BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8387_g1_i1 len=419 path=[1:0-418]

Length=419
                                                                      Score     E

ref|XP_010941969.1|  PREDICTED: pathogenesis-related protein PRB1...    127   5e-34   
sp|Q41359.1|PR1_SAMNI  RecName: Full=Pathogenesis-related protein...    127   6e-34   Sambucus nigra
ref|XP_010943450.1|  PREDICTED: pathogenesis-related protein PR-1...    126   1e-33   
ref|XP_002522065.1|  STS14 protein precursor, putative                  125   2e-33   Ricinus communis
ref|XP_008798890.1|  PREDICTED: pathogenesis-related protein PR-1...    124   8e-33   
ref|XP_011092473.1|  PREDICTED: pathogenesis-related leaf protein...    124   1e-32   
ref|XP_010941968.1|  PREDICTED: pathogenesis-related protein PRB1...    123   2e-32   
ref|XP_011002601.1|  PREDICTED: pathogenesis-related protein 1-like     121   9e-32   
ref|XP_010941967.1|  PREDICTED: pathogenesis-related protein PRB1...    121   1e-31   
ref|XP_008796972.1|  PREDICTED: pathogenesis-related protein PRB1...    121   1e-31   
gb|AHE81252.1|  pathogenesis-related protein 1-9                        121   1e-31   
ref|XP_006379156.1|  pathogenesis-related family protein                121   1e-31   
gb|AEH25624.1|  pathogenesis-related protein 1-9                        121   2e-31   
gb|AHE81273.1|  pathogenesis-related protein 1-9                        121   2e-31   
gb|EMT11012.1|  Pathogenesis-related protein PRMS                       121   2e-31   
ref|XP_010270273.1|  PREDICTED: pathogenesis-related leaf protein...    121   2e-31   
ref|XP_008798894.1|  PREDICTED: pathogenesis-related protein PRB1...    120   5e-31   
ref|XP_009388942.1|  PREDICTED: pathogenesis-related protein 1-like     119   5e-31   
gb|ABK94784.1|  unknown                                                 119   6e-31   Populus trichocarpa [western balsam poplar]
emb|CAA36790.1|  unnamed protein product                                120   7e-31   Nicotiana tabacum [American tobacco]
ref|NP_001234314.1|  pathogenesis-related leaf protein 6 precursor      119   7e-31   
gb|EMS62872.1|  Pathogenesis-related protein PRMS                       119   8e-31   
ref|XP_009803803.1|  PREDICTED: pathogenesis-related protein 1C-like    120   8e-31   
ref|NP_001234523.1|  pathogenesis-related leaf protein 4 precursor      118   1e-30   
gb|KDP35900.1|  hypothetical protein JCGZ_09872                         118   1e-30   
dbj|BAF03626.1|  pathogenesis related protein 1                         118   1e-30   Eutrema japonicum [wasabe]
gb|KFK39972.1|  hypothetical protein AALP_AA3G313200                    118   2e-30   
ref|XP_010691524.1|  PREDICTED: pathogenesis-related protein PR-1...    118   2e-30   
pdb|1CFE|A  Chain A, P14a, Nmr, 20 Structures                           117   2e-30   
gb|ABA41593.1|  pathogenesis-related protein                            117   2e-30   Solanum lycopersicum
ref|XP_010942046.1|  PREDICTED: uncharacterized protein LOC105060136    121   3e-30   
emb|CAA70070.1|  PR protein                                             118   3e-30   Solanum lycopersicum
gb|KGN48339.1|  hypothetical protein Csa_6G483242                       117   3e-30   
gb|KDP37611.1|  hypothetical protein JCGZ_06954                         117   3e-30   
ref|XP_009388943.1|  PREDICTED: pathogenesis-related protein 1-like     117   4e-30   
emb|CAN77102.1|  hypothetical protein VITISV_021166                     117   4e-30   Vitis vinifera
prf||1202235B  protein p14,pathogenesis related                         116   5e-30
ref|XP_002273788.2|  PREDICTED: pathogenesis-related protein 1          118   5e-30   Vitis vinifera
gb|KDP37612.1|  hypothetical protein JCGZ_06955                         116   5e-30   
ref|XP_004246724.1|  PREDICTED: pathogenesis-related leaf protein 4     117   6e-30   
emb|CAD38276.1|  pathogenesis related protein isoform b1                117   6e-30   Solanum phureja [chaucha]
gb|AAQ19681.1|  cytoplasmic small heat shock protein class I            117   6e-30   Capsicum frutescens [bird pepper]
gb|AEZ52390.1|  pathogenesis-related protein 1                          117   7e-30   
gb|AAX20041.1|  cytoplasmic small heat shock protein class I            116   7e-30   Capsicum annuum
gb|ABK41053.2|  pathogenesis-related protein 1                          116   8e-30   Musa acuminata [banana]
ref|XP_004955412.1|  PREDICTED: pathogenesis-related protein PRB1...    116   8e-30   
ref|NP_001234358.1|  PR1 protein precursor                              117   8e-30   
ref|XP_006409651.1|  hypothetical protein EUTSA_v10022890mg             116   9e-30   
emb|CAB58263.1|  pathogenesis related protein PR-1                      116   9e-30   Solanum tuberosum [potatoes]
gb|EAY95187.1|  hypothetical protein OsI_17005                          115   9e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_004955414.1|  PREDICTED: pathogenesis-related protein 1-like     116   9e-30   
emb|CDO97323.1|  unnamed protein product                                116   1e-29   
dbj|BAF95881.1|  putative pathogenesis-related protein 1                116   1e-29   Vitis hybrid cultivar
emb|CAD38277.1|  pathogenesis related protein isoform b2                116   1e-29   Solanum phureja [chaucha]
gb|KDP36353.1|  hypothetical protein JCGZ_09850                         116   1e-29   
gb|AEJ88253.1|  putative pathogenesis-related protein 1                 116   1e-29   
ref|XP_003606006.1|  Maturase K                                         123   2e-29   
gb|KDP37603.1|  hypothetical protein JCGZ_06946                         115   2e-29   
ref|NP_001275095.1|  pathogenesis-related protein 1b precursor          115   2e-29   
gb|KDP37606.1|  hypothetical protein JCGZ_06949                         115   2e-29   
ref|XP_002313935.2|  hypothetical protein POPTR_0009s08660g             115   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_006422719.1|  hypothetical protein CICLE_v10029950mg             115   2e-29   
ref|XP_009610821.1|  PREDICTED: pathogenesis-related protein 1B         115   3e-29   
emb|CAA31009.1|  PR1b preprotein                                        115   3e-29   Nicotiana tabacum [American tobacco]
ref|XP_004138862.1|  PREDICTED: basic form of pathogenesis-relate...    115   3e-29   
emb|CAA29022.1|  PR-1b protein                                          115   3e-29   Nicotiana tabacum [American tobacco]
ref|XP_010691525.1|  PREDICTED: pathogenesis-related protein 1A-like    115   3e-29   
ref|XP_002459696.1|  hypothetical protein SORBIDRAFT_02g008970          115   3e-29   Sorghum bicolor [broomcorn]
ref|NP_179068.1|  pathogenesis-related protein 1                        115   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004246723.1|  PREDICTED: pathogenesis-related leaf protein...    115   3e-29   
gb|ABK28181.1|  unknown                                                 115   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002274105.1|  PREDICTED: pathogenesis-related leaf protein 6     115   3e-29   Vitis vinifera
ref|XP_008796970.1|  PREDICTED: pathogenesis-related protein PRB1...    115   3e-29   
emb|CAA31010.1|  PR1c preprotein                                        115   4e-29   Nicotiana tabacum [American tobacco]
ref|XP_009769213.1|  PREDICTED: pathogenesis-related protein 1C         115   4e-29   
ref|XP_009605825.1|  PREDICTED: pathogenesis-related protein 1B-like    115   4e-29   
gb|ADN43435.1|  pathogenesis-related protein 1                          115   4e-29   
gb|AAL84768.1|AF475286_1  pathogenesis-related protein 1-1a             114   4e-29   Cucumis sativus [cucumbers]
gb|AAK30143.1|AF348141_1  pathogenesis-related protein PR-1 precu...    115   4e-29   Capsicum annuum
ref|XP_004168739.1|  PREDICTED: basic form of pathogenesis-relate...    114   4e-29   
gb|AHA56682.1|  pathogenesis related protein                            114   4e-29   
gb|AFK93503.1|  pathogenesis related protein 1 isoform 4                115   4e-29   
emb|CAA29023.1|  PR-1c protein                                          114   4e-29   Nicotiana tabacum [American tobacco]
ref|XP_010527028.1|  PREDICTED: pathogenesis-related protein PR-1...    114   6e-29   
emb|CAA31008.1|  PR1a preprotein                                        114   6e-29   Nicotiana tabacum [American tobacco]
ref|XP_006367091.1|  PREDICTED: basic form of pathogenesis-relate...    115   6e-29   
dbj|BAA14220.1|  PR1a protein precursor                                 114   7e-29   Nicotiana tabacum [American tobacco]
ref|XP_010943437.1|  PREDICTED: pathogenesis-related protein 1B-like    115   7e-29   
gb|AAB06458.1|  pathogenesis-related protein PR1                        114   7e-29   Brassica napus [oilseed rape]
ref|XP_009798466.1|  PREDICTED: pathogenesis-related protein 1A         114   8e-29   
gb|KDP37607.1|  hypothetical protein JCGZ_06950                         114   8e-29   
gb|EEC81457.1|  hypothetical protein OsI_24759                          114   8e-29   Oryza sativa Indica Group [Indian rice]
gb|AEL99925.1|  pathogenesis-related protein 1                          114   8e-29   
dbj|BAD11072.1|  pathogenesis-related protein 1                         114   8e-29   Capsicum chinense [bonnet pepper]
ref|XP_010691521.1|  PREDICTED: pathogenesis-related protein PR-1...    114   8e-29   
sp|P08299.1|PR1A_TOBAC  RecName: Full=Pathogenesis-related protei...    114   8e-29   Nicotiana tabacum [American tobacco]
ref|XP_006422707.1|  hypothetical protein CICLE_v10030029mg             114   9e-29   
ref|XP_010065847.1|  PREDICTED: basic form of pathogenesis-relate...    113   1e-28   
ref|XP_004168740.1|  PREDICTED: basic form of pathogenesis-relate...    113   1e-28   
ref|XP_006644187.1|  PREDICTED: pathogenesis-related protein PRB1...    114   1e-28   
ref|XP_009787159.1|  PREDICTED: basic form of pathogenesis-relate...    114   1e-28   
gb|ACN52596.1|  pathogenesis-related protein                            112   1e-28   Pyrus x bretschneideri [bai li]
dbj|BAL63013.1|  pathogenesis-related protein 1-1a                      112   1e-28   
gb|AAZ94265.1|  pathogenesis-related 1a                                 114   1e-28   Triticum monococcum [einkorn wheat]
ref|XP_009398310.1|  PREDICTED: pathogenesis-related protein 1-like     113   1e-28   
gb|EMT32398.1|  Pathogenesis-related protein PRMS                       114   1e-28   
ref|XP_004968783.1|  PREDICTED: pathogenesis-related protein PRMS...    113   2e-28   
gb|AEH25634.1|  pathogenesis-related protein 1-19                       113   2e-28   
ref|XP_002313936.2|  pathogenesis-related family protein                113   2e-28   Populus trichocarpa [western balsam poplar]
gb|AEX55228.1|  pathogenesis-related protein 1                          113   2e-28   
ref|XP_010053002.1|  PREDICTED: basic form of pathogenesis-relate...    113   2e-28   
gb|AAF78528.1|AF195237_1  pathogenesis-related protein                  112   2e-28   Pyrus pyrifolia [sha li]
gb|AFM76999.1|  pathogenesis related protein 1a                         112   2e-28   
emb|CDO97325.1|  unnamed protein product                                112   2e-28   
ref|XP_006367092.1|  PREDICTED: basic form of pathogenesis-relate...    113   3e-28   
ref|XP_006486819.1|  PREDICTED: pathogenesis-related protein 1-like     112   3e-28   
gb|EAZ02649.1|  hypothetical protein OsI_24760                          112   3e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_002274275.1|  PREDICTED: basic form of pathogenesis-relate...    112   3e-28   Vitis vinifera
ref|XP_008346349.1|  PREDICTED: pathogenesis-related protein 1-like     112   3e-28   
gb|AHE81280.1|  pathogenesis-related protein 1-16                       112   3e-28   
gb|AHE81259.1|  pathogenesis-related protein 1-16                       112   3e-28   
gb|AEH25631.1|  pathogenesis-related protein 1-16                       112   3e-28   
ref|XP_009342365.1|  PREDICTED: pathogenesis-related protein 1-like     112   3e-28   
gb|AEH25622.1|  pathogenesis-related protein 1-7                        112   4e-28   
gb|ADN43436.1|  pathogenesis-related protein 1                          112   4e-28   
gb|ABK55610.1|  pathogenesis-related protein PR1c                       112   4e-28   Oryza sativa Indica Group [Indian rice]
gb|AAT46023.1|  pathogenesis-related protein 1                          112   5e-28   Brassica rapa
ref|XP_010691519.1|  PREDICTED: pathogenesis-related protein 1A-like    112   5e-28   
gb|AFK37568.1|  unknown                                                 112   5e-28   
emb|CAA65420.1|  pathogenesis-related protein 1                         112   5e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CAA30017.1|  unnamed protein product                                112   5e-28   Nicotiana tabacum [American tobacco]
ref|NP_001058815.1|  Os07g0129200                                       112   5e-28   Oryza sativa Japonica Group [Japonica rice]
gb|KDP37604.1|  hypothetical protein JCGZ_06947                         112   6e-28   
gb|AAG44566.1|AF251277_1  acidic PR-1 type pathogenesis-related p...    112   6e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAF62171.1|  pathogenesis-related protein 1                          110   6e-28   Betula pendula [white birch]
ref|XP_004504945.1|  PREDICTED: basic form of pathogenesis-relate...    111   7e-28   
ref|XP_010052995.1|  PREDICTED: basic form of pathogenesis-relate...    111   7e-28   
ref|XP_009605696.1|  PREDICTED: basic form of pathogenesis-relate...    112   7e-28   
ref|XP_009342367.1|  PREDICTED: pathogenesis-related protein PR-1...    111   7e-28   
gb|ADN43431.1|  pathogenesis-related protein 1                          111   8e-28   
ref|XP_008651988.1|  PREDICTED: pathogenesis-related protein PRB1...    111   8e-28   
gb|AFK35640.1|  unknown                                                 112   8e-28   
emb|CAN68901.1|  hypothetical protein VITISV_019988                     111   8e-28   Vitis vinifera
ref|XP_003593453.1|  Pathogenesis-related protein 1a                    112   8e-28   
ref|XP_010252392.1|  PREDICTED: basic form of pathogenesis-relate...    111   8e-28   
ref|XP_006299028.1|  hypothetical protein CARUB_v10015165mg             111   8e-28   
ref|XP_006486820.1|  PREDICTED: pathogenesis-related protein 1-like     111   8e-28   
ref|XP_009378592.1|  PREDICTED: pathogenesis-related protein PR-1...    111   9e-28   
emb|CAA47374.1|  prb-1b                                                 112   9e-28   Nicotiana tabacum [American tobacco]
gb|ADN43432.1|  pathogenesis-related protein 1                          111   9e-28   
gb|ADN43437.1|  pathogenesis-related protein 1                          111   9e-28   
dbj|BAK01044.1|  predicted protein                                      111   9e-28   
gb|KGN62935.1|  hypothetical protein Csa_2G381130                       115   1e-27   
ref|NP_001058816.1|  Os07g0129300                                       111   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010054710.1|  PREDICTED: pathogenesis-related leaf protein...    112   1e-27   
ref|XP_006368144.1|  PREDICTED: pathogenesis-related protein 1C-like    110   1e-27   
gb|ADN43417.1|  pathogenesis-related protein 1                          110   1e-27   
gb|AFK64734.1|  pathogenesis related protein 1a                         110   1e-27   
gb|KCW63548.1|  hypothetical protein EUGRSUZ_G01181                     110   1e-27   
gb|KDP37600.1|  hypothetical protein JCGZ_06943                         110   1e-27   
ref|XP_006422714.1|  hypothetical protein CICLE_v10029431mg             110   1e-27   
ref|XP_006345692.1|  PREDICTED: pathogenesis-related leaf protein...    110   1e-27   
gb|EEE54618.1|  hypothetical protein OsJ_01863                          110   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002436405.1|  hypothetical protein SORBIDRAFT_10g001940          110   2e-27   Sorghum bicolor [broomcorn]
ref|XP_010065853.1|  PREDICTED: basic form of pathogenesis-relate...    110   2e-27   
ref|NP_001043091.1|  Os01g0382400                                       110   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EMS56527.1|  Pathogenesis-related protein PRMS                       110   2e-27   
ref|XP_006486833.1|  PREDICTED: pathogenesis-related leaf protein...    110   2e-27   
gb|ACU15426.1|  unknown                                                 110   2e-27   Glycine max [soybeans]
gb|ADN43415.1|  pathogenesis-related protein 1                          110   2e-27   
ref|XP_008372941.1|  PREDICTED: pathogenesis-related leaf protein...    110   2e-27   
ref|XP_010904557.1|  PREDICTED: pathogenesis-related protein 1-like     110   2e-27   
ref|XP_008652242.1|  PREDICTED: pathogenesis-related protein 1-like     110   2e-27   
ref|XP_003545771.1|  PREDICTED: pathogenesis-related protein PR-1...    110   2e-27   
gb|EMT01155.1|  Pathogenesis-related protein PRMS                       109   2e-27   
gb|AEH25629.1|  pathogenesis-related protein 1-14                       110   2e-27   
ref|XP_007041425.1|  Pathogenesis-related protein 1                     110   2e-27   
gb|AAB05225.1|  pathogenesis-related protein-1                          110   2e-27   Nicotiana glutinosa
ref|XP_006367103.1|  PREDICTED: basic form of pathogenesis-relate...    108   2e-27   
ref|XP_002265050.1|  PREDICTED: basic form of pathogenesis-relate...    110   3e-27   Vitis vinifera
gb|ADB54823.1|  pathogenesis-related protein 1                          110   3e-27   Vitis pseudoreticulata
ref|XP_008454501.1|  PREDICTED: basic form of pathogenesis-relate...    110   3e-27   
ref|XP_010488899.1|  PREDICTED: pathogenesis-related protein 1          110   3e-27   
ref|XP_006486822.1|  PREDICTED: pathogenesis-related protein 1-like     110   3e-27   
ref|XP_004152970.1|  PREDICTED: basic form of pathogenesis-relate...    110   3e-27   
ref|NP_001043089.1|  Os01g0382000                                       110   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007148301.1|  hypothetical protein PHAVU_006G196900g             110   3e-27   
gb|AEH25633.1|  pathogenesis-related protein 1-18                       110   3e-27   
ref|XP_002522071.1|  STS14 protein precursor, putative                  110   3e-27   Ricinus communis
ref|XP_006848057.1|  hypothetical protein AMTR_s00029p00197310          110   3e-27   
gb|ADN43428.1|  pathogenesis-related protein 1                          109   4e-27   
ref|XP_009136246.1|  PREDICTED: pathogenesis-related protein 1-like     109   4e-27   
gb|ADN43427.1|  pathogenesis-related protein 1                          109   4e-27   
gb|AGS80328.1|  pathogenesis-related protein 1                          110   4e-27   
gb|ADN43434.1|  pathogenesis-related protein 1                          109   4e-27   
gb|ADN43419.1|  pathogenesis-related protein 1                          109   4e-27   
gb|ADN43418.1|  pathogenesis-related protein 1                          109   4e-27   
gb|ADN43416.1|  pathogenesis-related protein 1                          109   4e-27   
ref|XP_002273416.1|  PREDICTED: basic form of pathogenesis-relate...    109   4e-27   Vitis vinifera
ref|XP_004138861.1|  PREDICTED: basic form of pathogenesis-relate...    109   4e-27   
ref|XP_006368156.1|  PREDICTED: basic form of pathogenesis-relate...    108   4e-27   
gb|ADB54822.1|  pathogenesis-related protein 1                          110   4e-27   Vitis pseudoreticulata
emb|CDX93140.1|  BnaA03g38620D                                          109   4e-27   
ref|XP_008798895.1|  PREDICTED: pathogenesis-related protein 1-like     109   4e-27   
ref|XP_010065833.1|  PREDICTED: pathogenesis-related protein 1-like     109   4e-27   
ref|XP_010517589.1|  PREDICTED: pathogenesis-related protein 1-like     109   4e-27   
gb|AEM36335.1|  pathogenesis-related protein                            109   5e-27   
gb|AFM77011.1|  pathogenesis related protein 1a                         109   5e-27   
ref|XP_008370577.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    109   6e-27   
gb|AGK89727.1|  pathogenesis-related 1 protein                          109   6e-27   
ref|XP_010252393.1|  PREDICTED: basic form of pathogenesis-relate...    109   6e-27   
gb|ADN43433.1|  pathogenesis-related protein 1                          108   7e-27   
emb|CAA88618.1|  type-1 pathogenesis-related protein                    109   7e-27   Hordeum vulgare [barley]
dbj|BAN09077.1|  pathogenesis related protein-1.2                       109   7e-27   
sp|P11670.1|PRB1_TOBAC  RecName: Full=Basic form of pathogenesis-...    109   7e-27   Nicotiana tabacum [American tobacco]
ref|XP_002274307.1|  PREDICTED: pathogenesis-related leaf protein 6     108   8e-27   Vitis vinifera
gb|KDP37598.1|  hypothetical protein JCGZ_06941                         108   8e-27   
emb|CDP12737.1|  unnamed protein product                                108   8e-27   
ref|XP_010042397.1|  PREDICTED: basic form of pathogenesis-relate...    108   8e-27   
ref|XP_010052998.1|  PREDICTED: basic form of pathogenesis-relate...    108   8e-27   
ref|XP_009788195.1|  PREDICTED: basic form of pathogenesis-relate...    109   9e-27   
gb|ADN43443.1|  pathogenesis-related protein 1                          108   9e-27   
ref|XP_003557605.1|  PREDICTED: pathogenesis-related protein 1-like     108   9e-27   
dbj|BAO09561.1|  pathogenesis-related protein 1                         108   9e-27   
gb|AFR90191.1|  pathogenesis-related protein 1a                         108   9e-27   
gb|AEH25626.1|  pathogenesis-related protein 1-11                       108   1e-26   
gb|ADN43429.1|  pathogenesis-related protein 1                          108   1e-26   
ref|XP_004136929.1|  PREDICTED: pathogenesis-related protein 1-like     108   1e-26   
ref|XP_010943469.1|  PREDICTED: pathogenesis-related protein PRB1...    108   1e-26   
ref|XP_010530683.1|  PREDICTED: pathogenesis-related protein 1-like     108   1e-26   
gb|AHE81254.1|  pathogenesis-related protein 1-11                       108   1e-26   
gb|AEH25637.1|  pathogenesis-related protein 1-22                       108   1e-26   
gb|AHE81275.1|  pathogenesis-related protein 1-11                       108   1e-26   
gb|KGN43833.1|  hypothetical protein Csa_7G070255                       108   1e-26   
ref|XP_006367104.1|  PREDICTED: basic form of pathogenesis-relate...    108   1e-26   
gb|ADN43442.1|  pathogenesis-related protein 1                          108   1e-26   
gb|AEH25638.1|  pathogenesis-related protein 1-23                       108   1e-26   
ref|XP_002274371.1|  PREDICTED: basic form of pathogenesis-relate...    108   1e-26   Vitis vinifera
ref|XP_006367095.1|  PREDICTED: basic form of pathogenesis-relate...    108   1e-26   
ref|XP_010904546.1|  PREDICTED: pathogenesis-related protein PRB1...    108   1e-26   
