sbjct  117  YTQVVWRNSVRLGCTRVKCNNNRGTFVICNYDPPGNVAGQRPY  159



>gb|ADN43433.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC N  G+FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQCDNG-GWFVTCNYDPPGNYVGQRPY  161



>gb|AEH25637.1| pathogenesis-related protein 1-22 [Triticum aestivum]
Length=164

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR+ST +GCAR+ C ++ G F+ CNY PPGNY+GQRPY
Sbjct  122  YTQIVWRNSTHIGCARLLCDHDAGVFITCNYGPPGNYIGQRPY  164



>ref|XP_004136927.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004155418.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 gb|KGN43832.1| hypothetical protein Csa_7G070253 [Cucumis sativus]
Length=164

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCA++ C NN G F+ CNY PPGN+VGQRPY
Sbjct  122  YTQVVWRNSVRIGCAKVICTNNGGTFITCNYDPPGNFVGQRPY  164



>gb|ADN43432.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC N  G+FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQCDNG-GWFVTCNYDPPGNYVGQRPY  161



>gb|AEP19204.1| PR-1-A2, partial [Triticum turgidum subsp. durum]
Length=89

 Score = 70.1 bits (170),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NNLG F+ CNY P GN +GQ+PY
Sbjct  47   YTQVVWRASTSIGCARVVCNNNLGVFITCNYEPRGNIIGQKPY  89



>gb|ADN43437.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=161

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC N  G+FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQCDNG-GWFVTCNYDPPGNYVGQRPY  161



>ref|XP_002459696.1| hypothetical protein SORBIDRAFT_02g008970 [Sorghum bicolor]
 gb|EER96217.1| hypothetical protein SORBIDRAFT_02g008970 [Sorghum bicolor]
Length=169

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F++CNY PPGN +GQ PY
Sbjct  127  YTQVVWRASTAIGCARVVCSNNAGVFIVCNYYPPGNVIGQSPY  169



>gb|EMS61770.1| Pathogenesis-related protein 1 [Triticum urartu]
Length=151

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NNLG F+ CNY P GN +GQ+PY
Sbjct  109  YTQVVWRASTSIGCARVVCNNNLGVFITCNYEPRGNIIGQKPY  151



>ref|XP_007148305.1| hypothetical protein PHAVU_006G197300g [Phaseolus vulgaris]
 gb|ESW20299.1| hypothetical protein PHAVU_006G197300g [Phaseolus vulgaris]
Length=145

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCA+++C NN G F+ CNYSPPGNYVGQRPY
Sbjct  104  YTQVVWRNSVRVGCAKVRC-NNGGTFITCNYSPPGNYVGQRPY  145



>gb|ACT99721.1| pathogen-related protein 1 [Nepenthes mirabilis]
Length=165

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G FVICNY P GN VGQ PY
Sbjct  123  YTQVVWRNSTHLGCARVHCANNTGTFVICNYDPAGNIVGQYPY  165



>ref|XP_008455066.1| PREDICTED: basic form of pathogenesis-related protein 1 [Cucumis 
melo]
Length=164

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW++S K+GCA+++C NN G F+ CNY P GNYV QRPY
Sbjct  122  YTQVVWKNSVKIGCAKVECNNNGGTFITCNYDPSGNYVNQRPY  164



>gb|ACJ62499.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62500.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62505.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62507.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  115  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  157



>gb|EMT10383.1| Pathogenesis-related protein 1 [Aegilops tauschii]
Length=147

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NNLG F+ CNY P GN +GQ+PY
Sbjct  105  YTQVVWRASTSIGCARVVCNNNLGVFITCNYEPRGNIIGQKPY  147



>ref|XP_009335379.1| PREDICTED: LOW QUALITY PROTEIN: basic form of pathogenesis-related 
protein 1 [Pyrus x bretschneideri]
Length=157

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW++S K+GCAR+QC N   +FV CNYSPPGNYVGQRPY
Sbjct  116  YTQVVWKNSVKLGCARVQCTNGW-WFVTCNYSPPGNYVGQRPY  157



>gb|KDO37905.1| hypothetical protein CISIN_1g039461mg, partial [Citrus sinensis]
Length=76

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR++C NN G FVIC+Y PPGN  G+RPY
Sbjct  34   YTQVVWRNSVRLGCARVKCNNNRGTFVICSYDPPGNVAGKRPY  76



>gb|KGN43831.1| hypothetical protein Csa_7G070254 [Cucumis sativus]
Length=165

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW++S K+GCA+++C NN G F+ CNY P GNYV QRPY
Sbjct  123  YTQVVWKNSVKIGCAKVECNNNGGTFITCNYDPSGNYVNQRPY  165



>gb|ACJ62489.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  115  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  157



>gb|ACJ62461.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62463.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62464.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62465.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62469.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62470.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62472.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62475.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62477.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62480.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62481.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62487.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62490.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62493.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62496.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62497.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62498.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62516.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62521.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62522.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62523.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62525.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62527.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62534.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62536.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62539.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  115  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  157



>gb|ACJ62486.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62501.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62502.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62503.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62504.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62506.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62508.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62509.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62510.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62526.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62535.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  115  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  157



>gb|ACJ62462.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62466.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62467.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62468.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62471.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62473.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62474.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62476.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62478.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62479.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62482.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62483.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62484.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62485.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62488.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62491.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62492.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62495.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62511.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62512.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62514.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62515.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62517.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62518.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62519.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62520.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62524.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62528.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62529.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62531.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62532.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62533.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62537.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62538.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62540.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62541.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  115  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  157



>ref|XP_004968783.1| PREDICTED: pathogenesis-related protein PRMS-like [Setaria italica]
Length=166

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN VGQ+PY
Sbjct  124  YTQVVWRATTTIGCARVVCRDNRGVFIICNYEPRGNIVGQKPY  166



>gb|AEH25620.1| pathogenesis-related protein 1-5 [Triticum aestivum]
 gb|AHE81269.1| pathogenesis-related protein 1-5 [Triticum aestivum]
Length=164

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NNLG F+ CNY P GN +GQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNLGVFITCNYEPRGNIIGQKPY  164



>ref|XP_004136924.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004169189.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=161

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW++S K+GCA+++C NN G F+ CNY P GNYV QRPY
Sbjct  119  YTQVVWKNSVKIGCAKVECNNNGGTFITCNYDPSGNYVNQRPY  161



>ref|XP_009335372.1| PREDICTED: pathogenesis-related leaf protein 6-like [Pyrus x 
bretschneideri]
 ref|XP_009346539.1| PREDICTED: pathogenesis-related leaf protein 6-like [Pyrus x 
bretschneideri]
Length=162

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW+ S K+GCAR+QC N   +FV CNYSPPGNYVGQRPY
Sbjct  121  YTQVVWKKSVKLGCARVQCTNGW-WFVTCNYSPPGNYVGQRPY  162



>ref|XP_008353150.1| PREDICTED: pathogenesis-related protein PR-1-like [Malus domestica]
Length=171

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWRS++KVGCAR+ C    G F++CNY PPGNY+G+RPY
Sbjct  129  YTQIVWRSTSKVGCARVNCFGGRGVFMVCNYDPPGNYIGERPY  171



>ref|XP_006422719.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
 gb|ESR35959.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
Length=159

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR++C NN G FVIC+Y PPGN  G+RPY
Sbjct  117  YTQVVWRNSVRLGCARVKCNNNRGTFVICSYDPPGNVAGKRPY  159



>prf||1803521A pathogenesis-related protein 1
Length=140

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  98   YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  140



>gb|ABA34060.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=163

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  121  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  163



>ref|XP_008652242.1| PREDICTED: pathogenesis-related protein 1-like [Zea mays]
 tpg|DAA60242.1| TPA: hypothetical protein ZEAMMB73_897468 [Zea mays]
Length=171

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR+ST +GCAR+ C NN G F+ICNY PPGN +GQ PY
Sbjct  129  YTQLVWRASTAIGCARVVCSNNAGVFIICNYYPPGNVIGQSPY  171



>ref|XP_006422707.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
 gb|ESR35947.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
Length=159

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR++C NN G FVIC+Y PPGN  G+RPY
Sbjct  117  YTQVVWRNSVRLGCARVKCNNNRGTFVICSYDPPGNVAGKRPY  159



