BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c837_g2_i1 len=127 path=[105:0-126]

Length=127
                                                                      Score     E

gb|KHG17649.1|  25.3 kDa vesicle transport -like protein              88.6    5e-20   
ref|XP_010541831.1|  PREDICTED: 25.3 kDa vesicle transport protein    88.2    5e-20   
ref|XP_006305596.1|  hypothetical protein CARUB_v10010262mg           88.2    5e-20   
ref|XP_009804444.1|  PREDICTED: 25.3 kDa vesicle transport protein    88.2    5e-20   
ref|XP_010061858.1|  PREDICTED: 25.3 kDa vesicle transport protein    88.2    5e-20   
ref|NP_001275228.1|  uncharacterized protein LOC102577571             88.2    5e-20   
ref|XP_004303719.1|  PREDICTED: 25.3 kDa vesicle transport protei...  88.2    6e-20   
gb|AEB71558.1|  synaptobrevin/VAMP-like protein                       88.2    6e-20   
gb|KCW68890.1|  hypothetical protein EUGRSUZ_F02475                   88.2    6e-20   
ref|XP_010493446.1|  PREDICTED: 25.3 kDa vesicle transport protein    88.2    6e-20   
ref|XP_010458604.1|  PREDICTED: 25.3 kDa vesicle transport protei...  88.2    6e-20   
ref|XP_009600035.1|  PREDICTED: 25.3 kDa vesicle transport protein    88.2    6e-20   
gb|EYU45902.1|  hypothetical protein MIMGU_mgv1a013509mg              87.4    9e-20   
gb|KHG18205.1|  25.3 kDa vesicle transport -like protein              87.4    1e-19   
ref|XP_007024708.1|  Synaptobrevin family protein isoform 1           87.4    1e-19   
ref|XP_002529185.1|  snare protein sec22, putative                    87.4    1e-19   Ricinus communis
ref|XP_006426747.1|  hypothetical protein CICLE_v10026450mg           87.4    1e-19   
ref|XP_006465842.1|  PREDICTED: 25.3 kDa vesicle transport protei...  87.4    1e-19   
emb|CDX98099.1|  BnaA06g08500D                                        87.4    1e-19   
emb|CDY34822.1|  BnaA09g47480D                                        87.4    1e-19   
emb|CDO97818.1|  unnamed protein product                              87.0    1e-19   
ref|XP_010103538.1|  25.3 kDa vesicle transport protein               87.0    1e-19   
ref|XP_011048585.1|  PREDICTED: 25.3 kDa vesicle transport protei...  87.0    1e-19   
emb|CDY30033.1|  BnaC05g09870D                                        87.0    1e-19   
ref|XP_009148638.1|  PREDICTED: 25.3 kDa vesicle transport protei...  87.4    1e-19   
ref|XP_011036488.1|  PREDICTED: 25.3 kDa vesicle transport protein    87.0    1e-19   
ref|XP_009148639.1|  PREDICTED: 25.3 kDa vesicle transport protei...  87.0    1e-19   
ref|XP_009118166.1|  PREDICTED: 25.3 kDa vesicle transport protei...  87.0    1e-19   
gb|KDP40665.1|  hypothetical protein JCGZ_24664                       87.0    1e-19   
ref|XP_002304234.1|  hypothetical protein POPTR_0003s06750g           87.0    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_006417294.1|  hypothetical protein EUTSA_v10008741mg           87.0    1e-19   
ref|XP_004252403.1|  PREDICTED: 25.3 kDa vesicle transport protein    87.0    1e-19   
ref|XP_009110687.1|  PREDICTED: 25.3 kDa vesicle transport protein    87.0    1e-19   
ref|XP_006361329.1|  PREDICTED: 25.3 kDa vesicle transport protei...  87.0    2e-19   
ref|XP_006369115.1|  25.3 kDa vesicle transport family protein        87.0    2e-19   
ref|XP_004241907.1|  PREDICTED: 25.3 kDa vesicle transport protein    87.0    2e-19   
ref|XP_002889901.1|  hypothetical protein ARALYDRAFT_888501           87.0    2e-19   
gb|EPS69205.1|  hypothetical protein M569_05563                       87.0    2e-19   
ref|XP_008228156.1|  PREDICTED: 25.3 kDa vesicle transport protein    87.0    2e-19   
ref|NP_172653.1|  vesicle transport protein SEC22                     87.0    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008342425.1|  PREDICTED: 25.3 kDa vesicle transport protein    87.0    2e-19   
ref|XP_009336710.1|  PREDICTED: 25.3 kDa vesicle transport protein    87.0    2e-19   
ref|XP_002269715.1|  PREDICTED: 25.3 kDa vesicle transport protein    86.7    2e-19   Vitis vinifera
ref|XP_007215829.1|  hypothetical protein PRUPE_ppa010142mg           87.4    2e-19   
ref|XP_006357417.1|  PREDICTED: 25.3 kDa vesicle transport protei...  86.7    2e-19   
ref|XP_011072622.1|  PREDICTED: 25.3 kDa vesicle transport protein    86.7    2e-19   
emb|CAN69529.1|  hypothetical protein VITISV_027247                   86.7    2e-19   Vitis vinifera
ref|XP_009765877.1|  PREDICTED: 25.3 kDa vesicle transport protei...  86.3    2e-19   
gb|AFK40098.1|  unknown                                               86.3    2e-19   
ref|XP_007135396.1|  hypothetical protein PHAVU_010G126000g           86.3    3e-19   
ref|XP_010688318.1|  PREDICTED: 25.3 kDa vesicle transport protein    86.3    3e-19   
gb|AAC17634.1|  Contains similarity to vesicle trafficking protei...  86.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557568.1|  PREDICTED: 25.3 kDa vesicle transport protei...  86.3    3e-19   
ref|XP_009601535.1|  PREDICTED: 25.3 kDa vesicle transport protei...  85.9    4e-19   
ref|XP_009765876.1|  PREDICTED: 25.3 kDa vesicle transport protei...  85.9    4e-19   
ref|XP_009794761.1|  PREDICTED: 25.3 kDa vesicle transport protei...  85.9    4e-19   
ref|XP_004141719.1|  PREDICTED: 25.3 kDa vesicle transport protei...  85.9    5e-19   
ref|XP_004155904.1|  PREDICTED: 25.3 kDa vesicle transport protei...  85.5    5e-19   
ref|XP_004510539.1|  PREDICTED: 25.3 kDa vesicle transport protei...  85.1    8e-19   
ref|XP_008460329.1|  PREDICTED: 25.3 kDa vesicle transport protei...  85.1    9e-19   
ref|XP_009378361.1|  PREDICTED: 25.3 kDa vesicle transport protei...  84.7    9e-19   
ref|XP_008380778.1|  PREDICTED: 25.3 kDa vesicle transport protei...  84.7    1e-18   
ref|XP_004510538.1|  PREDICTED: 25.3 kDa vesicle transport protei...  84.7    1e-18   
ref|XP_004969413.1|  PREDICTED: 25.3 kDa vesicle transport protei...  84.0    2e-18   
ref|XP_011079506.1|  PREDICTED: 25.3 kDa vesicle transport protei...  84.0    2e-18   
ref|NP_001241102.1|  uncharacterized protein LOC100795552             84.0    2e-18   
ref|XP_003547819.1|  PREDICTED: 25.3 kDa vesicle transport protei...  84.0    2e-18   
ref|XP_009601386.1|  PREDICTED: 25.3 kDa vesicle transport protei...  83.6    2e-18   
dbj|BAD81384.1|  putative ERS-24                                      82.4    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003627365.1|  vesicle transport protein                        83.6    3e-18   
ref|XP_001765225.1|  R-SNARE, SEC22-family                            83.2    4e-18   
ref|XP_010932071.1|  PREDICTED: 25.3 kDa vesicle transport protei...  83.2    4e-18   
ref|XP_009406558.1|  PREDICTED: 25.3 kDa vesicle transport protei...  83.2    4e-18   
ref|XP_002466320.1|  hypothetical protein SORBIDRAFT_01g005550        83.2    4e-18   Sorghum bicolor [broomcorn]
ref|XP_010245740.1|  PREDICTED: 25.3 kDa vesicle transport protein    83.2    4e-18   
ref|XP_010932073.1|  PREDICTED: 25.3 kDa vesicle transport protei...  82.8    4e-18   
ref|XP_009406559.1|  PREDICTED: 25.3 kDa vesicle transport protei...  82.8    4e-18   
ref|XP_008793905.1|  PREDICTED: 25.3 kDa vesicle transport protei...  83.2    4e-18   
gb|AAO37967.1|  putative vesicle trafficking protein                  83.2    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008793909.1|  PREDICTED: 25.3 kDa vesicle transport protei...  82.8    4e-18   
ref|XP_010932072.1|  PREDICTED: 25.3 kDa vesicle transport protei...  82.8    4e-18   
gb|EMT21136.1|  25.3 kDa vesicle transport protein                    81.3    5e-18   
ref|XP_003557880.1|  PREDICTED: 25.3 kDa vesicle transport protei...  82.8    5e-18   
ref|XP_006650707.1|  PREDICTED: 25.3 kDa vesicle transport protei...  82.8    5e-18   
gb|EEC80182.1|  hypothetical protein OsI_22041                        82.8    5e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_001762056.1|  R-SNARE, SEC22-family                            82.8    5e-18   
gb|EEC70253.1|  hypothetical protein OsI_01050                        82.8    5e-18   Oryza sativa Indica Group [Indian rice]
dbj|BAJ93886.1|  predicted protein                                    82.8    7e-18   
gb|EMT12128.1|  25.3 kDa vesicle transport protein                    83.2    7e-18   
tpg|DAA51850.1|  TPA: hypothetical protein ZEAMMB73_674900            82.0    8e-18   
ref|XP_009418956.1|  PREDICTED: 25.3 kDa vesicle transport protei...  82.4    9e-18   
gb|EMS52144.1|  25.3 kDa vesicle transport protein                    82.4    9e-18   
ref|XP_008665575.1|  PREDICTED: 25.3 kDa vesicle transport protein    82.0    9e-18   
ref|XP_003566118.1|  PREDICTED: 25.3 kDa vesicle transport protein    82.0    1e-17   
gb|ACG38472.1|  25.3 kDa vesicle transport protein                    81.6    1e-17   Zea mays [maize]
ref|XP_004967377.1|  PREDICTED: 25.3 kDa vesicle transport protei...  81.6    1e-17   
ref|XP_010927421.1|  PREDICTED: LOW QUALITY PROTEIN: 25.3 kDa ves...  81.3    2e-17   
gb|AFW83513.1|  hypothetical protein ZEAMMB73_416677                  79.7    3e-17   
gb|EMS51045.1|  25.3 kDa vesicle transport protein                    78.6    4e-17   
ref|XP_010271160.1|  PREDICTED: 25.3 kDa vesicle transport protei...  79.7    6e-17   
ref|XP_006838993.1|  hypothetical protein AMTR_s00002p00271790        79.0    2e-16   
tpg|DAA52578.1|  TPA: hypothetical protein ZEAMMB73_794902            79.0    2e-16   
gb|ABK22735.1|  unknown                                               78.6    2e-16   Picea sitchensis
ref|XP_002977884.1|  hypothetical protein SELMODRAFT_228494           78.2    3e-16   
ref|XP_006409455.1|  hypothetical protein EUTSA_v10023085mg           77.0    5e-16   
gb|ABK23301.1|  unknown                                               77.0    6e-16   Picea sitchensis
ref|XP_001694037.1|  R-SNARE protein, Sec22-family                    75.9    2e-15   Chlamydomonas reinhardtii
ref|XP_005646702.1|  R-SNARE protein, Sec22-family                    74.3    7e-15   
ref|XP_002949323.1|  R-SNARE, Sec22-family                            73.9    9e-15   
ref|XP_003060019.1|  predicted protein                                73.6    1e-14   
ref|XP_002505707.1|  predicted protein                                73.6    1e-14   Micromonas commoda
ref|XP_007509943.1|  predicted protein                                70.1    7e-14   
ref|XP_003083120.1|  putative vesicle transport protein (ISS)         71.2    8e-14   
emb|CEG02186.1|  Synaptobrevin                                        71.2    9e-14   
ref|XP_005850477.1|  hypothetical protein CHLNCDRAFT_20041            70.9    1e-13   
ref|XP_004304242.1|  PREDICTED: 25.3 kDa vesicle transport protei...  70.1    2e-13   
gb|KFM23355.1|  25.3 kDa vesicle transport protein                    69.7    3e-13   
dbj|BAK00094.1|  predicted protein                                    68.9    5e-13   
gb|KDD75214.1|  hypothetical protein H632_c806p0                      68.2    8e-13   
ref|XP_004510537.1|  PREDICTED: 25.3 kDa vesicle transport protei...  68.6    8e-13   
emb|CDS12148.1|  Putative Vesicle transporter SEC22                   65.9    7e-12   
ref|XP_001422772.1|  predicted protein                                65.5    1e-11   Ostreococcus lucimarinus CCE9901
ref|XP_003323757.1|  vesicle transporter SEC22                        65.1    1e-11   
gb|EIE87726.1|  hypothetical protein RO3G_12437                       64.7    2e-11   
ref|XP_006677282.1|  hypothetical protein BATDEDRAFT_23448            64.3    2e-11   
ref|XP_007410223.1|  hypothetical protein MELLADRAFT_86574            63.9    3e-11   
ref|XP_005716258.1|  putative vesicle transport protein               63.9    4e-11   
ref|XP_005704158.1|  vesicle transport protein SEC22                  63.5    4e-11   
emb|CDS08532.1|  Putative Vesicle transporter SEC22                   63.5    5e-11   
gb|EPB89715.1|  vesicle transporter SEC22                             63.2    5e-11   
emb|CEG67385.1|  Putative Vesicle transporter SEC22                   63.2    6e-11   
emb|CEG82786.1|  Putative Vesicle transporter SEC22                   63.2    6e-11   
gb|KFH67628.1|  vesicle transporter SEC22                             62.4    1e-10   
emb|CDM37441.1|  Protein transport protein SEC22                      62.0    1e-10   
gb|EPS28600.1|  hypothetical protein PDE_03546                        62.0    1e-10   
ref|XP_002563747.1|  Pc20g12620                                       62.0    1e-10   Penicillium rubens Wisconsin 54-1255
gb|ESA19407.1|  hypothetical protein GLOINDRAFT_92900                 62.0    2e-10   
gb|KGO49195.1|  Synaptobrevin                                         62.0    2e-10   
gb|EKV12218.1|  Protein transport protein sec22                       62.0    2e-10   
ref|XP_001270141.1|  protein transport protein sec22                  61.6    2e-10   Aspergillus clavatus NRRL 1
gb|EPZ33749.1|  Longin domain-containing protein                      61.6    2e-10   
dbj|BAE61887.1|  unnamed protein product                              61.2    3e-10   Aspergillus oryzae
ref|XP_002378338.1|  protein transport protein sec22                  61.2    3e-10   Aspergillus flavus NRRL3357
gb|EGE07470.1|  transporter SEC22                                     60.8    4e-10   
gb|EGD93356.1|  protein transporter SEC22                             60.8    4e-10   
ref|XP_001396678.1|  SNARE complex subunit SEC22                      60.8    4e-10   Aspergillus niger CBS 513.88
ref|XP_001209728.1|  protein transport protein sec22                  60.8    4e-10   Aspergillus terreus NIH2624
ref|XP_003176212.1|  transporter SEC22                                60.8    4e-10   
ref|XP_003239262.1|  protein transporter SEC22                        60.8    4e-10   
ref|XP_004345497.1|  R-SNARE                                          60.8    4e-10   
ref|XP_003014281.1|  hypothetical protein ARB_07586                   60.8    5e-10   
ref|XP_003018989.1|  hypothetical protein TRV_07002                   60.8    5e-10   
ref|XP_004333619.1|  vesicle trafficking protein, putative            60.5    5e-10   
ref|XP_002847629.1|  protein transport protein sec22                  60.5    6e-10   Microsporum canis CBS 113480
dbj|BAE22055.1|  unnamed protein product                              60.1    7e-10   Mus musculus [mouse]
pdb|3EGD|C  Chain C, Crystal Structure Of The Mammalian Copii-coa...  59.7    8e-10   
gb|KFO33691.1|  Vesicle-trafficking protein SEC22b                    59.7    8e-10   
ref|XP_747662.1|  protein transport protein sec22                     60.1    9e-10   Aspergillus fumigatus Af293
ref|XP_001257620.1|  protein transport protein sec22                  59.7    9e-10   Aspergillus fischeri NRRL 181
ref|XP_008581247.1|  PREDICTED: vesicle-trafficking protein SEC22b    60.1    9e-10   