gb|ACJ62597.1|  pathogenesis-related maize seed protein                 108   1e-26   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA34024.1|  pathogenesis-related maize seed protein                 108   1e-26   Zea diploperennis [chapule]
gb|KCW63526.1|  hypothetical protein EUGRSUZ_G01161                     107   1e-26   
ref|XP_010088980.1|  hypothetical protein L484_013560                   108   2e-26   
gb|ACJ62603.1|  pathogenesis-related maize seed protein                 108   2e-26   Zea mays subsp. parviglumis [Balsas teosinte]
sp|Q00008.1|PRMS_MAIZE  RecName: Full=Pathogenesis-related protei...    108   2e-26   Zea mays [maize]
ref|XP_010040969.1|  PREDICTED: pathogenesis-related protein 1-like     108   2e-26   
gb|KCW77204.1|  hypothetical protein EUGRSUZ_D01555                     107   2e-26   
ref|XP_010088981.1|  hypothetical protein L484_013561                   108   2e-26   
gb|ACJ62575.1|  pathogenesis-related maize seed protein                 108   2e-26   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010547940.1|  PREDICTED: pathogenesis-related protein 1-like     107   2e-26   
ref|XP_010052994.1|  PREDICTED: basic form of pathogenesis-relate...    107   2e-26   
ref|NP_195098.1|  putative pathogenesis-related protein                 107   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ62554.1|  pathogenesis-related maize seed protein                 108   2e-26   Zea mays subsp. parviglumis [Balsas teosinte]
gb|EMT00919.1|  Pathogenesis-related protein PRB1-2                     110   2e-26   
ref|XP_008798893.1|  PREDICTED: pathogenesis-related protein 1B-like    108   2e-26   
ref|XP_006409652.1|  hypothetical protein EUTSA_v10022888mg             107   2e-26   
gb|AEQ33601.1|  pathogenesis-related protein 1a                         107   2e-26   
ref|XP_010095625.1|  hypothetical protein L484_003726                   107   2e-26   
ref|XP_004487816.1|  PREDICTED: pathogenesis-related protein 1-like     108   2e-26   
gb|KGN62936.1|  hypothetical protein Csa_2G381380                       107   2e-26   
ref|XP_004955413.1|  PREDICTED: pathogenesis-related protein 1-like     107   2e-26   
ref|XP_008372945.1|  PREDICTED: pathogenesis-related protein 1-like     107   2e-26   
gb|ADN43441.1|  pathogenesis-related protein 1                          107   2e-26   
ref|XP_008455066.1|  PREDICTED: basic form of pathogenesis-relate...    107   2e-26   
gb|KCW63511.1|  hypothetical protein EUGRSUZ_G01142                     107   3e-26   
ref|XP_003631695.1|  PREDICTED: basic form of pathogenesis-relate...    107   3e-26   
gb|KCW63519.1|  hypothetical protein EUGRSUZ_G01152                     107   3e-26   
ref|XP_003545772.1|  PREDICTED: basic form of pathogenesis-relate...    107   3e-26   
ref|XP_010065845.1|  PREDICTED: basic form of pathogenesis-relate...    107   3e-26   
ref|XP_010065843.1|  PREDICTED: pathogenesis-related protein 1-like     107   4e-26   
emb|CDX89632.1|  BnaC03g45460D                                          107   4e-26   
ref|XP_004289701.1|  PREDICTED: pathogenesis-related protein 1B-like    107   4e-26   
ref|XP_007041422.1|  Pathogenesis-related protein 1                     107   4e-26   
gb|AEH25636.1|  pathogenesis-related protein 1-21                       107   4e-26   
ref|XP_002869194.1|  hypothetical protein ARALYDRAFT_491308             106   5e-26   
ref|XP_010467245.1|  PREDICTED: pathogenesis-related protein 1-like     107   5e-26   
ref|XP_010252394.1|  PREDICTED: basic form of pathogenesis-relate...    107   5e-26   
ref|XP_010488897.1|  PREDICTED: pathogenesis-related protein 1-like     107   5e-26   
ref|XP_010517582.1|  PREDICTED: pathogenesis-related protein 1-like     106   5e-26   
gb|ADN43430.1|  pathogenesis-related protein 1                          106   5e-26   
ref|XP_004289699.1|  PREDICTED: pathogenesis-related protein 1B-like    106   5e-26   
gb|AFM77000.1|  pathogenesis related protein 1a                         107   5e-26   
ref|XP_010052996.1|  PREDICTED: pathogenesis-related protein 1-like     107   6e-26   
ref|XP_009136247.1|  PREDICTED: pathogenesis-related protein 1-like     106   6e-26   
dbj|BAK23249.1|  pathogenesis-related protein 1a                        105   6e-26   
emb|CAD60273.1|  putative pathogenesis related protein 1 precursor      106   6e-26   
gb|ACJ62559.1|  pathogenesis-related maize seed protein                 107   6e-26   
gb|AHW81904.1|  pathogenesis-related protein                            107   6e-26   
ref|XP_009388944.1|  PREDICTED: pathogenesis-related protein 1C-like    106   6e-26   
gb|AHA43767.1|  pathogenesis related protein 1 isoform 4                107   6e-26   
gb|ABA34011.1|  pathogenesis-related maize seed protein                 106   6e-26   
ref|XP_003593358.1|  Pathogenesis-related protein 1a                    106   6e-26   
gb|KCW77211.1|  hypothetical protein EUGRSUZ_D01565                     106   6e-26   
gb|KDP37597.1|  hypothetical protein JCGZ_06940                         110   7e-26   
gb|KDP36354.1|  hypothetical protein JCGZ_09851                         110   7e-26   
ref|XP_010065842.1|  PREDICTED: pathogenesis-related protein 1-like     106   7e-26   
gb|KCW63515.1|  hypothetical protein EUGRSUZ_G01148                     106   7e-26   
ref|XP_010065838.1|  PREDICTED: pathogenesis-related protein 1-like     106   7e-26   
gb|KCW63509.1|  hypothetical protein EUGRSUZ_G01140                     106   7e-26   
gb|AFD29286.1|  pathogenesis-related protein 1                          106   8e-26   
gb|AHE81264.1|  pathogenesis-related protein 1-21                       106   8e-26   
ref|XP_010053000.1|  PREDICTED: pathogenesis-related protein 1-like     106   9e-26   
ref|XP_006367093.1|  PREDICTED: basic form of pathogenesis-relate...    107   9e-26   
ref|XP_003545770.1|  PREDICTED: basic form of pathogenesis-relate...    106   1e-25   
ref|XP_008455064.1|  PREDICTED: pathogenesis-related protein PRB1...    106   1e-25   
ref|XP_006412319.1|  hypothetical protein EUTSA_v10026438mg             106   1e-25   
gb|KCW77208.1|  hypothetical protein EUGRSUZ_D01560                     106   1e-25   
ref|XP_002273546.1|  PREDICTED: basic form of pathogenesis-relate...    105   1e-25   
gb|ADD97801.1|  pathogenesis-related protein 1                          105   1e-25   
gb|KCW77213.1|  hypothetical protein EUGRSUZ_D01567                     105   1e-25   
gb|AEH25628.1|  pathogenesis-related protein 1-13                       105   1e-25   
ref|XP_006406470.1|  hypothetical protein EUTSA_v10022205mg             105   1e-25   
ref|XP_007148303.1|  hypothetical protein PHAVU_006G197100g             105   1e-25   
gb|ACJ62562.1|  pathogenesis-related maize seed protein                 105   1e-25   
ref|XP_010054707.1|  PREDICTED: basic form of pathogenesis-relate...    105   1e-25   
gb|EMT02515.1|  Pathogenesis-related protein 1                          105   1e-25   
ref|XP_004230669.1|  PREDICTED: pathogenesis-related leaf protein 6     105   1e-25   
emb|CAE51954.1|  putative basic PR1                                     105   1e-25   
ref|XP_009605695.1|  PREDICTED: basic form of pathogenesis-relate...    106   1e-25   
gb|AEH25632.1|  pathogenesis-related protein 1-17                       105   1e-25   
ref|XP_007201612.1|  hypothetical protein PRUPE_ppa019807mg             105   1e-25   
ref|XP_010530686.1|  PREDICTED: pathogenesis-related protein 1-like     105   1e-25   
ref|XP_010068331.1|  PREDICTED: protein PRY2-like                       109   1e-25   
ref|XP_009398311.1|  PREDICTED: pathogenesis-related protein PRB1...    105   1e-25   
gb|KFK39965.1|  hypothetical protein AALP_AA3G312200                    105   1e-25   
ref|NP_001064278.1|  Os10g0191300                                       105   1e-25   
emb|CAA07474.1|  pathogenisis-related protein 1.2                       105   1e-25   
ref|XP_006658251.1|  PREDICTED: uncharacterized protein LOC102701282    109   2e-25   
ref|XP_004289697.1|  PREDICTED: pathogenesis-related protein 1C-like    105   2e-25   
gb|KFK39973.1|  hypothetical protein AALP_AA3G313300                    105   2e-25   
ref|XP_010525646.1|  PREDICTED: pathogenesis-related leaf protein...    105   2e-25   
gb|ACJ62544.1|  pathogenesis-related maize seed protein                 105   2e-25   
ref|XP_010467241.1|  PREDICTED: pathogenesis-related protein 1-like     105   2e-25   
ref|XP_010065841.1|  PREDICTED: basic form of pathogenesis-relate...    105   2e-25   
ref|XP_010245650.1|  PREDICTED: basic form of pathogenesis-relate...    105   2e-25   
ref|XP_003608310.1|  F-box/FBD/LRR-repeat protein                       111   2e-25   
ref|XP_010065835.1|  PREDICTED: pathogenesis-related protein PR-1...    105   2e-25   
ref|XP_010911073.1|  PREDICTED: pathogenesis-related protein PRB1...    105   3e-25   
ref|XP_010068342.1|  PREDICTED: basic form of pathogenesis-relate...    104   3e-25   
dbj|BAL63012.1|  pathogenesis-related protein 1-1a                      103   3e-25   
ref|XP_006422718.1|  hypothetical protein CICLE_v10029873mg             104   4e-25   
gb|ACJ62604.1|  pathogenesis-related maize seed protein                 104   4e-25   
gb|ADN43440.1|  pathogenesis-related protein 1                          104   4e-25   
ref|XP_010065836.1|  PREDICTED: pathogenesis-related protein 1-like     104   4e-25   
ref|XP_009397726.1|  PREDICTED: pathogenesis-related protein PRB1...    106   4e-25   
gb|KCW44084.1|  hypothetical protein EUGRSUZ_L02505                     104   4e-25   
gb|AAF78527.1|AF195236_1  pathogenesis-related proteins                 103   4e-25   
ref|XP_010530685.1|  PREDICTED: pathogenesis-related protein 1-like     103   4e-25   
gb|AFK93500.1|  pathogenesis related protein 1 isoform 1                104   5e-25   
ref|XP_009135645.1|  PREDICTED: pathogenesis-related protein 1          104   5e-25   
ref|XP_006393183.1|  hypothetical protein EUTSA_v10011955mg             104   5e-25   
gb|ABA34014.1|  pathogenesis-related maize seed protein                 104   5e-25   
gb|KCW77203.1|  hypothetical protein EUGRSUZ_D01554                     103   5e-25   
ref|XP_010052997.1|  PREDICTED: pathogenesis-related protein 1-like     104   5e-25   
gb|KCW63528.1|  hypothetical protein EUGRSUZ_G01163                     103   6e-25   
ref|XP_002522070.1|  STS14 protein precursor, putative                  103   6e-25   
emb|CDY46098.1|  BnaA03g52700D                                          103   6e-25   
ref|XP_006486832.1|  PREDICTED: pathogenesis-related protein PR-1...    103   7e-25   
gb|AAN37409.1|  pathogenesis-related protein 1                          103   7e-25   
emb|CDY22960.1|  BnaC03g41090D                                          103   7e-25   
emb|CDO97324.1|  unnamed protein product                                103   8e-25   
ref|XP_004289700.1|  PREDICTED: basic form of pathogenesis-relate...    103   8e-25   
gb|ADP69172.1|  pathogenesis related protein-1                          103   8e-25   
gb|AEH25630.1|  pathogenesis-related protein 1-15                       103   8e-25   
ref|XP_006369711.1|  Pathogenesis-related family protein                103   9e-25   
gb|AHE81270.1|  pathogenesis-related protein 1-6                        103   1e-24   
gb|ACQ41880.1|  pathogenisis-related protein 1.1                        103   1e-24   
ref|XP_009378591.1|  PREDICTED: pathogenesis-related leaf protein...    103   1e-24   
gb|AEH25621.1|  pathogenesis-related protein 1-6                        103   1e-24   
gb|AFK39516.1|  unknown                                                 103   1e-24   
gb|AFK36478.1|  unknown                                                 103   1e-24   
ref|XP_004136924.1|  PREDICTED: basic form of pathogenesis-relate...    103   1e-24   
ref|XP_010065846.1|  PREDICTED: pathogenesis-related protein 1-like     103   1e-24   
gb|KGN43831.1|  hypothetical protein Csa_7G070254                       103   1e-24   
ref|XP_004955945.1|  PREDICTED: pathogenesis-related protein PRMS...    103   1e-24   
ref|XP_010437726.1|  PREDICTED: pathogenesis-related protein 1-like     103   1e-24   
ref|XP_004155485.1|  PREDICTED: basic form of pathogenesis-relate...    103   1e-24   
gb|EMS45472.1|  Pathogenesis-related protein PRMS                       103   2e-24   
ref|XP_011030277.1|  PREDICTED: pathogenesis-related protein 1-like     102   2e-24   
ref|XP_011030276.1|  PREDICTED: basic form of pathogenesis-relate...    102   2e-24   
ref|XP_010691522.1|  PREDICTED: pathogenesis-related protein PR-1...    103   2e-24   
gb|KFK30004.1|  hypothetical protein AALP_AA7G205200                    102   2e-24   
ref|XP_009138205.1|  PREDICTED: pathogenesis-related protein 1-like     102   2e-24   
gb|ADN43439.1|  pathogenesis-related protein 1                          102   2e-24   
ref|XP_009138206.1|  PREDICTED: pathogenesis-related protein 1-like     102   2e-24   
gb|ABK55734.1|  pathogenesis-related protein 1-1a                       100   2e-24   
gb|AEH25625.1|  pathogenesis-related protein 1-10                       102   2e-24   
ref|XP_002313932.2|  pathogenesis-related family protein                102   2e-24   
ref|XP_010065834.1|  PREDICTED: pathogenesis-related protein 1-like     102   2e-24   
gb|AFK38989.1|  unknown                                                 102   2e-24   
ref|XP_006661674.1|  PREDICTED: pathogenesis-related protein PRB1...    102   2e-24   
ref|NP_001140745.1|  uncharacterized protein LOC100272820 precursor     102   2e-24   
ref|XP_002300292.2|  Pathogenesis-related family protein                102   2e-24   
ref|XP_007148304.1|  hypothetical protein PHAVU_006G197200g             102   3e-24   
gb|AEH25623.1|  pathogenesis-related protein 1-8                        102   3e-24   
ref|XP_010691520.1|  PREDICTED: pathogenesis-related protein 1C-like    102   3e-24   
ref|XP_008236237.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    102   3e-24   
ref|XP_002885924.1|  predicted protein                                  102   4e-24   
ref|XP_010943969.1|  PREDICTED: pathogenesis-related protein PRB1...    101   4e-24   
gb|ACQ41879.1|  pathogenisis-related protein 1.1                        102   4e-24   
ref|XP_010270442.1|  PREDICTED: basic form of pathogenesis-relate...    102   4e-24   
ref|XP_004983398.1|  PREDICTED: pathogenesis-related protein PRMS...    102   4e-24   
ref|XP_011030266.1|  PREDICTED: basic form of pathogenesis-relate...    101   4e-24   
gb|AFK93502.1|  pathogenesis related protein 1 isoform 3                101   5e-24   
ref|XP_009605697.1|  PREDICTED: pathogenesis-related leaf protein...    101   5e-24   
ref|XP_006306376.1|  hypothetical protein CARUB_v10012281mg             101   5e-24   
gb|ACJ62587.1|  pathogenesis-related maize seed protein                 101   5e-24   
gb|ACJ62589.1|  pathogenesis-related maize seed protein                 101   6e-24   
ref|XP_006369712.1|  hypothetical protein POPTR_0001s29540g             102   6e-24   
gb|ACJ62553.1|  pathogenesis-related maize seed protein                 101   6e-24   
emb|CDY46097.1|  BnaA03g52710D                                          100   6e-24   
ref|XP_002465112.1|  hypothetical protein SORBIDRAFT_01g032200          101   6e-24   
ref|XP_010488898.1|  PREDICTED: pathogenesis-related protein 1-like     101   6e-24   
sp|P35792.1|PR12_HORVU  RecName: Full=Pathogenesis-related protei...    101   7e-24   
ref|XP_010478439.1|  PREDICTED: pathogenesis-related leaf protein...    101   7e-24   
ref|XP_010447203.1|  PREDICTED: pathogenesis-related protein 1-like     101   7e-24   
ref|XP_006368158.1|  PREDICTED: pathogenesis-related protein 1A-like    100   8e-24   
ref|XP_007201285.1|  hypothetical protein PRUPE_ppa012617mg             101   8e-24   
emb|CDX82282.1|  BnaA03g35390D                                          101   8e-24   
emb|CDY49367.1|  BnaA03g50560D                                          101   8e-24   
gb|EYU18353.1|  hypothetical protein MIMGU_mgv1a023502mg                100   8e-24   
ref|XP_010467244.1|  PREDICTED: pathogenesis-related protein 1-like     101   8e-24   
ref|XP_010647197.1|  PREDICTED: pathogenesis-related protein PRB1...    101   8e-24   
ref|XP_009138211.1|  PREDICTED: pathogenesis-related protein 1-like     101   8e-24   
ref|XP_004136927.1|  PREDICTED: basic form of pathogenesis-relate...    100   9e-24   
ref|XP_010052992.1|  PREDICTED: basic form of pathogenesis-relate...    100   1e-23   
gb|AAM33434.1|AF507974_1  pathogenesis-related protein 1              99.4    1e-23   
ref|XP_006367094.1|  PREDICTED: pathogenesis-related leaf protein...    100   1e-23   
ref|XP_006367096.1|  PREDICTED: pathogenesis-related leaf protein...    100   1e-23   
ref|XP_006286103.1|  hypothetical protein CARUB_v10007651mg             100   1e-23   
ref|XP_006379155.1|  hypothetical protein POPTR_0009s08640g           99.8    1e-23   
ref|XP_010500562.1|  PREDICTED: pathogenesis-related leaf protein...    100   1e-23   
emb|CBI25103.3|  unnamed protein product                                100   1e-23   
ref|XP_003593357.1|  Pathogenesis-related protein 1a                    103   1e-23   
ref|XP_009138233.1|  PREDICTED: pathogenesis-related protein 1-like     100   1e-23   
gb|KCW77194.1|  hypothetical protein EUGRSUZ_D01543                   99.8    1e-23   
ref|XP_009138212.1|  PREDICTED: pathogenesis-related protein 1-like     100   2e-23   
gb|EMS35766.1|  Pathogenesis-related protein PRMS                       100   2e-23   
gb|AEL17301.1|  pathogenesis-related protein 1                        99.0    2e-23   
ref|XP_006387932.1|  hypothetical protein POPTR_0473s00220g           99.8    2e-23   
gb|KCW77219.1|  hypothetical protein EUGRSUZ_D01572                   99.8    2e-23   
gb|EEC81456.1|  hypothetical protein OsI_24758                          100   2e-23   
ref|XP_008236225.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    100   2e-23   
gb|AEI28607.1|  pathogenesis-related protein 1                          100   2e-23   
ref|XP_004486257.1|  PREDICTED: basic form of pathogenesis-relate...  99.8    2e-23   
gb|AGO62049.1|  pathogenesis-related protein 1                        99.0    2e-23   
ref|XP_002891554.1|  hypothetical protein ARALYDRAFT_474142           99.8    3e-23   
ref|XP_002522066.1|  STS14 protein precursor, putative                  100   3e-23   
ref|XP_006657422.1|  PREDICTED: pathogenesis-related protein 1-like     100   3e-23   
sp|Q05968.1|PR1_HORVU  RecName: Full=Pathogenesis-related protein...  99.8    3e-23   
gb|ACJ62573.1|  pathogenesis-related maize seed protein               99.8    3e-23   
ref|XP_010531558.1|  PREDICTED: pathogenesis-related protein 1        99.8    3e-23   
ref|XP_011002583.1|  PREDICTED: pathogenesis-related leaf protein...  99.8    3e-23   
gb|AEH25627.1|  pathogenesis-related protein 1-12                     99.8    3e-23   
gb|ADN43438.1|  pathogenesis-related protein 1                        99.4    3e-23   
ref|NP_179064.1|  pathogenesis-related protein 1                      99.4    4e-23   
dbj|BAB78476.1|  PR-1                                                 99.4    4e-23   
ref|XP_010266628.1|  PREDICTED: pathogenesis-related protein 1A-like  99.4    4e-23   
ref|XP_010943479.1|  PREDICTED: pathogenesis-related protein PRB1...  99.4    5e-23   
ref|XP_010461858.1|  PREDICTED: pathogenesis-related leaf protein...  99.0    5e-23   
ref|XP_007148307.1|  hypothetical protein PHAVU_006G197500g           99.0    6e-23   
ref|NP_188603.1|  putative pathogenesis-related protein               98.6    6e-23   
ref|XP_011002613.1|  PREDICTED: basic form of pathogenesis-relate...  98.6    7e-23   
ref|XP_009787160.1|  PREDICTED: pathogenesis-related leaf protein...  98.6    7e-23   
ref|XP_008236223.1|  PREDICTED: pathogenesis-related protein 1-like   98.6    7e-23   
ref|XP_006367102.1|  PREDICTED: basic form of pathogenesis-relate...  98.6    8e-23   
ref|NP_001234128.1|  pathogenesis-related protein 1A1 precursor       99.0    8e-23   
ref|XP_011092436.1|  PREDICTED: basic form of pathogenesis-relate...  98.6    8e-23   
ref|XP_006367089.1|  PREDICTED: pathogenesis-related protein 1A1-...  99.0    8e-23   
ref|XP_008657154.1|  PREDICTED: pathogenesis-related protein PRB1...  99.0    9e-23   
ref|XP_011092435.1|  PREDICTED: basic form of pathogenesis-relate...  98.2    9e-23   
dbj|BAC84725.1|  putative pathogenesis-related protein 1              98.2    1e-22   
emb|CDX72421.1|  BnaC07g44430D                                        98.6    1e-22   
ref|XP_002459310.1|  hypothetical protein SORBIDRAFT_02g002150        98.6    1e-22   
ref|XP_008455065.1|  PREDICTED: pathogenesis-related leaf protein...  98.2    1e-22   
ref|XP_011016555.1|  PREDICTED: basic form of pathogenesis-relate...  97.8    1e-22   
ref|XP_006282972.1|  hypothetical protein CARUB_v10007846mg           97.8    1e-22   
ref|XP_004485656.1|  PREDICTED: pathogenesis-related protein 1B-like  97.8    1e-22   
ref|XP_010065832.1|  PREDICTED: pathogenesis-related protein 1-like   97.8    2e-22   
gb|KCW63502.1|  hypothetical protein EUGRSUZ_G01132                   97.8    2e-22   
ref|XP_009394873.1|  PREDICTED: pathogenesis-related protein PRMS...  98.2    2e-22   
ref|XP_002270281.2|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...  97.8    2e-22   
ref|XP_002885324.1|  hypothetical protein ARALYDRAFT_898358           97.4    2e-22   
gb|ACJ62499.1|  pathogenesis-related protein class I                  97.4    2e-22   
emb|CDO97326.1|  unnamed protein product                              97.4    2e-22   
gb|ACJ62489.1|  pathogenesis-related protein class I                  97.1    2e-22   
gb|ACJ62461.1|  pathogenesis-related protein class I                  97.1    2e-22   
gb|ACB45874.1|  pathogen-related protein 1                            97.1    3e-22   
gb|ABA34056.1|  pathogenesis-related protein 1                        97.1    3e-22   
ref|NP_001105399.1|  pathogenesis related protein4 precursor          97.1    3e-22   
ref|XP_004136923.1|  PREDICTED: pathogenesis-related leaf protein...  97.1    3e-22   
gb|KGN43830.1|  hypothetical protein Csa_7G070252                     97.1    3e-22   
ref|XP_007199955.1|  hypothetical protein PRUPE_ppa1027191mg          97.1    3e-22   
gb|EEE54617.1|  hypothetical protein OsJ_01861                        95.1    3e-22   
gb|EEC70684.1|  hypothetical protein OsI_02025                        95.1    3e-22   
ref|XP_003608313.1|  Pathogenesis-related protein 1A                  96.7    3e-22   
ref|XP_006298656.1|  hypothetical protein CARUB_v10014746mg           97.4    3e-22   
ref|XP_007041423.1|  Basic pathogenesis-related protein 1             97.8    4e-22   
gb|ACT99721.1|  pathogen-related protein 1                            96.7    4e-22   