>gb|AHE81264.1| pathogenesis-related protein 1-21 [Triticum aestivum]
Length=174

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ICNY+PPGN+ G RP+
Sbjct  122  YTQVVWRKSTRIGCARVVCAGNRGVFIICNYNPPGNFNGDRPF  164



>gb|AAK60565.1|AF384143_1 pathogenesis-related protein 1 [Triticum aestivum]
 gb|AEH25619.1| pathogenesis-related protein 1-4 [Triticum aestivum]
 gb|AEJ22716.1| pathogenesis-related protein 1 [Triticum aestivum]
 gb|AHE81268.1| pathogenesis-related protein 1-4 [Triticum aestivum]
Length=164

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NNLG F+ CNY P GN +GQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNLGVFITCNYEPRGNIIGQKPY  164



>gb|AEH25636.1| pathogenesis-related protein 1-21 [Triticum aestivum]
 gb|AHE81285.1| pathogenesis-related protein 1-21 [Triticum aestivum]
Length=174

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ICNY+PPGN+ G RP+
Sbjct  122  YTQVVWRKSTRIGCARVVCAGNRGVFIICNYNPPGNFNGDRPF  164



>gb|AHE81254.1| pathogenesis-related protein 1-11 [Triticum aestivum]
Length=169

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSST +GCAR+ C +N G F+ICNYSP GN  GQ+PY
Sbjct  127  YTQVVWRSSTSIGCARVVCDSNRGVFIICNYSPRGNIAGQKPY  169



>ref|XP_010691521.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
Length=166

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC N  G FV CNY PPGNY+GQ+PY
Sbjct  125  YTQVVWRNSVRLGCARVQCDNG-GVFVTCNYDPPGNYIGQKPY  166



>gb|ADB54822.1| pathogenesis-related protein 1 [Vitis pseudoreticulata]
Length=176

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQV+WR+S ++GCAR+QC N  G+F+ CNY PPGNY+GQRP+
Sbjct  120  YTQVIWRNSLRLGCARVQCDNG-GWFITCNYDPPGNYMGQRPF  161



>gb|AAP14676.1| pathogenesis related-1 [Triticum aestivum]
Length=156

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NNLG F+ CNY P GN +GQ+PY
Sbjct  114  YTQVVWRASTSIGCARVVCNNNLGVFITCNYEPRGNIIGQKPY  156



>gb|ABA34056.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=158

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  116  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  158



>gb|AHE81275.1| pathogenesis-related protein 1-11 [Triticum aestivum]
Length=169

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSST +GCAR+ C +N G F+ICNYSP GN  GQ+PY
Sbjct  127  YTQVVWRSSTSIGCARVVCDSNRGVFIICNYSPRGNIAGQKPY  169



>ref|XP_009346545.1| PREDICTED: pathogenesis-related protein 1A-like [Pyrus x bretschneideri]
Length=166

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST+VGCAR +C+N++  FVIC+Y PPGN++G+RPY
Sbjct  125  YTQVVWRNSTRVGCARAKCKNDM-IFVICSYDPPGNWIGERPY  166



>gb|ABA34062.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=163

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  121  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  163



>ref|NP_001105399.1| pathogenesis related protein4 precursor [Zea mays]
 gb|AAC25629.1| pathogenesis related protein-1 [Zea mays]
 gb|ABA34057.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34058.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34061.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34065.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=163

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  121  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  163



>ref|XP_010088981.1| hypothetical protein L484_013561 [Morus notabilis]
 gb|EXB37196.1| hypothetical protein L484_013561 [Morus notabilis]
Length=171

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCA+++C N+ G FVICNY+PPGNY+GQRPY
Sbjct  123  YTQVVWRKSTRLGCAKVRC-NSGGSFVICNYNPPGNYIGQRPY  164



>gb|ABA34077.1| pathogenesis-related protein 1 [Zea diploperennis]
Length=158

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  116  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  158



>gb|ABA34066.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34067.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=163

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  121  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  163



>gb|ABA34063.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34064.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34069.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34075.1| pathogenesis-related protein 1 [Zea diploperennis]
Length=163

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  121  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  163



>gb|ABA34055.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34059.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34068.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34070.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
 gb|ABA34071.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34072.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34073.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34074.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34076.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ABA34078.1| pathogenesis-related protein 1 [Zea diploperennis]
 gb|ACF86188.1| unknown [Zea mays]
 gb|ACF86501.1| unknown [Zea mays]
 tpg|DAA59479.1| TPA: pathogeneis protein 1 [Zea mays]
Length=163

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  121  YTQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  163



>gb|AHA43767.1| pathogenesis related protein 1 isoform 4 [Morus alba var. multicaulis]
 gb|AHW81905.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCA+++C N+ G FVICNY+PPGNY+GQRPY
Sbjct  123  YTQVVWRKSTRLGCAKVRC-NSGGSFVICNYNPPGNYIGQRPY  164



>gb|AAB05225.1| pathogenesis-related protein-1 [Nicotiana glutinosa]
Length=168

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCAR+QC NN GY V CNY PPGN+VGQ PY
Sbjct  127  YTQVVWRNSVRVGCARVQC-NNGGYVVSCNYDPPGNFVGQSPY  168



>gb|AHW81904.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCA+++C N+ G FVICNY+PPGNY+GQRPY
Sbjct  123  YTQVVWRKSTRLGCAKVRC-NSGGSFVICNYNPPGNYIGQRPY  164



>gb|ADN43439.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN  +FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQC-NNGWWFVTCNYDPPGNYVGQRPY  161



>gb|ADD97801.1| pathogenesis-related protein 1 [Musa ABB Group]
Length=163

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSST +GC R++C NN G F+ CNY PPGNY GQRPY
Sbjct  122  YTQVVWRSSTAIGCGRVRC-NNGGIFITCNYKPPGNYAGQRPY  163



>gb|KDO40549.1| hypothetical protein CISIN_1g043403mg, partial [Citrus sinensis]
Length=124

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCA++ C NN G F+ CNY PPGN+VG++PY
Sbjct  82   YTQVVWRNSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  124



>ref|XP_006486822.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCA++ C NN G F+ CNY PPGN+VG++PY
Sbjct  121  YTQVVWRNSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  163



>gb|KDP37600.1| hypothetical protein JCGZ_06943 [Jatropha curcas]
Length=148

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCA+++C NN G F+ CNY PPGNYVGQRPY
Sbjct  107  YTQVVWRNSVRIGCAKVKC-NNGGTFITCNYDPPGNYVGQRPY  148



>ref|XP_010691525.1| PREDICTED: pathogenesis-related protein 1A-like [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN G FV CNYSPPGNY GQ+PY
Sbjct  126  YTQVVWRNSNRLGCARVQC-NNGGIFVTCNYSPPGNYNGQKPY  167



>dbj|BAO09561.1| pathogenesis-related protein 1, partial [Morus alba]
Length=164

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCA+++C N+ G FVICNY+PPGNY+GQRPY
Sbjct  116  YTQVVWRKSTRLGCAKVRC-NSGGSFVICNYNPPGNYIGQRPY  157



>ref|XP_009788194.1| PREDICTED: pathogenesis-related leaf protein 4-like [Nicotiana 
sylvestris]
Length=161

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++ +VGCAR++C+N   +FV CNY PPGNY+G+RPY
Sbjct  119  YTQVVWRNTLQVGCARLKCQNGEAWFVSCNYYPPGNYIGERPY  161



>ref|NP_001043089.1| Os01g0382000 [Oryza sativa Japonica Group]
 gb|AAB49685.1| pathogenesis-related protein class 1 [Oryza sativa Indica Group]
 dbj|BAB84468.1| putative pathogenesis-related protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAC10793.1| putative pathogenesis-related protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAF05003.1| Os01g0382000 [Oryza sativa Japonica Group]
 gb|ABK55609.1| pathogenesis-related protein PR1b [Oryza sativa Indica Group]
Length=164

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C N  G F+ CNY P GN+VGQRPY
Sbjct  122  YTQVVWRASTSIGCARVVCSNGRGVFITCNYKPAGNFVGQRPY  164



>ref|XP_002436405.1| hypothetical protein SORBIDRAFT_10g001940 [Sorghum bicolor]
 gb|EER87772.1| hypothetical protein SORBIDRAFT_10g001940 [Sorghum bicolor]
Length=168

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ CR+N G F+ICNY P GN VG +PY
Sbjct  126  YTQVVWRASTSIGCARVVCRDNRGVFIICNYEPRGNIVGHKPY  168