ref|XP_002759847.1|  PREDICTED: vesicle-trafficking protein SEC22...  60.1    9e-10   Callithrix jacchus [common marmoset]
ref|NP_001233675.1|  vesicle-trafficking protein SEC22b precursor     59.7    1e-09   
gb|EYE96704.1|  protein transport protein sec22                       59.7    1e-09   
pdb|2NUP|C  Chain C, Crystal Structure Of The Human Sec23a24A HET...  59.7    1e-09   
ref|XP_005341418.1|  PREDICTED: vesicle-trafficking protein SEC22...  59.7    1e-09   
ref|NP_035472.1|  vesicle-trafficking protein SEC22b precursor        59.7    1e-09   Mus musculus [mouse]
ref|XP_004646240.1|  PREDICTED: vesicle-trafficking protein SEC22...  59.7    1e-09   
ref|XP_003944836.1|  PREDICTED: vesicle-trafficking protein SEC22b    59.7    1e-09   
ref|XP_004881900.1|  PREDICTED: vesicle-trafficking protein SEC22...  59.7    1e-09   
gb|EDL38949.1|  SEC22 vesicle trafficking protein homolog B (S. c...  59.7    1e-09   
gb|ELV11681.1|  Vesicle-trafficking protein SEC22b                    59.7    1e-09   
gb|AAH09024.1|  SEC22 vesicle trafficking protein homolog B (S. c...  59.7    1e-09   Mus musculus [mouse]
ref|XP_006982681.1|  PREDICTED: vesicle-trafficking protein SEC22...  59.7    1e-09   
ref|XP_008023979.1|  hypothetical protein SETTUDRAFT_168436           59.7    1e-09   
ref|XP_004881899.1|  PREDICTED: vesicle-trafficking protein SEC22...  59.7    1e-09   
gb|KDO45713.1|  hypothetical protein CISIN_1g040101mg                 58.5    1e-09   
gb|KDO45711.1|  hypothetical protein CISIN_1g043681mg                 58.5    1e-09   
ref|XP_002676099.1|  predicted protein                                59.7    1e-09   Naegleria gruberi strain NEG-M
ref|XP_007589471.1|  putative protein transport protein sec22 pro...  59.7    1e-09   
gb|EKG21102.1|  Synaptobrevin                                         59.3    1e-09   
ref|XP_007689307.1|  hypothetical protein COCMIDRAFT_27453            59.3    1e-09   
ref|XP_003840312.1|  similar to transport protein sec22               59.3    1e-09   
ref|XP_008717505.1|  hypothetical protein HMPREF1541_04941            59.3    1e-09   
ref|XP_001934091.1|  protein transport protein SEC22                  59.3    2e-09   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_009050356.1|  hypothetical protein LOTGIDRAFT_231136           59.3    2e-09   
ref|XP_007735492.1|  vesicle transporter SEC22                        59.3    2e-09   
ref|XP_008728094.1|  hypothetical protein G647_05544                  59.3    2e-09   
ref|XP_006751243.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    2e-09   
ref|XP_007755050.1|  vesicle transporter SEC22                        58.9    2e-09   
gb|ERE92069.1|  vesicle-trafficking protein SEC22b precursor          59.7    2e-09   
ref|XP_009159589.1|  vesicle transporter SEC22                        58.9    2e-09   
ref|XP_007749521.1|  vesicle transporter SEC22                        58.9    2e-09   
ref|XP_007722851.1|  vesicle transporter SEC22                        58.9    2e-09   
ref|XP_010210083.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    2e-09   
gb|ERE92071.1|  vesicle-trafficking protein SEC22b precursor          59.7    2e-09   
ref|XP_001792269.1|  hypothetical protein SNOG_01633                  58.9    2e-09   Parastagonospora nodorum SN15
ref|XP_005426737.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    2e-09   
ref|XP_001634368.1|  predicted protein                                58.9    2e-09   Nematostella vectensis
gb|KEF61329.1|  vesicle transporter SEC22                             58.9    2e-09   
ref|XP_006122090.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    2e-09   
ref|XP_005493649.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    2e-09   
ref|XP_009998178.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    2e-09   
ref|XP_009971200.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    2e-09   
ref|XP_010141241.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    2e-09   
ref|XP_009937611.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    3e-09   
ref|XP_009318967.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    3e-09   
ref|XP_003769901.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_010113691.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    3e-09   
ref|XP_008937479.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    3e-09   
ref|XP_009283632.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    3e-09   
ref|XP_009563784.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    3e-09   
ref|XP_010407826.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    3e-09   
ref|XP_008405321.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_002192858.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   Taeniopygia guttata
ref|XP_001501277.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   Equus caballus [domestic horse]
ref|XP_009891194.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    3e-09   
ref|XP_005241317.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.2    3e-09   
ref|XP_005147153.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_007061269.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_009929232.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    3e-09   
ref|XP_007946618.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    3e-09   
ref|XP_005434275.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_008493061.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    3e-09   
ref|XP_006919754.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_008405319.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_533025.1|  PREDICTED: vesicle-trafficking protein SEC22b       58.5    3e-09   Canis lupus familiaris [dogs]
ref|XP_007528743.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    3e-09   
ref|XP_007441927.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_006260013.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_006190861.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_003219927.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    3e-09   
ref|XP_006861376.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_009507991.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    3e-09   
ref|XP_009082902.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    3e-09   
dbj|GAD91527.1|  protein transport protein sec22                      58.2    3e-09   
gb|EOA95793.1|  Vesicle-trafficking protein SEC22b                    58.2    3e-09   
ref|XP_007776883.1|  vesicle transporter SEC22                        58.5    3e-09   
ref|XP_009671175.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    3e-09   
ref|NP_001026437.1|  vesicle-trafficking protein SEC22b precursor     58.5    3e-09   Gallus gallus [bantam]
ref|XP_009485071.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    3e-09   
gb|EFB15606.1|  hypothetical protein PANDA_020247                     58.2    3e-09   Ailuropoda melanoleuca
ref|XP_009643668.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    3e-09   
ref|XP_005050026.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    3e-09   
ref|XP_006036426.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.2    3e-09   
gb|ETE65053.1|  Vesicle-trafficking protein SEC22b                    58.5    3e-09   
gb|KGO68165.1|  Synaptobrevin                                         58.2    3e-09   
ref|XP_010580376.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    4e-09   
ref|XP_005027467.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.2    4e-09   
ref|XP_010198776.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    4e-09   
ref|XP_004582181.1|  PREDICTED: vesicle-trafficking protein SEC22...  59.3    4e-09   
ref|XP_009097967.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    4e-09   
gb|EHB01226.1|  Vesicle-trafficking protein SEC22b                    58.5    4e-09   
ref|XP_005499078.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.2    4e-09   
ref|XP_795453.1|  PREDICTED: vesicle-trafficking protein SEC22b-like  58.2    4e-09   Strongylocentrotus purpuratus [purple urchin]
ref|XP_009896562.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.5    5e-09   
ref|XP_007787921.1|  Protein transport protein sec22                  58.2    5e-09   
ref|XP_009031669.1|  hypothetical protein HELRODRAFT_90867            58.2    5e-09   
ref|NP_001069811.1|  vesicle-trafficking protein SEC22b precursor     58.5    5e-09   Bos taurus [bovine]
ref|XP_005895332.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    5e-09   
ref|XP_004638733.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.5    5e-09   
ref|XP_004618214.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.2    6e-09   
ref|XP_009460842.1|  PREDICTED: vesicle-trafficking protein SEC22b    58.2    6e-09   
gb|KDR18017.1|  Vesicle-trafficking protein SEC22b-B                  57.8    6e-09   
ref|XP_002736579.1|  PREDICTED: vesicle-trafficking protein SEC22...  57.8    7e-09   Saccoglossus kowalevskii
ref|XP_003729207.1|  PREDICTED: vesicle-trafficking protein SEC22...  58.2    9e-09   
ref|XP_006763141.1|  PREDICTED: vesicle-trafficking protein SEC22...  57.0    1e-08   
ref|NP_958459.1|  vesicle-trafficking protein SEC22b-B precursor      57.0    1e-08   Danio rerio [leopard danio]
ref|NP_001107489.1|  uncharacterized protein LOC100135340 precursor   57.0    1e-08   Xenopus tropicalis [western clawed frog]
ref|XP_002836281.1|  hypothetical protein                             57.0    1e-08   Tuber melanosporum Mel28
sp|O75396.4|SC22B_HUMAN  RecName: Full=Vesicle-trafficking protei...  57.0    1e-08   Homo sapiens [man]
ref|XP_008145457.1|  PREDICTED: vesicle-trafficking protein SEC22b    57.0    1e-08   
gb|ELK30859.1|  Vesicle-trafficking protein SEC22b                    56.6    1e-08   
ref|XP_005879138.1|  PREDICTED: vesicle-trafficking protein SEC22...  56.6    1e-08   
emb|CCX04245.1|  Similar to Protein transport protein sec22; acc....  56.6    2e-08   
gb|EMD40457.1|  protein transport protein Sec22                       56.6    2e-08   
ref|XP_004659145.1|  PREDICTED: vesicle-trafficking protein SEC22...  56.2    2e-08   
ref|XP_002492492.1|  R-SNARE protein                                  56.2    2e-08   Komagataella phaffii GS115
dbj|GAM19218.1|  hypothetical protein SAMD00019534_023930             56.2    2e-08   
emb|CDR43237.1|  CYFA0S11e02168g1_1                                   56.2    2e-08   
ref|XP_008305309.1|  PREDICTED: vesicle-trafficking protein SEC22...  56.2    2e-08   
ref|XP_008305308.1|  PREDICTED: vesicle-trafficking protein SEC22...  56.2    2e-08   
ref|XP_002109991.1|  hypothetical protein TRIADDRAFT_20955            56.2    2e-08   
ref|XP_008927861.1|  PREDICTED: vesicle-trafficking protein SEC22b    57.0    3e-08   
gb|EMG48678.1|  Protein transport protein SEC22                       55.8    3e-08   
ref|XP_010773510.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    3e-08   
ref|XP_010773511.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    3e-08   
emb|CDQ75595.1|  unnamed protein product                              55.8    3e-08   
emb|CDQ74240.1|  unnamed protein product                              55.8    3e-08   
gb|ACM09163.1|  Vesicle-trafficking protein SEC22b-B                  55.8    3e-08   
ref|XP_005994129.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    3e-08   
ref|XP_007901137.1|  PREDICTED: vesicle-trafficking protein SEC22b    55.5    3e-08   
ref|XP_003451347.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    3e-08   
ref|XP_006790391.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    3e-08   
ref|XP_003451346.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    3e-08   
emb|CAF95853.1|  unnamed protein product                              55.8    3e-08   
ref|XP_006790392.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    3e-08   
ref|NP_001158722.1|  Vesicle-trafficking protein SEC22b-B precursor   55.8    3e-08   
ref|XP_007918533.1|  putative protein transport protein sec22 pro...  55.8    3e-08   
ref|XP_008275740.1|  PREDICTED: vesicle-trafficking protein SEC22b-B  55.8    3e-08   
ref|XP_007558688.1|  PREDICTED: vesicle-trafficking protein SEC22b-B  55.8    3e-08   
ref|XP_010728474.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    3e-08   
ref|XP_010728475.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    3e-08   
ref|XP_004067731.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.8    4e-08   
ref|XP_007245872.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.5    4e-08   
ref|XP_004067730.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.5    4e-08   
ref|XP_007245871.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.5    4e-08   
ref|NP_001290973.1|  vesicle-trafficking protein SEC22b-B precursor   55.5    4e-08   
ref|XP_002143407.1|  protein transport protein sec22                  55.5    4e-08   
ref|XP_002479729.1|  protein transport protein sec22                  55.5    4e-08   
gb|EWC44570.1|  protein transport protein sec22                       55.5    4e-08   
ref|XP_010870105.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.5    4e-08   
gb|ELU03416.1|  hypothetical protein CAPTEDRAFT_92845                 55.1    4e-08   
ref|XP_003645448.1|  hypothetical protein Ecym_3127                   55.5    4e-08   
emb|CDQ68877.1|  unnamed protein product                              55.5    4e-08   
gb|EGC49796.1|  protein transporter sec22                             55.5    5e-08   
gb|EER43949.1|  SNARE sec22                                           55.5    5e-08   
gb|EEH09278.1|  protein transporter sec22                             55.1    5e-08   
ref|XP_001539675.1|  protein transport protein sec22                  55.1    5e-08   
gb|KFX49058.1|  Protein transport protein sec22                       55.1    5e-08   
ref|XP_005311578.1|  PREDICTED: vesicle-trafficking protein SEC22b    55.8    5e-08   
gb|EFA81715.1|  hypothetical protein PPL_05709                        55.1    5e-08   
dbj|GAM39839.1|  protein transport protein                            55.1    5e-08   
ref|XP_002143406.1|  protein transport protein sec22                  55.1    5e-08   
ref|XP_008628662.1|  PREDICTED: vesicle-trafficking protein SEC22b    55.5    6e-08   
ref|XP_002479728.1|  protein transport protein sec22                  55.1    6e-08   
ref|XP_006900385.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.1    6e-08   
ref|XP_004717316.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.1    6e-08   
ref|NP_989156.1|  vesicle-trafficking protein SEC22b precursor        55.1    6e-08   
ref|XP_010731618.1|  PREDICTED: vesicle-trafficking protein SEC22...  55.1    6e-08   
ref|NP_001257938.1|  vesicle-trafficking protein SEC22b-b precursor   55.1    6e-08   