>ref|XP_010941969.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   127 bits (320),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD+++ HNAAR AVGVGP++WDN VAA AQ+YAN+R GDC+L+HSG   YGENL 
Sbjct  24   AQNSPQDFVSAHNAARAAVGVGPVSWDNTVAAYAQNYANQRIGDCQLVHSGG-PYGENLF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGSG   T   AV LWV EK+WY+Y+TN+C A  G+ C
Sbjct  83   WGSGREYTAADAVNLWVSEKQWYDYSTNTCAA--GKVC  118



>sp|Q41359.1|PR1_SAMNI RecName: Full=Pathogenesis-related protein PR-1 type; Flags: 
Precursor [Sambucus nigra]
 emb|CAA87071.1| pathogenesis-related protein, PR-1 type [Sambucus nigra]
Length=167

 Score =   127 bits (320),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR AV VGP+TWD +VAA A+ YA  RAGDC+L+HSGD RYGENLA
Sbjct  28   AQNSPQDYVDAHNAARSAVNVGPVTWDESVAAFARQYAQSRAGDCRLVHSGDPRYGENLA  87

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            +GSG  +TGR AV++WV E+  YN  TN+C   PG+ C
Sbjct  88   FGSGFELTGRNAVDMWVAERNDYNPNTNTC--APGKVC  123



>ref|XP_010943450.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Elaeis 
guineensis]
Length=166

 Score =   126 bits (317),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS--GDRRYGEN  298
            AQNSP D++  HNAAR+AVGVGP++WD  VA+ A+ YAN+R GDC+LIHS      YGEN
Sbjct  23   AQNSPDDFVNAHNAAREAVGVGPVSWDTTVASYAEDYANQRKGDCQLIHSDASSHGYGEN  82

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            L WG G   T + AV+LWV E+++Y+Y +NSC+AP G+SC
Sbjct  83   LFWGGGPDHTAKNAVDLWVGEQQYYDYGSNSCSAPQGQSC  122



>ref|XP_002522065.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40265.1| STS14 protein precursor, putative [Ricinus communis]
Length=161

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQN PQDY+  HNAAR AVGVGPMTWDN VAA AQ+YAN+R  DC+L+HSG  RYGEN+
Sbjct  23   HAQNLPQDYINAHNAARAAVGVGPMTWDNTVAAYAQNYANQRINDCRLVHSGG-RYGENI  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AW SG  ++G  AV+LWVDEK +YNY +N+C A  G+ C
Sbjct  82   AWSSGD-LSGTAAVKLWVDEKAFYNYNSNTCAA--GQQC  117



>ref|XP_008798890.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Phoenix 
dactylifera]
Length=166

 Score =   124 bits (312),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRR--YGEN  298
            AQNSP D++  HNAAR+AVGVGP++W+  VA+ A+ YAN+R GDC+LIHS      YGEN
Sbjct  23   AQNSPDDFVNAHNAAREAVGVGPVSWNTTVASYAKDYANQRKGDCQLIHSDSISYGYGEN  82

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            L  G G   T + AV+LWV EK++Y+Y +NSC+APPG+SC
Sbjct  83   LFIGGGPDFTAKDAVDLWVGEKQYYDYDSNSCSAPPGQSC  122



>ref|XP_011092473.1| PREDICTED: pathogenesis-related leaf protein 6-like [Sesamum 
indicum]
Length=162

 Score =   124 bits (311),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDY++ HNAAR  VGVGP+ WD  VAA A++Y N+R GDC L+HS +R YGENL
Sbjct  24   HAQNSPQDYVSAHNAARAQVGVGPIAWDEKVAAFARNYVNQRIGDCNLVHSTNRPYGENL  83

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GSG F TGR AVELWV EK +Y+Y++NSC
Sbjct  84   AKGSGEF-TGRAAVELWVREKPFYDYSSNSC  113



>ref|XP_010941968.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD+++ HNAAR AVGVGP++WDN VAA AQ+YAN+R GDC+L+HSG   YGENL 
Sbjct  24   AQNSPQDFVSAHNAARAAVGVGPVSWDNTVAAYAQNYANQRIGDCQLVHSGG-PYGENLF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGSG   T   AV  WV EK+WY+Y TN+C A  G+ C
Sbjct  83   WGSGREYTAADAVNSWVSEKQWYDYNTNTCAA--GKVC  118



>ref|XP_011002601.1| PREDICTED: pathogenesis-related protein 1-like [Populus euphratica]
Length=162

 Score =   121 bits (304),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ++PQDYL  HNAAR AVGVGP+TWD  V A AQ+YAN+RAGDC L+HSG   YGENLA
Sbjct  25   AQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            W S A ++G  AV++WVDEK +Y+Y++NSC A  G+ C
Sbjct  84   W-SSADLSGTDAVKMWVDEKAYYDYSSNSCAA--GQQC  118



>ref|XP_010941967.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD+++ HNAAR AVGVGP++WD+ VAA AQ+YAN+R GDCKL+HSG   YGENL 
Sbjct  24   AQNSPQDFVSAHNAARAAVGVGPVSWDDTVAAYAQNYANQRIGDCKLVHSGG-PYGENLF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WG G   T   AV  WV EK+WY+Y TN+C A  G+ C
Sbjct  83   WGLGKEYTAADAVNSWVSEKQWYDYNTNTCAA--GKVC  118



>ref|XP_008796972.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD+++ HNAAR AVGVG ++WD+ VAA AQ+YAN+R GDC+L HSG   YGENL 
Sbjct  24   AQNSPQDFVSAHNAARAAVGVGSVSWDDTVAAYAQNYANQRIGDCQLKHSGG-PYGENLF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSGA  T   AV+ WVDEK+WY+Y TN+C
Sbjct  83   WGSGADFTAADAVKSWVDEKQWYDYNTNTC  112



>gb|AHE81252.1| pathogenesis-related protein 1-9 [Triticum aestivum]
Length=166

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGENLA  304
            QNSPQD++  HNAAR  VGVGP+TWD+NVAA AQ+YA +R GDC+LIH+ D R YGENL 
Sbjct  24   QNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGENLF  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             GSG   T   AV  WV EK++Y++ +NSC+AP G+SC
Sbjct  84   GGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSC  121



>ref|XP_006379156.1| pathogenesis-related family protein [Populus trichocarpa]
 gb|ERP56953.1| pathogenesis-related family protein [Populus trichocarpa]
Length=161

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ++PQDYL  HNAAR AVGVGP+TWD  V A AQ+YAN+RAGDC LIHSG   YGENLA
Sbjct  24   AQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLIHSGG-PYGENLA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            W S A ++G  AV++WVDEK +Y+Y +NSC A  G+ C
Sbjct  83   W-SSADLSGTDAVKMWVDEKAYYDYNSNSCAA--GQQC  117



>gb|AEH25624.1| pathogenesis-related protein 1-9 [Triticum aestivum]
Length=166

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGENLA  304
            QNSPQD++  HNAAR  VGVGP+TWD+NVAA AQ+YA +R GDC+LIH+ D R YGENL 
Sbjct  24   QNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGENLF  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             GSG   T   AV  WV EK++Y++ +NSC+AP G+SC
Sbjct  84   GGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSC  121



>gb|AHE81273.1| pathogenesis-related protein 1-9, partial [Triticum aestivum]
Length=162

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGENLA  304
            QNSPQD++  HNAAR  VGVGP+TWD+NVAA AQ+YA +R GDC+LIH+ D R YGENL 
Sbjct  20   QNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGENLF  79

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             GSG   T   AV  WV EK++Y++ +NSC+AP G+SC
Sbjct  80   GGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSC  117



>gb|EMT11012.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=166

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGEN  298
             AQNSPQD++  HNAAR  VGVGP+TWD+NVAA AQ+YA +R GDC+LIH+ D R YGEN
Sbjct  22   TAQNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGEN  81

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            L  G G   T   AV  WV EK++Y++ +NSC+AP G+SC
Sbjct  82   LFGGGGTQWTAADAVSSWVSEKQYYDHGSNSCSAPEGDSC  121



>ref|XP_010270273.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nelumbo 
nucifera]
Length=167

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR  VGVGPM WDNNVAA A++YAN+R  DC L+HSG   YGENLA
Sbjct  24   AQNSPQDYLNAHNAARAQVGVGPMRWDNNVAAYARNYANQRIRDCNLVHSGGGLYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSGAF TG  AV LWV EK +Y+Y +NSC
Sbjct  84   KGSGAF-TGVDAVNLWVKEKPFYDYNSNSC  112



>ref|XP_008798894.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Phoenix 
dactylifera]
Length=162

 Score =   120 bits (300),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSP+D+++ HNAAR AV VGP++WD+ VAA AQ+YAN+R GDCKL+HSG   YGENL 
Sbjct  24   AQNSPEDFVSAHNAARAAVNVGPVSWDSTVAAYAQNYANQRIGDCKLVHSGG-PYGENLV  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             G GA +T   AV+LWV EK+WYNY +N+C A  G+ C
Sbjct  83   GGPGAEVTAADAVKLWVGEKQWYNYNSNTCAA--GKVC  118



>ref|XP_009388942.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD++  HN+AR  VGVGP++WD+NVAA AQ+YAN+R GDC+L+HSG   YGEN+ 
Sbjct  24   AQNSPQDFVDAHNSARADVGVGPVSWDDNVAAYAQNYANERIGDCQLVHSGG-PYGENIF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSGA  T   AV  WVDEK++Y+Y +NSC
Sbjct  83   WGSGADFTAADAVNSWVDEKQYYDYDSNSC  112



>gb|ABK94784.1| unknown [Populus trichocarpa]
 gb|ABK96093.1| unknown [Populus trichocarpa]
Length=161

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ++PQDYL  HNAAR AVGVGP+TWD  V A AQ+YAN+RAGDC L+HSG   YGEN+A
Sbjct  24   AQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVHSGG-PYGENIA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            W S A ++G  AV++WVDEK +Y+Y +NSC A  G+ C
Sbjct  83   W-SSADLSGTDAVKMWVDEKAYYDYNSNSCAA--GQQC  117



>emb|CAA36790.1| unnamed protein product [Nicotiana tabacum]
Length=184

 Score =   120 bits (300),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENLA
Sbjct  30   AQNSPQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCMLVHS-HGQYGENLA  88

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG FMT  +AVE+WV+EK++Y++ +N+C
Sbjct  89   WGSGDFMTAAKAVEMWVNEKQYYDHDSNTC  118



>ref|NP_001234314.1| pathogenesis-related leaf protein 6 precursor [Solanum lycopersicum]
 sp|P04284.2|PR06_SOLLC RecName: Full=Pathogenesis-related leaf protein 6; Short=P6; 
AltName: Full=Ethylene-induced protein P1; AltName: Full=P14; 
AltName: Full=P14A; AltName: Full=PR protein; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA48672.1| P1(p14) protein [Solanum lycopersicum]
 gb|AAA03616.1| pathogenesis-related protein P6 [Solanum lycopersicum]
 emb|CAA70042.1| PR protein [Solanum lycopersicum]
Length=159

 Score =   119 bits (298),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 70/90 (78%), Gaps = 4/90 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYLAVHN AR  VGVGPM+WD N+A+ AQ+YAN RAGDC LIHSG    GENLA
Sbjct  24   AQNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNYANSRAGDCNLIHSGA---GENLA  80

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             G G F TGR AV+LWV E+  YNYATN C
Sbjct  81   KGGGDF-TGRAAVQLWVSERPSYNYATNQC  109



>gb|EMS62872.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=166

 Score =   119 bits (298),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 1/98 (1%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGENLA  304
            QNSPQD++  HNAAR   GVGP+TWD+NVAA AQ+YA +R GDC+LIH+ D R YGENL 
Sbjct  24   QNSPQDFVDPHNAARADAGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGENLF  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             GSG   T   AV  WV EK++Y++ +NSC+AP G+SC
Sbjct  84   GGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSC  121



>ref|XP_009803803.1| PREDICTED: pathogenesis-related protein 1C-like [Nicotiana sylvestris]
Length=184

 Score =   120 bits (300),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENLA
Sbjct  30   AQNSPQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCMLVHS-HGQYGENLA  88

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG FMT  +AVE+WV+EK++Y++ +N+C
Sbjct  89   WGSGDFMTAAKAVEMWVNEKQYYDHDSNTC  118



>ref|NP_001234523.1| pathogenesis-related leaf protein 4 precursor [Solanum lycopersicum]
 sp|Q04108.1|PR04_SOLLC RecName: Full=Pathogenesis-related leaf protein 4; Short=P4; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAA03615.1| pathogenesis-related protein P4 [Solanum lycopersicum]
 emb|CAA09671.1| pathogenesis-related protein PR1a (P4) [Solanum lycopersicum]
Length=159

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 70/90 (78%), Gaps = 4/90 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYLAVHN AR  VGVGPM+WD N+A+ AQ+YAN RAGDC LIHSG    GENLA
Sbjct  24   AQNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNYANSRAGDCNLIHSGA---GENLA  80

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             G G F TGR AV+LWV E+  YNYATN C
Sbjct  81   KGGGDF-TGRAAVQLWVSERPDYNYATNQC  109



>gb|KDP35900.1| hypothetical protein JCGZ_09872 [Jatropha curcas]
Length=160

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ+SPQDY+  HN AR AVGVGP+TWDN VAA A++YAN+  GDC+L+HSG   YGENL
Sbjct  22   HAQDSPQDYVNAHNTARAAVGVGPVTWDNTVAAYARNYANRHIGDCRLVHSGG-PYGENL  80

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A GS  +++G  AV+LWVDEK +YNY +N+C A  G+ C
Sbjct  81   A-GSSGYLSGTAAVKLWVDEKAFYNYNSNTCAA--GKVC  116



>dbj|BAF03626.1| pathogenesis related protein 1 [Eutrema japonicum]
Length=161

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDYL VHN AR AVGVGPM WD+ VAA A+SYA++R GDC+LIHSG   YGENLA
Sbjct  26   AQDSPQDYLRVHNQARAAVGVGPMQWDDRVAAFARSYADQRRGDCRLIHSGG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
            WGS + ++G  AV +WV+EK  YNY +N+CN   G 
Sbjct  85   WGS-SDLSGISAVNMWVNEKANYNYPSNTCNGVCGH  119



>gb|KFK39972.1| hypothetical protein AALP_AA3G313200 [Arabis alpina]
Length=150

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQD++  HN AR AVGVGP+ WD  VAA A+SYAN+R GDC+L+HSG   YGENLA
Sbjct  15   AQDSPQDFVNAHNQARSAVGVGPIQWDERVAAYARSYANQRRGDCRLVHSGG-PYGENLA  73

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
            WGSG  ++G RAV +WV+EK  YNYA N+CN   G 
Sbjct  74   WGSGD-LSGVRAVNMWVNEKANYNYALNTCNGVCGH  108



>ref|XP_010691524.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
Length=166

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS-GDRRYGEN  298
            +AQNSPQDY+  HNAAR AVGVG + WD+ VAA AQ YAN+R  DC L HS G  RYGEN
Sbjct  25   HAQNSPQDYVNAHNAARAAVGVGNIQWDDQVAAFAQQYANQRKADCALRHSGGGGRYGEN  84

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            +A  SG+ MTG  AV+LWVDEK +YNY TN+C
Sbjct  85   IAVSSGSSMTGTAAVKLWVDEKAFYNYNTNTC  116



>pdb|1CFE|A Chain A, P14a, Nmr, 20 Structures
Length=135

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLAW  307
            QNSPQDYLAVHN AR  VGVGPM+WD N+A+ AQ+YAN RAGDC LIHSG    GENLA 
Sbjct  1    QNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNYANSRAGDCNLIHSGA---GENLAK  57

Query  308  GSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            G G F TGR AV+LWV E+  YNYATN C
Sbjct  58   GGGDF-TGRAAVQLWVSERPSYNYATNQC  85



>gb|ABA41593.1| pathogenesis-related protein [Solanum lycopersicum]
Length=136

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLAW  307
            QNSPQDYLAVHN AR  VGVGPM+WD N+A+ AQ+YAN RAGDC LIHSG    GENLA 
Sbjct  2    QNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNYANSRAGDCNLIHSGA---GENLAK  58

Query  308  GSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            G G F TGR AV+LWV E+  YNYATN C
Sbjct  59   GGGDF-TGRAAVQLWVSERPSYNYATNQC  86



>ref|XP_010942046.1| PREDICTED: uncharacterized protein LOC105060136 [Elaeis guineensis]
Length=325

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY++ HN AR AVGVGP++WD+ VAA AQ+Y N+R GDC+L+HSG   YGENL 
Sbjct  24   AQNSPQDYVSAHNVARAAVGVGPVSWDDTVAAYAQNYVNQRIGDCQLVHSG-GPYGENLF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGSG   T   AV  WV EK+WY+Y TN+C A  G+ C
Sbjct  83   WGSGREYTAADAVNSWVSEKQWYDYNTNTCAA--GKVC  118



>emb|CAA70070.1| PR protein [Solanum lycopersicum]
Length=168

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 68/91 (75%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL VHN AR  VGVGPM+WD ++ + AQSYAN RAGDC LIHSG    GENL
Sbjct  24   DAQNSPQDYLEVHNDARAQVGVGPMSWDADLESRAQSYANSRAGDCNLIHSGS---GENL  80

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G G F TGR AVELWV EK  YNY TN C
Sbjct  81   AKGGGDF-TGRAAVELWVSEKPNYNYDTNEC  110



>gb|KGN48339.1| hypothetical protein Csa_6G483242 [Cucumis sativus]
Length=150

 Score =   117 bits (293),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDY+++HN AR AVGVGPMTWDN VAA AQSYANKR  DC L+HS    YGEN+
Sbjct  8    HAQNSPQDYISLHNKARAAVGVGPMTWDNTVAAYAQSYANKRKNDCALVHS-TGPYGENI  66

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G     TG   V+LWV EK  Y+YA+NSC
Sbjct  67   AIGFYPEFTGADGVKLWVGEKHLYDYASNSC  97



>gb|KDP37611.1| hypothetical protein JCGZ_06954 [Jatropha curcas]
Length=163

 Score =   117 bits (294),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            +Q+  QDYL  HN AR AVGVGP++WD+ VAA AQ+YAN+RAGDC L+HSG   YGENLA
Sbjct  26   SQDQQQDYLDAHNQARTAVGVGPLSWDDTVAAYAQNYANQRAGDCNLVHSGG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            W S A ++G  AV++WVDEK +Y+Y +NSC+  PG+ C
Sbjct  85   W-SSAELSGTDAVKMWVDEKAYYDYDSNSCS--PGQMC  119



>ref|XP_009388943.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD++  HN+AR AVGVGP++WD+NVAA AQ+YAN+R GDC+L+HSG   YGENL 
Sbjct  24   AQNSPQDFVDAHNSARAAVGVGPVSWDDNVAAYAQNYANQRIGDCQLVHSGG-PYGENLF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GS    TG  AV  WVDEK++Y+Y +NSC
Sbjct  83   GGSSTEFTGIDAVNSWVDEKQYYDYDSNSC  112



>emb|CAN77102.1| hypothetical protein VITISV_021166 [Vitis vinifera]
 emb|CBI25100.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HN AR  VGVGPM+WDN VAA AQ+YAN+R GDC L+HSG   YGENLA
Sbjct  24   AQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYANQRIGDCNLVHSGG-PYGENLA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV LWV EK  Y+Y +NSC
Sbjct  83   WGSPS-LTGTDAVNLWVGEKSNYDYNSNSC  111



>prf||1202235B protein p14,pathogenesis related
Length=130

 Score =   116 bits (291),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 69/89 (78%), Gaps = 4/89 (4%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLAW  307
            +NSPQDYLAVHN AR  VGVGPM+WD N+A+ AQ+YAN RAGDC LIHSG    GENLA 
Sbjct  1    ENSPQDYLAVHNDARAQVGVGPMSWDANLASRAQNYANSRAGDCNLIHSGA---GENLAK  57

Query  308  GSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            G G F TGR AV+LWV E+  YNYATN C
Sbjct  58   GGGDF-TGRAAVQLWVSERPSYNYATNQC  85



>ref|XP_002273788.2| PREDICTED: pathogenesis-related protein 1 [Vitis vinifera]
Length=197

 Score =   118 bits (295),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HN AR  VGVGPM+WDN VAA AQ+YAN+R GDC L+HSG   YGENLA
Sbjct  61   AQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYANQRIGDCNLVHSGG-PYGENLA  119

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV LWV EK  Y+Y +NSC
Sbjct  120  WGSPS-LTGTDAVNLWVGEKSNYDYNSNSC  148



>gb|KDP37612.1| hypothetical protein JCGZ_06955 [Jatropha curcas]
Length=147

 Score =   116 bits (291),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            NAQ +P+DYL  HN AR  VG+GPM+WD  VAA AQ+YAN+   +C L+HS +  YGENL
Sbjct  24   NAQQTPEDYLNAHNQARAVVGLGPMSWDKKVAAYAQNYANQHVSECNLVHS-EGPYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AWGSG  ++G  AV++WVDEK +Y+Y +NSC   PGE C
Sbjct  83   AWGSGD-LSGEEAVKMWVDEKTYYDYNSNSC--VPGEVC  118



>ref|XP_004246724.1| PREDICTED: pathogenesis-related leaf protein 4 [Solanum lycopersicum]
 emb|CAA04881.1| pathogenesis-related protein [Solanum lycopersicum]
Length=160

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 68/91 (75%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL VHN AR  VGVGPM+WD ++ + AQSYAN RAGDC LIHSG    GENL
Sbjct  24   DAQNSPQDYLEVHNDARAQVGVGPMSWDADLESRAQSYANSRAGDCNLIHSGS---GENL  80