>ref|XP_010245650.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=163

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCA++ C NN G F+ICNY PPGNY+G+RPY
Sbjct  122  YTQVVWRNSVRLGCAKVHC-NNGGIFIICNYDPPGNYIGERPY  163



>ref|XP_006422714.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
 gb|ESR35954.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
Length=163

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S ++GCA++ C NN G F+ CNY PPGN+VG++PY
Sbjct  121  YTQVVWRKSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  163



>ref|XP_009759149.1| PREDICTED: pathogenesis-related protein PR-1 [Nicotiana sylvestris]
Length=174

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR S ++GCA++ C N LG F+ CNY PPGNY+G+RPY
Sbjct  132  YTQIVWRESRRIGCAKVTCFNGLGVFMTCNYDPPGNYIGERPY  174



>ref|XP_010530682.1| PREDICTED: pathogenesis-related protein 1A-like [Tarenaya hassleriana]
Length=162

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST++GCA+++C +N G F+ CNY PPGNY+G+RPY
Sbjct  121  YTQVVWRNSTRIGCAKMEC-DNGGTFITCNYDPPGNYIGERPY  162



>emb|CBI25103.3| unnamed protein product [Vitis vinifera]
Length=155

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQV+WR+S ++GCAR QC N+ G+FV CNY PPGNYVGQRP+
Sbjct  99   YTQVIWRNSLRLGCARAQC-NSGGWFVTCNYDPPGNYVGQRPF  140



>ref|XP_009618987.1| PREDICTED: pathogenesis-related protein PR-1-like [Nicotiana 
tomentosiformis]
Length=174

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR S ++GCA++ C N LG F+ CNY PPGNY+G+RPY
Sbjct  132  YTQIVWRESRRIGCAKVTCFNGLGVFMTCNYDPPGNYIGERPY  174



>ref|XP_006486820.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S ++GCA++ C NN G F+ CNY PPGN+VG++PY
Sbjct  121  YTQVVWRKSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  163



>ref|XP_002274371.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN80994.1| hypothetical protein VITISV_042545 [Vitis vinifera]
Length=161

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN  +FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQC-NNGWWFVTCNYDPPGNYVGQRPY  161



>ref|XP_004485656.1| PREDICTED: pathogenesis-related protein 1B-like [Cicer arietinum]
Length=160

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S +VGCA+++C N  G F+ CNYSPPGNY+GQ+PY
Sbjct  119  YTQVVWRDSHRVGCAKVKCDNG-GTFITCNYSPPGNYIGQKPY  160



>gb|ABA34079.1| pathogenesis-related protein 1 [Zea diploperennis]
Length=163

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  121  YTQVVWRDSTAIGCARVVCDNNEGVFIICSYNPPGNVVGESPY  163



>ref|XP_006367102.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=167

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCA++QC NN  YF+ CNY PPGNY+GQRPY
Sbjct  117  YTQVVWRNSIRVGCAKVQC-NNGWYFITCNYDPPGNYIGQRPY  158



>gb|AFK39516.1| unknown [Lotus japonicus]
Length=164

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW++S ++GCA+++C N  G F+ CNY PPGNYVGQ+PY
Sbjct  122  YTQVVWKNSMRLGCAKVKCDNGGGTFITCNYDPPGNYVGQKPY  164



>gb|ABB96918.1| pathogenesis-related protein 1 [Triticum aestivum]
Length=103

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            Y QVVWR+ST +GCAR+ C NNLG F+ CNY P GN +GQ+PY
Sbjct  61   YAQVVWRASTSIGCARVVCNNNLGVFITCNYEPRGNIIGQKPY  103



>gb|KDP35900.1| hypothetical protein JCGZ_09872 [Jatropha curcas]
Length=160

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCA+++C NN G F+ CNY PPGNYVGQRPY
Sbjct  119  YTQVVWRNSVRIGCAKVKC-NNGGTFITCNYDPPGNYVGQRPY  160



>gb|AEH25625.1| pathogenesis-related protein 1-10 [Triticum aestivum]
 gb|AHE81253.1| pathogenesis-related protein 1-10 [Triticum aestivum]
 gb|AHE81274.1| pathogenesis-related protein 1-10 [Triticum aestivum]
Length=170

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSST +GCAR+ C +N G F+ICNYSP GN  GQ+PY
Sbjct  128  YTQVVWRSSTSIGCARVVCDSNRGVFIICNYSPRGNIAGQKPY  170



>ref|XP_010691522.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
 emb|CAP66260.1| pathogenesis-related protein 1a [Beta vulgaris]
Length=168

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S ++GCAR+QC N  G FV CNY PPGN+VGQ+PY
Sbjct  127  YTQVVWRDSVRLGCARVQCDNG-GIFVTCNYDPPGNFVGQKPY  168



>ref|XP_009336676.1| PREDICTED: pathogenesis-related protein PR-1-like [Pyrus x bretschneideri]
Length=233

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VW+S++KVGCAR+ C    G F++CNY PPGNY+G+RPY
Sbjct  191  YTQIVWKSTSKVGCARVNCFGGRGIFMVCNYDPPGNYIGERPY  233



>gb|AFK36478.1| unknown [Lotus japonicus]
Length=164

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW++S ++GCA+++C N  G F+ CNY PPGNYVGQ+PY
Sbjct  122  YTQVVWKNSMRLGCAKVKCDNGGGTFITCNYDPPGNYVGQKPY  164



>ref|XP_003557607.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Brachypodium 
distachyon]
Length=165

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST VGCAR+ C +  G F+ICNY+PPGNYVG+ PY
Sbjct  123  YTQVVWRDSTAVGCARVVCDSGDGLFIICNYNPPGNYVGRSPY  165



>gb|AHE81248.1| pathogenesis-related protein 1-5 [Triticum aestivum]
Length=164

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NNLG F+ CNY P GN  GQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNLGVFITCNYEPRGNITGQKPY  164



>gb|ADN43429.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN  +FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQC-NNGWWFVTCNYDPPGNYVGQRPY  161



>ref|XP_009605694.1| PREDICTED: pathogenesis-related leaf protein 4-like [Nicotiana 
tomentosiformis]
Length=161

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQV+WR++ +VGCAR++C+N   +FV CNY PPGNY+G+RPY
Sbjct  119  YTQVIWRNTLQVGCARLKCQNGEAWFVSCNYYPPGNYIGERPY  161



>gb|AFK38989.1| unknown [Medicago truncatula]
 gb|AES63608.2| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=159

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++ ++GCA+++C NN G F+ICNY PPGNYVGQ+PY
Sbjct  118  YTQVVWRNTKRIGCAKVRC-NNGGTFIICNYDPPGNYVGQKPY  159



>gb|AEP19203.1| PR-1-A1, partial [Triticum turgidum subsp. durum]
Length=103

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P GN VGQ+PY
Sbjct  61   YTQVVWRASTSIGCARVVCNNNRGVFITCNYEPAGNVVGQKPY  103



>ref|XP_009605697.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nicotiana 
tomentosiformis]
Length=163

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCAR QC NN  +FVIC+Y PPGNYVGQRPY
Sbjct  122  YTQVVWRNSVRVGCARAQC-NNGWWFVICSYDPPGNYVGQRPY  163



>ref|XP_003557605.1| PREDICTED: pathogenesis-related protein 1-like [Brachypodium 
distachyon]
Length=171

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW +STK+GCAR+ C NN G F+IC+Y PPGN  GQ+PY
Sbjct  129  YTQVVWAASTKIGCARVVCDNNKGVFIICSYDPPGNMNGQKPY  171



>sp|Q41359.1|PR1_SAMNI RecName: Full=Pathogenesis-related protein PR-1 type; Flags: 
Precursor [Sambucus nigra]
 emb|CAA87071.1| pathogenesis-related protein, PR-1 type [Sambucus nigra]
Length=167

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR++C NN  +F+ CNYSPPGNY GQRPY
Sbjct  126  YTQVVWRNSVRIGCARVRC-NNGAWFITCNYSPPGNYAGQRPY  167



>emb|CDO97328.1| unnamed protein product [Coffea canephora]
Length=537

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S+ +GCA  +CRNN   FV CNY PPGNY+G+RPY
Sbjct  495  YTQVVWRDSSNIGCAAARCRNNGWTFVTCNYYPPGNYIGERPY  537



>ref|XP_007201612.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
 gb|EMJ02811.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
Length=157