ref|XP_646421.1|  hypothetical protein DDB_G0269942                   55.1    6e-08   
ref|XP_008083924.1|  SNARE-like protein                               55.1    6e-08   
ref|XP_002129330.1|  PREDICTED: vesicle-trafficking protein SEC22b    55.1    7e-08   
ref|NP_001080905.1|  vesicle-trafficking protein SEC22b-a             55.1    7e-08   
gb|AAH49291.1|  Sec22l1b protein                                      55.1    7e-08   
ref|XP_002624507.1|  protein transporter sec22                        54.7    7e-08   
emb|CCM03394.1|  predicted protein                                    54.3    7e-08   
ref|XP_003742438.1|  PREDICTED: vesicle-trafficking protein SEC22...  54.7    8e-08   
dbj|BAN20505.1|  snare protein sec22                                  54.7    8e-08   
ref|XP_008431535.1|  PREDICTED: vesicle-trafficking protein SEC22...  54.3    8e-08   
ref|XP_010760134.1|  hypothetical protein PADG_04764                  54.7    8e-08   
gb|KIH95119.1|  vesicle transport protein SEC22                       54.7    8e-08   
gb|ERS95537.1|  hypothetical protein HMPREF1624_08053                 54.7    8e-08   
ref|XP_003283151.1|  hypothetical protein DICPUDRAFT_146775           55.8    8e-08   
ref|XP_005111656.1|  PREDICTED: vesicle-trafficking protein SEC22...  54.7    9e-08   
ref|XP_009223970.1|  protein transporter SEC22                        54.7    9e-08   
gb|EEH33555.2|  transport protein sec22                               54.3    9e-08   
emb|CDK27262.1|  unnamed protein product                              54.7    9e-08   
ref|XP_002793695.1|  transport protein sec22                          54.3    1e-07   
emb|CCA39894.1|  scavenger mRNA-decapping enzyme DcpS                 56.2    1e-07   
ref|XP_002421960.1|  R-SNARE protein, putative; protein transport...  54.3    1e-07   
ref|XP_003038239.1|  hypothetical protein SCHCODRAFT_46766            54.3    1e-07   
ref|XP_008431534.1|  PREDICTED: vesicle-trafficking protein SEC22...  54.3    1e-07   
gb|EEQ43496.1|  protein transport protein SEC22                       54.3    1e-07   
gb|KDQ64925.1|  hypothetical protein JAAARDRAFT_28582                 54.3    1e-07   
ref|XP_006459944.1|  protein transport protein Sec22                  54.3    1e-07   
ref|XP_011064323.1|  PREDICTED: vesicle-trafficking protein SEC22b    54.3    1e-07   
gb|EFN68103.1|  Vesicle-trafficking protein SEC22b                    54.3    1e-07   
gb|KFY33543.1|  hypothetical protein V494_07504                       54.3    1e-07   
ref|XP_004366615.1|  hypothetical protein DFA_04207                   55.5    1e-07   
gb|KFZ14526.1|  hypothetical protein V501_03225                       54.3    1e-07   
gb|KFY71436.1|  hypothetical protein V499_08388                       54.3    1e-07   
gb|KFZ23797.1|  hypothetical protein V502_01754                       53.9    1e-07   
gb|EWG43366.1|  vesicle transporter SEC22                             53.9    1e-07   
gb|EGU78440.1|  hypothetical protein FOXB_11054                       53.9    1e-07   
ref|XP_007568755.1|  PREDICTED: vesicle-trafficking protein SEC22...  53.9    1e-07   
ref|XP_503132.1|  YALI0D21956p                                        53.9    1e-07   
gb|KFX86939.1|  hypothetical protein V490_08702                       53.9    2e-07   
gb|EQB50290.1|  hypothetical protein CGLO_10277                       53.9    2e-07   
ref|XP_007293573.1|  transporter sec22                                53.9    2e-07   
ref|XP_007284645.1|  protein transport protein sec22                  53.9    2e-07   
ref|XP_006635130.1|  PREDICTED: vesicle-trafficking protein SEC22...  53.9    2e-07   
emb|CCE42594.1|  hypothetical protein CPAR2_202370                    53.9    2e-07   
ref|XP_011121205.1|  hypothetical protein AOL_s00076g350              53.9    2e-07   
gb|EDK39730.2|  hypothetical protein PGUG_03828                       53.5    2e-07   
ref|XP_011111363.1|  hypothetical protein H072_5483                   53.9    2e-07   
ref|NP_001134386.1|  Vesicle-trafficking protein SEC22b-B precursor   53.9    2e-07   
ref|XP_003974030.1|  PREDICTED: vesicle-trafficking protein SEC22...  53.9    2e-07   
ref|NP_986933.2|  AGR267Wp                                            53.9    2e-07   
gb|ELR08763.1|  vesicle transporter SEC22                             53.9    2e-07   
gb|AGO11946.1|  AaceriAGR267Wp                                        53.9    2e-07   
gb|EPE02296.1|  protein transport protein sec22                       53.9    2e-07   
ref|XP_010772883.1|  PREDICTED: vesicle-trafficking protein SEC22...  53.9    2e-07   
ref|NP_998549.1|  vesicle-trafficking protein SEC22b-A                53.9    2e-07   
ref|XP_003974031.1|  PREDICTED: vesicle-trafficking protein SEC22...  53.9    2e-07   
ref|XP_003869226.1|  Sec22 protein                                    53.9    2e-07   
emb|CDQ56294.1|  unnamed protein product                              53.9    2e-07   
gb|ENH88293.1|  protein transport protein sec22                       53.9    2e-07   
emb|CCA14301.1|  vesicletrafficking protein SEC22b putative           53.9    2e-07   
ref|XP_007788363.1|  putative protein transport protein sec22 pro...  53.9    2e-07   
ref|XP_001553340.1|  hypothetical protein BC1G_08170                  53.9    2e-07   
ref|XP_002430641.1|  Vesicle-trafficking protein SEC22B, putative     53.9    2e-07   
gb|ETP51159.1|  hypothetical protein, variant 1                       54.3    2e-07   
gb|EPQ61983.1|  hypothetical protein BGT96224_A21387                  53.5    2e-07   
ref|XP_001911329.1|  hypothetical protein                             53.5    2e-07   
gb|KFY17684.1|  hypothetical protein V492_00460                       53.9    2e-07   
ref|XP_006673022.1|  protein transport protein sec22                  53.5    2e-07   
ref|XP_001590003.1|  hypothetical protein SS1G_08767                  53.5    2e-07   
gb|AHH29557.1|  synaptobrevin                                         53.5    2e-07   
gb|KFY32437.1|  hypothetical protein V493_00170                       53.9    2e-07   
gb|ESU11161.1|  transporter SEC22                                     53.5    2e-07   
ref|XP_009258659.1|  hypothetical protein FPSE_07266                  53.5    2e-07   
emb|CCD48716.1|  similar to transport protein sec22                   53.5    2e-07   
gb|ESZ92972.1|  protein transport protein sec22                       53.5    2e-07   
gb|ETO82044.1|  hypothetical protein, variant 1                       54.3    2e-07   
ref|XP_009536987.1|  hypothetical protein PHYSODRAFT_529447           53.5    2e-07   
ref|XP_385402.1|  hypothetical protein FG05226.1                      53.5    2e-07   
ref|XP_007837800.1|  Protein transport protein sec22                  53.5    2e-07   
ref|XP_008900890.1|  hypothetical protein, variant 1                  54.3    2e-07   
ref|XP_002555707.1|  KLTH0G15510p                                     53.5    2e-07   
gb|KDQ29048.1|  hypothetical protein PLEOSDRAFT_1039188               53.5    3e-07   
gb|ETO82046.1|  hypothetical protein, variant 3                       53.5    3e-07   
ref|XP_008900889.1|  hypothetical protein, variant 3                  53.5    3e-07   
emb|CAF97566.1|  unnamed protein product                              53.5    3e-07   
ref|XP_002904211.1|  vesicle-trafficking protein SEC22b, putative     53.5    3e-07   
gb|KFY87257.1|  hypothetical protein V500_07060                       54.3    3e-07   
gb|KFM68816.1|  Vesicle-trafficking protein SEC22b                    53.1    3e-07   
ref|XP_003975801.1|  PREDICTED: vesicle-trafficking protein SEC22...  53.1    3e-07   
ref|XP_003676213.1|  hypothetical protein NCAS_0D02710                52.8    3e-07   
ref|XP_001484447.1|  hypothetical protein PGUG_03828                  52.8    3e-07   
ref|XP_002404323.1|  synaptobrevin 1-2, putative                      53.1    3e-07   
ref|XP_975087.1|  PREDICTED: vesicle-trafficking protein SEC22b-B     52.8    4e-07   
ref|XP_006786896.1|  PREDICTED: vesicle-trafficking protein SEC22...  52.8    4e-07   
ref|XP_005721016.1|  PREDICTED: vesicle-trafficking protein SEC22...  52.8    4e-07   
gb|EMT68473.1|  Protein transport protein sec22                       52.8    4e-07   
ref|XP_008281053.1|  PREDICTED: vesicle-trafficking protein SEC22...  52.8    4e-07   
ref|XP_004570563.1|  PREDICTED: vesicle-trafficking protein SEC22...  52.8    4e-07   
ref|XP_005802430.1|  PREDICTED: vesicle-trafficking protein SEC22...  52.8    4e-07   
ref|XP_003672032.1|  hypothetical protein NDAI_0I02200                52.4    4e-07   
ref|XP_007861909.1|  protein transport protein Sec22                  52.8    4e-07   
ref|XP_003437846.1|  PREDICTED: vesicle-trafficking protein SEC22...  52.8    4e-07   
ref|XP_009843914.1|  hypothetical protein, variant                    52.8    5e-07   
gb|KFY95203.1|  hypothetical protein V498_03501                       52.8    5e-07   
gb|EZA61906.1|  Vesicle-trafficking protein SEC22b-B                  52.4    5e-07   
gb|KDN68197.1|  putative transporter sec22                            52.4    5e-07   
gb|EFQ27859.1|  transporter sec22                                     52.4    5e-07   
ref|XP_001239175.1|  hypothetical protein CIMG_10197                  52.4    5e-07   
ref|XP_008877922.1|  hypothetical protein H310_12576                  52.8    5e-07   
ref|XP_004198976.1|  Piso0_002373                                     52.4    6e-07   
ref|XP_001225428.1|  hypothetical protein CHGG_07772                  52.4    6e-07   
ref|XP_009843913.1|  hypothetical protein H257_16985                  52.8    6e-07   
ref|XP_001875306.1|  protein transport protein Sec22                  52.4    6e-07   
ref|XP_460999.2|  DEHA2F14674p                                        52.4    7e-07   
ref|XP_003661646.1|  hypothetical protein MYCTH_2314627               52.4    7e-07   
gb|ESW98488.1|  Protein transport protein SEC22                       52.0    8e-07   
ref|XP_004078935.1|  PREDICTED: vesicle-trafficking protein SEC22...  52.0    8e-07   
ref|XP_003050173.1|  predicted protein                                52.0    8e-07   
ref|XP_003955073.1|  hypothetical protein KAFR_0A05020                52.0    8e-07   
ref|XP_003649173.1|  hypothetical protein THITE_2107535               52.0    8e-07   
ref|XP_007602665.1|  transporter sec22                                52.8    8e-07   
emb|CCK70946.1|  hypothetical protein KNAG_0F02840                    52.0    9e-07   
ref|XP_003682986.1|  hypothetical protein TDEL_0G04080                52.0    9e-07   
ref|XP_008332325.1|  PREDICTED: vesicle-trafficking protein SEC22...  52.0    9e-07   
gb|EFN81052.1|  Vesicle-trafficking protein SEC22b                    52.0    9e-07   
ref|NP_001291126.1|  vesicle-trafficking protein SEC22b-like prec...  52.0    9e-07   
gb|EPT02844.1|  hypothetical protein FOMPIDRAFT_1022719               52.0    1e-06   
emb|CBN76882.1|  Soluble NSF Attachment Protein (SNAP) Receptor (...  52.0    1e-06   
ref|NP_001153403.1|  vesicle-trafficking protein SEC22b               51.6    1e-06   
ref|XP_007373858.1|  hypothetical protein SPAPADRAFT_59695            51.6    1e-06   
ref|XP_007315388.1|  hypothetical protein SERLADRAFT_460483           51.6    1e-06   
gb|EFX88988.1|  hypothetical protein DAPPUDRAFT_187154                51.6    1e-06   
ref|XP_006686739.1|  snare-like protein                               51.6    1e-06   
ref|XP_003394350.1|  PREDICTED: vesicle-trafficking protein SEC22...  51.6    1e-06   
ref|XP_001386516.2|  hypothetical protein PICST_64252                 51.2    1e-06   
ref|XP_003490821.1|  PREDICTED: vesicle-trafficking protein SEC22...  51.6    1e-06   
ref|XP_008555588.1|  PREDICTED: vesicle-trafficking protein SEC22b-B  51.6    1e-06   
gb|KDR83430.1|  hypothetical protein GALMADRAFT_235564                51.6    1e-06   
ref|XP_003719791.1|  protein transporter SEC22                        51.6    1e-06   
gb|EFX04099.1|  protein transport protein sec22                       53.1    1e-06   
ref|XP_005535769.1|  similar to putative vesicle transport protein    51.6    1e-06   
ref|XP_005829410.1|  vesicle trafficking protein Sec22                51.6    1e-06   
ref|XP_004668516.1|  PREDICTED: vesicle-trafficking protein SEC22...  52.0    2e-06   
gb|KDO30734.1|  hypothetical protein SPRG_04635                       51.2    2e-06   
ref|XP_008611589.1|  hypothetical protein SDRG_07531                  51.2    2e-06   
ref|NP_001155802.1|  transport protein SEC22-like                     51.2    2e-06   
ref|XP_003699863.1|  PREDICTED: vesicle-trafficking protein SEC22...  51.2    2e-06   
gb|KDN38042.1|  putative SEC22-synaptobrevin                          51.2    2e-06   
gb|ACO10948.1|  Vesicle-trafficking protein SEC22b-B                  50.8    2e-06   
ref|XP_002600269.1|  hypothetical protein BRAFLDRAFT_113706           51.2    2e-06   
ref|XP_006558046.1|  PREDICTED: vesicle-trafficking protein SEC22...  50.4    2e-06   
ref|XP_003008415.1|  transport protein sec22                          50.8    2e-06   
ref|XP_001525437.1|  protein transport protein SEC22                  50.8    2e-06   
gb|KEZ39739.1|  hypothetical protein SAPIO_CDS9697                    50.8    2e-06   
gb|ENN73906.1|  hypothetical protein YQE_09478                        51.2    2e-06   
ref|XP_007768161.1|  protein transport protein Sec22                  50.8    2e-06   
emb|CEJ89855.1|  Putative Protein transport protein sec22             50.8    2e-06   
ref|XP_007846920.1|  protein transport protein sec22                  50.8    2e-06   
emb|CCA70466.1|  probable SEC22-synaptobrevin (V-SNARE)               50.8    3e-06   
gb|EHK26060.1|  hypothetical protein TRIVIDRAFT_55478                 50.8    3e-06   
ref|XP_006964482.1|  v-SNARE protein                                  50.8    3e-06   
ref|XP_007364232.1|  protein transport protein Sec22                  50.4    3e-06   
gb|ETS60714.1|  hypothetical protein PaG_04617                        52.8    3e-06   
gb|ACO12012.1|  Vesicle-trafficking protein SEC22b-B                  50.4    3e-06   
ref|XP_003855148.1|  SNARE complex subunit SEC22                      50.4    3e-06   
gb|ADD24346.1|  Vesicle-trafficking protein SEC22b-B                  50.4    3e-06   
ref|XP_006011303.1|  PREDICTED: vesicle-trafficking protein SEC22...  50.4    3e-06   
ref|XP_010107437.1|  25.3 kDa vesicle transport protein               50.1    3e-06   
gb|ADD37937.1|  Vesicle-trafficking protein SEC22b-B                  50.4    3e-06   
gb|EGZ75449.1|  protein transport protein sec22                       50.4    3e-06   
ref|XP_396838.2|  PREDICTED: vesicle-trafficking protein SEC22b-B...  50.4    3e-06   



