BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83733_g1_i1 len=729 path=[707:0-728]

Length=729
                                                                      Score     E

ref|XP_009628615.1|  PREDICTED: protein YLS3-like                       171   3e-49   
ref|XP_009776706.1|  PREDICTED: protein YLS3-like                       166   2e-47   
gb|KCW57668.1|  hypothetical protein EUGRSUZ_H00429                     147   5e-41   
ref|XP_010069341.1|  PREDICTED: protein YLS3-like                       148   1e-40   
ref|XP_002283442.1|  PREDICTED: protein YLS3-like                       144   6e-39   Vitis vinifera
ref|XP_007029080.1|  Bifunctional inhibitor/lipid-transfer protei...    145   7e-39   
ref|XP_011075093.1|  PREDICTED: protein YLS3-like                       142   2e-38   
emb|CDP10170.1|  unnamed protein product                                142   3e-38   
ref|XP_010257571.1|  PREDICTED: protein YLS3                            143   3e-38   
ref|XP_008451096.1|  PREDICTED: protein YLS3-like                       142   5e-38   
emb|CBI16491.3|  unnamed protein product                                141   9e-38   
ref|XP_010243423.1|  PREDICTED: protein YLS3-like                       143   9e-38   
ref|XP_002309285.2|  hypothetical protein POPTR_0006s21040g             140   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_004165809.1|  PREDICTED: uncharacterized GPI-anchored prot...    140   4e-37   
ref|XP_004144111.1|  PREDICTED: uncharacterized GPI-anchored prot...    139   8e-37   
ref|XP_011025176.1|  PREDICTED: protein YLS3                            139   9e-37   
ref|XP_011047088.1|  PREDICTED: protein YLS3 isoform X1                 138   1e-36   
ref|XP_009397688.1|  PREDICTED: protein YLS3-like                       138   2e-36   
ref|XP_006445830.1|  hypothetical protein CICLE_v10016842mg             137   6e-36   
ref|XP_006386057.1|  hypothetical protein POPTR_0003s21390g             136   7e-36   
ref|XP_011047089.1|  PREDICTED: protein YLS3 isoform X2                 135   1e-35   
ref|XP_011089694.1|  PREDICTED: protein YLS3-like                       136   1e-35   
ref|XP_002304871.1|  hypothetical protein POPTR_0003s21390g             136   1e-35   Populus trichocarpa [western balsam poplar]
gb|KDP44350.1|  hypothetical protein JCGZ_19217                         135   3e-35   
ref|XP_002270671.1|  PREDICTED: protein YLS3                            135   3e-35   Vitis vinifera
ref|XP_011009645.1|  PREDICTED: protein YLS3-like                       135   3e-35   
ref|XP_004228722.1|  PREDICTED: protein YLS3                            135   4e-35   
ref|XP_009375461.1|  PREDICTED: protein YLS3-like                       135   4e-35   
ref|XP_002530873.1|  lipid binding protein, putative                    133   6e-35   Ricinus communis
ref|XP_007205970.1|  hypothetical protein PRUPE_ppa012060mg             134   7e-35   
emb|CBI16494.3|  unnamed protein product                                133   7e-35   
emb|CDP17362.1|  unnamed protein product                                134   8e-35   
emb|CCH50970.1|  T4.9                                                   134   9e-35   
ref|XP_008351727.1|  PREDICTED: protein YLS3-like                       134   9e-35   
ref|XP_007014734.1|  Bifunctional inhibitor/lipid-transfer protei...    133   1e-34   
ref|XP_006369482.1|  hypothetical protein POPTR_0001s23850g             132   1e-34   
ref|XP_009628973.1|  PREDICTED: protein YLS3-like                       133   1e-34   
ref|XP_009364110.1|  PREDICTED: protein YLS3-like                       133   2e-34   
ref|XP_002285691.1|  PREDICTED: protein YLS3-like                       133   2e-34   Vitis vinifera
ref|XP_009766807.1|  PREDICTED: protein YLS3-like                       133   2e-34   
ref|XP_006369483.1|  hypothetical protein POPTR_0001s23850g             133   2e-34   
ref|XP_007159392.1|  hypothetical protein PHAVU_002G234400g             132   5e-34   
ref|XP_006492750.1|  PREDICTED: uncharacterized protein LOC102613530    136   5e-34   
ref|XP_011010692.1|  PREDICTED: protein YLS3-like                       131   6e-34   