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G G F TGR AVELWV EK  YNY TN C
Sbjct  81   AKGGGDF-TGRAAVELWVSEKPNYNYDTNEC  110



>emb|CAD38276.1| pathogenesis related protein isoform b1 [Solanum phureja]
Length=159

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYLAVHN AR  VGVGPM+WD  +A+ AQ+YAN R GDC LIHSG    GENL
Sbjct  23   DAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQNYANSRTGDCNLIHSGA---GENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GSG F TGR AV+LWV EK  YNY TN C
Sbjct  80   AKGSGDF-TGRAAVQLWVGEKPNYNYGTNQC  109



>gb|AAQ19681.1| cytoplasmic small heat shock protein class I [Capsicum frutescens]
Length=158

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 70/91 (77%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYLAVHN AR  VGVGPM+WD  +A+ AQ+YAN R GDC LIHSG    GENL
Sbjct  23   HAQNSPQDYLAVHNNARAQVGVGPMSWDAGLASRAQNYANSRTGDCSLIHSGA---GENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G G + TGRRAVELWV EK  YN+ATN C
Sbjct  80   AKGGGDY-TGRRAVELWVSEKPNYNHATNQC  109



>gb|AEZ52390.1| pathogenesis-related protein 1 [Wolffia australiana]
Length=169

 Score =   117 bits (292),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSP DYLA HN AR  VGV P+TWD N+ A AQ+YAN+RAGDC+L+HS    YGENL 
Sbjct  27   AQNSPDDYLAPHNDARAEVGVEPLTWDYNLEAYAQNYANERAGDCELVHS-QGPYGENLF  85

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGSG       AV+LWVDEK++Y+Y +NSC   P + C
Sbjct  86   WGSGKVYNAEDAVKLWVDEKEYYDYNSNSCQ--PDQMC  121



>gb|AAX20041.1| cytoplasmic small heat shock protein class I [Capsicum annuum]
 gb|AHZ65519.1| cytoplasmic small heat shock protein class I [Capsicum annuum 
Conoides Group]
Length=158

 Score =   116 bits (291),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 70/91 (77%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYLAVHN AR  VGVGPM+WD  +A+ AQ+YAN R GDC LIHSG    GENL
Sbjct  23   HAQNSPQDYLAVHNNARAQVGVGPMSWDAGLASRAQNYANSRTGDCNLIHSGA---GENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G G + TGRRAVELWV EK  YN+ATN C
Sbjct  80   AKGGGDY-TGRRAVELWVSEKPNYNHATNQC  109



>gb|ABK41053.2| pathogenesis-related protein 1 [Musa acuminata]
Length=162

 Score =   116 bits (291),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD+++ HNAAR AVGVGP++WDN VAA AQ+YAN+RA DC+L+HSG   YGEN+ 
Sbjct  25   AQNSPQDFVSPHNAARAAVGVGPVSWDNTVAAYAQNYANQRAADCQLVHSGG-PYGENIF  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGSG   T   AV  WV EK++Y+Y +N+C   P + C
Sbjct  84   WGSGRDYTAADAVNAWVSEKQYYDYNSNTC--APNKVC  119



>ref|XP_004955412.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Setaria 
italica]
Length=163

 Score =   116 bits (291),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD++ +HNAAR AVGVGP++W++NVAA A+S+A KRAGDC+L+HS    YGENL 
Sbjct  24   AQNSPQDFVKLHNAARAAVGVGPVSWNDNVAAFARSWAAKRAGDCRLVHSRGSGYGENLF  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             GSGA  +   AV LWV EK+WY++ +NSC A  G+ C
Sbjct  84   GGSGADWSASDAVGLWVAEKQWYDHGSNSCAA--GKVC  119



>ref|NP_001234358.1| PR1 protein precursor [Solanum lycopersicum]
 gb|ACB88202.1| PR1 protein [Solanum lycopersicum]
Length=179

 Score =   117 bits (292),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 76/100 (76%), Gaps = 8/100 (8%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR+ VGVGPMTWDN +AA AQ+YAN+RAGDC++ HSG   YGENLA
Sbjct  23   AQNSPQDYLNAHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDCRMQHSGG-PYGENLA  81

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
                AF  +    AV++WVDEK+WYNY +N+C A  G+ C
Sbjct  82   ---AAFPQLNAAGAVKMWVDEKQWYNYNSNTCQA--GKVC  116



>ref|XP_006409651.1| hypothetical protein EUTSA_v10022890mg [Eutrema salsugineum]
 gb|ESQ51104.1| hypothetical protein EUTSA_v10022890mg [Eutrema salsugineum]
Length=158

 Score =   116 bits (291),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDYL  HN AR AVGV P+ WD  VAA A+SYA++R GDC+LIHSG   YGENLA
Sbjct  21   AQDSPQDYLTAHNQARTAVGVAPIQWDERVAAYARSYADQRRGDCRLIHSGG-PYGENLA  79

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
            WGS + ++G RAV LWV+EK  YNY +N+CN   G 
Sbjct  80   WGS-SDLSGVRAVNLWVNEKANYNYPSNTCNGVCGH  114



>emb|CAB58263.1| pathogenesis related protein PR-1 [Solanum tuberosum]
Length=159

 Score =   116 bits (291),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYLAVHN AR  VGVGPM+WD  +A+ AQ+YAN R GDC LIHSG    GENL
Sbjct  23   DAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQNYANSRTGDCNLIHSGA---GENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GSG F TGR AV+LWV EK  YNY TN C
Sbjct  80   AKGSGDF-TGRAAVQLWVGEKPNYNYGTNQC  109



>gb|EAY95187.1| hypothetical protein OsI_17005 [Oryza sativa Indica Group]
Length=122

 Score =   115 bits (288),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDR-RYGENL  301
            AQNS +DY+  HNAAR  VGVGP+ WD+ VAA AQ YAN+R GDCKL HS    +YGEN+
Sbjct  2    AQNSAKDYVDPHNAARAEVGVGPVHWDDTVAAYAQGYANQRRGDCKLQHSDSGWKYGENI  61

Query  302  AWG-SGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WG +G   T   AV LWV EK+WYN+ +NSC+AP G+ C
Sbjct  62   FWGPAGGDWTAASAVSLWVKEKQWYNHGSNSCSAPAGKEC  101



>ref|XP_004955414.1| PREDICTED: pathogenesis-related protein 1-like [Setaria italica]
Length=168

 Score =   116 bits (291),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL-  301
            AQNS QD++ +HNAAR  VGVGP++WD+NVAA A+SYA +RAGDC L HS    YGEN+ 
Sbjct  26   AQNSQQDFVDLHNAARSDVGVGPVSWDDNVAAFARSYAAQRAGDCALQHSSGSGYGENIF  85

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
              G+GA  +   AV LWV EK+WY++ +NSC+AP G+SC
Sbjct  86   VGGAGADWSASDAVGLWVAEKQWYDHGSNSCSAPAGQSC  124



>emb|CDO97323.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL VHN+AR  VGVGPMTWD  VAA AQ+YAN+R  DC L+HS    YGENL
Sbjct  26   HAQNSPQDYLNVHNSARSQVGVGPMTWDTTVAAYAQNYANQRISDCNLVHS-QGPYGENL  84

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G+G F TG  A  LWV EK +YNY +NSC
Sbjct  85   AKGTGTF-TGTAAANLWVAEKPYYNYTSNSC  114



>dbj|BAF95881.1| putative pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HN AR  VGVGPM+WDN VAA AQ+YAN+R GDC L+HSG   YGENLA
Sbjct  24   AQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYANQRIGDCNLVHSGG-PYGENLA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV +WV EK  Y+Y +NSC
Sbjct  83   WGSPS-LTGTDAVNMWVGEKSNYDYNSNSC  111



>emb|CAD38277.1| pathogenesis related protein isoform b2 [Solanum phureja]
Length=159

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYLAVHN AR  VGVGPM+WD  +AA AQ+YAN R GDC LIHSG    GENL
Sbjct  23   DAQNSPQDYLAVHNDARAQVGVGPMSWDAGLAARAQNYANSRIGDCNLIHSGA---GENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G G + TGRRAV+LWV EK  YNY TN C
Sbjct  80   AKGGGDY-TGRRAVQLWVSEKPNYNYDTNQC  109



>gb|KDP36353.1| hypothetical protein JCGZ_09850 [Jatropha curcas]
Length=182

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ+SPQDY+ VHN AR AVGV P+TWDN VAA A++YAN+R GDC+L+HSG   YGENL
Sbjct  10   HAQDSPQDYVNVHNTARAAVGVDPVTWDNTVAAYARNYANQRIGDCRLVHSGG-PYGENL  68

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNA  400
            A GS   ++G  AVELWVDEK +Y+Y ++SC A
Sbjct  69   A-GSSGDLSGTTAVELWVDEKAFYDYNSSSCAA  100



>gb|AEJ88253.1| putative pathogenesis-related protein 1 [Wolffia australiana]
Length=164

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+PQDYLA HNAAR AVGVGPM WD  VAA AQSYAN+R  DC+L+HS    YGENL 
Sbjct  25   AQNTPQDYLAAHNAARAAVGVGPMVWDAQVAAYAQSYANQRRADCRLVHSTGSNYGENLF  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGSG   T R AV+ WV+E+K YNYATN+C   PG  C
Sbjct  85   WGSGKEWTAREAVQSWVNERKDYNYATNTCT--PGRVC  120



>ref|XP_003606006.1| Maturase K [Medicago truncatula]
Length=855

 Score =   123 bits (309),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 60/100 (60%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS-GDRRYGEN  298
            NAQNS  DY+  HN AR+ VGVG + WDN VA+ AQ YAN+R GDC+LIHS G  RYGEN
Sbjct  351  NAQNSRADYVNAHNDARRQVGVGDIVWDNTVASFAQDYANQRKGDCQLIHSGGGGRYGEN  410

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            LAW SG  M+G  AV+LWV+EK  YNY +N+C +  G+ C
Sbjct  411  LAWSSGD-MSGSDAVKLWVNEKADYNYNSNTCAS--GKVC  447



>gb|KDP37603.1| hypothetical protein JCGZ_06946 [Jatropha curcas]
Length=157

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            +Q+  QDYL  HN AR AVGVGP++WD+ VAA AQ+YA++RAGDC L+HSG   YGENLA
Sbjct  20   SQDQQQDYLDAHNQARAAVGVGPLSWDDTVAAYAQNYASQRAGDCNLVHSGG-PYGENLA  78

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            W S A ++G  AV++WVDEK +Y+Y +NSC+  PG+ C
Sbjct  79   W-SSAELSGTDAVKMWVDEKAYYDYDSNSCS--PGQMC  113



>ref|NP_001275095.1| pathogenesis-related protein 1b precursor [Solanum tuberosum]
 ref|XP_006345693.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
 ref|XP_006345695.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
 gb|AAL01594.1| pathogenesis-related protein 1b precursor [Solanum tuberosum]
Length=159

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYLAVHN AR  VGVGPM+WD  +A+ AQ+YAN R GDC LIHSG    GENL
Sbjct  23   DAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQNYANSRTGDCNLIHSGA---GENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G+G F TGR AV+LWV EK  YNY TN C
Sbjct  80   AKGTGDF-TGRAAVQLWVGEKPNYNYGTNQC  109



>gb|KDP37606.1| hypothetical protein JCGZ_06949 [Jatropha curcas]
Length=163

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            +Q+  QDYL  HN AR AVGVGP++WD+ VAA AQ+YA++RAGDC L+HSG   YGENLA
Sbjct  26   SQDQQQDYLDAHNQARAAVGVGPLSWDDTVAAYAQNYASQRAGDCNLVHSGG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            W S A ++G  AV++WVDEK +Y+Y +NSC+  PG+ C
Sbjct  85   W-SSAELSGTDAVKMWVDEKAYYDYDSNSCS--PGQMC  119



>ref|XP_002313935.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
 gb|EEE87890.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
Length=160

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ++PQDYL  HN AR AVGVGP+TWD  V A AQ+YAN+RAGDC L+HSG   YGEN+A
Sbjct  23   AQDNPQDYLDAHNTARAAVGVGPLTWDTTVQAYAQNYANQRAGDCNLVHSGG-PYGENIA  81

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            W S A ++G  AV++WVDE  +Y+Y +NSC +  G+ C
Sbjct  82   W-SSADLSGTDAVKMWVDEMAYYDYNSNSCAS--GQQC  116



>ref|XP_006422719.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
 gb|ESR35959.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
Length=159

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR +V VGPM WDN VAA AQ+YAN+R GDC+L+HSG   YGENL
Sbjct  21   SAQNSQQDYLRAHNEARASVRVGPMRWDNKVAAYAQNYANQRKGDCRLVHSGG-PYGENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            AW SG  +TG  AV+LWVDE+  YNY +N+C
Sbjct  80   AWSSGD-LTGTAAVKLWVDERPKYNYNSNTC  109



>ref|XP_009610821.1| PREDICTED: pathogenesis-related protein 1B [Nicotiana tomentosiformis]
 sp|P07053.1|PR1B_TOBAC RecName: Full=Pathogenesis-related protein 1B; Short=PR-1B; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA35665.1| unnamed protein product [Nicotiana tabacum]
 dbj|BAA14221.1| PR1b protein precursor [Nicotiana tabacum]
 emb|CAA27183.1| PR-1b precursor; (aa -30-138) [Nicotiana tabacum]
 prf||1203245A protein 1b,pathogenesis related
Length=168

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR  VGV P+TWDN VAA AQ+Y ++ A DC L+HS   +YGENL
Sbjct  29   HAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVHS-HGQYGENL  87

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A GSG FMT  +AVE+WVDEK++Y++ +N+C    G+ C
Sbjct  88   AQGSGDFMTAAKAVEMWVDEKQYYDHDSNTC--AQGQVC  124



>emb|CAA31009.1| PR1b preprotein [Nicotiana tabacum]
Length=153

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR  VGV P+TWDN VAA AQ+Y ++ A DC L+HS   +YGENL
Sbjct  14   HAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVHS-HGQYGENL  72

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A GSG FMT  +AVE+WVDEK++Y++ +N+C    G+ C
Sbjct  73   AQGSGDFMTAAKAVEMWVDEKQYYDHDSNTC--AQGQVC  109



>ref|XP_004138862.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004173439.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDY+++HN AR AVGVGPMTW+N VAA AQSYANKR  DC L+HS    YGEN+
Sbjct  16   HAQNSPQDYISLHNKARSAVGVGPMTWNNTVAAYAQSYANKRINDCALVHS-TGPYGENI  74

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G     TG   V++WV EK  Y+YA+NSC
Sbjct  75   AVGYYPEFTGADGVKMWVGEKHLYDYASNSC  105



>emb|CAA29022.1| PR-1b protein [Nicotiana tabacum]
Length=164

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR  VGV P+TWDN VAA AQ+Y ++ A DC L+HS   +YGENL
Sbjct  25   HAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVHS-HGQYGENL  83

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GSG FMT  +AVE+WVDEK++Y++ +N+C
Sbjct  84   AQGSGDFMTAAKAVEMWVDEKQYYDHDSNTC  114



>ref|XP_010691525.1| PREDICTED: pathogenesis-related protein 1A-like [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS-GDRRYGEN  298
            +AQNSPQDY+  HNAAR AVGVG + WD+ VAA AQ YAN+R  DC L HS G  RYGEN
Sbjct  25   HAQNSPQDYVNAHNAARAAVGVGNIQWDDQVAAFAQQYANQRKADCALRHSGGGGRYGEN  84

Query  299  LAWG-SGAFMTGRRAVELWVDEKKWYNYATNSC  394
            +A G +G F+TG  AV+LWVDEK +YNY +N+C
Sbjct  85   IAAGPAGVFLTGASAVKLWVDEKAFYNYNSNTC  117



>ref|XP_002459696.1| hypothetical protein SORBIDRAFT_02g008970 [Sorghum bicolor]
 gb|EER96217.1| hypothetical protein SORBIDRAFT_02g008970 [Sorghum bicolor]
Length=169

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +2

Query  71   WFAciicifvvvitpccNAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRA  250
            WFA    + V       +AQN+ QD++ +HN+ R  VGVG +TW+  VAA AQSYAN+RA
Sbjct  9    WFALAFTVVVAAAGGVVSAQNTAQDFVNLHNSPRADVGVGSVTWNTTVAAYAQSYANQRA  68

Query  251  GDCKLIHSGDRRYGENLAWGSGAFM-TGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            GDC+L+HSG   YGENL WGS  +      AV  WV EK++Y++ATN+C+AP G+SC
Sbjct  69   GDCRLVHSGG-PYGENLFWGSAGYAWAASDAVGSWVAEKQYYDHATNTCSAPSGQSC  124



>ref|NP_179068.1| pathogenesis-related protein 1 [Arabidopsis thaliana]
 sp|P33154.1|PR1_ARATH RecName: Full=Pathogenesis-related protein 1; Short=PR-1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAA32863.1| PR-1-like protein [Arabidopsis thaliana]
 gb|AAC69381.1| pathogenesis-related PR-1-like protein [Arabidopsis thaliana]
 gb|AAL36379.1| putative pathogenesis-related PR-1 protein [Arabidopsis thaliana]
 gb|AAM51262.1| putative pathogenesis-related PR-1 protein [Arabidopsis thaliana]
 gb|ABE65442.1| pathogenesis-like protein 1 [Arabidopsis thaliana]
 gb|AEC06314.1| pathogenesis-related protein 1 [Arabidopsis thaliana]
Length=161

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDYL VHN AR AVGVGPM WD  VAA A+SYA +  G+C+LIHSG   YGENLA
Sbjct  26   AQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYARSYAEQLRGNCRLIHSGG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
            WGSG  ++G  AV +WV EK  YNYA N+CN   G 
Sbjct  85   WGSGD-LSGVSAVNMWVSEKANYNYAANTCNGVCGH  119



>ref|XP_004246723.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
lycopersicum]
Length=159

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 67/91 (74%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL VHN AR  VGVGPM+WD+ +A  AQ YA+ R GDC LIHSG    GENL
Sbjct  23   DAQNSPQDYLVVHNNARGQVGVGPMSWDDALATKAQRYADSRRGDCNLIHSGP---GENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GSG F TGRRA ELWV EK  YNY TN C
Sbjct  80   AKGSGDF-TGRRASELWVAEKPNYNYGTNQC  109



>gb|ABK28181.1| unknown [Arabidopsis thaliana]
Length=162

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDYL VHN AR AVGVGPM WD  VAA A+SYA +  G+C+LIHSG   YGENLA
Sbjct  26   AQDSPQDYLRVHNQARGAVGVGPMQWDERVAAYARSYAEQLRGNCRLIHSGG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
            WGSG  ++G  AV +WV EK  YNYA N+CN   G 
Sbjct  85   WGSGD-LSGVSAVNMWVSEKANYNYAANTCNGVCGH  119



>ref|XP_002274105.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=176

 Score =   115 bits (288),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD+L  HN AR  VGVGPM+WDN VAA AQ+Y N+R GDC L+HSG   YGENLA
Sbjct  25   AQNSPQDFLDAHNVARAEVGVGPMSWDNTVAAYAQNYTNQRIGDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV LWV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTGIDAVNLWVGEKTNYDYNSNSC  112



>ref|XP_008796970.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD+++ HNAAR AVGVG ++WD+ VAA AQ+YAN+R  DC+L HSG   YGENL 
Sbjct  24   AQNSPQDFVSAHNAARAAVGVGSVSWDDTVAAYAQNYANQRISDCQLKHSGG-PYGENLF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             GSGA  T   AV  WVDEK+WY+Y TN+C A  G  C
Sbjct  83   GGSGADFTAADAVNSWVDEKQWYDYNTNTCAA--GHEC  118



>emb|CAA31010.1| PR1c preprotein [Nicotiana tabacum]
Length=163

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENL
Sbjct  24   HAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS-HGQYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AWGSG F+T  +AVE+WV+EK++Y + +N+C    G+ C
Sbjct  83   AWGSGDFLTAAKAVEMWVNEKQYYAHDSNTC--AQGQVC  119



>ref|XP_009769213.1| PREDICTED: pathogenesis-related protein 1C [Nicotiana sylvestris]
 sp|P09042.3|PR1C_TOBAC RecName: Full=Pathogenesis-related protein 1C; Short=PR-1C; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA35666.1| unnamed protein product [Nicotiana tabacum]
Length=168

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENL
Sbjct  29   HAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS-HGQYGENL  87

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AWGSG F+T  +AVE+WV+EK++Y + +N+C    G+ C
Sbjct  88   AWGSGDFLTAAKAVEMWVNEKQYYAHDSNTC--AQGQVC  124



>ref|XP_009605825.1| PREDICTED: pathogenesis-related protein 1B-like [Nicotiana tomentosiformis]
Length=177

 Score =   115 bits (288),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR  V V P+TWD++VAA AQ+Y ++ A DC L+HS   +YGENL
Sbjct  29   HAQNSQQDYLDAHNTARADVAVEPLTWDDDVAAYAQNYVSQLAADCNLVHS-HGQYGENL  87

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A GSG FMT  +AVE+WVDEK++Y+Y +N+C    G+ C
Sbjct  88   AQGSGDFMTAAKAVEMWVDEKQYYDYDSNTC--AEGQVC  124



>gb|ADN43435.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVGPMTW+N VAA AQ+YAN+R GDC L+HSG   YGEN+A
Sbjct  25   AQNSPQDYVDAHNAARAQVGVGPMTWNNTVAAYAQNYANQRIGDCNLVHSGG-PYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV +WV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTGTDAVNMWVGEKPNYDYNSNSC  112



>gb|AAL84768.1|AF475286_1 pathogenesis-related protein 1-1a [Cucumis sativus]
Length=140

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQD++ VHN AR  VGVGP+ WD  VA+ AQ YAN+R  DC+L++SG   YGEN+A
Sbjct  1    AQDSPQDFVGVHNVARAQVGVGPIEWDKTVASFAQQYANRRLNDCRLVNSGG-PYGENIA  59

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS   ++ + AV+LWVDEK +YNY TN+C A  GE C
Sbjct  60   WGSPD-LSAKDAVQLWVDEKPFYNYETNTCAA--GELC  94



>gb|AAK30143.1|AF348141_1 pathogenesis-related protein PR-1 precursor [Capsicum annuum]
 gb|AAC06244.2| basic PR-1 protein precursor [Capsicum annuum]
 gb|AAU20808.1| basic PR-1 protein precursor [Capsicum annuum]
Length=179

 Score =   115 bits (288),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 75/100 (75%), Gaps = 8/100 (8%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR+ VGVGPMTWDN +AA AQ+YAN+R GDC++ HSG   YGENLA
Sbjct  23   AQNSPQDYLNAHNAARRQVGVGPMTWDNRLAAFAQNYANQRIGDCRMQHSGG-PYGENLA  81

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
                AF  +    AV++WV+EK+WYNY +NSC   PG+ C
Sbjct  82   ---AAFPQLNAAGAVKMWVNEKQWYNYNSNSC--APGKVC  116



>ref|XP_004168739.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   114 bits (286),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDY+++HN AR AVGVGPMTW+N VAA AQSYANKR  DC L+HS    YGEN+
Sbjct  16   HAQNSPQDYISLHNKARAAVGVGPMTWNNTVAAYAQSYANKRINDCALVHS-TGPYGENI  74

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G     TG   V++WV EK  Y+YA+NSC
Sbjct  75   AVGYYPEFTGADGVKMWVGEKHLYDYASNSC  105