>gb|KHG17649.1| 25.3 kDa vesicle transport -like protein [Gossypium arboreum]
Length=228

 Score = 88.6 bits (218),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  114  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  155



>ref|XP_010541831.1| PREDICTED: 25.3 kDa vesicle transport protein [Tarenaya hassleriana]
 ref|XP_010541832.1| PREDICTED: 25.3 kDa vesicle transport protein [Tarenaya hassleriana]
Length=218

 Score = 88.2 bits (217),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>ref|XP_006305596.1| hypothetical protein CARUB_v10010262mg [Capsella rubella]
 gb|EOA38494.1| hypothetical protein CARUB_v10010262mg [Capsella rubella]
Length=218

 Score = 88.2 bits (217),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>ref|XP_009804444.1| PREDICTED: 25.3 kDa vesicle transport protein [Nicotiana sylvestris]
Length=218

 Score = 88.2 bits (217),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>ref|XP_010061858.1| PREDICTED: 25.3 kDa vesicle transport protein [Eucalyptus grandis]
 gb|KCW68889.1| hypothetical protein EUGRSUZ_F02475 [Eucalyptus grandis]
Length=218

 Score = 88.2 bits (217),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>ref|NP_001275228.1| uncharacterized protein LOC102577571 [Solanum tuberosum]
 ref|XP_004235564.1| PREDICTED: 25.3 kDa vesicle transport protein [Solanum lycopersicum]
 gb|ABB29953.1| unknown [Solanum tuberosum]
Length=218

 Score = 88.2 bits (217),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>ref|XP_004303719.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>gb|AEB71558.1| synaptobrevin/VAMP-like protein [Solanum chacoense]
Length=218

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>gb|KCW68890.1| hypothetical protein EUGRSUZ_F02475 [Eucalyptus grandis]
Length=217

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>ref|XP_010493446.1| PREDICTED: 25.3 kDa vesicle transport protein [Camelina sativa]
 ref|XP_010476131.1| PREDICTED: 25.3 kDa vesicle transport protein [Camelina sativa]
Length=218

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>ref|XP_010458604.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Camelina 
sativa]
Length=218

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>ref|XP_009600035.1| PREDICTED: 25.3 kDa vesicle transport protein [Nicotiana tomentosiformis]
Length=218

 Score = 88.2 bits (217),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/42 (100%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  145



>gb|EYU45902.1| hypothetical protein MIMGU_mgv1a013509mg [Erythranthe guttata]
Length=218

 Score = 87.4 bits (215),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRN+SKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNVSKLNDELYE  145



>gb|KHG18205.1| 25.3 kDa vesicle transport -like protein [Gossypium arboreum]
 gb|KHG24628.1| 25.3 kDa vesicle transport -like protein [Gossypium arboreum]
Length=218

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_007024708.1| Synaptobrevin family protein isoform 1 [Theobroma cacao]
 ref|XP_007024709.1| Synaptobrevin family protein isoform 1 [Theobroma cacao]
 gb|EOY27330.1| Synaptobrevin family protein isoform 1 [Theobroma cacao]
 gb|EOY27331.1| Synaptobrevin family protein isoform 1 [Theobroma cacao]
Length=218

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_002529185.1| snare protein sec22, putative [Ricinus communis]
 gb|EEF33199.1| snare protein sec22, putative [Ricinus communis]
Length=233

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_006426747.1| hypothetical protein CICLE_v10026450mg [Citrus clementina]
 ref|XP_006426748.1| hypothetical protein CICLE_v10026450mg [Citrus clementina]
 gb|ESR39987.1| hypothetical protein CICLE_v10026450mg [Citrus clementina]
 gb|ESR39988.1| hypothetical protein CICLE_v10026450mg [Citrus clementina]
Length=218

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_006465842.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Citrus sinensis]
Length=218

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>emb|CDX98099.1| BnaA06g08500D [Brassica napus]
Length=218

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>emb|CDY34822.1| BnaA09g47480D [Brassica napus]
Length=232

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>emb|CDO97818.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_010103538.1| 25.3 kDa vesicle transport protein [Morus notabilis]
 gb|EXB96198.1| 25.3 kDa vesicle transport protein [Morus notabilis]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_011048585.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Populus euphratica]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNVAKLNDELYE  145



>emb|CDY30033.1| BnaC05g09870D [Brassica napus]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_009148638.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X1 
[Brassica rapa]
Length=234

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  120  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  161



>ref|XP_011036488.1| PREDICTED: 25.3 kDa vesicle transport protein [Populus euphratica]
 ref|XP_011036489.1| PREDICTED: 25.3 kDa vesicle transport protein [Populus euphratica]
 ref|XP_011036490.1| PREDICTED: 25.3 kDa vesicle transport protein [Populus euphratica]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_009148639.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X2 
[Brassica rapa]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_009118166.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Brassica 
rapa]
 emb|CDY34617.1| BnaC08g41760D [Brassica napus]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>gb|KDP40665.1| hypothetical protein JCGZ_24664 [Jatropha curcas]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_002304234.1| hypothetical protein POPTR_0003s06750g [Populus trichocarpa]
 ref|XP_006385526.1| hypothetical protein POPTR_0003s06750g [Populus trichocarpa]
 ref|XP_006385527.1| 25.3 kDa vesicle transport family protein [Populus trichocarpa]
 gb|EEE79213.1| hypothetical protein POPTR_0003s06750g [Populus trichocarpa]
 gb|ERP63323.1| hypothetical protein POPTR_0003s06750g [Populus trichocarpa]
 gb|ERP63324.1| 25.3 kDa vesicle transport family protein [Populus trichocarpa]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_006417294.1| hypothetical protein EUTSA_v10008741mg [Eutrema salsugineum]
 gb|ESQ35647.1| hypothetical protein EUTSA_v10008741mg [Eutrema salsugineum]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_004252403.1| PREDICTED: 25.3 kDa vesicle transport protein [Solanum lycopersicum]
 ref|XP_010314328.1| PREDICTED: 25.3 kDa vesicle transport protein [Solanum lycopersicum]
 ref|XP_010314329.1| PREDICTED: 25.3 kDa vesicle transport protein [Solanum lycopersicum]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNITKLNDELYE  145



>ref|XP_009110687.1| PREDICTED: 25.3 kDa vesicle transport protein [Brassica rapa]
 emb|CDY31220.1| BnaC08g15150D [Brassica napus]
 emb|CDY21019.1| BnaA08g25060D [Brassica napus]
Length=218

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_006361329.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X1 
[Solanum tuberosum]
 ref|XP_006361330.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X2 
[Solanum tuberosum]
Length=218

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNITKLNDELYE  145



>ref|XP_006369115.1| 25.3 kDa vesicle transport family protein [Populus trichocarpa]
 gb|ERP65684.1| 25.3 kDa vesicle transport family protein [Populus trichocarpa]
Length=218

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNVAKLNDELYE  145



>ref|XP_004241907.1| PREDICTED: 25.3 kDa vesicle transport protein [Solanum lycopersicum]
 ref|XP_010322818.1| PREDICTED: 25.3 kDa vesicle transport protein [Solanum lycopersicum]
 ref|XP_010322819.1| PREDICTED: 25.3 kDa vesicle transport protein [Solanum lycopersicum]
Length=218

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNVAKLNDELYE  145



>ref|XP_002889901.1| hypothetical protein ARALYDRAFT_888501 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66160.1| hypothetical protein ARALYDRAFT_888501 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>gb|EPS69205.1| hypothetical protein M569_05563 [Genlisea aurea]
Length=218

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_008228156.1| PREDICTED: 25.3 kDa vesicle transport protein [Prunus mume]
Length=217

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|NP_172653.1| vesicle transport protein SEC22 [Arabidopsis thaliana]
 sp|Q94AU2.1|SEC22_ARATH RecName: Full=25.3 kDa vesicle transport protein; Short=AtSEC22 
[Arabidopsis thaliana]
 gb|AAK76469.1| putative vesicle transport protein [Arabidopsis thaliana]
 gb|AAL85144.1| putative vesicle transport protein [Arabidopsis thaliana]
 gb|AAM63800.1| putative vesicle transport protein [Arabidopsis thaliana]
 gb|AEE28809.1| vesicle transport protein SEC22 [Arabidopsis thaliana]
Length=218

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_008342425.1| PREDICTED: 25.3 kDa vesicle transport protein [Malus domestica]
 ref|XP_008342426.1| PREDICTED: 25.3 kDa vesicle transport protein [Malus domestica]
 ref|XP_008342427.1| PREDICTED: 25.3 kDa vesicle transport protein [Malus domestica]
 ref|XP_008362341.1| PREDICTED: 25.3 kDa vesicle transport protein [Malus domestica]
 ref|XP_008362342.1| PREDICTED: 25.3 kDa vesicle transport protein [Malus domestica]
 ref|XP_008362343.1| PREDICTED: 25.3 kDa vesicle transport protein [Malus domestica]
Length=218

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_009336710.1| PREDICTED: 25.3 kDa vesicle transport protein [Pyrus x bretschneideri]
 ref|XP_009336711.1| PREDICTED: 25.3 kDa vesicle transport protein [Pyrus x bretschneideri]
Length=218

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_002269715.1| PREDICTED: 25.3 kDa vesicle transport protein [Vitis vinifera]
 ref|XP_010654404.1| PREDICTED: 25.3 kDa vesicle transport protein [Vitis vinifera]
 emb|CBI35830.3| unnamed protein product [Vitis vinifera]
Length=218

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_007215829.1| hypothetical protein PRUPE_ppa010142mg [Prunus persica]
 gb|EMJ17028.1| hypothetical protein PRUPE_ppa010142mg [Prunus persica]
Length=262

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  149  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  190



>ref|XP_006357417.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X1 
[Solanum tuberosum]
 ref|XP_006357418.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X2 
[Solanum tuberosum]
 ref|XP_006357419.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X3 
[Solanum tuberosum]
 ref|XP_006357420.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X4 
[Solanum tuberosum]
Length=218

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNVAKLNDELYE  145



>ref|XP_011072622.1| PREDICTED: 25.3 kDa vesicle transport protein [Sesamum indicum]
 ref|XP_011072623.1| PREDICTED: 25.3 kDa vesicle transport protein [Sesamum indicum]
 ref|XP_011072624.1| PREDICTED: 25.3 kDa vesicle transport protein [Sesamum indicum]
Length=218

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>emb|CAN69529.1| hypothetical protein VITISV_027247 [Vitis vinifera]
Length=218

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_009765877.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X2 
[Nicotiana sylvestris]
Length=195

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQ+TKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQRTKKLYQDTRTQRNITKLNDELYE  145



>gb|AFK40098.1| unknown [Lotus japonicus]
Length=218

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDT TQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTHTQRNISKLNDELYE  145



>ref|XP_007135396.1| hypothetical protein PHAVU_010G126000g [Phaseolus vulgaris]
 gb|ESW07390.1| hypothetical protein PHAVU_010G126000g [Phaseolus vulgaris]
Length=218

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDT TQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTHTQRNISKLNDELYE  145



>ref|XP_010688318.1| PREDICTED: 25.3 kDa vesicle transport protein [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQ+TKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQRTKKLYQDTRTQRNIAKLNDELYE  145



>gb|AAC17634.1| Contains similarity to vesicle trafficking protein gb|U91538 
from Mus musculus. ESTs gb|F15494 and gb|F14097 come from this 
gene [Arabidopsis thaliana]
Length=263

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  149  IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYE  190



>ref|XP_010557568.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Tarenaya 
hassleriana]
 ref|XP_010557569.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Tarenaya 
hassleriana]
 ref|XP_010557571.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Tarenaya 
hassleriana]
 ref|XP_010557572.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Tarenaya 
hassleriana]
 ref|XP_010557573.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Tarenaya 
hassleriana]
 ref|XP_010557574.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Tarenaya 
hassleriana]
Length=218

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTF+QKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFMQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_009601535.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Nicotiana 
tomentosiformis]
Length=218

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQ+TKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQRTKKLYQDTRTQRNITKLNDELYE  145



>ref|XP_009765876.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X1 
[Nicotiana sylvestris]
Length=218

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQ+TKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQRTKKLYQDTRTQRNITKLNDELYE  145



>ref|XP_009794761.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Nicotiana 
sylvestris]
 ref|XP_009794762.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Nicotiana 
sylvestris]
Length=218

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/42 (98%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDT TQRNISKLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTGTQRNISKLNDELYE  145



>ref|XP_004141719.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Cucumis sativus]
Length=231

 Score = 85.9 bits (211),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDT+IQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  117  IETAARPYAFIKFDTYIQKTKKLYQDTRTQRNIAKLNDELYE  158



>ref|XP_004155904.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Cucumis sativus]
 ref|XP_008462269.1| PREDICTED: 25.3 kDa vesicle transport protein [Cucumis melo]
 ref|XP_008462270.1| PREDICTED: 25.3 kDa vesicle transport protein [Cucumis melo]
 gb|KGN45465.1| hypothetical protein Csa_7G448760 [Cucumis sativus]
Length=218

 Score = 85.5 bits (210),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 42/42 (100%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDT+IQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTYIQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_004510539.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X1 
[Cicer arietinum]
 ref|XP_004510540.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X2 
[Cicer arietinum]
Length=218

 Score = 85.1 bits (209),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDT TQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTHTQRNIAKLNDELYE  145



>ref|XP_008460329.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Cucumis melo]
 ref|XP_008460330.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Cucumis melo]
 ref|XP_008460331.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Cucumis melo]
Length=218

 Score = 85.1 bits (209),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            +ETAARPYAFIKFDTFIQK KKLYQDTRTQRNI+KLNDELYE
Sbjct  104  VETAARPYAFIKFDTFIQKMKKLYQDTRTQRNIAKLNDELYE  145



>ref|XP_009378361.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Pyrus x bretschneideri]
 ref|XP_009378362.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Pyrus x bretschneideri]
 ref|XP_009378363.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Pyrus x bretschneideri]
Length=218

 Score = 84.7 bits (208),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDT TQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTHTQRNIAKLNDELYE  145



>ref|XP_008380778.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Malus domestica]
 ref|XP_008380779.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Malus domestica]
Length=218

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDT TQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTHTQRNIAKLNDELYE  145



>ref|XP_004510538.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X2 
[Cicer arietinum]
Length=218

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAF+KFDTFIQKTKKLYQDT TQRNI+KLNDELYE
Sbjct  104  IETAARPYAFVKFDTFIQKTKKLYQDTHTQRNIAKLNDELYE  145