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW++S ++GCAR++C N L +FV CNY PPGNYVGQRPY
Sbjct  116  YTQVVWKNSVRLGCARVKCSNGL-WFVTCNYDPPGNYVGQRPY  157



>ref|XP_009398310.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=163

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSST +GC R++C N+   F+ICNY PPGNYVGQRPY
Sbjct  122  YTQVVWRSSTAIGCGRVRC-NSGAIFIICNYKPPGNYVGQRPY  163



>ref|XP_004955413.1| PREDICTED: pathogenesis-related protein 1-like [Setaria italica]
Length=170

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST VGCAR+ C N+ G F+ CNY+PPGN VGQ PY
Sbjct  128  YTQVVWRDSTAVGCARVVCDNDGGVFITCNYNPPGNVVGQSPY  170



>ref|XP_002274105.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=176

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQV+WR+S ++GCAR QC N+ G+FV CNY PPGNYVGQRP+
Sbjct  120  YTQVIWRNSLRLGCARAQC-NSGGWFVTCNYDPPGNYVGQRPF  161



>gb|ADN43442.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN  +FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARVQC-NNGWWFVTCNYDPPGNYVGQRPY  161



>ref|XP_004296418.1| PREDICTED: pathogenesis-related protein PR-1-like [Fragaria vesca 
subsp. vesca]
Length=179

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWRS+T+VGCAR+ C    G F++C+Y PPGNY+G+RPY
Sbjct  137  YTQIVWRSTTRVGCARVDCFGGRGVFMVCSYDPPGNYIGERPY  179



>gb|ACQ41877.1| pathogenesis-related protein 1 [Triticum aestivum]
Length=164

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NNLG F+ CN+ P GN +GQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNLGVFITCNHEPRGNIIGQKPY  164



>gb|EMS67474.1| Pathogenesis-related protein PRB1-3 [Triticum urartu]
Length=86

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ CNY+PPGN+ G+RP+
Sbjct  36   YTQVVWRKSTRIGCARVVCAGNRGVFITCNYNPPGNFNGERPF  78



>gb|ACQ41880.1| pathogenisis-related protein 1.1 [Triticum aestivum]
 gb|AEH25616.1| pathogenesis-related protein 1-1 [Triticum aestivum]
 gb|AHE81244.1| pathogenesis-related protein 1-1 [Triticum aestivum]
 gb|AHE81265.1| pathogenesis-related protein 1-1 [Triticum aestivum]
Length=164

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P GN VGQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNRGVFITCNYEPAGNVVGQKPY  164



>gb|AFJ93090.1| pathogenesis-related protein 1 [Bacopa monnieri]
Length=176

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+QC N    FV CNY PPGNYVG+RPY
Sbjct  135  YTQVVWRDSTHLGCARLQCHNGW-LFVTCNYDPPGNYVGERPY  176



>ref|XP_010095626.1| hypothetical protein L484_003727 [Morus notabilis]
 gb|EXB61533.1| hypothetical protein L484_003727 [Morus notabilis]
Length=145

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S  VGCAR++C NN G FVIC+YSP GNY GQRPY
Sbjct  103  YTQVVWRNSVHVGCARVRCYNNRGTFVICSYSPRGNYRGQRPY  145



>ref|XP_010539449.1| PREDICTED: pathogenesis-related protein PR-1-like [Tarenaya hassleriana]
Length=207

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N LG F+ CNY PPGNY+G++PY
Sbjct  165  YTQIVWRDTKRLGCARVVCDNGLGVFITCNYDPPGNYIGEKPY  207



>ref|XP_008382391.1| PREDICTED: pathogenesis-related protein 1A-like [Malus domestica]
Length=166

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST+VGCAR +C+N +  FVIC+Y PPGN++G+RPY
Sbjct  125  YTQVVWRNSTRVGCARAKCKNGM-IFVICSYDPPGNWIGERPY  166



>ref|XP_007148303.1| hypothetical protein PHAVU_006G197100g [Phaseolus vulgaris]
 gb|ESW20297.1| hypothetical protein PHAVU_006G197100g [Phaseolus vulgaris]
Length=166

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCA+++C N  G F+ CNYSPPGNYVGQ+PY
Sbjct  125  YTQVVWRNSVRVGCAKVRCSNG-GTFITCNYSPPGNYVGQKPY  166



>emb|CBI25105.3| unnamed protein product [Vitis vinifera]
Length=267

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR+QC NN  +FV CNY PPGNYVGQRPY
Sbjct  226  YTQVVWRNSVRLGCARVQC-NNGWWFVTCNYDPPGNYVGQRPY  267


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYV  116
            YTQVVW +S ++GCAR+QC NN  +FV CNY PPGNY+
Sbjct  98   YTQVVWSNSVRLGCARVQC-NNGWWFVTCNYDPPGNYI  134



>gb|EMT11012.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=166

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C +  G F+IC+Y+PPGNYVGQ PY
Sbjct  124  YTQVVWRDSTAIGCARVVCDSGDGVFIICSYNPPGNYVGQSPY  166



>gb|AEH25632.1| pathogenesis-related protein 1-17 [Triticum aestivum]
 gb|AHE81260.1| pathogenesis-related protein 1-17 [Triticum aestivum]
 gb|AHE81281.1| pathogenesis-related protein 1-17 [Triticum aestivum]
Length=174

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ CNY+PPGN+ G+RP+
Sbjct  122  YTQVVWRKSTRIGCARVVCAGNRGVFITCNYNPPGNFNGERPF  164



>emb|CDO97323.1| unnamed protein product [Coffea canephora]
Length=163

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S ++GCAR+QC N+  +FVIC+Y PPGNY+GQRPY
Sbjct  122  YTQVVWRDSVRLGCARVQCTNSW-WFVICSYDPPGNYIGQRPY  163



>ref|XP_004955412.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Setaria 
italica]
Length=163

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNYSPPGNY GQ PY
Sbjct  122  YTQVVWRASTAIGCARVVC-NNGGIFITCNYSPPGNYAGQSPY  163



>gb|AEH25617.1| pathogenesis-related protein 1-2 [Triticum aestivum]
 gb|EMT07925.1| Pathogenesis-related protein PRB1-3 [Aegilops tauschii]
 gb|AHE81245.1| pathogenesis-related protein 1-2 [Triticum aestivum]
 gb|AHE81266.1| pathogenesis-related protein 1-2 [Triticum aestivum]
Length=164

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P GN VGQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNRGVFITCNYEPAGNVVGQKPY  164



>gb|EAZ02649.1| hypothetical protein OsI_24760 [Oryza sativa Indica Group]
 gb|EAZ38569.1| hypothetical protein OsJ_22958 [Oryza sativa Japonica Group]
Length=149

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW +ST +GCAR+ C N+LG F+ CNYSPPGN  G+ PY
Sbjct  107  YTQVVWSNSTAIGCARVVCDNSLGVFITCNYSPPGNVDGESPY  149



>ref|XP_002522070.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40270.1| STS14 protein precursor, putative [Ricinus communis]
Length=162

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSS ++GCA++ C NN G F+ CNY PPGNY+GQRPY
Sbjct  120  YTQVVWRSSVRLGCAKVSC-NNGGTFIGCNYDPPGNYIGQRPY  161



>dbj|BAK01044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ CNY+PPGN+ G+RP+
Sbjct  122  YTQVVWRKSTRIGCARVVCAGNRGVFITCNYNPPGNFNGERPF  164



>emb|CAA07474.1| pathogenisis-related protein 1.2 [Triticum aestivum]
 gb|AEH25635.1| pathogenesis-related protein 1-20 [Triticum aestivum]
 dbj|BAN09076.1| pathogenesis related protein-1.2 [Triticum aestivum]
 gb|AHE81263.1| pathogenesis-related protein 1-20 [Triticum aestivum]
 gb|AHE81284.1| pathogenesis-related protein 1-20 [Triticum aestivum]
Length=173

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ CNY+PPGN+ G+RP+
Sbjct  122  YTQVVWRKSTRIGCARVVCTGNRGVFITCNYNPPGNFNGERPF  164



>ref|XP_006285131.1| hypothetical protein CARUB_v10006471mg [Capsella rubella]
 gb|EOA18029.1| hypothetical protein CARUB_v10006471mg [Capsella rubella]
Length=208

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG++PY
Sbjct  166  YTQIVWRDTKRIGCARVVCENGAGVFITCNYDPPGNYVGEKPY  208