ref|XP_002299127.1|  hypothetical protein POPTR_0001s04590g             131   7e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011089118.1|  PREDICTED: protein YLS3-like                       131   1e-33   
ref|XP_008225280.1|  PREDICTED: protein YLS3-like                       130   2e-33   
emb|CAN59826.1|  hypothetical protein VITISV_016657                     136   2e-33   Vitis vinifera
gb|KGN54079.1|  hypothetical protein Csa_4G280560                       130   2e-33   
ref|XP_007163836.1|  hypothetical protein PHAVU_001G268300g             130   2e-33   
emb|CDP07663.1|  unnamed protein product                                130   3e-33   
ref|XP_008384404.1|  PREDICTED: protein YLS3-like                       130   3e-33   
gb|KDO46035.1|  hypothetical protein CISIN_1g029183mg                   130   3e-33   
ref|XP_010044958.1|  PREDICTED: protein YLS3-like                       130   4e-33   
ref|XP_008449799.1|  PREDICTED: protein YLS3                            129   4e-33   
gb|KHG12536.1|  hypothetical protein F383_03102                         129   6e-33   
gb|EYU39237.1|  hypothetical protein MIMGU_mgv1a014178mg                129   7e-33   
ref|NP_001235687.1|  uncharacterized protein LOC100306483 precursor     129   8e-33   
ref|XP_006579354.1|  PREDICTED: uncharacterized protein LOC100306...    129   9e-33   
ref|XP_006492820.1|  PREDICTED: protein YLS3-like isoform X2            128   1e-32   
ref|XP_009592817.1|  PREDICTED: protein YLS3-like isoform X2            127   1e-32   
ref|NP_001238362.1|  uncharacterized protein LOC100499687 precursor     128   1e-32   
ref|XP_009770685.1|  PREDICTED: protein YLS3-like                       128   2e-32   
ref|XP_002512201.1|  lipid binding protein, putative                    126   2e-32   Ricinus communis
ref|XP_006354156.1|  PREDICTED: non-specific lipid-transfer prote...    127   2e-32   
ref|XP_010542451.1|  PREDICTED: protein YLS3-like isoform X2            127   2e-32   
gb|KHN47957.1|  Putative GPI-anchored protein                           127   2e-32   
ref|XP_010542450.1|  PREDICTED: protein YLS3-like isoform X1            127   3e-32   
ref|XP_009592816.1|  PREDICTED: protein YLS3-like isoform X1            127   5e-32   
ref|XP_010917572.1|  PREDICTED: protein YLS3-like                       126   5e-32   
ref|XP_006482799.1|  PREDICTED: protein YLS3-like                       125   5e-32   
gb|KHG18912.1|  hypothetical protein F383_24909                         126   7e-32   
gb|KFK38683.1|  hypothetical protein AALP_AA3G147000                    126   7e-32   
gb|KFK38682.1|  hypothetical protein AALP_AA3G147000                    126   7e-32   
ref|XP_010101137.1|  hypothetical protein L484_016701                   125   9e-32   
ref|XP_010044960.1|  PREDICTED: protein YLS3-like                       126   1e-31   
ref|XP_006359139.1|  PREDICTED: non-specific lipid-transfer prote...    125   1e-31   
gb|ACU14650.1|  unknown                                                 125   1e-31   Glycine max [soybeans]
ref|XP_010934252.1|  PREDICTED: protein YLS3                            126   1e-31   
ref|XP_010544520.1|  PREDICTED: protein YLS3-like                       125   1e-31   
ref|XP_004504343.1|  PREDICTED: non-specific lipid-transfer prote...    125   2e-31   
ref|XP_010693844.1|  PREDICTED: protein YLS3 isoform X2                 125   2e-31   
ref|XP_010693842.1|  PREDICTED: protein YLS3 isoform X1                 125   2e-31   
ref|XP_006492819.1|  PREDICTED: protein YLS3-like isoform X1            124   2e-31   
gb|KDO70843.1|  hypothetical protein CISIN_1g043293mg                   123   4e-31   
gb|KHN44488.1|  Putative GPI-anchored protein                           124   4e-31   
ref|XP_011093401.1|  PREDICTED: protein YLS3-like                       124   4e-31   
ref|XP_010534886.1|  PREDICTED: protein YLS3-like                       124   6e-31   
ref|XP_004229337.1|  PREDICTED: protein YLS3                            124   7e-31   
gb|KHG04910.1|  hypothetical protein F383_07676                         124   8e-31   
ref|NP_001237564.1|  uncharacterized protein LOC100305590 precursor     123   8e-31   
gb|KHG28399.1|  hypothetical protein F383_02239                         123   1e-30   
ref|XP_006439006.1|  hypothetical protein CICLE_v10033694mg             123   1e-30   