>ref|XP_004969413.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Setaria italica]
Length=218

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNIAKLNDELYE  145



>ref|XP_011079506.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Sesamum indicum]
Length=218

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETA RPYAFIKFDTF+QKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  104  IETAGRPYAFIKFDTFMQKTKKLYQDTRTQRNIAKLNDELYE  145



>ref|NP_001241102.1| uncharacterized protein LOC100795552 [Glycine max]
 gb|ACU21015.1| unknown [Glycine max]
 gb|KHN01440.1| 25.3 kDa vesicle transport protein [Glycine soja]
Length=218

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTF+QKTKKLYQDT TQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFMQKTKKLYQDTHTQRNIAKLNDELYE  145



>ref|XP_003547819.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X1 
[Glycine max]
 ref|XP_006598843.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X2 
[Glycine max]
 gb|KHN39600.1| 25.3 kDa vesicle transport protein [Glycine soja]
Length=218

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTF+QKTKKLYQDT TQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFMQKTKKLYQDTHTQRNIAKLNDELYE  145



>ref|XP_009601386.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Nicotiana 
tomentosiformis]
Length=218

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLYQDT TQRNISKL+DELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYQDTGTQRNISKLSDELYE  145



>dbj|BAD81384.1| putative ERS-24 [Oryza sativa Japonica Group]
Length=146

 Score = 82.4 bits (202),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_003627365.1| vesicle transport protein [Medicago truncatula]
 gb|AET01841.1| synaptobrevin-like protein [Medicago truncatula]
 gb|AFK44006.1| unknown [Medicago truncatula]
Length=218

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFD FIQKTKKLYQDT+TQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDAFIQKTKKLYQDTQTQRNIAKLNDELYE  145



>ref|XP_001765225.1| R-SNARE, SEC22-family [Physcomitrella patens]
 ref|XP_001765226.1| R-SNARE, SEC22-family [Physcomitrella patens]
 gb|EDQ69953.1| R-SNARE, SEC22-family [Physcomitrella patens]
 gb|EDQ69954.1| R-SNARE, SEC22-family [Physcomitrella patens]
Length=219

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IET ARPYAFIKFDTFIQKT+KLYQDTRTQRN+SKLND+LYE
Sbjct  104  IETVARPYAFIKFDTFIQKTRKLYQDTRTQRNLSKLNDDLYE  145



>ref|XP_010932071.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X1 [Elaeis 
guineensis]
Length=218

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_009406558.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=218

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNMAKLNDELYE  145



>ref|XP_002466320.1| hypothetical protein SORBIDRAFT_01g005550 [Sorghum bicolor]
 gb|EER93318.1| hypothetical protein SORBIDRAFT_01g005550 [Sorghum bicolor]
Length=218

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_010245740.1| PREDICTED: 25.3 kDa vesicle transport protein [Nelumbo nucifera]
 ref|XP_010245741.1| PREDICTED: 25.3 kDa vesicle transport protein [Nelumbo nucifera]
 ref|XP_010245742.1| PREDICTED: 25.3 kDa vesicle transport protein [Nelumbo nucifera]
 ref|XP_010245743.1| PREDICTED: 25.3 kDa vesicle transport protein [Nelumbo nucifera]
 ref|XP_010245744.1| PREDICTED: 25.3 kDa vesicle transport protein [Nelumbo nucifera]
Length=218

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_010932073.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X3 [Elaeis 
guineensis]
Length=192

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_009406559.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=207

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNMAKLNDELYE  145



>ref|XP_008793905.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793906.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793908.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X1 [Phoenix 
dactylifera]
Length=218

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTR+QRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYSDTRSQRNLAKLNDELYE  145



>gb|AAO37967.1| putative vesicle trafficking protein [Oryza sativa Japonica Group]
 gb|ABF99287.1| 25.3 kDa vesicle transport protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99288.1| 25.3 kDa vesicle transport protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAH01645.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76313.1| hypothetical protein OsI_13847 [Oryza sativa Indica Group]
 gb|EEE60076.1| hypothetical protein OsJ_12902 [Oryza sativa Japonica Group]
Length=218

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_008793909.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X2 [Phoenix 
dactylifera]
Length=202

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTR+QRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYSDTRSQRNLAKLNDELYE  145



>ref|XP_010932072.1| PREDICTED: 25.3 kDa vesicle transport protein isoform X2 [Elaeis 
guineensis]
Length=205

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>gb|EMT21136.1| 25.3 kDa vesicle transport protein [Aegilops tauschii]
Length=125

 Score = 81.3 bits (199),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKT+KLY DTRTQRN++KLNDELYE
Sbjct  30   IETAARPYAFIKFDTFIQKTRKLYLDTRTQRNLAKLNDELYE  71



>ref|XP_003557880.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Brachypodium 
distachyon]
Length=218

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_006650707.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Oryza brachyantha]
Length=218

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>gb|EEC80182.1| hypothetical protein OsI_22041 [Oryza sativa Indica Group]
 gb|EEE65259.1| hypothetical protein OsJ_20460 [Oryza sativa Japonica Group]
Length=218

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_001762056.1| R-SNARE, SEC22-family [Physcomitrella patens]
 gb|EDQ73160.1| R-SNARE, SEC22-family [Physcomitrella patens]
Length=219

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IET ARPYAFIKFDTFIQKT+KLYQDTRTQRN+SKLND+LYE
Sbjct  104  IETVARPYAFIKFDTFIQKTRKLYQDTRTQRNLSKLNDDLYE  145



>gb|EEC70253.1| hypothetical protein OsI_01050 [Oryza sativa Indica Group]
Length=226

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>dbj|BAJ93886.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score = 82.8 bits (203),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDT+IQKTKKLY DTRTQRNI+KLNDELYE
Sbjct  114  IETAARPYAFIKFDTYIQKTKKLYLDTRTQRNIAKLNDELYE  155



>gb|EMT12128.1| 25.3 kDa vesicle transport protein [Aegilops tauschii]
Length=306

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDT+IQKTKKLY DTRTQRNI+KLNDELYE
Sbjct  113  IETAARPYAFIKFDTYIQKTKKLYLDTRTQRNIAKLNDELYE  154



>tpg|DAA51850.1| TPA: hypothetical protein ZEAMMB73_674900 [Zea mays]
Length=207

 Score = 82.0 bits (201),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKT+KLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTRKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_009418956.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009418957.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score = 82.4 bits (202),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DT TQRNI+KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTHTQRNIAKLNDELYE  145



>gb|EMS52144.1| 25.3 kDa vesicle transport protein [Triticum urartu]
Length=226

 Score = 82.4 bits (202),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDT+IQKTKKLY DTRTQRNI+KLNDELYE
Sbjct  112  IETAARPYAFIKFDTYIQKTKKLYLDTRTQRNIAKLNDELYE  153



>ref|XP_008665575.1| PREDICTED: 25.3 kDa vesicle transport protein [Zea mays]
 ref|XP_008665576.1| PREDICTED: 25.3 kDa vesicle transport protein [Zea mays]
 tpg|DAA51849.1| TPA: hypothetical protein ZEAMMB73_674900 [Zea mays]
Length=218

 Score = 82.0 bits (201),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKT+KLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTRKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_003566118.1| PREDICTED: 25.3 kDa vesicle transport protein [Brachypodium distachyon]
Length=218

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKT+KLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTRKLYLDTRTQRNLTKLNDELYE  145



>gb|ACG38472.1| 25.3 kDa vesicle transport protein [Zea mays]
 gb|ACL54049.1| unknown [Zea mays]
 tpg|DAA52725.1| TPA: vesicle transport protein [Zea mays]
Length=218

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFD FIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDAFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_004967377.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Setaria italica]
Length=218

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFD FIQKTKKLY DTRTQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDAFIQKTKKLYLDTRTQRNLAKLNDELYE  145



>ref|XP_010927421.1| PREDICTED: LOW QUALITY PROTEIN: 25.3 kDa vesicle transport protein-like 
[Elaeis guineensis]
Length=218

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DT TQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTHTQRNLAKLNDELYE  145



>gb|AFW83513.1| hypothetical protein ZEAMMB73_416677 [Zea mays]
Length=166

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IE AARPYAFIKFDTFI KTKKLY DTRTQRN++KLNDELYE
Sbjct  63   IEIAARPYAFIKFDTFIHKTKKLYLDTRTQRNLAKLNDELYE  104



>gb|EMS51045.1| 25.3 kDa vesicle transport protein [Triticum urartu]
Length=111

 Score = 78.6 bits (192),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKT+KLY DTRTQRN++KLNDEL E
Sbjct  30   IETAARPYAFIKFDTFIQKTRKLYLDTRTQRNLAKLNDELCE  71



>ref|XP_010271160.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Nelumbo nucifera]
 ref|XP_010271162.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Nelumbo nucifera]
 ref|XP_010271163.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Nelumbo nucifera]
 ref|XP_010271164.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Nelumbo nucifera]
Length=218

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DT TQRN++KLNDELYE
Sbjct  104  IETAARPYAFIKFDTFIQKTKKLYLDTCTQRNLAKLNDELYE  145



>ref|XP_006838993.1| hypothetical protein AMTR_s00002p00271790 [Amborella trichopoda]
 gb|ERN01562.1| hypothetical protein AMTR_s00002p00271790 [Amborella trichopoda]
Length=214

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKT+KLY DT TQRN++KLND+LYE
Sbjct  104  IETAARPYAFIKFDTFIQKTRKLYLDTHTQRNLAKLNDDLYE  145



>tpg|DAA52578.1| TPA: hypothetical protein ZEAMMB73_794902 [Zea mays]
Length=248

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFI KTKKLY DTRTQRN++KLNDELYE
Sbjct  95   IETAARPYAFIKFDTFIHKTKKLYLDTRTQRNLAKLNDELYE  136



>gb|ABK22735.1| unknown [Picea sitchensis]
Length=218

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            +ET ARPYAFIKFDTFIQKT+KLY DTRTQRN++KLND+LYE
Sbjct  104  VETVARPYAFIKFDTFIQKTRKLYLDTRTQRNLAKLNDDLYE  145



>ref|XP_002977884.1| hypothetical protein SELMODRAFT_228494 [Selaginella moellendorffii]
 ref|XP_002979443.1| hypothetical protein SELMODRAFT_271384 [Selaginella moellendorffii]
 gb|EFJ19332.1| hypothetical protein SELMODRAFT_271384 [Selaginella moellendorffii]
 gb|EFJ21222.1| hypothetical protein SELMODRAFT_228494 [Selaginella moellendorffii]
Length=219

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IET ARPYAF+KFD FIQKT+KLY DTRTQRN+S+LNDELYE
Sbjct  104  IETVARPYAFVKFDIFIQKTRKLYLDTRTQRNLSRLNDELYE  145



>ref|XP_006409455.1| hypothetical protein EUTSA_v10023085mg, partial [Eutrema salsugineum]
 gb|ESQ50908.1| hypothetical protein EUTSA_v10023085mg, partial [Eutrema salsugineum]
Length=198

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IETAARPYAFIKFDTFIQKTKKLY DTR QRNI+KLNDEL+E
Sbjct  111  IETAARPYAFIKFDTFIQKTKKLY-DTRMQRNIAKLNDELHE  151



>gb|ABK23301.1| unknown [Picea sitchensis]
Length=219

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IET ARPYAFIKFDTFIQKT+KLY DT TQRN++KLND+LYE
Sbjct  104  IETVARPYAFIKFDTFIQKTRKLYLDTHTQRNLAKLNDDLYE  145



>ref|XP_001694037.1| R-SNARE protein, Sec22-family [Chlamydomonas reinhardtii]
 gb|EDP02973.1| R-SNARE protein, Sec22-family [Chlamydomonas reinhardtii]
Length=219

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            + T +RPYAFIKFDTFIQKTKKLY DTRTQRN+SKLND+L E
Sbjct  104  VHTVSRPYAFIKFDTFIQKTKKLYMDTRTQRNLSKLNDDLAE  145



>ref|XP_005646702.1| R-SNARE protein, Sec22-family [Coccomyxa subellipsoidea C-169]
 gb|EIE22158.1| R-SNARE protein, Sec22-family [Coccomyxa subellipsoidea C-169]
Length=220

 Score = 74.3 bits (181),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IE+AARPYAFIKFDTFI KTKKLY DTRTQRNISKL ++L E
Sbjct  103  IESAARPYAFIKFDTFISKTKKLYMDTRTQRNISKLTEDLSE  144



>ref|XP_002949323.1| R-SNARE, Sec22-family [Volvox carteri f. nagariensis]
 gb|EFJ49816.1| R-SNARE, Sec22-family [Volvox carteri f. nagariensis]
Length=219

 Score = 73.9 bits (180),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            + + +RPYAFIKFDTFIQKTKKLY DTRTQRN+SKLND+L E
Sbjct  104  VHSVSRPYAFIKFDTFIQKTKKLYLDTRTQRNLSKLNDDLAE  145



>ref|XP_003060019.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55971.1| predicted protein [Micromonas pusilla CCMP1545]
Length=223

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            +ET ARPYAFIKFDTFIQ+TKKLY DTRTQRN++KLN++L++
Sbjct  103  VETVARPYAFIKFDTFIQRTKKLYLDTRTQRNLNKLNEDLHD  144



>ref|XP_002505707.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66965.1| predicted protein [Micromonas sp. RCC299]
Length=219

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            +ET ARPYAFIKFDT IQ+TKKLYQDTRTQRN++KLN++L++
Sbjct  103  VETVARPYAFIKFDTVIQRTKKLYQDTRTQRNLNKLNEDLHD  144



>ref|XP_007509943.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19058.1| predicted protein [Bathycoccus prasinos]
Length=119

 Score = 70.1 bits (170),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            +++ ARPYAFIKFDTFIQKTKKLY D RTQRN+ KLN++L++
Sbjct  3    VDSVARPYAFIKFDTFIQKTKKLYSDQRTQRNLEKLNEDLHD  44



>ref|XP_003083120.1| putative vesicle transport protein (ISS) [Ostreococcus tauri]
Length=239

 Score = 71.2 bits (173),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            + T  RPYAFIKFDTFIQ+TKKLY D RTQRN++KLND+L++
Sbjct  122  VGTVGRPYAFIKFDTFIQRTKKLYSDARTQRNLNKLNDDLHD  163



>emb|CEG02186.1| Synaptobrevin [Ostreococcus tauri]
Length=232

 Score = 71.2 bits (173),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            + T  RPYAFIKFDTFIQ+TKKLY D RTQRN++KLND+L++
Sbjct  115  VGTVGRPYAFIKFDTFIQRTKKLYSDARTQRNLNKLNDDLHD  156



>ref|XP_005850477.1| hypothetical protein CHLNCDRAFT_20041 [Chlorella variabilis]
 gb|EFN58375.1| hypothetical protein CHLNCDRAFT_20041 [Chlorella variabilis]
Length=217

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            IE   RPYAFIKFDTFIQKTKKLY DTRTQRNI+KLN ++ E
Sbjct  104  IEAVTRPYAFIKFDTFIQKTKKLYLDTRTQRNIAKLNADIAE  145



>ref|XP_004304242.1| PREDICTED: 25.3 kDa vesicle transport protein-like [Fragaria 
vesca subsp. vesca]
Length=215