>gb|AHA56682.1| pathogenesis related protein [Camellia sinensis]
Length=162

 Score =   114 bits (286),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HNAAR  VGVGPMTWDNNVAA AQ YA+ R GDC L+HSG   YGENLA
Sbjct  24   AQNSQQDYLNAHNAARAQVGVGPMTWDNNVAAYAQRYASSRMGDCNLVHSGG-PYGENLA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             G+G+F TG   V LWV EK +Y+Y +NSC
Sbjct  83   EGNGSF-TGTAGVNLWVGEKPYYDYNSNSC  111



>gb|AFK93503.1| pathogenesis related protein 1 isoform 4 [Ficus pumila var. awkeotsang]
Length=169

 Score =   115 bits (287),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQD+LA HN AR  VGVGPMTWD +VAA A+ YAN+R GDCKLIHSG   YGEN+A
Sbjct  25   AQDSPQDFLAPHNRARAEVGVGPMTWDESVAAYARDYANRRKGDCKLIHSGG-PYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPP  406
            WGSG  ++  RAV +WV EK  Y+Y  N C   P
Sbjct  84   WGSGD-LSAARAVGMWVAEKSLYDYNNNKCIGDP  116



>emb|CAA29023.1| PR-1c protein [Nicotiana tabacum]
Length=161

 Score =   114 bits (286),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENL
Sbjct  22   HAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS-HGQYGENL  80

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AWGSG F+T  +AVE+WV+EK++Y + +N+C    G+ C
Sbjct  81   AWGSGDFLTAAKAVEMWVNEKQYYAHDSNTC--AQGQVC  117



>ref|XP_010527028.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Tarenaya 
hassleriana]
Length=164

 Score =   114 bits (286),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 4/99 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS-GDRRYGENL  301
            AQ+SPQDY+  HN AR  VGVGP++WDN VAA AQ+YA +RAGDC+LIHS G  RYGENL
Sbjct  25   AQDSPQDYVNAHNRARAEVGVGPVSWDNTVAAFAQNYARQRAGDCRLIHSGGGGRYGENL  84

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A  +G  +TG  AV LWV+EK  Y+Y +N+C   PG+ C
Sbjct  85   AMSTGG-LTGVDAVALWVNEKVDYDYNSNTCR--PGKVC  120



>emb|CAA31008.1| PR1a preprotein [Nicotiana tabacum]
Length=165

 Score =   114 bits (286),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENLA
Sbjct  27   AQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS-HGQYGENLA  85

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG FMT  +AVE+WVDEK++Y++ +N+C
Sbjct  86   EGSGDFMTAAKAVEMWVDEKQYYDHDSNTC  115



>ref|XP_006367091.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=179

 Score =   115 bits (287),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 75/100 (75%), Gaps = 8/100 (8%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR+ VGVGPMTWDN +AA AQ+YAN+RAGDC++ HSG   YGENLA
Sbjct  23   AQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDCRMQHSGG-PYGENLA  81

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
                AF  +    AV++W DEK+WYNY +N+C A  G+ C
Sbjct  82   ---AAFPQLNAAGAVKMWFDEKQWYNYNSNTCQA--GKVC  116



>dbj|BAA14220.1| PR1a protein precursor [Nicotiana tabacum]
 prf||1501385A pathogenesis related protein PR1a
Length=168

 Score =   114 bits (286),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENLA
Sbjct  30   AQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS-HGQYGENLA  88

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             GSG FMT  +AVE+WVDEK++Y++ +N+C+   G+ C
Sbjct  89   EGSGDFMTAAKAVEMWVDEKQYYDHDSNTCSQ--GQVC  124



>ref|XP_010943437.1| PREDICTED: pathogenesis-related protein 1B-like [Elaeis guineensis]
Length=191

 Score =   115 bits (287),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR+AVGVGPMTWDN +A  A +YAN R GDC+L+HS    YGENL 
Sbjct  27   AQNSPQDYLQPHNAARRAVGVGPMTWDNTLARYALNYANTRTGDCRLVHSRG-PYGENLY  85

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
              S +  T  RAV  WVDE+++Y+Y TN+C
Sbjct  86   MSSPSIATAARAVGAWVDERRFYDYRTNTC  115



>gb|AAB06458.1| pathogenesis-related protein PR1 [Brassica napus]
 gb|ABS11041.1| pathogenesis-related protein [Brassica oleracea var. gemmifera]
 emb|CDX89633.1| BnaC03g45470D [Brassica napus]
Length=162

 Score =   114 bits (285),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HN ARQAVGVGP+ WD  +AA AQSYA++  GDC+L+HSG   YGENLA
Sbjct  26   AQNSPQDYVNAHNQARQAVGVGPVQWDGTLAAFAQSYADRLRGDCRLVHSGG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            W S  F +G  AV LWV+EK  YNYA+N+C
Sbjct  85   WSSADF-SGVSAVNLWVNEKANYNYASNTC  113



>ref|XP_009798466.1| PREDICTED: pathogenesis-related protein 1A [Nicotiana sylvestris]
Length=168

 Score =   114 bits (285),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENLA
Sbjct  30   AQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS-HGQYGENLA  88

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG FMT  +AVE+WVDEK++Y++ +N+C
Sbjct  89   EGSGDFMTAAKAVEMWVDEKQYYDHDSNTC  118



>gb|KDP37607.1| hypothetical protein JCGZ_06950 [Jatropha curcas]
Length=162

 Score =   114 bits (285),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            NAQ +P+DYL  HN AR  VG+GPM+WD  VAA AQ+YAN+   +C L+HS +  YGENL
Sbjct  24   NAQQTPEDYLNAHNQARAVVGLGPMSWDKKVAAYAQNYANQHVSECNLVHS-EGPYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AWGSG  ++G  AV++WVDEK +Y+Y +NSC   PG  C
Sbjct  83   AWGSGD-LSGEEAVKMWVDEKTYYDYNSNSC--APGRVC  118



>gb|EEC81457.1| hypothetical protein OsI_24759 [Oryza sativa Indica Group]
 gb|EEE66502.1| hypothetical protein OsJ_22957 [Oryza sativa Japonica Group]
Length=149

 Score =   114 bits (284),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 72/101 (71%), Gaps = 2/101 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGEN  298
             AQNS QD++  HNAAR  VGVGP++WD+ VAA A+SYA +R GDCKL HS    +YGEN
Sbjct  4    TAQNSAQDFVDPHNAARADVGVGPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGEN  63

Query  299  LAWGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            + WGS G   T   AV  WV EK+WY++ +NSC+AP G SC
Sbjct  64   IFWGSAGGDWTAASAVSAWVSEKQWYDHGSNSCSAPEGSSC  104



>gb|AEL99925.1| pathogenesis-related protein 1 [Nicotiana benthamiana]
Length=160

 Score =   114 bits (284),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENLA
Sbjct  22   AQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS-HGQYGENLA  80

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG FMT  +AVE+WVDEK++Y++ +N+C
Sbjct  81   EGSGDFMTAAKAVEMWVDEKQYYDHDSNTC  110



>dbj|BAD11072.1| pathogenesis-related protein 1 [Capsicum chinense]
Length=161

 Score =   114 bits (284),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 67/91 (74%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL VHN AR  VGVGPMTWD  +A+ AQ+YAN R GDC LIHSG    GENL
Sbjct  23   DAQNSPQDYLEVHNNARAQVGVGPMTWDAGLASRAQNYANSRTGDCNLIHSGP---GENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G G F TGR AVELWV EK  YN+ TN C
Sbjct  80   AKGGGDF-TGRAAVELWVFEKPNYNHGTNQC  109



>ref|XP_010691521.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
Length=166

 Score =   114 bits (285),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS-GDRRYGEN  298
            +AQNSPQDY+  HNAAR AVGVG + WD+ VAA AQ YAN+R GDC L HS G  RYGEN
Sbjct  25   HAQNSPQDYVNAHNAARAAVGVGNIQWDDQVAAFAQEYANERKGDCALRHSGGGGRYGEN  84

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            LA  +G+ +TG  +V+LWVDEK  YNY +N+C
Sbjct  85   LAASTGSSLTGTESVKLWVDEKVDYNYDSNNC  116



>sp|P08299.1|PR1A_TOBAC RecName: Full=Pathogenesis-related protein 1A; Short=PR-1A; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA31233.1| unnamed protein product [Nicotiana tabacum]
 emb|CAA29392.1| PR-1a precursor (AA -30 to 138) [Nicotiana tabacum]
 emb|CAA29660.1| PR1a precursor (AA -30 to -1) [Nicotiana tabacum]
Length=168

 Score =   114 bits (285),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENLA
Sbjct  30   AQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS-HGQYGENLA  88

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG FMT  +AVE+WVDEK++Y++ +N+C
Sbjct  89   EGSGDFMTAAKAVEMWVDEKQYYDHDSNTC  118



>ref|XP_006422707.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
 gb|ESR35947.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
Length=159

 Score =   114 bits (284),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR +V VGPM WDN VAA A++YAN+R GDC+L+HSG   YGENL
Sbjct  21   SAQNSQQDYLRAHNEARASVRVGPMRWDNKVAAYAKNYANQRKGDCRLVHSGG-PYGENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            AW SG  +TG  AV+LWVDE+  YNY +N+C
Sbjct  80   AWSSGD-LTGTAAVKLWVDERPKYNYNSNTC  109



>ref|XP_010065847.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
 gb|KCW63537.1| hypothetical protein EUGRSUZ_G01173 [Eucalyptus grandis]
Length=158

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HNAAR+ VGV  MTWDN +AA AQSYAN+R  DC L+HS +  YGENL
Sbjct  20   HAQNSPQDYLNSHNAARKQVGVANMTWDNTLAAYAQSYANQRVSDCGLVHS-NGPYGENL  78

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G+G F TG  AV LWV EK+ YNY TN+C
Sbjct  79   AKGTGTF-TGTYAVSLWVTEKQNYNYNTNTC  108



>ref|XP_004168740.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQN+PQDY+++HN AR AVGVGPMTW+N VAA AQSYANKR  DC LIHS    YGEN+
Sbjct  16   HAQNAPQDYISLHNKARAAVGVGPMTWNNTVAAYAQSYANKRKNDCALIHS-TGPYGENI  74

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G     TG   V++WV EK  Y+YA+NSC
Sbjct  75   AVGYYPEFTGADGVKMWVGEKHLYDYASNSC  105



>ref|XP_006644187.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Oryza brachyantha]
Length=168

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 74/100 (74%), Gaps = 4/100 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDR-RYGENL  301
            AQNSPQDY+ +HNAAR AVGVGP+TWD +V A A+SYA +RAGDC+LIHS +R   GENL
Sbjct  26   AQNSPQDYVRLHNAARAAVGVGPVTWDPSVQAFAESYARQRAGDCRLIHSPNRDNLGENL  85

Query  302  AWGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGS G   T   AV LWV EK  YNYA+NSC A  G+ C
Sbjct  86   FWGSAGKDWTAADAVNLWVGEKGDYNYASNSCAA--GKVC  123



>ref|XP_009787159.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana sylvestris]
Length=179

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 76/100 (76%), Gaps = 8/100 (8%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR+ VGVGPMTWDN VAA AQ+YAN+RAGDC++ HSG   YGENLA
Sbjct  23   AQNSPQDYLNAHNAARRRVGVGPMTWDNRVAAFAQNYANQRAGDCRMQHSGG-PYGENLA  81

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
                AF  +    AV++WVDEK++Y+Y +NSC A  G+ C
Sbjct  82   ---AAFPQLNAAGAVKMWVDEKQFYDYNSNSCAA--GKVC  116



>gb|ACN52596.1| pathogenesis-related protein, partial [Pyrus x bretschneideri]
Length=132

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++PQDYL  HN AR AVGVGP+TWD+NVA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  23   HAQDTPQDYLNSHNTARAAVGVGPLTWDDNVAGYAQNYANQHVGDCNLVHSGG-PYGENL  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A  +G  M+G  AV+LWV EK  YNY +NSC
Sbjct  82   AMSTGD-MSGTAAVDLWVAEKADYNYESNSC  111



>dbj|BAL63013.1| pathogenesis-related protein 1-1a, partial [Cucumis sativus]
Length=131

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLAW  307
            Q+SPQD++ VHN AR  VGVGP+ WD  VA+ AQ YAN+R  DC+L++SG   YGEN+AW
Sbjct  1    QDSPQDFVGVHNVARAQVGVGPIEWDKTVASFAQQYANRRFNDCRLVNSGG-PYGENIAW  59

Query  308  GSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            GS   ++ + AV+LWVDEK +YNY TN+C A  GE C
Sbjct  60   GSPD-LSAKDAVQLWVDEKPFYNYETNTCAA--GELC  93



>gb|AAZ94265.1| pathogenesis-related 1a [Triticum monococcum]
Length=167

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 3/100 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL-  301
            AQNSPQD++  HNAAR  VGVGP+TWD+NVAA AQ+YA +R GDC+L+HSG  +YGEN+ 
Sbjct  24   AQNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGG-QYGENIY  82

Query  302  -AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
               G GA  T   AV+ WV EK++Y++ +NSC+AP  +SC
Sbjct  83   GGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSC  122



>ref|XP_009398310.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=163

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD+++ HNAAR AVGVGP++WDN VAA AQ+YAN+RA DC+L+HSG   YGEN+ 
Sbjct  25   AQNSPQDFVSPHNAARAAVGVGPVSWDNTVAAYAQNYANQRAADCQLVHSGG-PYGENIF  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGSG   T   AV  WV EK+ Y+Y +N C   P + C
Sbjct  84   WGSGRDYTAADAVNAWVSEKQDYDYNSNKC--APNKVC  119



>gb|EMT32398.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=180

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
             AQNSPQD++  HNAAR  VGVGP+TWD+NVAA AQ+YA +R GDC+L+HSG  +YGEN+
Sbjct  23   TAQNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGG-QYGENI  81

Query  302  --AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
                G GA  T   AV+ WV EK++Y++ +NSC+AP  +SC
Sbjct  82   YGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSC  122



>ref|XP_004968783.1| PREDICTED: pathogenesis-related protein PRMS-like [Setaria italica]
Length=166

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HN AR AVGVGP+TW   +   A+SYA +RAGDC+L HSG   YGEN+
Sbjct  25   SAQNSPQDYLTPHNQARAAVGVGPVTWSTKLQQFAESYAAQRAGDCRLQHSGG-PYGENI  83

Query  302  AWGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGS GA      AV+ WVDEK+WYNYA+NSC A  G+ C
Sbjct  84   FWGSAGANWKAADAVKSWVDEKQWYNYASNSCAA--GKVC  121



>gb|AEH25634.1| pathogenesis-related protein 1-19 [Triticum aestivum]
 gb|AHE81262.1| pathogenesis-related protein 1-19 [Triticum aestivum]
 gb|AHE81283.1| pathogenesis-related protein 1-19 [Triticum aestivum]
Length=167

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
             AQNSPQD++  HNAAR  VGVGP+TWD+NVAA AQ YA +R GDC+L+HSG  +YGEN+
Sbjct  23   TAQNSPQDFVDPHNAARANVGVGPVTWDDNVAAYAQKYAEQRRGDCQLVHSGG-QYGENI  81

Query  302  --AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
                G GA  T   AV+ WV EK++Y++ +NSC+AP  +SC
Sbjct  82   YGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSC  122



>ref|XP_002313936.2| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE87891.2| pathogenesis-related family protein [Populus trichocarpa]
Length=160

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (76%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ++PQDYL  HNAAR AVGVGP+TWDN V A AQ+YA++RAGDC L+ SG   YGE L 
Sbjct  23   AQDNPQDYLDAHNAARAAVGVGPLTWDNTVQAYAQAYASQRAGDCNLVLSGG-PYGEILQ  81

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            W S A ++G  AV+LWVDEK +Y+Y +NSC +  G+ C
Sbjct  82   W-SSADLSGTDAVKLWVDEKAFYDYNSNSCAS--GQQC  116



>gb|AEX55228.1| pathogenesis-related protein 1 [Allium sativum]
Length=165

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 4/100 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKR-AGDCKLIHSGDRRYGEN  298
            NAQNSPQDY+  HN+ R  VGVGP++WD N+AA AQ+YAN++  GDC L+HSG   YGEN
Sbjct  25   NAQNSPQDYVNAHNSVRGQVGVGPVSWDQNLAAYAQNYANQQIGGDCHLVHSGG-PYGEN  83

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            L  GSGA  TG  AV LW  EK++Y+Y +N+C+  PG  C
Sbjct  84   LFGGSGAAFTGLDAVNLWASEKQYYHYDSNTCD--PGRVC  121



>ref|XP_010053002.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
 gb|KCW77216.1| hypothetical protein EUGRSUZ_D01570 [Eucalyptus grandis]
Length=158

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HNAAR+ VGV  MTWDN +AA AQSYAN+R  DC L+HS +  YGENL
Sbjct  20   HAQNSPQDYLNSHNAARKQVGVANMTWDNTLAAYAQSYANQRVSDCGLVHS-NGPYGENL  78

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G+G F TG  AV LWV EK+ YNY TN+C
Sbjct  79   AKGTGTF-TGTYAVSLWVAEKQNYNYDTNTC  108



>gb|AAF78528.1|AF195237_1 pathogenesis-related protein [Pyrus pyrifolia]
Length=142

 Score =   112 bits (280),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++PQDYL  HN AR AVGVGP+TWD+NVA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  23   HAQDTPQDYLNSHNTARAAVGVGPLTWDDNVAGYAQNYANQHVGDCNLVHSGG-PYGENL  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A  +G  M+G  AV+LWV EK  YNY +NSC
Sbjct  82   AMSTGD-MSGTAAVDLWVAEKADYNYESNSC  111



>gb|AFM76999.1| pathogenesis related protein 1a, partial [Pyrus communis]
Length=153

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++PQDYL  HN AR AVGVGP+TWD+NVA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  15   HAQDTPQDYLNSHNTARAAVGVGPLTWDDNVAGYAQNYANQHVGDCSLVHSGG-PYGENL  73

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A  +G  M+G  AV+LWV EK  YNY +NSC
Sbjct  74   AMSTGD-MSGTAAVDLWVAEKADYNYESNSC  103



>emb|CDO97325.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDY+  HNAAR  VGVGP+ WD+ VAA AQ+YAN+R  DC L+HSG  RYGENLA
Sbjct  24   AQNSQQDYVDAHNAARAQVGVGPIAWDDTVAAYAQNYANQRINDCNLVHSGG-RYGENLA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             GSG  +TGR AV LWV EK++Y+Y +N+C    G+ C
Sbjct  83   EGSGD-LTGRDAVNLWVSEKQYYDYNSNTC--AQGQQC  117



>ref|XP_006367092.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=178

 Score =   113 bits (282),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HN AR+ VGVGPM WDN +AA AQ+YAN+R GDC++ HSG   YGENLA
Sbjct  20   AQNSPQDYLNPHNEARRQVGVGPMAWDNRLAAFAQNYANQRIGDCRMQHSGG-PYGENLA  78

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             G    +    AV++WVDEK+WY+Y +NSC   PG+ C
Sbjct  79   AGFPQ-LNAAGAVKMWVDEKQWYDYNSNSCQ--PGKVC  113



>ref|XP_006486819.1| PREDICTED: pathogenesis-related protein 1-like, partial [Citrus 
sinensis]
Length=154

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR +V +GPM WDN VAA AQ+YAN+R  DC+L+HSG   YGENL
Sbjct  16   SAQNSQQDYLRAHNEARASVRIGPMRWDNKVAAYAQNYANQRKADCRLVHSGG-PYGENL  74

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            AW SG  +TG  AV+LWVDE+  YNY +N+C
Sbjct  75   AWSSGD-LTGTAAVKLWVDERPKYNYNSNTC  104



>gb|EAZ02649.1| hypothetical protein OsI_24760 [Oryza sativa Indica Group]
 gb|EAZ38569.1| hypothetical protein OsJ_22958 [Oryza sativa Japonica Group]
Length=149

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGEN  298
             AQNS QDY+  HNAAR  VGVGP++WD+ VAA A+SYA +R GDC L HS    +YGEN
Sbjct  4    TAQNSAQDYVDAHNAARSDVGVGPVSWDDTVAAYAESYAAQRQGDCALEHSDSGGKYGEN  63

Query  299  LAWGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            + WGS G   T   AV  WV EK+WY++ +NSC+AP G SC
Sbjct  64   IFWGSAGGDWTAASAVSSWVAEKQWYDHDSNSCSAPAGSSC  104



>ref|XP_002274275.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
Length=161

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HN AR  VGVG MTWD+ VA  AQ+YAN+R GDC L+HSG   YGENLA
Sbjct  25   AQNSPQDYVNAHNTARAQVGVGSMTWDDTVATYAQNYANQRIGDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV +WV EK +Y+Y +NSC
Sbjct  84   WGSPS-LTGTDAVNMWVAEKPYYDYNSNSC  112



>ref|XP_008346349.1| PREDICTED: pathogenesis-related protein 1-like [Malus domestica]
Length=161

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++PQDYL  HNAAR AVGVGP+TWD+NVA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  23   HAQDTPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQNYANQHVGDCNLVHSGG-PYGENL  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A  +G  M+G  AV+LWV EK  Y+Y +NSC A  G+ C
Sbjct  82   AMSTGD-MSGTAAVDLWVAEKADYSYESNSCAA--GKVC  117



>gb|AHE81280.1| pathogenesis-related protein 1-16 [Triticum aestivum]
Length=167

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
             AQNSPQD++  HNAAR  +GVGP+TWD+NVAA AQ+YA +R GDC+L+HSG  +YGEN+
Sbjct  23   TAQNSPQDFVDPHNAARADMGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGG-QYGENI  81

Query  302  --AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
                G GA  T   AV+ WV EK++Y++ +NSC+AP  +SC
Sbjct  82   YGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSC  122



>gb|AHE81259.1| pathogenesis-related protein 1-16 [Triticum aestivum]
Length=167

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
             AQNSPQD++  HNAAR  +GVGP+TWD+NVAA AQ+YA +R GDC+L+HSG  +YGEN+
Sbjct  23   TAQNSPQDFVDPHNAARADMGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGG-QYGENI  81

Query  302  --AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
                G GA  T   AV+ WV EK++Y++ +NSC+AP  +SC
Sbjct  82   YGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSC  122



>gb|AEH25631.1| pathogenesis-related protein 1-16 [Triticum aestivum]
Length=167

 Score =   112 bits (281),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%), Gaps = 3/101 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
             AQNSPQD++  HNAAR  +GVGP+TWD+NVAA AQ+YA +R GDC+L+HSG  +YGEN+
Sbjct  23   TAQNSPQDFVDPHNAARADMGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGG-QYGENI  81

Query  302  --AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
                G GA  T   AV+ WV EK++Y++ +NSC+AP  +SC
Sbjct  82   YGGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSC  122



>ref|XP_009342365.1| PREDICTED: pathogenesis-related protein 1-like [Pyrus x bretschneideri]
Length=161

 Score =   112 bits (280),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++PQDYL  HN AR AVGVGP+TWD+NVA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  23   HAQDTPQDYLNSHNTARAAVGVGPLTWDDNVAGYAQNYANQHVGDCNLVHSGG-PYGENL  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A  +G  M+G  AV+LWV EK  YNY +NSC
Sbjct  82   AMSTGD-MSGTAAVDLWVAEKADYNYESNSC  111



>gb|AEH25622.1| pathogenesis-related protein 1-7 [Triticum aestivum]
 gb|AHE81250.1| pathogenesis-related protein 1-7 [Triticum aestivum]
 gb|AHE81271.1| pathogenesis-related protein 1-7 [Triticum aestivum]
Length=165