>gb|AEH25633.1| pathogenesis-related protein 1-18 [Triticum aestivum]
 gb|AHE81261.1| pathogenesis-related protein 1-18 [Triticum aestivum]
 gb|AHE81282.1| pathogenesis-related protein 1-18 [Triticum aestivum]
Length=174

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ CNY+PPGN+ G+RP+
Sbjct  122  YTQVVWRKSTRIGCARVVCAGNRGVFITCNYNPPGNFNGERPF  164



>gb|AEH25629.1| pathogenesis-related protein 1-14 [Triticum aestivum]
 gb|AHE81257.1| pathogenesis-related protein 1-14 [Triticum aestivum]
 gb|AHE81278.1| pathogenesis-related protein 1-14 [Triticum aestivum]
Length=172

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ CNY+PPGN+ G+RP+
Sbjct  122  YTQVVWRKSTRIGCARVVCAGNRGVFITCNYNPPGNFNGERPF  164



>emb|CAA07473.1| pathogenisis-related protein 1.1 [Triticum aestivum]
 gb|AEH25618.1| pathogenesis-related protein 1-3 [Triticum aestivum]
 gb|AHE81246.1| pathogenesis-related protein 1-3 [Triticum aestivum]
 gb|AHE81267.1| pathogenesis-related protein 1-3 [Triticum aestivum]
Length=164

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P GN VGQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNRGVFITCNYEPAGNVVGQKPY  164



>gb|ACQ41878.1| pathogenesis-related protein 1 [Triticum aestivum]
Length=164

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST VGCAR+ C +NLG F+ CNY P GN +GQ+PY
Sbjct  122  YTQVVWRASTSVGCARVVCNSNLGVFITCNYEPRGNIIGQKPY  164



>dbj|BAN09077.1| pathogenesis related protein-1.2 [Triticum aestivum]
Length=172

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ CNY+PPGN+ G+RP+
Sbjct  122  YTQVVWRKSTRIGCARVVCAGNRGVFITCNYNPPGNFNGERPF  164



>gb|ACQ41879.1| pathogenisis-related protein 1.1 [Triticum aestivum]
Length=164

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P GN +GQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNRGVFITCNYEPAGNVIGQKPY  164



>sp|P35793.1|PR13_HORVU RecName: Full=Pathogenesis-related protein PRB1-3; AltName: Full=HV-8; 
AltName: Full=PR-1B; Flags: Precursor [Hordeum vulgare]
 emb|CAA52894.1| PR-1b pathogenesis related protein (Hv-8) [Hordeum vulgare subsp. 
vulgare]
 emb|CAA81230.1| pathogenesis-related protein [Hordeum vulgare subsp. vulgare]
 emb|CAA81234.1| pathogenesis-related protein [Hordeum vulgare subsp. vulgare]
Length=164

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P GN VGQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNRGVFITCNYEPRGNIVGQKPY  164



>gb|ACJ62530.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GC R+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  115  YTQVVWRDSTAIGCVRVVCDNNAGVFIICSYNPPGNVVGESPY  157



>gb|ACJ62513.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GC R+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  115  YTQVVWRDSTAIGCVRVVCDNNAGVFIICSYNPPGNVVGESPY  157



>ref|XP_009378591.1| PREDICTED: pathogenesis-related leaf protein 4-like [Pyrus x 
bretschneideri]
Length=161

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWRSST++GCA+++C NN G F+ CNY PPGNY GQ+PY
Sbjct  120  YTQVVWRSSTRLGCAKVRC-NNGGTFIGCNYDPPGNYAGQKPY  161



>ref|XP_004242676.1| PREDICTED: pathogenesis-related protein PR-1-like [Solanum lycopersicum]
Length=182

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCA++ C N LG F+ CNY PPGNY+G+RPY
Sbjct  140  YTQIVWRETRRIGCAKVTCYNGLGVFMTCNYDPPGNYIGERPY  182



>ref|XP_002532413.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF29977.1| STS14 protein precursor, putative [Ricinus communis]
Length=179

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCA++ C ++LG F+ CNY PPGNY+G+RPY
Sbjct  137  YTQIVWRKTRRIGCAKVTCSDDLGVFMTCNYDPPGNYIGERPY  179



>gb|ADN43438.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCAR QC NN  +FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWRNSVRLGCARAQC-NNGWWFVTCNYDPPGNYVGQRPY  161



>ref|XP_006343539.1| PREDICTED: pathogenesis-related protein PR-1-like [Solanum tuberosum]
Length=180

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCA++ C N LG F+ CNY PPGNY+G+RPY
Sbjct  138  YTQIVWRETRRIGCAKVTCYNGLGVFMTCNYDPPGNYIGERPY  180



>emb|CAA52893.1| PR-1a pathogenesis related protein (Hv-1a) [Hordeum vulgare subsp. 
vulgare]
 dbj|BAK02039.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96307.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=164

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P GN VGQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNGGVFITCNYEPAGNVVGQKPY  164



>ref|XP_004290371.1| PREDICTED: pathogenesis-related protein 1B-like [Fragaria vesca 
subsp. vesca]
Length=164

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW +STK+GCA+++C N  G F+ICNY PPGNYVG++P+
Sbjct  123  YTQVVWANSTKIGCAKVRCANG-GTFIICNYDPPGNYVGEKPF  164



>ref|NP_001058816.1| Os07g0129300 [Oryza sativa Japonica Group]
 gb|AAM45439.1|AF306651_1 pathogenesis-related protein 1 [Oryza sativa]
 dbj|BAC84723.1| pathogenesis-related protein 1 [Oryza sativa Japonica Group]
 dbj|BAF20730.1| Os07g0129300 [Oryza sativa Japonica Group]
Length=165

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW +ST +GCAR+ C N+LG F+ CNYSPPGN  G+ PY
Sbjct  123  YTQVVWSNSTAIGCARVVCDNSLGVFITCNYSPPGNVDGESPY  165



>ref|XP_008651988.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Zea mays]
 tpg|DAA59477.1| TPA: hypothetical protein ZEAMMB73_881711 [Zea mays]
Length=167

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C N  G F+ CNY+PPGN+ GQRPY
Sbjct  125  YTQVVWRKSTAIGCARVVCNNGGGVFITCNYNPPGNFRGQRPY  167



>gb|KDP37606.1| hypothetical protein JCGZ_06949 [Jatropha curcas]
Length=163

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S +VGCA+++C N  G FV CNY PPGNYVGQ+PY
Sbjct  122  YTQVVWRDSVRVGCAKVRCSNG-GTFVTCNYDPPGNYVGQKPY  163



>gb|AHE81247.1| pathogenesis-related protein 1-4 [Triticum aestivum]
Length=164

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GC R+ C NNLG F+ CNY P GN +GQ+PY
Sbjct  122  YTQVVWRASTSIGCTRVVCNNNLGVFITCNYEPRGNIIGQKPY  164



>dbj|BAA05473.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=122

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++ +VGCAR++C+N   +FV CNY PPGNY+G++PY
Sbjct  80   YTQVVWRNTLQVGCARLKCQNGEAWFVSCNYYPPGNYIGEKPY  122



>ref|XP_003572883.1| PREDICTED: pathogenesis-related protein PR-1-like [Brachypodium 
distachyon]
Length=180

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR ST+VGCA + C N  G F+ CNY PPGNYVG RPY
Sbjct  138  YTQIVWRGSTRVGCAMVNCYNGRGTFITCNYDPPGNYVGMRPY  180



>ref|XP_006583787.1| PREDICTED: basic form of pathogenesis-related protein 1-like, 
partial [Glycine max]
Length=160

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST+VGCA+++C +N G F+ CNY PPGNYVGQRPY
Sbjct  119  YTQVVWRDSTQVGCAKVEC-DNGGTFICCNYYPPGNYVGQRPY  160



>ref|NP_001043091.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAB84473.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAC10798.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAF05005.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAH00320.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70685.1| hypothetical protein OsI_02026 [Oryza sativa Indica Group]
Length=167

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST VGCAR++C  N G F+ICNY P GN VG+RPY
Sbjct  125  YTQVVWRDSTNVGCARVRCDANRGIFIICNYEPRGNIVGRRPY  167



>ref|XP_007227657.1| hypothetical protein PRUPE_ppa015046mg [Prunus persica]
 gb|EMJ28856.1| hypothetical protein PRUPE_ppa015046mg [Prunus persica]
Length=169