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            I TAARPYAF+ FD FIQKTKKLYQDTRT  NIS LNDE+ E
Sbjct  100  IHTAARPYAFLNFDKFIQKTKKLYQDTRTLHNISMLNDEVSE  141



>gb|KFM23355.1| 25.3 kDa vesicle transport protein [Auxenochlorella protothecoides]
Length=217

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            ++T  RPYAFIKFDTFIQKTKKLY DTRTQRNI+KLN ++ E
Sbjct  103  VDTVNRPYAFIKFDTFIQKTKKLYLDTRTQRNIAKLNQDIAE  144



>dbj|BAK00094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=170

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 41/68 (60%), Gaps = 26/68 (38%)
 Frame = +2

Query  2    IETAARPYAFIKF--------------------------DTFIQKTKKLYQDTRTQRNIS  103
            IETAARPYAFIKF                          DTFIQKT+KLY DTRTQRN++
Sbjct  30   IETAARPYAFIKFGMVLRSFMNIFHIHLLISYWVVCLCLDTFIQKTRKLYLDTRTQRNLA  89

Query  104  KLNDELYE  127
            KLNDELYE
Sbjct  90   KLNDELYE  97



>gb|KDD75214.1| hypothetical protein H632_c806p0 [Helicosporidium sp. ATCC 50920]
Length=190

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            I+T  RPYAFIKFDTFIQKT+KLY DTRTQRN+SKL+ E+ E
Sbjct  77   IDTTNRPYAFIKFDTFIQKTRKLYLDTRTQRNLSKLSAEIAE  118



>ref|XP_004510537.1| PREDICTED: 25.3 kDa vesicle transport protein-like isoform X1 
[Cicer arietinum]
Length=248

 Score = 68.6 bits (166),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 41/72 (57%), Gaps = 30/72 (42%)
 Frame = +2

Query  2    IETAARPYAFIKF------------------------------DTFIQKTKKLYQDTRTQ  91
            IETAARPYAF+KF                              DTFIQKTKKLYQDT TQ
Sbjct  104  IETAARPYAFVKFGRYQFLYYLAYFSLFPMVFNIPFFFLEYLIDTFIQKTKKLYQDTHTQ  163

Query  92   RNISKLNDELYE  127
            RNI+KLNDELYE
Sbjct  164  RNIAKLNDELYE  175



>emb|CDS12148.1| Putative Vesicle transporter SEC22 [Absidia idahoensis var. thermophila]
Length=217

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  11   AARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
              RPYAF+KFDTF+QKTKK+YQDTRTQ N+SKLN++L
Sbjct  106  GLRPYAFVKFDTFMQKTKKIYQDTRTQSNLSKLNEDL  142



>ref|XP_001422772.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01089.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=227

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            ++  ARPYAFIKFDTFIQ+TK LY D RTQRN++KLN +L
Sbjct  111  VDAVARPYAFIKFDTFIQRTKALYSDARTQRNLNKLNTDL  150



>ref|XP_003323757.1| vesicle transporter SEC22 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
 gb|EFP79338.1| vesicle transporter SEC22 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
Length=215

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            RPYAF+KFDTFIQ+TKKLYQDTRTQ N+ +LN++L E
Sbjct  108  RPYAFVKFDTFIQRTKKLYQDTRTQSNLDRLNEDLGE  144



>gb|EIE87726.1| hypothetical protein RO3G_12437 [Rhizopus delemar RA 99-880]
Length=217

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +2

Query  5    ETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +   RPYAF+KFDTF+QKTK++YQDTRTQ N+SKLN++L
Sbjct  104  KAGLRPYAFVKFDTFMQKTKRIYQDTRTQSNLSKLNEDL  142



>ref|XP_006677282.1| hypothetical protein BATDEDRAFT_23448 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82127.1| hypothetical protein BATDEDRAFT_23448 [Batrachochytrium dendrobatidis 
JAM81]
Length=215

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            I    RPYAF++FD+FIQKTKKLY+D RTQRN+ KLN++L
Sbjct  101  IAAIGRPYAFVRFDSFIQKTKKLYKDARTQRNLHKLNEDL  140



>ref|XP_007410223.1| hypothetical protein MELLADRAFT_86574 [Melampsora larici-populina 
98AG31]
 gb|EGG06389.1| hypothetical protein MELLADRAFT_86574 [Melampsora larici-populina 
98AG31]
Length=215

 Score = 63.9 bits (154),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            RPYAF+KFDTFIQ+TK+LYQDTRTQ N+ +LN++L E
Sbjct  108  RPYAFVKFDTFIQRTKRLYQDTRTQSNLDRLNEDLGE  144



>ref|XP_005716258.1| putative vesicle transport protein [Chondrus crispus]
 emb|CDF36439.1| putative vesicle transport protein [Chondrus crispus]
Length=226

 Score = 63.9 bits (154),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +  A+RPY FI+FDTFIQKTKK+Y D++TQRN+ KLN EL
Sbjct  112  VAGASRPYEFIRFDTFIQKTKKVYNDSKTQRNLQKLNSEL  151



>ref|XP_005704158.1| vesicle transport protein SEC22 [Galdieria sulphuraria]
 gb|EME27638.1| vesicle transport protein SEC22 [Galdieria sulphuraria]
Length=168

 Score = 63.5 bits (153),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + TA RPY FI+FD+F+QKTKKLY++TRTQRNI+KL  EL
Sbjct  106  VATATRPYEFIRFDSFLQKTKKLYENTRTQRNITKLQQEL  145



>emb|CDS08532.1| Putative Vesicle transporter SEC22 [Absidia idahoensis var. thermophila]
Length=217

 Score = 63.5 bits (153),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF+KFDTF+QKTK++YQDTRTQ N++KLN++L
Sbjct  108  RPYAFVKFDTFMQKTKRIYQDTRTQNNLTKLNEDL  142



>gb|EPB89715.1| vesicle transporter SEC22 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=217

 Score = 63.2 bits (152),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  11   AARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
              RPYAF+KFDTF+QKTK++YQDTRTQ N++KLN++L
Sbjct  106  GLRPYAFVKFDTFMQKTKRIYQDTRTQSNLTKLNEDL  142



>emb|CEG67385.1| Putative Vesicle transporter SEC22 [Rhizopus microsporus]
 emb|CEI86313.1| Putative Vesicle transporter SEC22 [Rhizopus microsporus]
Length=217

 Score = 63.2 bits (152),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  11   AARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
              RPYAF+KFDTF+QKTK++YQDTRTQ N++KLN++L
Sbjct  106  GLRPYAFVKFDTFMQKTKRIYQDTRTQSNLAKLNEDL  142



>emb|CEG82786.1| Putative Vesicle transporter SEC22 [Rhizopus microsporus]
Length=217

 Score = 63.2 bits (152),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  11   AARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
              RPYAF+KFDTF+QKTK++YQDTRTQ N++KLN++L
Sbjct  106  GLRPYAFVKFDTFMQKTKRIYQDTRTQSNLAKLNEDL  142



>gb|KFH67628.1| vesicle transporter SEC22 [Mortierella verticillata NRRL 6337]
Length=215

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  11   AARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
              RPYAF+KFDTF+QKTK+LYQDTRTQ N++KL+++L
Sbjct  104  GLRPYAFVKFDTFMQKTKRLYQDTRTQSNLTKLHEDL  140



>emb|CDM37441.1| Protein transport protein SEC22 [Penicillium roqueforti FM164]
Length=215

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ KLNDEL
Sbjct  108  RPYAFVEFDTFIQRTKKLYQDSRASQNLDKLNDEL  142



>gb|EPS28600.1| hypothetical protein PDE_03546 [Penicillium oxalicum 114-2]
Length=215

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ KLNDEL
Sbjct  108  RPYAFVEFDTFIQRTKKLYQDSRASQNLDKLNDEL  142



>ref|XP_002563747.1| Pc20g12620 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP86591.1| Pc20g12620 [Penicillium rubens Wisconsin 54-1255]
Length=215

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ KLNDEL
Sbjct  108  RPYAFVEFDTFIQRTKKLYQDSRASQNLDKLNDEL  142



>gb|ESA19407.1| hypothetical protein GLOINDRAFT_92900 [Rhizophagus irregularis 
DAOM 181602]
Length=218

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            RPYAF+KFDTF+QKTKK+YQ+TRTQ N+ +LN EL E
Sbjct  109  RPYAFVKFDTFMQKTKKVYQNTRTQHNLDRLNTELNE  145



>gb|KGO49195.1| Synaptobrevin [Penicillium expansum]
 gb|KGO50740.1| Synaptobrevin [Penicillium expansum]
 gb|KGO54126.1| Synaptobrevin [Penicillium expansum]
Length=196

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ KLNDEL
Sbjct  95   RPYAFVEFDTFIQRTKKLYQDSRASQNLDKLNDEL  129



>gb|EKV12218.1| Protein transport protein sec22 [Penicillium digitatum PHI26]
 gb|EKV20378.1| Protein transport protein sec22 [Penicillium digitatum Pd1]
Length=202

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ KLNDEL
Sbjct  95   RPYAFVEFDTFIQRTKKLYQDSRASQNLDKLNDEL  129



>ref|XP_001270141.1| protein transport protein sec22 [Aspergillus clavatus NRRL 1]
 gb|EAW08715.1| protein transport protein sec22 [Aspergillus clavatus NRRL 1]
Length=202

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ +LNDEL
Sbjct  95   RPYAFVEFDTFIQRTKKLYQDSRASQNLGRLNDEL  129



>gb|EPZ33749.1| Longin domain-containing protein [Rozella allomycis CSF55]
Length=213

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            IET  RPYA IKFDT+IQK K+ YQD R+QRN+ KLN++L
Sbjct  100  IETVDRPYALIKFDTYIQKAKRNYQDARSQRNVEKLNEDL  139



>dbj|BAE61887.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=215

 Score = 61.2 bits (147),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ +LNDEL
Sbjct  108  RPYAFVEFDTFIQRTKKLYQDSRASQNLDRLNDEL  142



>ref|XP_002378338.1| protein transport protein sec22 [Aspergillus flavus NRRL3357]
 ref|XP_001823020.2| SNARE complex subunit SEC22 [Aspergillus oryzae RIB40]
 dbj|BAF36383.1| v-SNARE [Aspergillus oryzae]
 gb|EED51331.1| protein transport protein sec22 [Aspergillus flavus NRRL3357]
Length=215

 Score = 61.2 bits (147),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ +LNDEL
Sbjct  108  RPYAFVEFDTFIQRTKKLYQDSRASQNLDRLNDEL  142



>gb|EGE07470.1| transporter SEC22 [Trichophyton equinum CBS 127.97]
Length=215

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + ++ RPYAF++FD+FIQ+TKK YQD+R  +NI KLNDEL
Sbjct  103  LSSSLRPYAFVEFDSFIQRTKKSYQDSRASQNIEKLNDEL  142



>gb|EGD93356.1| protein transporter SEC22 [Trichophyton tonsurans CBS 112818]
Length=202

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + ++ RPYAF++FD+FIQ+TKK YQD+R  +NI KLNDEL
Sbjct  90   LSSSLRPYAFVEFDSFIQRTKKSYQDSRASQNIEKLNDEL  129



>ref|XP_001396678.1| SNARE complex subunit SEC22 [Aspergillus niger CBS 513.88]
 emb|CAL00952.1| unnamed protein product [Aspergillus niger]
 gb|EHA24514.1| hypothetical protein ASPNIDRAFT_40412 [Aspergillus niger ATCC 
1015]
 dbj|GAA90642.1| hypothetical protein AKAW_08756 [Aspergillus kawachii IFO 4308]
Length=215

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ +LNDEL
Sbjct  108  RPYAFVEFDTFIQRTKKLYQDSRASQNLDRLNDEL  142



>ref|XP_001209728.1| protein transport protein sec22 [Aspergillus terreus NIH2624]
 gb|EAU32426.1| protein transport protein sec22 [Aspergillus terreus NIH2624]
Length=179

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ +LNDEL
Sbjct  72   RPYAFVEFDTFIQRTKKLYQDSRASQNLDRLNDEL  106



>ref|XP_003176212.1| transporter SEC22 [Microsporum gypseum CBS 118893]
 gb|EFQ97260.1| transporter SEC22 [Microsporum gypseum CBS 118893]
Length=215

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + ++ RPYAF++FD+FIQ+TKK YQD+R  +NI KLNDEL
Sbjct  103  LSSSLRPYAFVEFDSFIQRTKKSYQDSRASQNIDKLNDEL  142



>ref|XP_003239262.1| protein transporter SEC22 [Trichophyton rubrum CBS 118892]
 gb|EGD84971.1| hypothetical protein TERG_01244 [Trichophyton rubrum CBS 118892]
 gb|EZF09965.1| hypothetical protein H100_08715 [Trichophyton rubrum MR850]
 gb|EZF36367.1| hypothetical protein H101_00125 [Trichophyton interdigitale H6]
 gb|EZF36819.1| hypothetical protein H102_08674 [Trichophyton rubrum CBS 100081]
 gb|EZF47415.1| hypothetical protein H103_08697 [Trichophyton rubrum CBS 288.86]
 gb|EZF58073.1| hypothetical protein H104_08649 [Trichophyton rubrum CBS 289.86]
 gb|EZF68680.1| hypothetical protein H105_08701 [Trichophyton soudanense CBS 
452.61]
 gb|EZF79373.1| hypothetical protein H110_08699 [Trichophyton rubrum MR1448]
 gb|EZF90129.1| hypothetical protein H113_08766 [Trichophyton rubrum MR1459]
 gb|EZG01239.1| hypothetical protein H106_08572 [Trichophyton rubrum CBS 735.88]
 gb|EZG11666.1| hypothetical protein H107_08852 [Trichophyton rubrum CBS 202.88]
 gb|KDB21906.1| hypothetical protein H109_06171 [Trichophyton interdigitale MR816]
 gb|KDB28530.1| hypothetical protein H112_08693 [Trichophyton rubrum D6]
Length=215

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + ++ RPYAF++FD+FIQ+TKK YQD+R  +NI KLNDEL
Sbjct  103  LSSSLRPYAFVEFDSFIQRTKKSYQDSRASQNIDKLNDEL  142



>ref|XP_004345497.1| R-SNARE [Capsaspora owczarzaki ATCC 30864]
 gb|EFW40775.1| hypothetical protein CAOG_05907 [Capsaspora owczarzaki ATCC 30864]
Length=217

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            I TA+RPYAFI FDT IQ+ +K Y DTR  RN+SKLND+L +
Sbjct  102  IHTASRPYAFISFDTTIQRLRKQYSDTRAARNVSKLNDDLMD  143



>ref|XP_003014281.1| hypothetical protein ARB_07586 [Arthroderma benhamiae CBS 112371]
 gb|EFE33641.1| hypothetical protein ARB_07586 [Arthroderma benhamiae CBS 112371]
Length=215

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + ++ RPYAF++FD+FIQ+TKK YQD+R  +NI KLNDEL
Sbjct  103  LSSSLRPYAFVEFDSFIQRTKKSYQDSRASQNIDKLNDEL  142