ref|XP_004294978.1|  PREDICTED: uncharacterized protein LOC101298982    123   2e-30   
ref|XP_004504341.1|  PREDICTED: non-specific lipid-transfer prote...    122   2e-30   
ref|XP_008378010.1|  PREDICTED: protein YLS3-like                       122   3e-30   
ref|XP_009354800.1|  PREDICTED: protein YLS3-like                       120   3e-30   
ref|XP_007052623.1|  Bifunctional inhibitor/lipid-transfer protei...    121   4e-30   
gb|EEE66751.1|  hypothetical protein OsJ_23458                          122   4e-30   Oryza sativa Japonica Group [Japonica rice]
gb|AFK48341.1|  unknown                                                 120   5e-30   
ref|XP_010673513.1|  PREDICTED: protein YLS3                            121   6e-30   
ref|XP_008775497.1|  PREDICTED: protein YLS3-like                       121   6e-30   
gb|AFK37798.1|  unknown                                                 121   6e-30   
ref|XP_002881958.1|  protease inhibitor/seed storage/lipid transf...    121   8e-30   
gb|KDO35899.1|  hypothetical protein CISIN_1g039949mg                   119   1e-29   
gb|KEH35234.1|  Lipid transfer protein                                  119   2e-29   
gb|EEC74584.1|  hypothetical protein OsI_10163                          119   2e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_009138957.1|  PREDICTED: protein YLS3                            119   2e-29   
ref|XP_008231394.1|  PREDICTED: protein YLS3-like isoform X1            119   3e-29   
ref|XP_010934234.1|  PREDICTED: protein YLS3-like isoform X1            119   3e-29   
ref|XP_008231395.1|  PREDICTED: protein YLS3-like isoform X2            119   3e-29   
ref|XP_010506351.1|  PREDICTED: protein YLS3-like                       119   3e-29   
ref|XP_010516504.1|  PREDICTED: protein YLS3-like                       119   3e-29   
gb|ABF94168.1|  Protease inhibitor/seed storage/LTP family protei...    119   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010518028.1|  PREDICTED: protein YLS3-like                       119   4e-29   
ref|XP_003601632.1|  Non-specific lipid-transfer protein-like pro...    119   4e-29   
ref|XP_006295014.1|  hypothetical protein CARUB_v10024085mg             119   4e-29   
ref|XP_010098644.1|  putative GPI-anchored protein                      118   6e-29   
gb|EEC81687.1|  hypothetical protein OsI_25271                          119   7e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_011088858.1|  PREDICTED: protein YLS3-like                       118   8e-29   
ref|XP_003561314.1|  PREDICTED: protein YLS3-like isoform X2            118   9e-29   
gb|KDP20375.1|  hypothetical protein JCGZ_05258                         118   1e-28   
ref|XP_009409233.1|  PREDICTED: protein YLS3-like                       118   1e-28   
gb|EEE58386.1|  hypothetical protein OsJ_09548                          117   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459511.1|  hypothetical protein SORBIDRAFT_02g005900          118   1e-28   Sorghum bicolor [broomcorn]
ref|XP_010228246.1|  PREDICTED: protein YLS3-like isoform X1            117   1e-28   
gb|AFK48853.1|  unknown                                                 117   2e-28   
dbj|BAG92716.1|  unnamed protein product                                117   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008802527.1|  PREDICTED: protein YLS3-like                       117   2e-28   
ref|NP_001059125.1|  Os07g0198300                                       117   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010504811.1|  PREDICTED: protein YLS3-like                       116   3e-28   
ref|XP_003629697.1|  Non-specific lipid-transfer protein-like pro...    116   3e-28   
ref|XP_010508309.1|  PREDICTED: protein YLS3-like                       116   4e-28   
ref|XP_003558736.1|  PREDICTED: protein YLS3-like                       116   5e-28   
emb|CDY02452.1|  BnaA08g00590D                                          116   5e-28   
ref|XP_004158216.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   6e-28   
ref|XP_006402776.1|  hypothetical protein EUTSA_v10006273mg             115   6e-28   
ref|XP_009106891.1|  PREDICTED: protein YLS3-like                       116   6e-28   