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWRS+ +VGCAR+ C    G F++CNY PPGNY+G+RPY
Sbjct  127  YTQIVWRSTRRVGCARVTCLGGRGVFMVCNYDPPGNYIGERPY  169



>ref|XP_002465112.1| hypothetical protein SORBIDRAFT_01g032200 [Sorghum bicolor]
 gb|EER92110.1| hypothetical protein SORBIDRAFT_01g032200 [Sorghum bicolor]
Length=179

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G FV+C+Y PPGN+ G+RP+
Sbjct  129  YTQVVWRKSTRLGCARVVCAANRGVFVVCSYDPPGNFNGERPF  171



>ref|XP_003545770.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 gb|KHN33604.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=164

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S ++GCA++ C N  G F+ CNY+PPGNYVGQRPY
Sbjct  123  YTQVVWRDSVRLGCAKVACDNG-GTFITCNYAPPGNYVGQRPY  164



>gb|ABA34024.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34025.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34026.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34027.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34028.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34029.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34031.1| pathogenesis-related maize seed protein [Zea diploperennis]
Length=167

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CRNN G F+ICNY P GN  G +PY
Sbjct  125  YTQVVWRATTSIGCARVVCRNNRGVFIICNYEPRGNIAGMKPY  167



>ref|XP_002864522.1| hypothetical protein ARALYDRAFT_495859 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40781.1| hypothetical protein ARALYDRAFT_495859 [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG+RPY
Sbjct  165  YTQMVWRDTKRLGCARVVCENGAGVFITCNYDPPGNYVGERPY  207



>gb|EMS58167.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=197

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ CNY+PPGN+ G+RP+
Sbjct  145  YTQVVWRKSTRIGCARVVCAGNRGVFITCNYNPPGNFNGERPF  187



>ref|XP_006486819.1| PREDICTED: pathogenesis-related protein 1-like, partial [Citrus 
sinensis]
Length=154

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW +S ++GCAR++C NN G FVIC+Y PPGN  G+RPY
Sbjct  112  YTQVVWHNSVRLGCARVKCNNNRGTFVICSYDPPGNVAGKRPY  154



>ref|XP_008223670.1| PREDICTED: pathogenesis-related protein PR-1-like [Prunus mume]
Length=169

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWRS+ +VGCAR+ C    G F++CNY PPGNY+G+RPY
Sbjct  127  YTQIVWRSTRRVGCARVTCLGGRGVFMVCNYDPPGNYIGERPY  169



>ref|XP_004955945.1| PREDICTED: pathogenesis-related protein PRMS-like [Setaria italica]
Length=172

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR  C NN G F++CNYSP GN VGQ PY
Sbjct  130  YTQVVWRASTALGCARAVCSNNAGVFIVCNYSPRGNIVGQSPY  172



>sp|P35792.1|PR12_HORVU RecName: Full=Pathogenesis-related protein PRB1-2; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA81229.1| pathogenesis-related protein [Hordeum vulgare subsp. vulgare]
Length=164

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P GN VGQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNRGVFITCNYEPRGNIVGQKPY  164



>ref|XP_008455068.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis melo]
Length=162

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR +T +GC R++C NN   FVICNY+PPGNY+GQ PY
Sbjct  121  YTQIVWRHTTNIGCGRVKCENNW-VFVICNYNPPGNYIGQHPY  162



>ref|XP_008453637.1| PREDICTED: pathogenesis-related protein PR-1 [Cucumis melo]
Length=171

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWRS+ ++GCAR+ C +  G F+ CNY PPGNY+G RPY
Sbjct  129  YTQIVWRSTRRIGCARVTCNDGKGVFITCNYDPPGNYIGMRPY  171



>ref|XP_010558299.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Tarenaya 
hassleriana]
Length=189

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY*ST  140
            YTQVVWR++T VGCA I+C N  GY  +C Y+PPGNY G+RP+ +T
Sbjct  139  YTQVVWRTTTSVGCASIKCYNETGYLAVCEYNPPGNYEGERPFDAT  184



>ref|XP_004136922.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004169191.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 gb|KGN43827.1| hypothetical protein Csa_7G070235 [Cucumis sativus]
Length=161

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR +T +GC R++C NN   FVICNY+PPGNY+GQ PY
Sbjct  120  YTQIVWRHTTNIGCGRVKCENNW-VFVICNYNPPGNYIGQHPY  161



>gb|EMT00919.1| Pathogenesis-related protein PRB1-2 [Aegilops tauschii]
Length=248

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C  N G F+ CNY+PPGN+ G+RP+
Sbjct  122  YTQVVWRKSTRIGCARVVCTGNRGVFITCNYNPPGNFNGERPF  164



>ref|XP_010691519.1| PREDICTED: pathogenesis-related protein 1A-like [Beta vulgaris 
subsp. vulgaris]
Length=166

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR S ++GCAR+ C+N  G F+ CNY PPGNY+G+RPY
Sbjct  125  YTQVVWRESVRLGCARVLCKNG-GAFITCNYDPPGNYIGERPY  166



>ref|XP_007041425.1| Pathogenesis-related protein 1 [Theobroma cacao]
 gb|EOX97256.1| Pathogenesis-related protein 1 [Theobroma cacao]
Length=159

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST++GCAR++C N+  +FV CNY PPGNYVG+RPY
Sbjct  118  YTQVVWRNSTRLGCARVEC-NSGWWFVTCNYDPPGNYVGERPY  159



>ref|XP_009803803.1| PREDICTED: pathogenesis-related protein 1C-like [Nicotiana sylvestris]
Length=184

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCAR+QC N+ GY V CNY PPGN+VGQ PY
Sbjct  127  YTQVVWRNSVRVGCARVQC-NDGGYVVSCNYDPPGNFVGQSPY  168



>ref|XP_011092436.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST VGCAR++C N    FV CNY PPGNYVG+RPY
Sbjct  118  YTQVVWRGSTHVGCARVKCSNGW-TFVTCNYDPPGNYVGERPY  159



>gb|EEE54618.1| hypothetical protein OsJ_01863 [Oryza sativa Japonica Group]
Length=147

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST VGCAR++C  N G F+ICNY P GN VG+RPY
Sbjct  105  YTQVVWRDSTNVGCARVRCDANRGIFIICNYEPRGNIVGRRPY  147



>gb|ABK55610.1| pathogenesis-related protein PR1c [Oryza sativa Indica Group]
Length=167

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST VGCAR++C  N G F+ICNY P GN VG+RPY
Sbjct  125  YTQVVWRDSTNVGCARVRCDANRGVFIICNYEPRGNIVGRRPY  167



>ref|XP_004146301.1| PREDICTED: pathogenesis-related protein PR-1-like [Cucumis sativus]
 ref|XP_004171071.1| PREDICTED: pathogenesis-related protein PR-1-like [Cucumis sativus]
 gb|KGN65424.1| hypothetical protein Csa_1G420610 [Cucumis sativus]
Length=170

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWRS+ ++GCAR+ C +  G F+ CNY PPGNY+G RPY
Sbjct  128  YTQIVWRSTRRIGCARVTCNDGKGVFITCNYDPPGNYIGMRPY  170



>gb|KFE66075.1| SCP-like family protein [Hyalangium minutum]
Length=180

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 6/49 (12%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNN--LG----YFVICNYSPPGNYVGQRPY  131
            YTQ+VWRS+T+VGCAR QC  N  +G    +F +CNYSPPGNYVGQRPY
Sbjct  132  YTQIVWRSTTQVGCARAQCNQNSPIGTTPWWFWVCNYSPPGNYVGQRPY  180



>ref|NP_194309.1| allergen V5/Tpx-1-related family protein [Arabidopsis thaliana]
 emb|CAB39600.1| putative pathogenesis-related protein [Arabidopsis thaliana]
 emb|CAB79434.1| putative pathogenesis-related protein [Arabidopsis thaliana]
 gb|AAR24190.1| At4g25790 [Arabidopsis thaliana]
 gb|AAR92336.1| At4g25790 [Arabidopsis thaliana]
 gb|AEE85114.1| allergen V5/Tpx-1-related family protein [Arabidopsis thaliana]
Length=210

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG++PY
Sbjct  168  YTQIVWRETRRLGCARVVCENGAGVFITCNYDPPGNYVGEKPY  210



>ref|XP_006658251.1| PREDICTED: uncharacterized protein LOC102701282 [Oryza brachyantha]
Length=376