>ref|XP_003018989.1| hypothetical protein TRV_07002 [Trichophyton verrucosum HKI 0517]
 gb|EFE38344.1| hypothetical protein TRV_07002 [Trichophyton verrucosum HKI 0517]
Length=215

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + ++ RPYAF++FD+FIQ+TKK YQD+R  +NI KLNDEL
Sbjct  103  LSSSLRPYAFVEFDSFIQRTKKSYQDSRASQNIDKLNDEL  142



>ref|XP_004333619.1| vesicle trafficking protein, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11606.1| vesicle trafficking protein, putative [Acanthamoeba castellanii 
str. Neff]
Length=212

 Score = 60.5 bits (145),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            + +A RPYAFIKFDTFIQKTKKLY DT+++RN+ ++  EL E
Sbjct  97   VRSATRPYAFIKFDTFIQKTKKLYLDTKSERNLDRVAKELTE  138



>ref|XP_002847629.1| protein transport protein sec22 [Arthroderma otae CBS 113480]
 gb|EEQ30316.1| protein transport protein sec22 [Arthroderma otae CBS 113480]
Length=212

 Score = 60.5 bits (145),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + +  RPYAF++FD+FIQ+TKK YQD+R  +NI+KLNDEL
Sbjct  103  LSSTLRPYAFVEFDSFIQRTKKTYQDSRATQNINKLNDEL  142



>dbj|BAE22055.1| unnamed protein product [Mus musculus]
Length=166

 Score = 60.1 bits (144),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>pdb|3EGD|C Chain C, Crystal Structure Of The Mammalian Copii-coat Protein 
Sec23a/24a Complexed With The Snare Protein Sec22 And Bound 
To The Transport Signal Sequence Of Vesicular Stomatitis Virus 
Glycoprotein
 pdb|3EGX|C Chain C, Crystal Structure Of The Mammalian Copii-coat Protein 
Sec23a/24a Complexed With The Snare Protein Sec22b And Bound 
To The Transport Signal Sequence Of The Snare Protein Bet1
Length=157

 Score = 59.7 bits (143),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>gb|KFO33691.1| Vesicle-trafficking protein SEC22b [Fukomys damarensis]
Length=157

 Score = 59.7 bits (143),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  45   VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  84



>ref|XP_747662.1| protein transport protein sec22 [Aspergillus fumigatus Af293]
 gb|EAL85624.1| protein transport protein sec22 [Aspergillus fumigatus Af293]
 gb|EDP47570.1| protein transport protein sec22 [Aspergillus fumigatus A1163]
 gb|KEY76909.1| protein transport protein sec22 [Aspergillus fumigatus var. RP-2014]
Length=215

 Score = 60.1 bits (144),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKK+YQD+R  +N+ +LNDEL
Sbjct  108  RPYAFVEFDTFIQRTKKIYQDSRASQNLDRLNDEL  142



>ref|XP_001257620.1| protein transport protein sec22 [Neosartorya fischeri NRRL 181]
 gb|EAW15723.1| protein transport protein sec22 [Neosartorya fischeri NRRL 181]
Length=202

 Score = 59.7 bits (143),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKK+YQD+R  +N+ +LNDEL
Sbjct  95   RPYAFVEFDTFIQRTKKIYQDSRASQNLDRLNDEL  129



>ref|XP_008581247.1| PREDICTED: vesicle-trafficking protein SEC22b [Galeopterus variegatus]
Length=215

 Score = 60.1 bits (144),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_002759847.1| PREDICTED: vesicle-trafficking protein SEC22b isoform X1 [Callithrix 
jacchus]
Length=215

 Score = 60.1 bits (144),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|NP_001233675.1| vesicle-trafficking protein SEC22b precursor [Cricetulus griseus]
 sp|O08595.3|SC22B_CRIGR RecName: Full=Vesicle-trafficking protein SEC22b; AltName: Full=ER-Golgi 
SNARE of 24 kDa; Short=ERS-24; Short=ERS24; AltName: 
Full=SEC22 vesicle-trafficking protein homolog B [Cricetulus 
griseus]
 gb|AAB51513.1| ERS-24 [Cricetulus griseus]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>gb|EYE96704.1| protein transport protein sec22 [Aspergillus ruber CBS 135680]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ ++NDEL
Sbjct  108  RPYAFVEFDTFIQRTKKLYQDSRASQNLDRVNDEL  142



>pdb|2NUP|C Chain C, Crystal Structure Of The Human Sec23a24A HETERODIMER, 
Complexed With The Snare Protein Sec22b
 pdb|2NUT|C Chain C, Crystal Structure Of The Human Sec23a24A HETERODIMER, 
Complexed With The Snare Protein Sec22b
Length=196

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  104  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  143



>ref|XP_005341418.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Ictidomys 
tridecemlineatus]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|NP_035472.1| vesicle-trafficking protein SEC22b precursor [Mus musculus]
 ref|NP_001020857.1| vesicle-trafficking protein SEC22b precursor [Rattus norvegicus]
 ref|NP_001125720.1| vesicle-trafficking protein SEC22b precursor [Pongo abelii]
 ref|NP_004883.3| vesicle-trafficking protein SEC22b precursor [Homo sapiens]
 ref|NP_001248258.1| vesicle-trafficking protein SEC22b precursor [Macaca mulatta]
 ref|XP_002715713.1| PREDICTED: vesicle-trafficking protein SEC22b [Oryctolagus cuniculus]
 ref|XP_003268121.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Nomascus 
leucogenys]
 ref|XP_003409673.1| PREDICTED: vesicle-trafficking protein SEC22b [Loxodonta africana]
 ref|XP_003479325.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Cavia porcellus]
 ref|XP_003793851.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Otolemur 
garnettii]
 ref|XP_003892552.1| PREDICTED: vesicle-trafficking protein SEC22b [Papio anubis]
 ref|XP_005084280.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Mesocricetus 
auratus]
 ref|XP_005357133.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Microtus 
ochrogaster]
 ref|XP_005413537.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Chinchilla 
lanigera]
 ref|XP_005542195.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Macaca fascicularis]
 ref|XP_006166333.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X1 
[Tupaia chinensis]
 ref|XP_006166334.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X2 
[Tupaia chinensis]
 ref|XP_006166335.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X3 
[Tupaia chinensis]
 ref|XP_007975525.1| PREDICTED: vesicle-trafficking protein SEC22b [Chlorocebus sabaeus]
 ref|XP_008046030.1| PREDICTED: vesicle-trafficking protein SEC22b [Tarsius syrichta]
 ref|XP_008828741.1| PREDICTED: vesicle-trafficking protein SEC22b [Nannospalax galili]
 ref|XP_008982403.1| PREDICTED: vesicle-trafficking protein SEC22b isoform X2 [Callithrix 
jacchus]
 ref|XP_001144507.2| PREDICTED: vesicle-trafficking protein SEC22b [Pan troglodytes]
 ref|XP_010358947.1| PREDICTED: vesicle-trafficking protein SEC22b [Rhinopithecus 
roxellana]
 ref|XP_010621425.1| PREDICTED: vesicle-trafficking protein SEC22b [Fukomys damarensis]
 sp|O08547.3|SC22B_MOUSE RecName: Full=Vesicle-trafficking protein SEC22b; AltName: Full=ER-Golgi 
SNARE of 24 kDa; Short=ERS-24; Short=ERS24; AltName: 
Full=SEC22 vesicle-trafficking protein homolog B; AltName: 
Full=SEC22 vesicle-trafficking protein-like 1; Short=mSec22b 
[Mus musculus]
 sp|Q5RAI9.3|SC22B_PONAB RecName: Full=Vesicle-trafficking protein SEC22b; AltName: Full=SEC22 
vesicle-trafficking protein homolog B; AltName: Full=SEC22 
vesicle-trafficking protein-like 1 [Pongo abelii]
 sp|Q4KM74.3|SC22B_RAT RecName: Full=Vesicle-trafficking protein SEC22b; AltName: Full=ER-Golgi 
SNARE of 24 kDa; Short=ERS-24; Short=ERS24; AltName: 
Full=SEC22 vesicle-trafficking protein homolog B; AltName: 
Full=SEC22 vesicle-trafficking protein-like 1 [Rattus norvegicus]
 gb|AAC53130.1| vesicle trafficking protein sec22b [Mus musculus]
 gb|AAC39893.1| vesicle trafficking protein sec22b [Homo sapiens]
 gb|AAH01364.1| SEC22B protein [Homo sapiens]
 dbj|BAB30646.1| unnamed protein product [Mus musculus]
 dbj|BAC28899.1| unnamed protein product [Mus musculus]
 dbj|BAC29901.1| unnamed protein product [Mus musculus]
 dbj|BAC40397.1| unnamed protein product [Mus musculus]
 dbj|BAC40999.1| unnamed protein product [Mus musculus]
 emb|CAH91221.1| hypothetical protein [Pongo abelii]
 gb|AAH98725.1| SEC22 vesicle trafficking protein homolog B (S. cerevisiae) [Rattus 
norvegicus]
 gb|ABK42478.1| sec22 [synthetic construct]
 gb|ABM83510.1| SEC22 vesicle trafficking protein homolog B (S. cerevisiae) [synthetic 
construct]
 gb|ABM86727.1| SEC22 vesicle trafficking protein homolog B (S. cerevisiae) [synthetic 
construct]
 gb|EDL38948.1| SEC22 vesicle trafficking protein homolog B (S. cerevisiae), 
isoform CRA_a [Mus musculus]
 gb|EDL85575.1| SEC22 vesicle trafficking protein-like 1 (S. cerevisiae) [Rattus 
norvegicus]
 dbj|BAF82564.1| unnamed protein product [Homo sapiens]
 gb|EGW09220.1| Vesicle-trafficking protein SEC22b [Cricetulus griseus]
 gb|EHH15120.1| hypothetical protein EGK_01168 [Macaca mulatta]
 gb|EHH50226.1| hypothetical protein EGM_01019 [Macaca fascicularis]
 gb|ERE92070.1| vesicle-trafficking protein SEC22b precursor [Cricetulus griseus]
 gb|AIC55614.1| SEC22B, partial [synthetic construct]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_004646240.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Octodon degus]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_003944836.1| PREDICTED: vesicle-trafficking protein SEC22b [Saimiri boliviensis 
boliviensis]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_004881900.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X2 
[Heterocephalus glaber]
 ref|XP_004881901.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X3 
[Heterocephalus glaber]
 ref|XP_004881902.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X4 
[Heterocephalus glaber]
 ref|XP_004881903.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X5 
[Heterocephalus glaber]
 ref|XP_004853913.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X2 
[Heterocephalus glaber]
 ref|XP_004853914.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X3 
[Heterocephalus glaber]
 ref|XP_004853915.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X4 
[Heterocephalus glaber]
 ref|XP_004853916.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X5 
[Heterocephalus glaber]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>gb|EDL38949.1| SEC22 vesicle trafficking protein homolog B (S. cerevisiae), 
isoform CRA_b [Mus musculus]
Length=223

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  111  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  150



>gb|ELV11681.1| Vesicle-trafficking protein SEC22b [Tupaia chinensis]
Length=210

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  98   VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  137



>gb|AAH09024.1| SEC22 vesicle trafficking protein homolog B (S. cerevisiae) [Mus 
musculus]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_006982681.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Peromyscus 
maniculatus bairdii]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_008023979.1| hypothetical protein SETTUDRAFT_168436 [Setosphaeria turcica 
Et28A]
 gb|EOA88601.1| hypothetical protein SETTUDRAFT_168436 [Setosphaeria turcica 
Et28A]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R  +N+ KLNDEL
Sbjct  103  LSPTCRPYAFVEFDTFIQRTKKTYQDSRATQNLDKLNDEL  142



>ref|XP_004881899.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X1 
[Heterocephalus glaber]
 ref|XP_004853912.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X1 
[Heterocephalus glaber]
Length=223

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  111  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  150



>gb|KDO45713.1| hypothetical protein CISIN_1g040101mg, partial [Citrus sinensis]
Length=101

 Score = 58.5 bits (140),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  44   TFIQKTKKLYQDTRTQRNISKLNDELYE  127
            TFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  1    TFIQKTKKLYQDTRTQRNIAKLNDELYE  28



>gb|KDO45711.1| hypothetical protein CISIN_1g043681mg, partial [Citrus sinensis]
Length=101

 Score = 58.5 bits (140),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  44   TFIQKTKKLYQDTRTQRNISKLNDELYE  127
            TFIQKTKKLYQDTRTQRNI+KLNDELYE
Sbjct  1    TFIQKTKKLYQDTRTQRNIAKLNDELYE  28



>ref|XP_002676099.1| predicted protein [Naegleria gruberi]
 gb|EFC43355.1| predicted protein [Naegleria gruberi]
Length=216

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF+KFDTFIQKT+++Y D+RT+RNI  L DEL
Sbjct  102  VHKVERPYAFMKFDTFIQKTRRIYTDSRTKRNIQTLKDEL  141



>ref|XP_007589471.1| putative protein transport protein sec22 protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD43068.1| putative protein transport protein sec22 protein [Neofusicoccum 
parvum UCRNP2]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R  +N+ KLNDEL
Sbjct  103  LAATCRPYAFVEFDTFIQRTKKTYQDSRATQNLDKLNDEL  142



>gb|EKG21102.1| Synaptobrevin [Macrophomina phaseolina MS6]
Length=215

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R  +N+ KLNDEL
Sbjct  103  LAATCRPYAFVEFDTFIQRTKKTYQDSRATQNLDKLNDEL  142



>ref|XP_007689307.1| hypothetical protein COCMIDRAFT_27453 [Bipolaris oryzae ATCC 
44560]
 ref|XP_007704048.1| hypothetical protein COCSADRAFT_40344 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_007709396.1| hypothetical protein COCCADRAFT_88603 [Bipolaris zeicola 26-R-13]
 gb|EMD59861.1| hypothetical protein COCSADRAFT_40344 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD87282.1| hypothetical protein COCHEDRAFT_1023467 [Bipolaris maydis C5]
 gb|ENI00324.1| hypothetical protein COCC4DRAFT_65486 [Bipolaris maydis ATCC 
48331]
 gb|EUC36264.1| hypothetical protein COCCADRAFT_88603 [Bipolaris zeicola 26-R-13]
 gb|EUC44145.1| hypothetical protein COCMIDRAFT_27453 [Bipolaris oryzae ATCC 
44560]
 gb|EUN22569.1| hypothetical protein COCVIDRAFT_111085 [Bipolaris victoriae FI3]
Length=215

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R  +N+ KLNDEL
Sbjct  103  LSPTCRPYAFVEFDTFIQRTKKTYQDSRATQNLDKLNDEL  142



>ref|XP_003840312.1| similar to transport protein sec22 [Leptosphaeria maculans JN3]
 emb|CBX96833.1| similar to transport protein sec22 [Leptosphaeria maculans JN3]
Length=215

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R  +N+ KLNDEL
Sbjct  103  LSPTCRPYAFVEFDTFIQRTKKTYQDSRATQNLDKLNDEL  142



>ref|XP_008717505.1| hypothetical protein HMPREF1541_04941 [Cyphellophora europaea 
CBS 101466]
 gb|ETN40662.1| hypothetical protein HMPREF1541_04941 [Cyphellophora europaea 
CBS 101466]
Length=215