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGEN  298
             AQNS QD++  HNAAR  VG+G +TWD  VAA AQ YA++R GDC+LIH+ D R YGEN
Sbjct  21   TAQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRRGDCQLIHTPDGRPYGEN  80

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            L  G G   T   AV  WV EK++Y++ +N+C+AP GESC
Sbjct  81   LYGGGGTEWTATDAVNSWVSEKQYYDHDSNTCSAPEGESC  120



>gb|ADN43436.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVGP+TW++ VAA AQ+YAN+R GDC L+HSG   YGEN+A
Sbjct  25   AQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQNYANQRIGDCNLVHSGG-PYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV LWV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTGTDAVNLWVGEKPNYDYNSNSC  112



>gb|ABK55610.1| pathogenesis-related protein PR1c [Oryza sativa Indica Group]
Length=167

 Score =   112 bits (280),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL+  NAAR AVGVGPM+W   +   A+SYA +R GDC+L HSG   YGEN+
Sbjct  26   DAQNSPQDYLSPQNAARSAVGVGPMSWSTKLQGFAESYARQRKGDCRLQHSGG-PYGENI  84

Query  302  AWGS-GAFMTGRRAVELWVDEKKWYNYATNSCNA  400
             WGS GA  T   AV  WVDEKK+YNYA+NSC A
Sbjct  85   FWGSAGADWTAADAVRSWVDEKKYYNYASNSCAA  118



>gb|AAT46023.1| pathogenesis-related protein 1 [Brassica rapa subsp. oleifera]
Length=161

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDY   HN ARQAVGVGP+ WD  +AA AQ+YA++  GDC+L+HSG R YGENLA
Sbjct  26   AQDSPQDYANAHNQARQAVGVGPVQWDGTLAAYAQNYADRLRGDCRLVHSG-RPYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
             GS   ++G RAV LWV EK  YNY +N+CN   G 
Sbjct  85   -GSSGDLSGVRAVNLWVSEKASYNYPSNTCNGVCGH  119



>ref|XP_010691519.1| PREDICTED: pathogenesis-related protein 1A-like [Beta vulgaris 
subsp. vulgaris]
Length=166

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+P+DY+AVHNAAR AVGVGP+ W + VAA AQ YAN+RA DC+L+HS +  YGEN+A
Sbjct  27   AQNTPKDYIAVHNAARAAVGVGPLAWSDTVAAYAQQYANQRAADCRLVHS-NTNYGENIA  85

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSCN  397
             G G++  ++G   V+LW++EK  Y+Y +NSC 
Sbjct  86   EGYGSYGALSGVDGVKLWINEKSMYDYHSNSCT  118



>gb|AFK37568.1| unknown [Medicago truncatula]
 gb|KEH37178.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=183

 Score =   112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL +HN AR  VGVGP++WD  VA+ A++Y NK   +CK++HS    YGENLA
Sbjct  26   AQNSPQDYLKIHNKARSDVGVGPISWDAKVASYAETYVNKLKANCKMVHS-KGPYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            W SG  MTG  AV +W+ EKK+YNY +NSC
Sbjct  85   WSSGD-MTGTAAVTMWIGEKKYYNYNSNSC  113



>emb|CAA65420.1| pathogenesis-related protein 1 [Arabidopsis thaliana]
Length=169

 Score =   112 bits (280),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQD+LAVHN AR  VGVGP+ WD  VAA A++YAN+R GDC + HS    YGENLA
Sbjct  26   AQDSPQDFLAVHNRARAEVGVGPLRWDEKVAAYARNYANQRKGDCAMKHSSG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            W SG  +TGRRAV++WVDE+  Y+Y +N+C
Sbjct  85   WSSGR-LTGRRAVDMWVDEQFDYDYDSNTC  113



>emb|CAA30017.1| unnamed protein product [Nicotiana tabacum]
Length=168

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+YA++ A DC L+HS   +YGENLA
Sbjct  30   AQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS-HGQYGENLA  88

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG FMT  +AVE+WV+EK++Y++ +N+C
Sbjct  89   EGSGDFMTAAKAVEMWVNEKQYYDHDSNTC  118



>ref|NP_001058815.1| Os07g0129200 [Oryza sativa Japonica Group]
 dbj|BAC84842.1| PR-1 type pathogenesis-related protein PR-1a [Oryza sativa Japonica 
Group]
 dbj|BAD31924.1| PR-1 type pathogenesis-related protein PR-1a [Oryza sativa Japonica 
Group]
 dbj|BAF20729.1| Os07g0129200 [Oryza sativa Japonica Group]
 gb|ABK55608.1| pathogenesis-related protein PR1a [Oryza sativa Indica Group]
Length=168

 Score =   112 bits (279),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGENLA  304
            QNS QD++  HNAAR  VGVGP++WD+ VAA A+SYA +R GDCKL HS    +YGEN+ 
Sbjct  25   QNSAQDFVDPHNAARADVGVGPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENIF  84

Query  305  WGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS G   T   AV  WV EK+WY++ +NSC+AP G SC
Sbjct  85   WGSAGGDWTAASAVSAWVSEKQWYDHGSNSCSAPEGSSC  123



>gb|KDP37604.1| hypothetical protein JCGZ_06947 [Jatropha curcas]
Length=162

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            NAQ +P+DYL  HN AR  VG+GPM+WD  VAA AQ+YAN+   +C L+HS +  YGENL
Sbjct  24   NAQQTPEDYLNAHNQARAVVGLGPMSWDKKVAAYAQNYANQHVSECNLVHS-EGPYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AWGSG  ++   AV++WVDEK +Y+Y +NSC   PG+ C
Sbjct  83   AWGSGD-LSVEEAVKMWVDEKTYYDYNSNSC--APGQVC  118



>gb|AAG44566.1|AF251277_1 acidic PR-1 type pathogenesis-related protein PR-1a [Oryza sativa 
Japonica Group]
 emb|CAC03571.1| PR1a protein [Oryza sativa Japonica Group]
Length=168

 Score =   112 bits (279),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGENLA  304
            QNS QD++  HNAAR  VGVGP++WD+ VAA A+SYA +R GDCKL HS    +YGEN+ 
Sbjct  25   QNSAQDFVDPHNAARADVGVGPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENIF  84

Query  305  WGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS G   T   AV  WV EK+WY++ +NSC+AP G SC
Sbjct  85   WGSPGGDWTAASAVSAWVSEKQWYDHGSNSCSAPEGSSC  123



>gb|AAF62171.1| pathogenesis-related protein 1 [Betula pendula]
Length=102

 Score =   110 bits (274),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 71/98 (72%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            +QNSPQDYL  HN AR AVGV  +TWD+ VAA AQ+YANK  GDC L+HSG   YGENLA
Sbjct  1    SQNSPQDYLKAHNDARAAVGVAALTWDDKVAAYAQNYANKHIGDCNLVHSGG-PYGENLA  59

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
              SG  ++G  AV+LWVDEK  YNY +NSC A  G+ C
Sbjct  60   ASSGD-LSGTAAVKLWVDEKANYNYNSNSCAA--GKVC  94



>ref|XP_004504945.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cicer arietinum]
Length=163

 Score =   111 bits (278),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            NAQNSPQDYL  HN AR  VGV  +TWDN VA  A +YAN R GDC L+HS    YGENL
Sbjct  24   NAQNSPQDYLNAHNIARAQVGVANITWDNTVATYALNYANSRIGDCNLVHSSG-SYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GS    TG  AV LWV+EK++Y+Y TNSC
Sbjct  83   AKGSSGSFTGITAVNLWVNEKQYYDYNTNSC  113



>ref|XP_010052995.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
 gb|KCW77197.1| hypothetical protein EUGRSUZ_D01546 [Eucalyptus grandis]
Length=158

 Score =   111 bits (278),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HNAAR+ VGV  MTWDN +AA AQSY N+R  DC L+HS +  YGENL
Sbjct  20   HAQNSPQDYLDSHNAARKQVGVANMTWDNTLAAYAQSYVNQRVSDCGLVHS-NGAYGENL  78

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G+G F TG  AV LWV EK+ YNY TN+C
Sbjct  79   AKGTGTF-TGTYAVNLWVVEKQNYNYNTNTC  108



>ref|XP_009605696.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana tomentosiformis]
Length=179

 Score =   112 bits (280),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR+ VGVGPMTWDN +AA AQ+YAN+RAGDC++ HSG   YGENLA
Sbjct  23   AQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDCRMQHSGG-PYGENLA  81

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
              +   +    AV++WVDEK++YNY +N+C A  G+ C
Sbjct  82   -AAYPQLHAAGAVKMWVDEKQFYNYNSNTCAA--GKVC  116



>ref|XP_009342367.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Pyrus 
x bretschneideri]
Length=161

 Score =   111 bits (278),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++PQDYL  HNAAR AVGVGP+TWD+NVA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  23   HAQDTPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQNYANQHVGDCNLVHSGG-PYGENL  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A  S   M+G  AV++WV EK  YNY +NSC
Sbjct  82   AM-SSVDMSGTAAVDMWVAEKADYNYESNSC  111



>gb|ADN43431.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVGP+TW++ VAA AQ+YAN+R GDC L+HSG   YGEN+A
Sbjct  25   AQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQNYANQRIGDCNLVHSGG-PYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV +WV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTGTDAVNMWVGEKPNYDYNSNSC  112



>ref|XP_008651988.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Zea mays]
 tpg|DAA59477.1| TPA: hypothetical protein ZEAMMB73_881711 [Zea mays]
Length=167

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 4/100 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS--GDRRYGEN  298
            AQNSPQD++  HNAAR AVGVGP++WD NVAA A+SYA +R GDCKL+HS  G   YGEN
Sbjct  25   AQNSPQDFVNPHNAARAAVGVGPVSWDENVAAFARSYAAQRQGDCKLVHSGGGPNHYGEN  84

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            + WG G+      AV LWV EK+ Y+Y +NSC A  G+ C
Sbjct  85   IFWGGGSAWKASDAVGLWVGEKQNYDYNSNSCAA--GKVC  122



>gb|AFK35640.1| unknown [Medicago truncatula]
Length=186

 Score =   112 bits (280),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 2/92 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS-GDRRYGEN  298
            NAQNS  DY+  HN AR+ VGVG + WDN VA+ AQ YAN+R GDC+LIHS G  RYGEN
Sbjct  26   NAQNSRADYVNAHNDARRQVGVGDIVWDNTVASFAQDYANQRKGDCQLIHSGGGGRYGEN  85

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            LAW SG  M+G  AV+LWV+EK  YNY +N+C
Sbjct  86   LAWSSGD-MSGSDAVKLWVNEKADYNYNSNTC  116



>emb|CAN68901.1| hypothetical protein VITISV_019988 [Vitis vinifera]
Length=150

 Score =   111 bits (277),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  V VGPMTW+N VAA AQSYANK+ GDC L+HS +  YGENLA
Sbjct  14   AQNSQQDYLNAHNTARAQVSVGPMTWNNTVAAYAQSYANKQIGDCNLVHS-NGPYGENLA  72

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG+F TG  AV LWV EK  Y+Y++NSC
Sbjct  73   KGSGSF-TGTAAVNLWVAEKPNYDYSSNSC  101



>ref|XP_003593453.1| Pathogenesis-related protein 1a [Medicago truncatula]
 gb|AES63704.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
 gb|KEH29735.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=181

 Score =   112 bits (279),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 2/92 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS-GDRRYGEN  298
            NAQNS  DY+  HN AR+ VGVG + WDN VA+ AQ YAN+R GDC+LIHS G  RYGEN
Sbjct  21   NAQNSRADYVNAHNDARRQVGVGDIVWDNTVASFAQDYANQRKGDCQLIHSGGGGRYGEN  80

Query  299  LAWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            LAW SG  M+G  AV+LWV+EK  YNY +N+C
Sbjct  81   LAWSSGD-MSGSDAVKLWVNEKADYNYNSNTC  111



>ref|XP_010252392.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=162

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ++P DYL  HNAAR  VGVGP+TWD+NVAA AQ+YAN+RAGDC ++HSG   YGENLA
Sbjct  26   AQDAPADYLNAHNAARADVGVGPLTWDDNVAAYAQAYANERAGDCAMVHSGG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             G+ + ++G  AVE WV EK++Y+Y++NSC
Sbjct  85   TGTPS-LSGTAAVEGWVGEKQYYDYSSNSC  113



>ref|XP_006299028.1| hypothetical protein CARUB_v10015165mg [Capsella rubella]
 gb|EOA31926.1| hypothetical protein CARUB_v10015165mg [Capsella rubella]
Length=161

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDYL VHN AR AVGVG M WD  VAA A++YAN+  G C+L+HSG   YGENLA
Sbjct  26   AQDSPQDYLRVHNQARAAVGVGAMQWDETVAAYARNYANQLRGSCRLVHSGG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
            WGSG  ++G  AV +WV+E+  YNYA N+CN   G 
Sbjct  85   WGSGD-LSGVSAVNMWVNERVNYNYAANTCNGVCGH  119



>ref|XP_006486820.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   111 bits (278),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 76/99 (77%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ+SPQDY+  HNAAR  VGVGP+TWD+ VA+ AQ+YAN+R GDC L+HSG   YGENL
Sbjct  24   HAQDSPQDYVNAHNAARAQVGVGPVTWDDRVASYAQNYANQRKGDCNLVHSGG-PYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AW S A ++G  AV+LWV+EK  Y+Y +N+C A  G+ C
Sbjct  83   AW-SSAGLSGTDAVKLWVNEKADYHYNSNTCAA--GKVC  118



>ref|XP_009378592.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Pyrus 
x bretschneideri]
Length=161

 Score =   111 bits (277),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++PQDYL  HNAAR AVGVGP+TWD+NVA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  23   HAQDTPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQNYANQHVGDCNLVHSGG-PYGENL  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A  S   M+G  AV++WV EK  YNY +NSC
Sbjct  82   AM-SSVDMSGTAAVDMWVAEKADYNYESNSC  111



>emb|CAA47374.1| prb-1b [Nicotiana tabacum]
Length=179

 Score =   112 bits (279),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR+ VGVGPMTWDN +AA AQ+YAN+RAGDC++ HSG   YGENLA
Sbjct  23   AQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYANQRAGDCRMQHSGG-PYGENLA  81

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNA  400
              +   +    AV++WVDEK++YNY +N+C A
Sbjct  82   -AAYPQLHAAGAVKMWVDEKQFYNYNSNTCAA  112



>gb|ADN43432.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   111 bits (277),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVGP+TW++ VAA AQ+YAN+R GDC L+HSG   YGEN+A
Sbjct  25   AQNSPQDYVDSHNAARAQVGVGPITWNDTVAAYAQNYANQRIGDCNLVHSGG-PYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV +WV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTGTDAVNMWVGEKPNYDYNSNSC  112



>gb|ADN43437.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=161

 Score =   111 bits (277),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVGP+TW++ VAA AQ+YAN+R GDC L+HSG   YGEN+A
Sbjct  25   AQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQNYANQRIGDCNLVHSGG-PYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV +WV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTGTDAVNMWVGEKPNYDYNSNSC  112



>dbj|BAK01044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQN+PQD++ +HN AR A GVGP+TWDN+VA  AQ YANKRA DC+L HSG   +GEN+
Sbjct  24   SAQNTPQDFVNLHNRARAADGVGPVTWDNSVAKFAQDYANKRAADCRLQHSGG-PFGENI  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG   T   AV+ WVDEK+ Y++ TN+C+A  G+ C
Sbjct  83   FWGSGRSWTAANAVKSWVDEKRNYHHNTNTCDA--GKVC  119



>gb|KGN62935.1| hypothetical protein Csa_2G381130 [Cucumis sativus]
Length=328

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQN+PQDY+++HN AR AVGVGPMTW+N VAA AQSYANKR  DC LIHS    YGEN+
Sbjct  16   HAQNAPQDYISLHNKARAAVGVGPMTWNNTVAAYAQSYANKRKNDCALIHSTG-PYGENI  74

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G     TG   V++WV EK  Y+YA+NSC
Sbjct  75   AVGYYPEFTGADGVKMWVGEKHLYDYASNSC  105



>ref|NP_001058816.1| Os07g0129300 [Oryza sativa Japonica Group]
 gb|AAM45439.1|AF306651_1 pathogenesis-related protein 1 [Oryza sativa]
 dbj|BAC84723.1| pathogenesis-related protein 1 [Oryza sativa Japonica Group]
 dbj|BAF20730.1| Os07g0129300 [Oryza sativa Japonica Group]
Length=165

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGD-RRYGENLA  304
            QNS QDY+  HNAAR  VGVGP++WD+ VAA A+SYA +R GDC L HS    +YGEN+ 
Sbjct  22   QNSAQDYVDAHNAARSDVGVGPVSWDDTVAAYAESYAAQRQGDCALEHSDSGGKYGENIF  81

Query  305  WGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS G   T   AV  WV EK+WY++ +NSC+AP G SC
Sbjct  82   WGSAGGDWTAASAVSSWVAEKQWYDHDSNSCSAPAGSSC  120



>ref|XP_010054710.1| PREDICTED: pathogenesis-related leaf protein 6-like [Eucalyptus 
grandis]
Length=211

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HNAAR+ VGV  MTWDN +AA AQSYAN+R  DC L+HS +  YGENL
Sbjct  73   HAQNSPQDYLDSHNAARKQVGVANMTWDNMLAAYAQSYANQRVSDCGLVHS-NGPYGENL  131

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G+G F TG  AV LWV EK+ YNY TN+C
Sbjct  132  AKGTGTF-TGTYAVSLWVAEKQNYNYNTNTC  161



>ref|XP_006368144.1| PREDICTED: pathogenesis-related protein 1C-like, partial [Solanum 
tuberosum]
Length=153

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 3/96 (3%)
 Frame = +2

Query  131  NSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLAWG  310
            ++ QDYL  HN AR +VGV P TWD+ VAA AQ YA++ A DC L+HS   +YGENLA G
Sbjct  30   HAQQDYLDAHNTARASVGVEPFTWDDQVAAYAQQYASQLATDCNLVHS-HGQYGENLAAG  88

Query  311  SGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            SG FMT  +AVE+WVDEK++Y++ +N+C+   G+ C
Sbjct  89   SGDFMTATKAVEMWVDEKQYYHHDSNTCD--EGQVC  122



>gb|ADN43417.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGVG MTW+N VA+ AQ+YAN+R GDC L+HS +  YGEN+A
Sbjct  24   AQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS-NGPYGENIA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG+ +TG  AV LWV EK  Y+Y++NSC
Sbjct  83   WGSGS-LTGTDAVNLWVGEKPNYDYSSNSC  111



>gb|AFK64734.1| pathogenesis related protein 1a, partial [Cydonia oblonga]
Length=153

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++PQDYL  HNAAR AVGVGP+TWD+NVA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  15   HAQDAPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQNYANQHVGDCNLVHSGG-PYGENL  73

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A  +G  M+G  AV++WV EK  Y+Y +NSC
Sbjct  74   AMSTGD-MSGTAAVDMWVAEKADYDYESNSC  103



>gb|KCW63548.1| hypothetical protein EUGRSUZ_G01181, partial [Eucalyptus grandis]
Length=149

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HNAAR+ VGV  MTWDN +A  AQSYAN+R  DC L+HS +  YGENL
Sbjct  20   HAQNSPQDYLDSHNAARKQVGVVNMTWDNTLATYAQSYANQRVSDCSLVHS-NGPYGENL  78

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G+G F TG  AV LWV EK+ YNY TN+C
Sbjct  79   AKGTGTF-TGTYAVGLWVAEKQNYNYNTNTC  108



>gb|KDP37600.1| hypothetical protein JCGZ_06943 [Jatropha curcas]
Length=148

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ+SPQDY+  HN AR AVGVGP+TWDN VAA A++YAN+  GDC+L+HSG   YGENL
Sbjct  10   HAQDSPQDYVNAHNTARAAVGVGPVTWDNTVAAYARNYANQHIGDCRLVHSGG-PYGENL  68

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A GS   ++   AV+LWVDEK +Y+Y +N+C A  G+ C
Sbjct  69   A-GSSGDLSDPAAVKLWVDEKAFYDYNSNTCAA--GKVC  104



>ref|XP_006422714.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
 gb|ESR35954.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
Length=163

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ+ PQDY+  HNAAR  VGVGP+TWD+ VA+ AQ+YANKR GDC L+HSG   YGENL
Sbjct  24   HAQDLPQDYVNAHNAARAQVGVGPVTWDDRVASYAQNYANKRKGDCNLVHSGG-PYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AW S A ++G  AV+LWV+EK  Y+Y +N+C A  G+ C
Sbjct  83   AW-SSAGLSGTDAVKLWVNEKADYDYNSNTCAA--GKVC  118



>ref|XP_006345692.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
Length=159

 Score =   110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYLAVHN AR  V VGPM+WD  +A  AQ YA+ R GDC LIHSG    GENL
Sbjct  23   DAQNSPQDYLAVHNNARAQVRVGPMSWDGALATKAQKYADSRRGDCNLIHSGS---GENL  79

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GSG F TGR A ELWV EK  YNY TN C
Sbjct  80   AKGSGDF-TGRSASELWVAEKPNYNYDTNKC  109



>gb|EEE54618.1| hypothetical protein OsJ_01863 [Oryza sativa Japonica Group]
Length=147

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 71/100 (71%), Gaps = 4/100 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL+  NAAR AVGVGPM+W   +   A+ YA +R GDC+L HSG   YGEN+
Sbjct  6    DAQNSPQDYLSPQNAARSAVGVGPMSWSTKLQGFAEDYARQRKGDCRLQHSGG-PYGENI  64

Query  302  AWGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGS GA  T   AV  WVDEKK+YNYA+NSC A  G+ C
Sbjct  65   FWGSAGADWTAADAVRSWVDEKKYYNYASNSCAA--GKVC  102



>ref|XP_002436405.1| hypothetical protein SORBIDRAFT_10g001940 [Sorghum bicolor]
 gb|EER87772.1| hypothetical protein SORBIDRAFT_10g001940 [Sorghum bicolor]
Length=168

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 70/99 (71%), Gaps = 4/99 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQ+YL  HN AR AVGVGP+TW   +   A+SYA KRAGDC+L HSG   YGEN+ 
Sbjct  28   AQNSPQNYLTPHNNARAAVGVGPVTWSTKLQQFAESYAAKRAGDCRLQHSGG-PYGENIF  86

Query  305  WGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS GA      AV  WVDEK+WY+YATNSC A  G+ C
Sbjct  87   WGSAGADWKAADAVRSWVDEKQWYSYATNSCAA--GKVC  123



>ref|XP_010065853.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=158

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HNAAR+ VGV  MTWDN +A  AQSYAN+R  DC L+HS +  YGENL
Sbjct  20   HAQNSPQDYLDSHNAARKQVGVVNMTWDNTLATYAQSYANQRVSDCSLVHS-NGPYGENL  78

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G+G F TG  AV LWV EK+ YNY TN+C
Sbjct  79   AKGTGTF-TGTYAVGLWVAEKQNYNYNTNTC  108



>ref|NP_001043091.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAB84473.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAC10798.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAF05005.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAH00320.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70685.1| hypothetical protein OsI_02026 [Oryza sativa Indica Group]
Length=167

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 71/100 (71%), Gaps = 4/100 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL+  NAAR AVGVGPM+W   +   A+ YA +R GDC+L HSG   YGEN+
Sbjct  26   DAQNSPQDYLSPQNAARSAVGVGPMSWSTKLQGFAEDYARQRKGDCRLQHSGG-PYGENI  84