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C  NLG F+ICNYSP GN  GQ PY
Sbjct  334  YTQVVWRRSTAIGCARVVCNGNLGVFIICNYSPAGNIRGQSPY  376



>emb|CDY10431.1| BnaCnng03320D [Brassica napus]
Length=186

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ++WR++T VGCAR++C N LG+ V+C YSP GNY G+ P+
Sbjct  140  YTQIIWRTTTAVGCARVKCDNELGFLVVCEYSPGGNYDGESPF  182



>gb|ACJ62494.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GC R+ C NN G F+IC+Y+PPGN VG+ PY
Sbjct  115  YTQVVWRDSTAIGCVRVVCDNNAGVFIICSYNPPGNVVGESPY  157



>gb|AAZ94266.1| pathogenesis-related 1b [Triticum monococcum]
Length=164

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P G +VGQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNRGVFITCNYEPAGMFVGQKPY  164



>sp|Q05968.1|PR1_HORVU RecName: Full=Pathogenesis-related protein 1; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA79703.1| Pathogenesis-related protein 1 [Hordeum vulgare]
Length=164

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+ST +GCAR+ C NN G F+ CNY P GN +GQ+PY
Sbjct  122  YTQVVWRASTSIGCARVVCNNNRGVFITCNYEPRGNIIGQKPY  164



>ref|XP_007199066.1| hypothetical protein PRUPE_ppa018679mg [Prunus persica]
 gb|EMJ00265.1| hypothetical protein PRUPE_ppa018679mg [Prunus persica]
Length=145

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCA+++C NN G F+ CNY PPGNYVGQ+PY
Sbjct  104  YTQVVWRNSARVGCAKVRC-NNGGTFIGCNYDPPGNYVGQKPY  145



>emb|CAA30017.1| unnamed protein product [Nicotiana tabacum]
Length=168

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCAR+QC NN GY V CNY PPGNY G+ PY
Sbjct  127  YTQVVWRNSVRVGCARVQC-NNGGYVVTCNYDPPGNYRGESPY  168



>ref|XP_009122760.1| PREDICTED: pathogenesis-related protein PRB1-3 [Brassica rapa]
Length=186

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ++WR++T VGCAR++C N LG+ V+C YSP GNY G+ P+
Sbjct  140  YTQIIWRTTTAVGCARVKCDNELGFLVVCEYSPGGNYDGESPF  182



>ref|XP_008796970.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C N+   F+IC+Y PPGN+VGQRPY
Sbjct  121  YTQVVWRDSTNIGCARVTC-NSGAIFIICDYKPPGNFVGQRPY  162



>ref|XP_008455064.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Cucumis 
melo]
Length=164

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCA+++C NN G F+ICNY P GN +GQ+PY
Sbjct  122  YTQVVWRNSVRIGCAKVRCTNNRGTFIICNYEPRGNIIGQKPY  164



>ref|XP_008796972.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR++C N+   F+ICNY PPGN VGQRPY
Sbjct  121  YTQVVWRDSTNIGCARVKC-NSGAIFIICNYKPPGNIVGQRPY  162



>ref|XP_010525741.1| PREDICTED: pathogenesis-related protein PR-1 [Tarenaya hassleriana]
Length=167

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ++WR + ++GCAR+ C   LG F+ICNY PPGN++G+RPY
Sbjct  125  YTQIMWRETRRIGCARVLCDGGLGVFIICNYDPPGNFLGRRPY  167



>ref|XP_002867590.1| hypothetical protein ARALYDRAFT_492241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43849.1| hypothetical protein ARALYDRAFT_492241 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG++PY
Sbjct  166  YTQIVWRETRRLGCARVVCENGAGVFITCNYDPPGNYVGEKPY  208



>emb|CDX70351.1| BnaA10g27000D [Brassica napus]
Length=186

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ++WR++T VGCAR++C N LG+ V+C YSP GNY G+ P+
Sbjct  140  YTQIIWRTTTAVGCARVKCDNELGFLVVCEYSPGGNYDGESPF  182



>ref|XP_009139534.1| PREDICTED: pathogenesis-related protein PR-1 [Brassica rapa]
 emb|CDX94415.1| BnaC01g17690D [Brassica napus]
Length=209

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG+ PY
Sbjct  167  YTQIVWRDTKRIGCARVVCENGAGVFITCNYDPPGNYVGENPY  209



>ref|XP_010483291.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=205

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG++PY
Sbjct  163  YTQMVWRDTKRLGCARVVCENGAGVFITCNYDPPGNYVGEKPY  205



>ref|XP_010943479.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C N  G F+ CNY PPGN+VGQRPY
Sbjct  121  YTQVVWRDSTNIGCARVVCDNG-GIFITCNYYPPGNFVGQRPY  162



>ref|XP_006281936.1| hypothetical protein CARUB_v10028144mg [Capsella rubella]
 gb|EOA14834.1| hypothetical protein CARUB_v10028144mg [Capsella rubella]
Length=205

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG++PY
Sbjct  163  YTQMVWRDTKRLGCARVVCENGAGVFITCNYDPPGNYVGEKPY  205



>ref|XP_004170276.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=162

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR +  VGCAR++C NN   FVICNY PPGNYVGQ PY
Sbjct  121  YTQVVWRGTKHVGCARVKCHNNW-IFVICNYDPPGNYVGQFPY  162



>ref|XP_010443455.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=205

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG++PY
Sbjct  163  YTQMVWRDTKRLGCARVVCENGAGVFITCNYDPPGNYVGEKPY  205



>ref|XP_006657422.1| PREDICTED: pathogenesis-related protein 1-like [Oryza brachyantha]
Length=177

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW +ST++GCA + C NNLG F+ CNYSPPGN  G+ PY
Sbjct  135  YTQVVWSNSTEIGCAGVVCDNNLGVFITCNYSPPGNVDGESPY  177



>ref|XP_010088980.1| hypothetical protein L484_013560 [Morus notabilis]
 gb|EXB37195.1| hypothetical protein L484_013560 [Morus notabilis]
Length=171

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCA+++C N+ G FVICNY+PPGNY+GQ PY
Sbjct  123  YTQVVWRDSTRLGCAKVRC-NSGGSFVICNYNPPGNYIGQWPY  164



>ref|XP_010452554.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=205

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG++PY
Sbjct  163  YTQMVWRDTKRLGCARVVCENGAGVFITCNYDPPGNYVGEKPY  205



>gb|ABC86704.1| putative pathogenesis-related protein 1 [Coffea arabica]
Length=59

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR +T++GCAR+ C    G F+ CNY+PPGNY+G+RPY
Sbjct  17   YTQIVWRQTTRIGCARVTCFGGRGVFMTCNYNPPGNYIGERPY  59



>ref|XP_010943469.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR+ C N  G F+ CNY PPGN+VGQRPY
Sbjct  121  YTQVVWRDSTSIGCARVVCDNG-GIFITCNYYPPGNFVGQRPY  162



>ref|XP_003593361.1| Pathogenesis-related protein 1a [Medicago truncatula]
 gb|AES63612.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=165

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++ ++GCA+++C NN G F+ CNY PPGNY+G+RPY
Sbjct  124  YTQVVWRNTQRIGCAKVKC-NNGGTFITCNYDPPGNYIGERPY  165



>emb|CAN68901.1| hypothetical protein VITISV_019988 [Vitis vinifera]
Length=150

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S  +GCAR QC NN  +F+ICNY PPGNY+GQRPY
Sbjct  109  YTQVVWRNSVSLGCARAQC-NNGWWFIICNYYPPGNYIGQRPY  150



>gb|KDP43811.1| hypothetical protein JCGZ_23019 [Jatropha curcas]
Length=171

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR +T+VGCAR+ C    G F+ CNY PPGNY+G+RPY
Sbjct  129  YTQIVWRRTTRVGCARVNCFGGRGVFMTCNYDPPGNYIGERPY  171



>ref|XP_008455062.1| PREDICTED: pathogenesis-related protein 1-like [Cucumis melo]
Length=163

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW++S ++GCA+++CRN  G F++CNY P GN VGQRPY
Sbjct  121  YTQVVWKNSVRLGCAKVKCRNKGGVFIVCNYDPRGNIVGQRPY  163



>gb|AEL99925.1| pathogenesis-related protein 1 [Nicotiana benthamiana]
Length=160