ref|XP_006402775.1|  hypothetical protein EUTSA_v10006273mg             115   7e-28   
ref|XP_003549048.1|  PREDICTED: protein YLS3-like                       115   7e-28   
ref|XP_010554897.1|  PREDICTED: protein YLS3                            115   1e-27   
ref|NP_191414.1|  protease inhibitor/(LTP) family protein               114   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878226.1|  protease inhibitor/seed storage/lipid transf...    114   1e-27   
gb|AAM63806.1|  unknown                                                 114   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007219100.1|  hypothetical protein PRUPE_ppa015466mg             113   2e-27   
ref|NP_181959.1|  bifunctional inhibitor/lipid-transfer protein/s...    115   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ACR37836.1|  unknown                                                 114   2e-27   Zea mays [maize]
ref|XP_010427760.1|  PREDICTED: protein YLS3-like                       114   2e-27   
ref|XP_004502215.1|  PREDICTED: non-specific lipid-transfer prote...    114   2e-27   
ref|XP_008461230.1|  PREDICTED: protein YLS3-like                       114   2e-27   
emb|CDX98302.1|  BnaC06g16630D                                          114   3e-27   
ref|XP_004955761.1|  PREDICTED: non-specific lipid-transfer prote...    114   3e-27   
ref|XP_004985580.1|  PREDICTED: non-specific lipid-transfer prote...    114   4e-27   
ref|XP_002468449.1|  hypothetical protein SORBIDRAFT_01g046080          114   4e-27   Sorghum bicolor [broomcorn]
gb|ACG31262.1|  lipid transfer protein                                  114   4e-27   Zea mays [maize]
ref|XP_003549079.1|  PREDICTED: protein YLS3-like isoform X1            114   4e-27   
ref|XP_004135899.1|  PREDICTED: uncharacterized GPI-anchored prot...    114   5e-27   
ref|XP_003549102.1|  PREDICTED: protein YLS3-like isoform X1            113   5e-27   
ref|XP_006292695.1|  hypothetical protein CARUB_v10018941mg             113   5e-27   
gb|ACG45950.1|  lipid transfer protein                                  113   5e-27   Zea mays [maize]
gb|ACG37967.1|  lipid transfer protein                                  113   5e-27   Zea mays [maize]
ref|XP_006369481.1|  hypothetical protein POPTR_0001s23850g             111   7e-27   
ref|NP_001240276.1|  uncharacterized protein LOC100792950 precursor     113   9e-27   
ref|NP_181958.1|  bifunctional inhibitor/lipid-transfer protein/s...    113   9e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ACU15623.1|  unknown                                                 112   1e-26   Glycine max [soybeans]
gb|KEH19312.1|  Lipid transfer protein                                  112   1e-26   
gb|KFK37241.1|  hypothetical protein AALP_AA4G232200                    112   1e-26   
ref|XP_009147517.1|  PREDICTED: protein YLS3-like                       112   2e-26   
ref|XP_008803424.1|  PREDICTED: protein YLS3-like                       112   2e-26   
ref|XP_009143014.1|  PREDICTED: protein YLS3-like                       112   2e-26   
emb|CDY64362.1|  BnaAnng19290D                                          112   3e-26   
ref|XP_006392665.1|  hypothetical protein EUTSA_v10011802mg             111   4e-26   
emb|CDY54411.1|  BnaC06g41560D                                          111   4e-26   
ref|XP_006397606.1|  hypothetical protein EUTSA_v10001634mg             111   4e-26   
ref|XP_004142249.1|  PREDICTED: non-specific lipid-transfer prote...    109   4e-26   
ref|NP_001185235.1|  Bifunctional inhibitor/lipid-transfer protei...    111   5e-26   
ref|XP_007152276.1|  hypothetical protein PHAVU_004G115800g             110   5e-26   
emb|CDY24046.1|  BnaA06g00440D                                          109   5e-26   
ref|XP_010501137.1|  PREDICTED: protein YLS3-like                       110   5e-26   
ref|XP_009104149.1|  PREDICTED: protein YLS3-like                       110   6e-26   
ref|NP_564682.2|  Bifunctional inhibitor/lipid-transfer protein/s...    111   6e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51569.1|AC027034_15  unknown protein; 63629-62263                 110   6e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480053.1|  PREDICTED: protein YLS3-like                       110   8e-26   