Query  302  AWGS-GAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGS GA  T   AV  WVDEKK+YNYA+NSC A  G+ C
Sbjct  85   FWGSAGADWTAADAVRSWVDEKKYYNYASNSCAA--GKVC  122



>gb|EMS56527.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=164

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            NAQNSP DY+  HN AR AVG+GP+TWD +VAA A SYA +R+GDCKL+HS   +YGENL
Sbjct  23   NAQNSPHDYVIAHNVARAAVGLGPVTWDASVAAYAASYARQRSGDCKLVHSKAPQYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG   T  +AV++W DEK  YNYA+NSC A  G+ C
Sbjct  83   FWGSGKHWTAAQAVKIWADEKANYNYASNSCAA--GKQC  119



>ref|XP_006486833.1| PREDICTED: pathogenesis-related leaf protein 6-like [Citrus sinensis]
Length=159

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN  R +V VGPM WDN VAA AQ+YAN+R GDC+L+HSG   Y ENLA
Sbjct  22   AQNSQQDYLRAHNETRASVRVGPMRWDNKVAAYAQNYANQRKGDCRLVHSGG-PYSENLA  80

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            W +G  +TG  AV+LWVDE+  YNY +N+C
Sbjct  81   WSNGD-LTGMAAVKLWVDERPKYNYNSNTC  109



>gb|ACU15426.1| unknown [Glycine max]
 gb|ACU17403.1| unknown [Glycine max]
Length=164

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS-GDRRYGENL  301
            AQ+SP DY+  HNAAR  VGV  + WDN VAA AQ+YAN+R GDCKL+HS GD +YGENL
Sbjct  26   AQDSPTDYVNAHNAARSQVGVPNIVWDNAVAAFAQNYANQRKGDCKLVHSGGDGKYGENL  85

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GS   ++G+ AV+LWV+EK  YNY +NSC
Sbjct  86   A-GSTGNLSGKDAVQLWVNEKSKYNYNSNSC  115



>gb|ADN43415.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGVG MTW+N VA+ AQ+YAN+R GDC L+HS +  YGEN+A
Sbjct  24   AQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS-NGPYGENIA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG+ +TG  AV+LWV EK  Y+Y +NSC
Sbjct  83   WGSGS-LTGTDAVDLWVGEKPNYDYNSNSC  111



>ref|XP_008372941.1| PREDICTED: pathogenesis-related leaf protein 4-like [Malus domestica]
Length=170

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 73/99 (74%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +A ++PQDYL  HNAAR AVGVGP+TWD+NVA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  23   HAXDTPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQNYANQHVGDCNLVHSGG-PYGENL  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A  +G  M+G  AV+LWV EK  Y+Y +NSC A  G+ C
Sbjct  82   AMSTGD-MSGTAAVDLWVAEKADYSYESNSCAA--GKVC  117



>ref|XP_010904557.1| PREDICTED: pathogenesis-related protein 1-like [Elaeis guineensis]
Length=163

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSP+D++ +HNAAR AVGVGP++W++ VAA AQ YA+KR  DC+L+HS D  YGEN+
Sbjct  23   HAQNSPEDFINLHNAARAAVGVGPVSWNDTVAAYAQDYADKRKADCQLVHS-DGTYGENI  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             WG G   T   AV  WV E+++Y+YA+NSC
Sbjct  82   FWGGGPGWTATVAVNDWVSERQYYDYASNSC  112



>ref|XP_008652242.1| PREDICTED: pathogenesis-related protein 1-like [Zea mays]
 tpg|DAA60242.1| TPA: hypothetical protein ZEAMMB73_897468 [Zea mays]
Length=171

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +2

Query  128  QNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLAW  307
            QN+ QD++ +HN+ R  VGVG + W+  VAA AQSYAN+RAGDC+L+HSG   YGENL W
Sbjct  30   QNTAQDFVNLHNSPRADVGVGNVAWNTTVAAYAQSYANQRAGDCRLVHSGG-PYGENLFW  88

Query  308  GSGAFM-TGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            GS  +  T   AV  W  EK++YN+ATN+C+AP G+SC
Sbjct  89   GSAGYAWTASNAVGSWAAEKQYYNHATNTCSAPSGQSC  126



>ref|XP_003545771.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Glycine 
max]
 gb|KHN33605.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=164

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHS-GDRRYGENL  301
            AQ+SP DY+  HNAAR  VGV  + WDN VAA AQ+YAN+R GDCKL+HS GD +YGENL
Sbjct  26   AQDSPTDYVNAHNAARSQVGVPNIVWDNAVAAFAQNYANQRKGDCKLVHSGGDGKYGENL  85

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GS   ++G+ AV+LWV+EK  YNY +NSC
Sbjct  86   A-GSTGNLSGKDAVQLWVNEKSKYNYNSNSC  115



>gb|EMT01155.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=123

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            NAQNSP DY+  HN AR AVG+GP++WD +VAA A SYA +R+GDCKL+HS   +YGENL
Sbjct  23   NAQNSPHDYVVAHNVARAAVGLGPVSWDASVAAYAASYARQRSGDCKLVHSKAPQYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG   T  +AV++W DEK  YNYA+NSC A  G+ C
Sbjct  83   FWGSGKDWTAAQAVKIWADEKANYNYASNSCAA--GKQC  119



>gb|AEH25629.1| pathogenesis-related protein 1-14 [Triticum aestivum]
 gb|AHE81257.1| pathogenesis-related protein 1-14 [Triticum aestivum]
 gb|AHE81278.1| pathogenesis-related protein 1-14 [Triticum aestivum]
Length=172

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQN+PQD++ +HN AR A GVGP+TWDN+VA  AQ YANKRA DC+L HSG   +GEN+
Sbjct  24   SAQNTPQDFVNLHNRARAADGVGPVTWDNSVARFAQDYANKRAADCRLQHSGG-PFGENI  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG   T   AV+ WVDEK+ Y+  TN+C+A  G+ C
Sbjct  83   FWGSGQSWTAANAVKSWVDEKRNYHLNTNTCDA--GKVC  119



>ref|XP_007041425.1| Pathogenesis-related protein 1 [Theobroma cacao]
 gb|EOX97256.1| Pathogenesis-related protein 1 [Theobroma cacao]
Length=159

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL+VH+AAR  VGVGPMTWD  VAA AQ YAN R  DC L+HS    YGEN+A
Sbjct  23   AQNSPQDYLSVHDAARAQVGVGPMTWDPEVAAYAQDYANIRVADCGLVHSYG-PYGENIA  81

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
              S A +TG  AV++WVDEK +YNY  N C
Sbjct  82   EASYA-LTGAEAVQMWVDEKPYYNYDANIC  110



>gb|AAB05225.1| pathogenesis-related protein-1 [Nicotiana glutinosa]
Length=168

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HN AR  VGV P+TWD+ VAA AQ+Y ++ A DC L+ S   +YGENL
Sbjct  29   HAQNSQQDYLNAHNTARADVGVEPLTWDDEVAAYAQNYVSQLAADCNLVTS-HGQYGENL  87

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A GSG FMT  +AVE+WVDEK++Y++ +N C
Sbjct  88   AMGSGDFMTAAKAVEMWVDEKQYYDHGSNHC  118



>ref|XP_006367103.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=118

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 69/92 (75%), Gaps = 6/92 (7%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+PQDYL  HN AR+ VGVGPMTWDN +A  AQ+YAN+RAGDC++ HSG   YGENLA
Sbjct  24   AQNTPQDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGDCRMQHSGG-PYGENLA  82

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSC  394
                AF  +    AV+ WV+E++WYNY +N+C
Sbjct  83   ---SAFPQLNAAGAVQQWVNERQWYNYNSNTC  111



>ref|XP_002265050.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CBI35453.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  V VGPMTW+N VAA AQSYANK+ GDC L+HS +  YGENLA
Sbjct  25   AQNSQQDYLNAHNTARAQVSVGPMTWNNTVAAYAQSYANKQIGDCNLVHS-NGPYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG+F TG  AV LWV EK  Y+Y +NSC
Sbjct  84   KGSGSF-TGTAAVNLWVAEKPNYDYNSNSC  112



>gb|ADB54823.1| pathogenesis-related protein 1 [Vitis pseudoreticulata]
Length=161

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QD+L  HN  R  VGVGPM+WDN VAA AQ+Y N+R GDC L+HSG   YGENLA
Sbjct  25   AQNSAQDFLDAHNVPRAEVGVGPMSWDNTVAAYAQNYTNQRIGDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV LWV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTGTDAVNLWVGEKSNYDYNSNSC  112



>ref|XP_008454501.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis melo]
Length=158

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDY+A+HN AR AVGVGPMTW++ +AA A++YAN+R  DC L+HS    YGEN+
Sbjct  16   HAQNSPQDYIALHNKARAAVGVGPMTWNSTLAAYAEAYANQRIKDCALVHS-KGPYGENI  74

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G     TG   V+LWV EK+ Y+YA+NSC
Sbjct  75   AVGYYPEFTGADGVKLWVAEKRLYDYASNSC  105



>ref|XP_010488899.1| PREDICTED: pathogenesis-related protein 1 [Camelina sativa]
Length=161

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDYL VHN AR AVGVGPM WD  VAA A+SYA +  G+C+L+HS    YGENL+
Sbjct  26   AQDSPQDYLRVHNQARAAVGVGPMQWDETVAAYARSYAEQLRGNCRLVHSRG-PYGENLS  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
            WGS   ++G  AV +WV+EK  YNYA+N+CN   G 
Sbjct  85   WGSSD-LSGVSAVNMWVNEKANYNYASNTCNGVCGH  119



>ref|XP_006486822.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ+SPQDY+  HNAAR  VGVGP+TWD+ VA+ AQ+YAN+R GDC L+HSG   YGENL
Sbjct  24   HAQDSPQDYVNAHNAARAQVGVGPVTWDDRVASYAQNYANQRKGDCNLVHSGG-PYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            AW S A ++G  AV++WV+EK  Y+Y +N+C
Sbjct  83   AW-SSAGLSGTDAVKMWVNEKADYDYNSNTC  112



>ref|XP_004152970.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004168650.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDY+++HN AR  VGVGPMTW+N VAA AQSYANKR  DC L+HS    YGEN+
Sbjct  16   HAQNSAQDYISLHNKARATVGVGPMTWNNTVAAYAQSYANKRINDCALVHS-TGPYGENI  74

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A G     TG   V++WV EK  Y+YA+NSC
Sbjct  75   AVGYYPEFTGADGVKMWVGEKHLYDYASNSC  105



>ref|NP_001043089.1| Os01g0382000 [Oryza sativa Japonica Group]
 gb|AAB49685.1| pathogenesis-related protein class 1 [Oryza sativa Indica Group]
 dbj|BAB84468.1| putative pathogenesis-related protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAC10793.1| putative pathogenesis-related protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAF05003.1| Os01g0382000 [Oryza sativa Japonica Group]
 gb|ABK55609.1| pathogenesis-related protein PR1b [Oryza sativa Indica Group]
Length=164

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 70/92 (76%), Gaps = 2/92 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDR-RYGENL  301
            AQNSPQDY+ +HNAAR AVGVGP+TWD +V A A++YA++R+GDC LIHS +R   GENL
Sbjct  22   AQNSPQDYVRLHNAARAAVGVGPVTWDTSVQAFAENYASQRSGDCSLIHSSNRNNLGENL  81

Query  302  AWGS-GAFMTGRRAVELWVDEKKWYNYATNSC  394
             WGS G   T   AV+ WV EK  Y+YA+NSC
Sbjct  82   FWGSAGGDWTAASAVQSWVGEKSDYDYASNSC  113



>ref|XP_007148301.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
 gb|ESW20295.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
Length=183

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQD+L  HN AR  VGVGPM WD  VA+ AQ+Y NK  G+CK++HSG   YGENL
Sbjct  26   DAQNSPQDFLNAHNTARSQVGVGPMRWDATVASFAQNYVNKLKGNCKMVHSGG-PYGENL  84

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            AW SG  +T   AV+LWV EK +Y+Y +N+C
Sbjct  85   AWSSGD-LTATAAVKLWVGEKPYYDYNSNTC  114



>gb|AEH25633.1| pathogenesis-related protein 1-18 [Triticum aestivum]
 gb|AHE81261.1| pathogenesis-related protein 1-18 [Triticum aestivum]
 gb|AHE81282.1| pathogenesis-related protein 1-18 [Triticum aestivum]
Length=174

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQN+PQD++ +HN AR A GVGP+TWDN+VA  AQ YANKRA DC+L HSG   +GEN+
Sbjct  24   SAQNTPQDFVNLHNRARAADGVGPVTWDNSVARFAQDYANKRAADCRLQHSGG-PFGENI  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG   T   AV  WVDEK+ Y+  TN+C+A  G+ C
Sbjct  83   FWGSGQSWTAANAVTSWVDEKRNYHLNTNTCDA--GKVC  119



>ref|XP_002522071.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40271.1| STS14 protein precursor, putative [Ricinus communis]
Length=164

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 67/99 (68%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNS QDYL  HNAAR  VGV  + WDN VA  AQ+YAN R GDC L+HS    YGENL
Sbjct  25   HAQNSQQDYLDAHNAARAQVGVANIVWDNTVATYAQNYANSRIGDCNLVHSSG-SYGENL  83

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A GS + +TG  AV LWV EK +YNY +NSC    G+ C
Sbjct  84   AKGSSSSLTGTAAVNLWVAEKPYYNYTSNSCTG--GQQC  120



>ref|XP_006848057.1| hypothetical protein AMTR_s00029p00197310 [Amborella trichopoda]
 gb|ERN09638.1| hypothetical protein AMTR_s00029p00197310 [Amborella trichopoda]
Length=165

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HNAAR  + VGP+TWD+NVAA AQ+YAN+RA DC LIHSG   YGENL
Sbjct  26   HAQNSPQDYLNPHNAARTRLNVGPLTWDDNVAAFAQNYANQRARDCNLIHSGG-PYGENL  84

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
              GSGA  +   AV  WV+EK  Y+Y +N+C A  G+ C
Sbjct  85   FGGSGADFSAADAVNAWVNEKADYDYNSNTCAA--GKQC  121



>gb|ADN43428.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=160

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGVG MTW+N VA+ AQ+YAN+R GDC L+HS +  YGEN+A
Sbjct  24   AQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS-NGPYGENIA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG+ +TG  AV LWV EK  Y+Y +NSC
Sbjct  83   WGSGS-LTGTDAVNLWVGEKPNYDYNSNSC  111



>ref|XP_009136246.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
Length=160

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDY+ VHN AR  VGVGPM W+ ++AAVAQSYA++R  DC LIHS    YGENLA
Sbjct  25   AQDSPQDYVRVHNEARAGVGVGPMQWNESIAAVAQSYADQRRSDCNLIHSTG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
              SG  ++G RAV LWV+EK  Y+Y +N+CN   G 
Sbjct  84   KSSGD-LSGVRAVNLWVEEKANYDYPSNTCNGECGH  118



>gb|ADN43427.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=159

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGVG MTW+N VA+ AQ+YAN+R GDC L+HS +  YGEN+A
Sbjct  23   AQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS-NGPYGENIA  81

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG+ +TG  AV LWV EK  Y+Y +NSC
Sbjct  82   WGSGS-LTGTDAVNLWVGEKPNYDYNSNSC  110



>gb|AGS80328.1| pathogenesis-related protein 1 [Actinidia eriantha]
Length=173

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR AVGVGP+ WDNN+A  A+ YAN R  DC L+HS    YGENLA
Sbjct  26   AQNSPQDYLNAHNAARAAVGVGPIRWDNNLANYARDYANSRIKDCNLVHSKG-PYGENLA  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             G    +TGR +V++WVDEKK+Y+Y +NSC
Sbjct  85   KGFPG-LTGRDSVKMWVDEKKYYDYNSNSC  113



>gb|ADN43434.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAA+  VGVGP+TW++ VAA AQ+YAN+R GDC L+HSG   YGEN+A
Sbjct  25   AQNSPQDYVDPHNAAQAQVGVGPITWNDTVAAYAQNYANQRIGDCNLVHSGG-PYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV +WV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTGTDAVNMWVGEKPNYDYNSNSC  112



>gb|ADN43419.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGVG MTW+N VA+ AQ+YAN+R GDC L+HS +  YGEN+A
Sbjct  24   AQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS-NGPYGENIA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG+ +TG  AV LWV EK  Y+Y +NSC
Sbjct  83   WGSGS-LTGTDAVNLWVGEKPNYDYNSNSC  111



>gb|ADN43418.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43426.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGVG MTW+N VA+ AQ+YAN+R GDC L+HS +  YGEN+A
Sbjct  24   AQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS-NGPYGENIA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG+ +TG  AV LWV EK  Y+Y +NSC
Sbjct  83   WGSGS-LTGTDAVNLWVGEKPNYDYNSNSC  111



>gb|ADN43416.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGVG MTW+N VA+ AQ+YAN+R GDC L+HS +  YGEN+A
Sbjct  24   AQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS-NGPYGENIA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG+ +TG  AV LWV EK  Y+Y +NSC
Sbjct  83   WGSGS-LTGTDAVNLWVGEKPNYDYNSNSC  111



>ref|XP_002273416.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 gb|ADN43420.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43421.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43422.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43423.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43424.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43425.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=160

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL  HN AR  VGVG MTW+N VA+ AQ+YAN+R GDC L+HS +  YGEN+A
Sbjct  24   AQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQNYANQRIGDCNLVHS-NGPYGENIA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGSG+ +TG  AV LWV EK  Y+Y +NSC
Sbjct  83   WGSGS-LTGTDAVNLWVGEKPNYDYNSNSC  111



>ref|XP_004138861.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004173913.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
Length=158

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+++HN AR AV VGPMTW+  VAA AQSYANKR  DC L+HS    YGEN+A
Sbjct  17   AQNSPQDYISLHNKARAAVRVGPMTWNKTVAAYAQSYANKRKNDCALVHS-TGPYGENIA  75

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             G     TG   V+LWV EK  Y+YA+NSC
Sbjct  76   VGYYPEFTGADGVKLWVGEKHLYDYASNSC  105



>ref|XP_006368156.1| PREDICTED: basic form of pathogenesis-related protein 1-like, 
partial [Solanum tuberosum]
Length=135

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 6/94 (6%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+PQDYL  HN AR+ VGVGPMTWDN +A  AQ+YAN+RAGDC++ HSG   YGENLA
Sbjct  24   AQNTPQDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGDCRMQHSGG-PYGENLA  82

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSCNA  400
                AF  +    AV+ WV+E++WYNY +N+C A
Sbjct  83   ---SAFPQLNAAGAVQQWVNERQWYNYNSNTCQA  113



>gb|ADB54822.1| pathogenesis-related protein 1 [Vitis pseudoreticulata]
Length=176

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QD+L  HN  R  VGVGPM+WDN VAA AQ+Y N+R GDC L+HSG   YGENLA
Sbjct  25   AQNSAQDFLDAHNVPRAEVGVGPMSWDNTVAAYAQNYTNQRIGDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +TG  AV LWV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTGIDAVNLWVGEKINYDYNSNSC  112



>emb|CDX93140.1| BnaA03g38620D [Brassica napus]
Length=160

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDY+ VHN AR  VGVGPM W+ ++AAVAQSYA++R  DC LIHS    YGENLA
Sbjct  25   AQDSPQDYVRVHNEARAGVGVGPMQWNESIAAVAQSYADQRRSDCNLIHSTG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
              SG  ++G RAV LWV+EK  Y+Y +N+CN   G 
Sbjct  84   KSSGD-LSGVRAVNLWVEEKANYDYPSNTCNGECGH  118



>ref|XP_008798895.1| PREDICTED: pathogenesis-related protein 1-like [Phoenix dactylifera]
Length=162

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQD++  HNAAR AVGVGP++W+  VAA AQ YANKR  DC+L+HS +  YGEN+
Sbjct  23   HAQNSPQDFINPHNAARAAVGVGPVSWNATVAAYAQDYANKRKADCELVHS-NGPYGENI  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WG G   T   AV  WV EK++Y+YA+NSC   P + C
Sbjct  82   FWGGGPGWTAADAVNDWVSEKQYYDYASNSC--APSQVC  118



>ref|XP_010065833.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW63503.1| hypothetical protein EUGRSUZ_G01133 [Eucalyptus grandis]
Length=170

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 71/99 (72%), Gaps = 5/99 (5%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDC-KLIHSGDRRYGENL  301
            AQ+SPQDY+A HNAAR  VGVGP+TWD  VA+ A+ YA K A DC +L+HSG   YGENL
Sbjct  32   AQDSPQDYVAAHNAARSQVGVGPITWDERVASYARDYAQKHARDCTRLVHSGG-PYGENL  90

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AW S   +TG RAV LWV EK  YNY +NSC   PG+ C
Sbjct  91   AWAS-PDLTGTRAVNLWVGEKPDYNYNSNSC--APGKVC  126



>ref|XP_010517589.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=161

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDYL VHN AR AVGVGPM WD  VAA A+SYA +  G+C+L+HS    YGENL+
Sbjct  26   AQDSPQDYLRVHNQARAAVGVGPMQWDETVAAYARSYAAQLRGNCRLVHSRG-PYGENLS  84

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGE  412
            WGS   ++G  AV +WV+EK  YNYA+N+CN   G 
Sbjct  85   WGSSD-LSGVSAVNMWVNEKANYNYASNTCNGVCGH  119



>gb|AEM36335.1| pathogenesis-related protein [Vitis quinquangularis]
Length=160

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HN AR  VGVGPM+WDN VAA AQ+YA +R GDC L+HSG   YGENLA
Sbjct  24   AQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQNYAKQRIGDCNLVHSGG-PYGENLA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GS + +TG  AV LWV EK  Y++ +NSC
Sbjct  83   RGSPS-LTGTDAVNLWVGEKSNYDHNSNSC  111



>gb|AFM77011.1| pathogenesis related protein 1a, partial [Cydonia oblonga]
Length=154

 Score =   109 bits (272),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++PQDYL  HNAAR AVGVGP+TWD+ VA  AQ+YAN+  GDC L+HSG   YGENL
Sbjct  16   HAQDTPQDYLNSHNAARAAVGVGPLTWDDKVAGYAQNYANQHVGDCNLVHSGG-PYGENL  74

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            A  +G  M+G  AV++WV EK  Y+Y +NSC
Sbjct  75   AMSTGD-MSGTAAVDMWVAEKADYDYESNSC  104



>ref|XP_008370577.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related protein 
1-like [Malus domestica]
Length=169

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 74/99 (75%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQ++ QDYL  HNAAR AVGVGP+TWD+NVA  AQ+YAN+R GDCKL+HS    YGENL
Sbjct  23   HAQDTRQDYLNSHNAARAAVGVGPLTWDDNVARYAQNYANQRVGDCKLVHS-KGPYGENL  81

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A  +G  ++G  AV+LWV EK  Y+Y +NSC A  G+ C
Sbjct  82   AMSTGD-LSGTAAVDLWVKEKADYSYKSNSCAA--GKVC  117



>gb|AGK89727.1| pathogenesis-related 1 protein [Coffea canephora]
Length=162

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 70/98 (71%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
             QNS QDY+  HNAAR  VGVGP+ WD+ VAA AQ+YAN+R  DC L HS D RYGENLA
Sbjct  24   TQNSQQDYVDAHNAARAQVGVGPIAWDDTVAAYAQNYANQRINDCNLEHS-DGRYGENLA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             G G F TGR AV LWV EK++Y+Y +N+C    G+ C
Sbjct  83   EGGGDF-TGRDAVNLWVSEKQYYDYNSNTC--AQGQQC  117