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCAR+QC NN GY V CNY PPGNY G+ PY
Sbjct  119  YTQVVWRNSVRVGCARVQC-NNGGYVVSCNYDPPGNYRGESPY  160



>ref|XP_008455071.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis melo]
Length=161

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR +  VGCAR++C NN   FVICNY PPGNYVGQ PY
Sbjct  120  YTQVVWRGTKHVGCARVKCHNNW-IFVICNYDPPGNYVGQFPY  161



>ref|XP_008657154.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Zea mays]
 tpg|DAA45852.1| TPA: hypothetical protein ZEAMMB73_931706 [Zea mays]
Length=179

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST++GCAR+ C +N G F++C+Y PPGN  GQRP+
Sbjct  129  YTQVVWRRSTRIGCARVVCADNRGVFIVCSYDPPGNVNGQRPF  171



>emb|CAA31008.1| PR1a preprotein [Nicotiana tabacum]
Length=165

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCAR+QC NN GY V CNY PPGNY G+ PY
Sbjct  124  YTQVVWRNSVRVGCARVQC-NNGGYVVSCNYDPPGNYRGESPY  165



>ref|XP_003545771.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Glycine 
max]
 gb|KHN33605.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=164

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S ++GCA+++C NN G F+ CNY+PPGNY+GQRPY
Sbjct  123  YTQVVWRNSLRLGCAKVRC-NNGGTFIGCNYAPPGNYIGQRPY  164



>gb|KDP37603.1| hypothetical protein JCGZ_06946 [Jatropha curcas]
Length=157

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW SS +VGCA+++C N  G FV CNY PPGNYVGQ+PY
Sbjct  116  YTQVVWSSSVRVGCAKVRCSNG-GTFVTCNYDPPGNYVGQKPY  157



>ref|NP_680450.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Arabidopsis thaliana]
 dbj|BAB08798.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO29948.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP13357.1| At5g57625 [Arabidopsis thaliana]
 dbj|BAE99181.1| pathogenesis-related protein - like [Arabidopsis thaliana]
 gb|AED96927.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Arabidopsis thaliana]
Length=207

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG++PY
Sbjct  165  YTQMVWRDTKRLGCARVVCENGAGVFITCNYDPPGNYVGEKPY  207



>ref|XP_010941969.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST +GCAR++C N+   F+ICNY PPGN VGQRPY
Sbjct  121  YTQVVWRDSTHIGCARVKC-NSGAIFIICNYKPPGNIVGQRPY  162



>gb|ACJ62587.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN  G +PY
Sbjct  125  YTQVVWRATTSIGCARVVCRDNRGVFIICNYEPRGNIAGMKPY  167



>gb|ACJ62553.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN  G +PY
Sbjct  125  YTQVVWRATTSIGCARVVCRDNRGVFIICNYEPRGNIAGMKPY  167



>ref|NP_001140745.1| uncharacterized protein LOC100272820 precursor [Zea mays]
 gb|ABA34020.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACF84524.1| unknown [Zea mays]
 gb|ACJ62545.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62546.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62548.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62550.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62551.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62555.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62556.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62558.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62565.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62567.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62578.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62606.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62608.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62609.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62610.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|AFW80798.1| pathogeneis protein1 [Zea mays]
Length=167

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN  G +PY
Sbjct  125  YTQVVWRATTSIGCARVVCRDNRGVFIICNYEPRGNIAGMKPY  167



>ref|XP_002274307.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=161

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW +S ++GCAR+QC NN  +FV CNY PPGNYVGQRPY
Sbjct  120  YTQVVWSNSVRLGCARVQC-NNGWWFVTCNYDPPGNYVGQRPY  161



>ref|XP_006413271.1| hypothetical protein EUTSA_v10026254mg [Eutrema salsugineum]
 gb|ESQ54724.1| hypothetical protein EUTSA_v10026254mg [Eutrema salsugineum]
Length=207

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWR + ++GCAR+ C N  G F+ CNY PPGNYVG+ PY
Sbjct  165  YTQIVWRDTKRLGCARVVCENGAGVFITCNYDPPGNYVGENPY  207



>gb|ACJ62589.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN  G +PY
Sbjct  125  YTQVVWRATTSIGCARVVCRDNRGVFIICNYEPRGNIAGMKPY  167



>gb|ACJ62559.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN  G +PY
Sbjct  125  YTQVVWRATTSIGCARVVCRDNRGVFIICNYEPRGNIAGMKPY  167



>ref|XP_011092435.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR ST VGCA+++C N    FV CNY PPGNYVG+RPY
Sbjct  118  YTQVVWRGSTHVGCAKVKCANGWA-FVSCNYDPPGNYVGERPY  159



>sp|P08299.1|PR1A_TOBAC RecName: Full=Pathogenesis-related protein 1A; Short=PR-1A; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA31233.1| unnamed protein product [Nicotiana tabacum]
 emb|CAA29392.1| PR-1a precursor (AA -30 to 138) [Nicotiana tabacum]
 emb|CAA29660.1| PR1a precursor (AA -30 to -1) [Nicotiana tabacum]
Length=168

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCAR+QC NN GY V CNY PPGNY G+ PY
Sbjct  127  YTQVVWRNSVRVGCARVQC-NNGGYVVSCNYDPPGNYRGESPY  168



>gb|ABA34011.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN  G +PY
Sbjct  125  YTQVVWRATTSIGCARVVCRDNRGVFIICNYEPRGNIAGMKPY  167



>ref|XP_006486832.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Citrus 
sinensis]
Length=164

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCAR+QC N   +FV C+Y PPGNY+GQ+PY
Sbjct  123  YTQVVWRNSIRVGCARVQCSNGW-WFVTCSYDPPGNYIGQKPY  164



>ref|XP_006422718.1| hypothetical protein CICLE_v10029873mg [Citrus clementina]
 gb|ESR35958.1| hypothetical protein CICLE_v10029873mg [Citrus clementina]
 gb|KDO37560.1| hypothetical protein CISIN_1g048073mg [Citrus sinensis]
Length=164

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR+S +VGCAR+QC N   +FV C+Y PPGNY+GQ+PY
Sbjct  123  YTQVVWRNSIRVGCARVQCSNGW-WFVTCSYDPPGNYIGQKPY  164



>ref|XP_009397726.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Musa acuminata 
subsp. malaccensis]
Length=240

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVW+++T +GCAR QC +  G F++C+YSP GN VGQRPY
Sbjct  171  YTQVVWQNTTAIGCARTQCSDGNGIFILCDYSPAGNLVGQRPY  213



>ref|XP_010688504.1| PREDICTED: pathogenesis-related protein PR-1-like [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQ+VWRSS ++GCA++ C N  G F+ CNY PPGNY+G RPY
Sbjct  139  YTQIVWRSSRRIGCAKVVCYNGRGVFITCNYDPPGNYIGSRPY  181



>gb|ABA34014.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=168

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN  G +PY
Sbjct  126  YTQVVWRATTSIGCARVVCRDNRGVFIICNYEPRGNIAGMKPY  168



>gb|ACJ62562.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN  G +PY
Sbjct  125  YTQVVWRATTSIGCARVVCRDNRGVFIICNYEPRGNIAGMKPY  167



>sp|Q00008.1|PRMS_MAIZE RecName: Full=Pathogenesis-related protein PRMS; Flags: Precursor 
[Zea mays]
 emb|CAA38223.1| pathogenesis-related protein [Zea mays]
 gb|ABA34008.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34009.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34010.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34012.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34013.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34015.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34016.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34017.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34018.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34019.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34021.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34022.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34023.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34030.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ACJ62542.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62543.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62547.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62549.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62552.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62557.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62560.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62561.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62563.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62564.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62566.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62568.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62569.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62570.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62571.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62572.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62574.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62576.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62577.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62579.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62580.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62581.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62582.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62583.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62584.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62585.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62586.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62588.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62590.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62591.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62592.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62593.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62594.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62595.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62596.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62598.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62599.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62600.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62601.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62602.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62605.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62607.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62611.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62612.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62613.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62614.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62615.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62616.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62617.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62618.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62619.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62620.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62621.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62622.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62623.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    YTQVVWRSSTKVGCARIQCRNNLGYFVICNYSPPGNYVGQRPY  131
            YTQVVWR++T +GCAR+ CR+N G F+ICNY P GN  G +PY
Sbjct  125  YTQVVWRATTSIGCARVVCRDNRGVFIICNYEPRGNIAGMKPY  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522235234356