ref|XP_002891826.1|  protease inhibitor/seed storage/lipid transf...    110   9e-26   
ref|XP_007133468.1|  hypothetical protein PHAVU_011G181000g             110   1e-25   
ref|NP_001170312.1|  putative bifunctional inhibitor/LTP/seed sto...    110   1e-25   Zea mays [maize]
ref|NP_001152231.1|  LOC100285869 precursor                             109   1e-25   Zea mays [maize]
ref|XP_007152277.1|  hypothetical protein PHAVU_004G115900g             110   1e-25   
gb|AAM61728.1|  unknown                                                 109   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010088879.1|  hypothetical protein L484_020867                   109   1e-25   
ref|XP_006658373.1|  PREDICTED: protein YLS3-like                       110   2e-25   
gb|ABR16730.1|  unknown                                                 109   2e-25   Picea sitchensis
gb|ABB90545.1|  lipid transfer protein                                  108   2e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002515567.1|  lipid binding protein, putative                    108   2e-25   Ricinus communis
tpg|DAA52009.1|  TPA: putative bifunctional inhibitor/LTP/seed st...    109   3e-25   
ref|XP_010101138.1|  putative GPI-anchored protein                      108   3e-25   
ref|NP_001266562.1|  lipid binding protein                              109   3e-25   
ref|NP_001152188.1|  lipid binding protein precursor                    108   4e-25   Zea mays [maize]
gb|KEH21671.1|  RALF                                                    108   4e-25   
dbj|BAJ87912.1|  predicted protein                                      108   5e-25   
gb|ABK22783.1|  unknown                                                 108   5e-25   Picea sitchensis
ref|XP_010462370.1|  PREDICTED: protein YLS3-like                       108   5e-25   
emb|CDY69589.1|  BnaC04g53090D                                          108   6e-25   
ref|XP_002281585.1|  PREDICTED: protein YLS3                            107   7e-25   Vitis vinifera
ref|XP_004306485.1|  PREDICTED: uncharacterized GPI-anchored prot...    108   8e-25   
gb|KDP32327.1|  hypothetical protein JCGZ_13252                         107   8e-25   
gb|AES71883.2|  Lipid transfer protein                                  108   8e-25   
dbj|BAJ95766.1|  predicted protein                                      107   8e-25   
ref|XP_002881957.1|  protease inhibitor/seed storage/lipid transf...    108   8e-25   
ref|XP_006305662.1|  hypothetical protein CARUB_v10010370mg             107   8e-25   
ref|XP_006295054.1|  hypothetical protein CARUB_v10024122mg             107   9e-25   
ref|XP_006305663.1|  hypothetical protein CARUB_v10010370mg             107   1e-24   
ref|XP_011086771.1|  PREDICTED: protein YLS3-like                       107   1e-24   
ref|XP_009602101.1|  PREDICTED: protein YLS3-like                       107   1e-24   
ref|XP_003564265.1|  PREDICTED: protein YLS3-like                       107   2e-24   
gb|AII99869.1|  protease inhibitor/seed storage/ltp family              106   2e-24   
ref|XP_002466262.1|  hypothetical protein SORBIDRAFT_01g004610          106   2e-24   Sorghum bicolor [broomcorn]
ref|XP_006397607.1|  hypothetical protein EUTSA_v10001638mg             106   2e-24   
ref|XP_009781023.1|  PREDICTED: protein YLS3-like                       106   3e-24   
ref|XP_006838654.1|  hypothetical protein AMTR_s00002p00240480          106   3e-24   
emb|CBI28121.3|  unnamed protein product                                107   4e-24   
gb|AFK38594.1|  unknown                                                 105   4e-24   
emb|CDP03376.1|  unnamed protein product                                105   5e-24   
ref|XP_010518027.1|  PREDICTED: protein YLS3-like                       104   1e-23   
ref|XP_010506349.1|  PREDICTED: protein YLS3-like                       103   2e-23   
gb|EPS62245.1|  non-specific lipid-transfer protein                     102   2e-23   
ref|XP_004511135.1|  PREDICTED: uncharacterized GPI-anchored prot...    103   2e-23   
ref|XP_009374052.1|  PREDICTED: protein YLS3-like                       103   3e-23   
ref|XP_007013274.1|  Bifunctional inhibitor/lipid-transfer protei...    102   6e-23   