>ref|XP_010252393.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=167

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDY+  HNAAR  VGVG MTWD+ VAA AQ YAN+R GDC L+HSG   YGENLA
Sbjct  31   AQDSPQDYINAHNAARAEVGVGSMTWDDKVAAYAQQYANQRIGDCALVHSGG-PYGENLA  89

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCN  397
              +   ++G  AV++WVDEK++Y+Y +NSC+
Sbjct  90   -AAMPSLSGTDAVKMWVDEKQYYDYNSNSCS  119



>gb|ADN43433.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   108 bits (271),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDY+  HNAAR  VGVGPMTW+N VAA AQ+YAN+R GDC L+HSG   YGEN+A
Sbjct  25   AQNSLQDYVDAHNAARAQVGVGPMTWNNTVAAYAQNYANQRIGDCSLVHSGG-PYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS + +T   AV +WV EK  Y+Y +NSC
Sbjct  84   WGSPS-LTSTDAVNMWVGEKPNYDYNSNSC  112



>emb|CAA88618.1| type-1 pathogenesis-related protein [Hordeum vulgare]
Length=174

 Score =   109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQN+PQD++ +HN AR   GVGP+ WDNNVA  AQ+YA +RAGDC+L HSG   +GEN+
Sbjct  24   SAQNTPQDFVNLHNRARAVDGVGPVAWDNNVARFAQNYAAERAGDCRLQHSGG-PFGENI  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG   T   AV+LWVDEK+ Y+  +N+CNA  G+ C
Sbjct  83   FWGSGRSWTAADAVKLWVDEKQNYHLDSNTCNA--GKVC  119



>dbj|BAN09077.1| pathogenesis related protein-1.2 [Triticum aestivum]
Length=172

 Score =   109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQN+PQD++ +HN AR A GVGP+TWDN+VA  AQ YANKRA DC+L HSG   +GEN+
Sbjct  24   SAQNTPQDFVNLHNRARAADGVGPVTWDNSVARFAQDYANKRAADCRLQHSGG-PFGENI  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG   T   AV+ WVDEK+ Y+  +N+C+A  G+ C
Sbjct  83   FWGSGQSWTAANAVKSWVDEKRNYHLNSNTCDA--GKVC  119



>sp|P11670.1|PRB1_TOBAC RecName: Full=Basic form of pathogenesis-related protein 1; Short=PRP 
1; Flags: Precursor [Nicotiana tabacum]
 emb|CAA32228.1| PRP 1 precursor (AA -23 to 154) [Nicotiana tabacum]
 prf||1807333A pathogenesis-related protein 1
Length=177

 Score =   109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR+ VGVGPMTWDN +AA AQ+YAN+R GDC +IHS    YGENLA
Sbjct  23   AQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQNYANQRIGDCGMIHS-HGPYGENLA  81

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSC  394
                AF  +    AV++WVDEK++Y+Y +NSC
Sbjct  82   ---AAFPQLNAAGAVKMWVDEKRFYDYNSNSC  110



>ref|XP_002274307.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=161

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVG MTW++ VAA AQ+YANKR  DC L+HSG   YGENLA
Sbjct  25   AQNSPQDYVNAHNAARAQVGVGSMTWNDTVAAYAQNYANKRISDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG+ +TG  AV LWV EK  Y+Y +NSC
Sbjct  84   KGSGS-LTGTDAVNLWVGEKPNYDYNSNSC  112



>gb|KDP37598.1| hypothetical protein JCGZ_06941 [Jatropha curcas]
Length=148

 Score =   108 bits (270),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 4/99 (4%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            NAQ+S QDY+  HN AR AVG GP+TWDN VAA A++YA++  G+C+L+HSG  RYGENL
Sbjct  10   NAQDSHQDYVNAHNTARAAVGGGPVTWDNTVAAYARNYASQHIGNCRLVHSGG-RYGENL  68

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            A GS   ++G  AV+LWVDEK +Y+Y +N+C A  G+ C
Sbjct  69   A-GSSGDLSGTAAVQLWVDEKVFYDYNSNTCAA--GQVC  104



>emb|CDP12737.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNS QDYL VHNAAR  V VGP+ WD+ +AA AQ+YA +R  DC+L+HSG   YGENLA
Sbjct  24   AQNSQQDYLDVHNAARAQVNVGPIAWDDRLAAYAQNYATQRMNDCQLMHSGG-PYGENLA  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             GSG F T R AV LWV+E+++Y+Y +NSC    G+ C
Sbjct  83   AGSGDF-TARAAVNLWVNERQYYDYGSNSCTQ--GKEC  117



>ref|XP_010042397.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=158

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HN AR+ VGV  +TWDN +A  AQSYAN+R GDC L+HS +  YGENL
Sbjct  20   HAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVGDCSLVHS-NGPYGENL  78

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNA  400
            A G+  F TG  AV LWV EK+ YNY TN+C++
Sbjct  79   AKGTSTF-TGTYAVSLWVAEKQNYNYNTNTCSS  110



>ref|XP_010052998.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
 ref|XP_010068340.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Eucalyptus grandis]
Length=158

 Score =   108 bits (271),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HN AR+ VGV  +TWDN +A  AQSYAN+R GDC L+HS +  YGENL
Sbjct  20   HAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVGDCSLVHS-NGPYGENL  78

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNA  400
            A G+  F TG  AV LWV EK+ YNY TN+C++
Sbjct  79   AKGTSTF-TGTYAVSLWVAEKQNYNYNTNTCSS  110



>ref|XP_009788195.1| PREDICTED: basic form of pathogenesis-related protein 1 [Nicotiana 
sylvestris]
Length=177

 Score =   109 bits (272),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 70/92 (76%), Gaps = 6/92 (7%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDYL  HNAAR+ VGVGPMTWDN +AA AQ+YAN+R GDC +IHS    YGENLA
Sbjct  23   AQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQNYANQRIGDCGMIHS-HGPYGENLA  81

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSC  394
                AF  +    AV++WVDEK++Y+Y +NSC
Sbjct  82   ---AAFPQLNAAGAVKMWVDEKRFYDYNSNSC  110



>gb|ADN43443.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43444.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVG MTW++ VAA AQ+YANKR  DC L+HSG   YGENLA
Sbjct  25   AQNSPQDYVNAHNAARAQVGVGSMTWNDTVAAYAQNYANKRISDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG+ +TG  AV LWV EK  Y+Y +NSC
Sbjct  84   KGSGS-LTGTDAVNLWVGEKPNYDYNSNSC  112



>ref|XP_003557605.1| PREDICTED: pathogenesis-related protein 1-like [Brachypodium 
distachyon]
Length=171

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQN+P DY+A HNA R AV VGP+TWDN VAA AQ+YAN R  DC L+HSG   YGENL
Sbjct  30   SAQNAPSDYVAPHNATRAAVSVGPVTWDNTVAAYAQNYANARKADCALVHSGGTLYGENL  89

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG+  T + AV++W  EK++Y YATN+C A  G+ C
Sbjct  90   FWGSGSTWTAKNAVDMWAAEKQYYTYATNTCAA--GKVC  126



>dbj|BAO09561.1| pathogenesis-related protein 1, partial [Morus alba]
Length=164

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ +PQD+LA HN AR  VGVGPMTWD++VAA A++YAN+R GDCKL+HSG   YGEN+A
Sbjct  18   AQTTPQDFLAPHNRARAEVGVGPMTWDDSVAAYARNYANQRQGDCKLVHSGG-PYGENIA  76

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            W SG  ++   AV +WV EK  Y+Y +N+C
Sbjct  77   WSSGD-LSAAGAVGMWVAEKSLYDYYSNTC  105



>gb|AFR90191.1| pathogenesis-related protein 1a [Salsola ferganica]
Length=166

 Score =   108 bits (271),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDY+  HNAAR AVGVG + WD  +AA AQ YAN+R GDC L HSG   YGEN+
Sbjct  26   HAQNSPQDYVNAHNAARAAVGVGKIQWDGKLAAYAQQYANQRKGDCALKHSGG-PYGENI  84

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNA  400
            A G G F TGR AV++WV EK  YNY +N+C A
Sbjct  85   AVGGGPF-TGRDAVKMWVAEKANYNYNSNTCAA  116



>gb|AEH25626.1| pathogenesis-related protein 1-11 [Triticum aestivum]
 gb|EMT30572.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=169

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+P D++++HN++R  VGVGP+TWD  VA  A SYAN+R  DC L+HSG   YGEN+ 
Sbjct  29   AQNAPADFVSLHNSSRALVGVGPVTWDTTVANYALSYANQRKADCSLVHSGG-TYGENIF  87

Query  305  WGS-GAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS G   T   AV +W DEK++Y+YATN+C
Sbjct  88   WGSAGGTWTASSAVTMWTDEKQFYDYATNTC  118



>gb|ADN43429.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVG +TW++ VAA AQ+YAN+R  DC L+HSG   YGENLA
Sbjct  25   AQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG+ +TG  AV LWV EK +Y+Y +NSC
Sbjct  84   KGSGS-LTGTDAVNLWVGEKSYYDYNSNSC  112



>ref|XP_004136929.1| PREDICTED: pathogenesis-related protein 1-like [Cucumis sativus]
 ref|XP_004155420.1| PREDICTED: pathogenesis-related protein 1-like [Cucumis sativus]
Length=145

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDY+  HN AR AVGVGP+ WD  VA  ++ YANKR  DC+L+HS +  YGEN+A
Sbjct  7    AQDSPQDYVNSHNHARAAVGVGPIKWDEKVANYSRYYANKRMNDCRLVHS-NGPYGENIA  65

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS   ++G  AV+LWVDEK++YNY +NSC
Sbjct  66   WGS-PDLSGINAVKLWVDEKQYYNYNSNSC  94



>ref|XP_010943469.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSP+D+++ HN+AR AVGVGP++W+++VA  AQ YAN+R GDC+L+HS +  YGENL 
Sbjct  24   AQNSPEDFVSPHNSARAAVGVGPVSWNDSVAVYAQDYANQRTGDCQLVHS-NGSYGENLF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSGA  T   AV LWV EK++++Y +N+C
Sbjct  83   GGSGADYTAADAVNLWVSEKQYHDYNSNTC  112



>ref|XP_010530683.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=157

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 4/98 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+ PQD++  HN AR AVGVGP+ WD  VAA A+ YAN+R GDC+L+HS    YGEN+A
Sbjct  20   AQDRPQDFVDAHNRARAAVGVGPIRWDETVAAYARDYANRRRGDCRLVHSSG-PYGENIA  78

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            W SG  M+G  AV++WV+EK  YNY TN+C A  G+ C
Sbjct  79   WSSGD-MSGVSAVQMWVNEKADYNYNTNTCRA--GKVC  113



>gb|AHE81254.1| pathogenesis-related protein 1-11 [Triticum aestivum]
Length=169

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+P D++++HN++R  VGVGP+TWD  VA  A SYAN+R  DC L+HSG   YGEN+ 
Sbjct  29   AQNAPADFVSLHNSSRALVGVGPVTWDTTVANYALSYANQRKADCSLVHSGG-TYGENIL  87

Query  305  WGS-GAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS G   T   AV +W DEK++Y+YATN+C
Sbjct  88   WGSAGGTWTASSAVTMWTDEKQFYDYATNTC  118



>gb|AEH25637.1| pathogenesis-related protein 1-22 [Triticum aestivum]
Length=164

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            NAQNSP DY+  HN AR  VG+GP+TWD +VAA A SYA +R+GDCKL+HS  ++YGENL
Sbjct  23   NAQNSPHDYVVAHNVARAGVGLGPVTWDASVAAYAASYARQRSGDCKLVHSKAQQYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG   T  +AV++W DEK  YNYA+NSC A  G+ C
Sbjct  83   FWGSGKDWTAAQAVKIWADEKANYNYASNSCAA--GKQC  119



>gb|AHE81275.1| pathogenesis-related protein 1-11 [Triticum aestivum]
Length=169

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 67/91 (74%), Gaps = 2/91 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+P D++++HN++R  VGVGP+TWD  VA  A SYAN+R  DC L+HSG   YGEN+ 
Sbjct  29   AQNAPADFVSLHNSSRALVGVGPVTWDTTVANYALSYANQRKADCSLVHSGG-TYGENIF  87

Query  305  WGS-GAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS G   T   AV +W DEK++Y+YATN+C
Sbjct  88   WGSAGGTWTASSAVTMWTDEKQFYDYATNTC  118



>gb|KGN43833.1| hypothetical protein Csa_7G070255 [Cucumis sativus]
Length=163

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ+SPQDY+  HN AR AVGVGP+ WD  VA  ++ YANKR  DC+L+HS +  YGEN+A
Sbjct  25   AQDSPQDYVNSHNHARAAVGVGPIKWDEKVANYSRYYANKRMNDCRLVHS-NGPYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WGS   ++G  AV+LWVDEK++YNY +NSC
Sbjct  84   WGSPD-LSGINAVKLWVDEKQYYNYNSNSC  112



>ref|XP_006367104.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=182

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 6/94 (6%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+PQDYL  HN AR+ VGVGPMTWDN +A  AQ+YAN+RAGDC++ HSG   YGENLA
Sbjct  24   AQNTPQDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGDCRMQHSGG-PYGENLA  82

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSCNA  400
                AF  +    AV+ WV+E++WYNY +N+C A
Sbjct  83   ---SAFPQLNAAGAVQQWVNERQWYNYNSNTCQA  113



>gb|ADN43442.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVG +TW++ VAA AQ+YAN+R  DC L+HSG   YGENLA
Sbjct  25   AQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG+ +TG  AV LWV EK +Y+Y +NSC
Sbjct  84   KGSGS-LTGTDAVNLWVGEKPYYDYNSNSC  112



>gb|AEH25638.1| pathogenesis-related protein 1-23 [Triticum aestivum]
Length=164

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSP DY+  HN AR AVG+GP+TWD +VAA A SYA +R+GDCKL+HS   +YGENL
Sbjct  23   DAQNSPHDYVVAHNVARAAVGLGPVTWDASVAAYAASYARQRSGDCKLVHSKAPQYGENL  82

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
             WGSG   T  +AV++W DEK  YNYA+NSC A  G+ C
Sbjct  83   FWGSGKDWTAAQAVKIWADEKANYNYASNSCAA--GKQC  119



>ref|XP_002274371.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN80994.1| hypothetical protein VITISV_042545 [Vitis vinifera]
Length=161

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQDY+  HNAAR  VGVG +TW++ VAA AQ+YAN+R  DC L+HSG   YGENLA
Sbjct  25   AQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQNYANQRISDCNLVHSGG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
             GSG+ +TG  AV LWV EK +Y+Y +NSC
Sbjct  84   KGSGS-LTGTDAVNLWVGEKPYYDYNSNSC  112



>ref|XP_006367095.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=182

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 70/94 (74%), Gaps = 6/94 (6%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+PQDYL  HN AR+ VGVGPMTWDN +A  AQ+YAN+RAGDC++ HSG   YGENLA
Sbjct  24   AQNTPQDYLNAHNEARRQVGVGPMTWDNRLATFAQNYANQRAGDCRMQHSGG-PYGENLA  82

Query  305  WGSGAF--MTGRRAVELWVDEKKWYNYATNSCNA  400
                AF  +    AV+ WV+E++WYNY +N+C A
Sbjct  83   ---SAFPQLNAAGAVQQWVNERQWYNYNSNTCQA  113



>ref|XP_010904546.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=163

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQNSPQD++  HNAAR AVGVGP++W++ VAA AQ YANKR  DC+L+HS +  YGEN+ 
Sbjct  24   AQNSPQDFINPHNAARAAVGVGPVSWNDAVAAYAQDYANKRKADCQLVHS-NGPYGENIF  82

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            WG G   T   AV  WV E+++Y+YA+NSC
Sbjct  83   WGGGPGWTATVAVNDWVSERQYYDYASNSC  112



>gb|ACJ62597.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 4/99 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            ++NSPQDYL   N+AR AVGVGP+TW   +   A+ YA +RAGDC+L HSG   YGEN+ 
Sbjct  27   SENSPQDYLTPQNSARAAVGVGPVTWSTKLQQFAEKYAAQRAGDCRLQHSGG-PYGENIF  85

Query  305  WGSGAF-MTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS  F      AV  WVDEK+WYNYATNSC A  G+ C
Sbjct  86   WGSAGFDWKAVDAVRSWVDEKQWYNYATNSCAA--GKVC  122



>gb|ABA34024.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34025.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34026.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34027.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34028.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34029.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ABA34031.1| pathogenesis-related maize seed protein [Zea diploperennis]
Length=167

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 4/99 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            ++NSPQDYL   N+AR AVGVGP+TW   +   A+ YA +RAGDC+L HSG   YGEN+ 
Sbjct  27   SENSPQDYLTPQNSARAAVGVGPVTWSTKLQQFAEKYAAQRAGDCRLQHSGG-PYGENIF  85

Query  305  WGSGAF-MTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS  F      AV  WVDEK+WYNYATNSC A  G+ C
Sbjct  86   WGSAGFDWKAADAVRSWVDEKQWYNYATNSCAA--GKVC  122



>gb|KCW63526.1| hypothetical protein EUGRSUZ_G01161, partial [Eucalyptus grandis]
Length=141

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HN AR+ VGV  +TWDN +A  AQSYAN+R GDC L+HS +  YGENL
Sbjct  3    HAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVGDCSLVHS-NGPYGENL  61

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNA  400
            A G+  F TG  AV LWV EK+ YNY TN+C++
Sbjct  62   AKGTSTF-TGTYAVSLWVAEKQNYNYNTNTCSS  93



>ref|XP_010088980.1| hypothetical protein L484_013560 [Morus notabilis]
 gb|EXB37195.1| hypothetical protein L484_013560 [Morus notabilis]
Length=171

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQN+PQD+L  HN AR  VGVGPMTWD++VAA AQ YAN+R GDCKLIHS    YGENLA
Sbjct  25   AQNTPQDFLTPHNRARAEVGVGPMTWDDSVAAYAQRYANQRRGDCKLIHSSG-PYGENLA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            W SG  ++   AV++WV EK  Y++ +N C
Sbjct  84   WSSGD-LSAAGAVKMWVAEKSLYDHNSNKC  112



>gb|ACJ62603.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 4/99 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            ++NSPQDYL   N+AR AVGVGP+TW   +   A+ YA +RAGDC+L HSG   YGEN+ 
Sbjct  27   SENSPQDYLTPQNSARAAVGVGPVTWSTKLQQFAEKYAAQRAGDCRLQHSGG-PYGENIF  85

Query  305  WGSGAF-MTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS  F      AV  WVDEK+WYNYATNSC A  G+ C
Sbjct  86   WGSAGFDWKAVDAVRSWVDEKQWYNYATNSCAA--GKVC  122



>sp|Q00008.1|PRMS_MAIZE RecName: Full=Pathogenesis-related protein PRMS; Flags: Precursor 
[Zea mays]
 emb|CAA38223.1| pathogenesis-related protein [Zea mays]
 gb|ABA34008.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34009.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34010.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34012.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34013.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34015.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34016.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34017.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34018.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34019.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34021.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34022.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34023.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ABA34030.1| pathogenesis-related maize seed protein [Zea diploperennis]
 gb|ACJ62542.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62543.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62547.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62549.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62552.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62557.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62560.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62561.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62563.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62564.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62566.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62568.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62569.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62570.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62571.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62572.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62574.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62576.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62577.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62579.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62580.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62581.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62582.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62583.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62584.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62585.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62586.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62588.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62590.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62591.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62592.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62593.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62594.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62595.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62596.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62598.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62599.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62600.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62601.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62602.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62605.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62607.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62611.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62612.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62613.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62614.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62615.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62616.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62617.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62618.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62619.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62620.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62621.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62622.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
 gb|ACJ62623.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 4/99 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            ++NSPQDYL   N+AR AVGVGP+TW   +   A+ YA +RAGDC+L HSG   YGEN+ 
Sbjct  27   SENSPQDYLTPQNSARAAVGVGPVTWSTKLQQFAEKYAAQRAGDCRLQHSGG-PYGENIF  85

Query  305  WGSGAF-MTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS  F      AV  WVDEK+WYNYATNSC A  G+ C
Sbjct  86   WGSAGFDWKAVDAVRSWVDEKQWYNYATNSCAA--GKVC  122



>ref|XP_010040969.1| PREDICTED: pathogenesis-related protein 1-like [Eucalyptus grandis]
 gb|KCW44744.1| hypothetical protein EUGRSUZ_L01705 [Eucalyptus grandis]
Length=170

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 71/99 (72%), Gaps = 5/99 (5%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDC-KLIHSGDRRYGENL  301
            AQ+SPQDY+A HNAAR  VGVGP+TWD  VA+ A+ YA K A DC +L+HSG   YGENL
Sbjct  32   AQDSPQDYVAAHNAARSQVGVGPITWDERVASYARDYAQKHARDCTRLVHSGG-PYGENL  90

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            AW S   +TG RAV LWV EK  Y+Y +NSC   PG+ C
Sbjct  91   AWAS-PDLTGTRAVNLWVGEKPDYDYNSNSC--APGKVC  126



>gb|KCW77204.1| hypothetical protein EUGRSUZ_D01555, partial [Eucalyptus grandis]
Length=139

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 2/93 (2%)
 Frame = +2

Query  122  NAQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENL  301
            +AQNSPQDYL  HN AR+ VGV  +TWDN +A  AQSYAN+R GDC L+HS +  YGENL
Sbjct  1    HAQNSPQDYLDSHNVARKQVGVANVTWDNALATYAQSYANQRVGDCSLVHS-NGPYGENL  59

Query  302  AWGSGAFMTGRRAVELWVDEKKWYNYATNSCNA  400
            A G+  F TG  AV LWV EK+ YNY TN+C++
Sbjct  60   AKGTSTF-TGTYAVSLWVAEKQNYNYNTNTCSS  91



>ref|XP_010088981.1| hypothetical protein L484_013561 [Morus notabilis]
 gb|EXB37196.1| hypothetical protein L484_013561 [Morus notabilis]
Length=171

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            AQ +PQD+LA HN AR  VGVGPMTWD++VAA A++YAN+R GDCKL+HSG   YGEN+A
Sbjct  25   AQTTPQDFLAPHNRARAEVGVGPMTWDDSVAAYARNYANQRQGDCKLVHSGG-PYGENIA  83

Query  305  WGSGAFMTGRRAVELWVDEKKWYNYATNSC  394
            W SG  ++   AV +WV EK  Y+Y +N C
Sbjct  84   WSSGD-LSAAGAVGMWVAEKSLYDYYSNKC  112



>gb|ACJ62575.1| pathogenesis-related maize seed protein [Zea mays subsp. parviglumis]
Length=167

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 4/99 (4%)
 Frame = +2

Query  125  AQNSPQDYLAVHNAARQAVGVGPMTWDNNVAAVAQSYANKRAGDCKLIHSGDRRYGENLA  304
            ++NSPQDYL   N+AR AVGVGP+TW   +   A+ YA +RAGDC+L HSG   YGEN+ 
Sbjct  27   SENSPQDYLTPQNSARAAVGVGPVTWSTKLQQFAEKYAAQRAGDCRLQHSGG-PYGENIF  85

Query  305  WGSGAF-MTGRRAVELWVDEKKWYNYATNSCNAPPGESC  418
            WGS  F      AV  WVDEK+WYNYATNSC A  G+ C
Sbjct  86   WGSAGFDWKAVDAVRSWVDEKQWYNYATNSCAA--GKVC  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515322439940