 Score = 59.3 bits (142),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + +  RPYAF++FDT+IQ+TKK+YQD+R   N+ KLNDEL
Sbjct  103  LSSTLRPYAFVEFDTYIQRTKKVYQDSRASANLDKLNDEL  142



>ref|XP_001934091.1| protein transport protein SEC22 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 ref|XP_003304319.1| hypothetical protein PTT_16864 [Pyrenophora teres f. teres 0-1]
 gb|EDU46596.1| protein transport protein SEC22 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EFQ87596.1| hypothetical protein PTT_16864 [Pyrenophora teres f. teres 0-1]
Length=215

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R  +N+ KLNDEL
Sbjct  103  LSPTCRPYAFVEFDTFIQRTKKTYQDSRATQNLDKLNDEL  142



>ref|XP_009050356.1| hypothetical protein LOTGIDRAFT_231136 [Lottia gigantea]
 gb|ESO98712.1| hypothetical protein LOTGIDRAFT_231136 [Lottia gigantea]
Length=217

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            +ET +RPY+FI+FDT+IQKT+K Y D+R +RN++ +N EL++
Sbjct  105  VETVSRPYSFIEFDTYIQKTRKSYMDSRARRNLTNINTELHD  146



>ref|XP_007735492.1| vesicle transporter SEC22 [Capronia epimyces CBS 606.96]
 gb|EXJ80904.1| vesicle transporter SEC22 [Capronia epimyces CBS 606.96]
Length=215

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R   N+ KLNDEL
Sbjct  103  LSATLRPYAFVEFDTFIQRTKKTYQDSRASANLDKLNDEL  142



>ref|XP_008728094.1| hypothetical protein G647_05544 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI23739.1| hypothetical protein G647_05544 [Cladophialophora carrionii CBS 
160.54]
Length=215

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R   N+ KLNDEL
Sbjct  103  LSATLRPYAFVEFDTFIQRTKKTYQDSRASANLDKLNDEL  142



>ref|XP_006751243.1| PREDICTED: vesicle-trafficking protein SEC22b-like, partial [Leptonychotes 
weddellii]
Length=122

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  56   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  95



>ref|XP_007755050.1| vesicle transporter SEC22 [Cladophialophora yegresii CBS 114405]
 gb|EXJ62396.1| vesicle transporter SEC22 [Cladophialophora yegresii CBS 114405]
Length=215

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R   N+ KLNDEL
Sbjct  103  LSATLRPYAFVEFDTFIQRTKKTYQDSRASANLDKLNDEL  142



>gb|ERE92069.1| vesicle-trafficking protein SEC22b precursor [Cricetulus griseus]
Length=266

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_009159589.1| vesicle transporter SEC22 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59128.1| vesicle transporter SEC22 [Exophiala dermatitidis NIH/UT8656]
Length=215

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R   N+ KLNDEL
Sbjct  103  LSATLRPYAFVEFDTFIQRTKKTYQDSRASANLDKLNDEL  142



>ref|XP_007749521.1| vesicle transporter SEC22 [Cladophialophora psammophila CBS 110553]
 gb|EXJ66141.1| vesicle transporter SEC22 [Cladophialophora psammophila CBS 110553]
Length=202

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKK YQD+R   N+ KLNDEL
Sbjct  95   RPYAFVEFDTFIQRTKKTYQDSRASANLDKLNDEL  129



>ref|XP_007722851.1| vesicle transporter SEC22 [Capronia coronata CBS 617.96]
 gb|EXJ90657.1| vesicle transporter SEC22 [Capronia coronata CBS 617.96]
Length=179

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R   N+ KLNDEL
Sbjct  67   LSATLRPYAFVEFDTFIQRTKKTYQDSRASANLDKLNDEL  106



>ref|XP_010210083.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Tinamus 
guttatus]
Length=160

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  48   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  87



>gb|ERE92071.1| vesicle-trafficking protein SEC22b precursor [Cricetulus griseus]
Length=273

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_001792269.1| hypothetical protein SNOG_01633 [Phaeosphaeria nodorum SN15]
 gb|EAT91282.2| hypothetical protein SNOG_01633 [Phaeosphaeria nodorum SN15]
Length=222

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +  A RPYAF +FDTFIQ+TKK YQD+R  +N+ KLNDEL
Sbjct  110  LSPALRPYAFTEFDTFIQRTKKTYQDSRATQNLDKLNDEL  149



>ref|XP_005426737.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Geospiza 
fortis]
Length=157

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  45   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  84



>ref|XP_001634368.1| predicted protein [Nematostella vectensis]
 gb|EDO42305.1| predicted protein [Nematostella vectensis]
Length=215

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            +  A RPY FI+FDT++QK K+ YQD+RT+RN+++LNDEL +
Sbjct  103  VSRATRPYPFIEFDTYMQKAKRNYQDSRTRRNLNRLNDELVD  144



>gb|KEF61329.1| vesicle transporter SEC22 [Exophiala aquamarina CBS 119918]
Length=229

 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RPYAF++FDTFIQ+TKK YQD+R   N+ KLNDEL
Sbjct  117  LSATLRPYAFVEFDTFIQRTKKTYQDSRASANLDKLNDEL  156



>ref|XP_006122090.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Pelodiscus 
sinensis]
Length=157

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  45   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  84



>ref|XP_005493649.1| PREDICTED: vesicle-trafficking protein SEC22b-like, partial [Zonotrichia 
albicollis]
Length=154

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  42   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  81



>ref|XP_009998178.1| PREDICTED: vesicle-trafficking protein SEC22b [Chaetura pelagica]
Length=157

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  45   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  84



>ref|XP_009971200.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Tyto 
alba]
Length=154

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  42   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  81



>ref|XP_010141241.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Buceros 
rhinoceros silvestris]
Length=155

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  43   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  82



>ref|XP_009937611.1| PREDICTED: vesicle-trafficking protein SEC22b [Opisthocomus hoazin]
Length=199

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  87   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  126



>ref|XP_009318967.1| PREDICTED: vesicle-trafficking protein SEC22b [Pygoscelis adeliae]
Length=199

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  87   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  126



>ref|XP_003769901.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Sarcophilus 
harrisii]
Length=194

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  82   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  121



>ref|XP_010113691.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Chlamydotis 
macqueenii]
Length=190

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  78   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  117



>ref|XP_008937479.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Merops 
nubicus]
Length=190

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  78   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  117



>ref|XP_009283632.1| PREDICTED: vesicle-trafficking protein SEC22b [Aptenodytes forsteri]
Length=199

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  87   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  126



>ref|XP_009563784.1| PREDICTED: vesicle-trafficking protein SEC22b [Cuculus canorus]
Length=207

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  95   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  134



>ref|XP_010407826.1| PREDICTED: vesicle-trafficking protein SEC22b [Corvus cornix 
cornix]
Length=226

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  114  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  153



>ref|XP_008405321.1| PREDICTED: vesicle-trafficking protein SEC22b-B isoform X2 [Poecilia 
reticulata]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_002192858.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Taeniopygia 
guttata]
 ref|XP_005528706.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Pseudopodoces 
humilis]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_001501277.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Equus caballus]
 ref|XP_008530715.1| PREDICTED: vesicle-trafficking protein SEC22b [Equus przewalskii]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_009891194.1| PREDICTED: vesicle-trafficking protein SEC22b [Charadrius vociferus]
Length=199

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  87   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  126



>ref|XP_005241317.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Falco peregrinus]
Length=193

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  81   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  120



>ref|XP_005147153.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Melopsittacus 
undulatus]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_007061269.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Chelonia 
mydas]
 gb|EMP34560.1| Vesicle-trafficking protein SEC22b [Chelonia mydas]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_009929232.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Haliaeetus 
albicilla]
Length=200

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  88   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  127



>ref|XP_007946618.1| PREDICTED: vesicle-trafficking protein SEC22b [Orycteropus afer 
afer]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_005434275.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Falco cherrug]
Length=210

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  98   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  137



>ref|XP_008493061.1| PREDICTED: vesicle-trafficking protein SEC22b [Calypte anna]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_006919754.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Pteropus 
alecto]
 gb|ELK05971.1| Vesicle-trafficking protein SEC22b [Pteropus alecto]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_008405319.1| PREDICTED: vesicle-trafficking protein SEC22b-B isoform X1 [Poecilia 
reticulata]
Length=219

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  107  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  146



>ref|XP_533025.1| PREDICTED: vesicle-trafficking protein SEC22b [Canis lupus familiaris]
 ref|XP_001363127.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Monodelphis 
domestica]
 ref|XP_002929933.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Ailuropoda 
melanoleuca]
 ref|XP_003481524.1| PREDICTED: vesicle-trafficking protein SEC22b [Sus scrofa]
 ref|XP_003484266.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Sus scrofa]
 ref|XP_003990568.1| PREDICTED: vesicle-trafficking protein SEC22b [Felis catus]
 ref|XP_004002442.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Ovis aries]
 ref|XP_004263307.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Orcinus orca]
 ref|XP_004380391.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Trichechus 
manatus latirostris]
 ref|XP_004415998.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Odobenus 
rosmarus divergens]
 ref|XP_004420649.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Ceratotherium 
simum simum]
 ref|XP_004689646.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Condylura 
cristata]
 ref|XP_004771093.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Mustela putorius 
furo]
 ref|XP_004817686.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Mustela putorius 
furo]
 ref|XP_005204105.1| PREDICTED: vesicle-trafficking protein SEC22b isoform X1 [Bos 
taurus]
 ref|XP_005677838.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Capra hircus]
 ref|XP_005895333.1| PREDICTED: vesicle-trafficking protein SEC22b-like isoform X2 
[Bos mutus]
 ref|XP_005979651.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Pantholops 
hodgsonii]
 ref|XP_007075752.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Panthera 
tigris altaica]
 ref|XP_007123716.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Physeter 
catodon]
 ref|XP_006049407.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Bubalus bubalis]
 ref|XP_007169362.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007457187.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Lipotes vexillifer]
 ref|XP_008704573.1| PREDICTED: vesicle-trafficking protein SEC22b [Ursus maritimus]
 ref|XP_010831128.1| PREDICTED: vesicle-trafficking protein SEC22b [Bison bison bison]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_007528743.1| PREDICTED: vesicle-trafficking protein SEC22b [Erinaceus europaeus]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_007441927.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Python bivittatus]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_006260013.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Alligator 
mississippiensis]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_006190861.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Camelus ferus]
 ref|XP_006216209.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Vicugna pacos]
 ref|XP_010966224.1| PREDICTED: vesicle-trafficking protein SEC22b [Camelus bactrianus]
 ref|XP_010978826.1| PREDICTED: vesicle-trafficking protein SEC22b [Camelus dromedarius]
 gb|EPY76562.1| vesicle-trafficking protein SEC22b [Camelus ferus]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_003219927.1| PREDICTED: vesicle-trafficking protein SEC22b [Anolis carolinensis]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_006861376.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Chrysochloris 
asiatica]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_009507991.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Phalacrocorax 
carbo]
 ref|XP_009577226.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Fulmarus 
glacialis]
 ref|XP_009708309.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Cariama 
cristata]
 ref|XP_009810454.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Gavia 
stellata]
 ref|XP_009862576.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Apaloderma 
vittatum]
 ref|XP_009944467.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Leptosomus 
discolor]
 ref|XP_010011007.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Nestor 
notabilis]
 ref|XP_009987083.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Tauraco 
erythrolophus]
 ref|XP_010146249.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Eurypyga 
helias]
 ref|XP_010174100.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Caprimulgus 
carolinensis]
 ref|XP_010076617.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Pterocles 
gutturalis]
 ref|XP_010180869.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Mesitornis 
unicolor]
 ref|XP_010295725.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Phaethon 
lepturus]
 ref|XP_010296306.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Balearica 
regulorum gibbericeps]
Length=190

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  78   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  117



>ref|XP_009082902.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Acanthisitta 
chloris]
Length=190

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  78   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  117



>dbj|GAD91527.1| protein transport protein sec22 [Byssochlamys spectabilis No. 
5]
Length=210

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKK YQD+R   N+ +LNDEL
Sbjct  108  RPYAFVEFDTFIQRTKKTYQDSRAASNLDRLNDEL  142



>gb|EOA95793.1| Vesicle-trafficking protein SEC22b, partial [Anas platyrhynchos]
Length=191

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  79   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  118



>ref|XP_007776883.1| vesicle transporter SEC22 [Coniosporium apollinis CBS 100218]
 gb|EON61566.1| vesicle transporter SEC22 [Coniosporium apollinis CBS 100218]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            +    RP+AFI+FDTFIQ+TKK YQD+R   N+ KLNDEL
Sbjct  103  LSPTCRPFAFIEFDTFIQRTKKTYQDSRASMNLDKLNDEL  142



>ref|XP_009671175.1| PREDICTED: vesicle-trafficking protein SEC22b [Struthio camelus 
australis]
Length=194

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  82   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  121



>ref|NP_001026437.1| vesicle-trafficking protein SEC22b precursor [Gallus gallus]
 ref|XP_003208638.1| PREDICTED: vesicle-trafficking protein SEC22b [Meleagris gallopavo]
 sp|Q5ZJW4.1|SC22B_CHICK RecName: Full=Vesicle-trafficking protein SEC22b; AltName: Full=SEC22 
vesicle-trafficking protein homolog B [Gallus gallus]
 emb|CAG31979.1| hypothetical protein RCJMB04_15c3 [Gallus gallus]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_009485071.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Pelecanus 
crispus]
Length=190

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  78   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  117



>gb|EFB15606.1| hypothetical protein PANDA_020247 [Ailuropoda melanoleuca]
Length=191

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  79   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  118



>ref|XP_009643668.1| PREDICTED: vesicle-trafficking protein SEC22b [Egretta garzetta]
Length=193

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  81   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  120



>ref|XP_005050026.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Ficedula 
albicollis]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>ref|XP_006036426.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Alligator 
sinensis]
Length=210

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  98   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  137



>gb|ETE65053.1| Vesicle-trafficking protein SEC22b [Ophiophagus hannah]
Length=215

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  103  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  142



>gb|KGO68165.1| Synaptobrevin [Penicillium italicum]
Length=202

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   RPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            RPYAF++FDTFIQ+TKKLYQD+R  +N+ KLN EL
Sbjct  95   RPYAFVEFDTFIQRTKKLYQDSRASQNLDKLNYEL  129



>ref|XP_010580376.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Haliaeetus 
leucocephalus]
Length=216

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  104  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  143



>ref|XP_005027467.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Anas platyrhynchos]
Length=211

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  99   VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  138



>ref|XP_010198776.1| PREDICTED: vesicle-trafficking protein SEC22b, partial [Colius 
striatus]
Length=236

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDEL  121
            + T +RPY+FI+FDT+IQKTKKLY D+R +RN+  +N EL
Sbjct  124  VPTVSRPYSFIEFDTYIQKTKKLYIDSRARRNLGSINTEL  163



>ref|XP_004582181.1| PREDICTED: vesicle-trafficking protein SEC22b-like [Ochotona 
princeps]
Length=306

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    IETAARPYAFIKFDTFIQKTKKLYQDTRTQRNISKLNDELYE  127
            + T +RPY+FI+FDTFIQKTKKLY D+R +RN+  +N EL +
Sbjct  194  VPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQD  235



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515174157784