ref|XP_008242742.1|  PREDICTED: protein YLS3-like                       102   7e-23   
ref|XP_004172159.1|  PREDICTED: non-specific lipid-transfer prote...    100   7e-23   
ref|XP_009394719.1|  PREDICTED: protein YLS3-like                       102   9e-23   
ref|XP_010508310.1|  PREDICTED: protein YLS3-like                       101   2e-22   
gb|EMT07496.1|  Non-specific lipid-transfer protein-like protein        100   2e-22   
ref|XP_010497757.1|  PREDICTED: protein YLS3-like                     98.6    3e-22   
ref|XP_008337357.1|  PREDICTED: protein YLS3-like                       100   4e-22   
ref|XP_006476107.1|  PREDICTED: protein YLS3-like                       100   4e-22   
gb|EYU27162.1|  hypothetical protein MIMGU_mgv1a0260443mg             97.4    4e-22   
ref|XP_006451053.1|  hypothetical protein CICLE_v10010697mg             100   6e-22   
ref|XP_004241629.2|  PREDICTED: protein YLS3-like                     99.8    6e-22   
gb|EYU31694.1|  hypothetical protein MIMGU_mgv1a0143491mg             97.4    8e-22   
ref|XP_004981375.1|  PREDICTED: non-specific lipid-transfer prote...  99.4    1e-21   
ref|XP_007203697.1|  hypothetical protein PRUPE_ppa022009mg           99.4    1e-21   
ref|XP_006599593.1|  PREDICTED: protein YLS3-like isoform X2          97.8    2e-21   
ref|XP_010541739.1|  PREDICTED: protein YLS3-like                     98.6    2e-21   
ref|XP_006365420.1|  PREDICTED: uncharacterized GPI-anchored prot...  99.8    2e-21   
ref|XP_006599591.1|  PREDICTED: protein YLS3-like isoform X1          97.4    2e-21   
ref|XP_006599603.1|  PREDICTED: protein YLS3-like isoform X2          97.4    2e-21   
gb|EMT07497.1|  hypothetical protein F775_15194                       97.4    3e-21   
gb|EPS60733.1|  hypothetical protein M569_14069                       96.7    4e-21   
ref|XP_006600057.1|  PREDICTED: protein YLS3-like                     96.3    4e-21   
emb|CDY00571.1|  BnaC04g23540D                                        95.9    6e-21   
ref|XP_006600039.1|  PREDICTED: protein YLS3-like                     96.3    6e-21   
ref|XP_010934241.1|  PREDICTED: protein YLS3-like isoform X2          95.9    8e-21   
ref|XP_004985579.1|  PREDICTED: non-specific lipid-transfer prote...  98.2    9e-21   
emb|CDX88991.1|  BnaA04g01950D                                        95.1    1e-20   
ref|NP_001132744.1|  putative bifunctional inhibitor/LTP/seed sto...  96.7    1e-20   Zea mays [maize]
gb|ACN27466.1|  unknown                                               97.4    1e-20   Zea mays [maize]
ref|XP_006600043.1|  PREDICTED: protein YLS3-like                     94.7    1e-20   
ref|XP_003549042.2|  PREDICTED: protein YLS3-like                     93.2    2e-20   
ref|XP_006429931.1|  hypothetical protein CICLE_v10013719mg           94.4    2e-20   
ref|XP_009418410.1|  PREDICTED: protein YLS3-like                     95.9    3e-20   
emb|CDX67750.1|  BnaA07g17900D                                        93.6    4e-20   
gb|EMT03137.1|  hypothetical protein F775_19441                       94.7    5e-20   
ref|XP_006600045.1|  PREDICTED: protein YLS3-like                     92.8    7e-20   
gb|AAS07215.1|  putative protease inhibitor                           93.2    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EYU25912.1|  hypothetical protein MIMGU_mgv1a017757mg              92.8    2e-19   
ref|XP_008809013.1|  PREDICTED: protein YLS3-like                     92.8    3e-19   
ref|XP_003549086.2|  PREDICTED: protein YLS3-like                     89.0    3e-18   
ref|XP_006651927.1|  PREDICTED: protein YLS3-like                     89.4    6e-18   
ref|XP_010915020.1|  PREDICTED: protein YLS3-like                     86.3    4e-17   
ref|NP_001051617.2|  Os03g0804200                                     83.6    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KHN24015.1|  hypothetical protein glysoja_025188                   82.0    3e-16   
gb|EMT29098.1|  hypothetical protein F775_26764                       83.2    3e-16   
gb|AGZ80685.1|  lipid binding protein                                 81.6    5e-16   
gb|AGZ80687.1|  lipid binding protein                                 81.3    6e-16   
gb|AGZ80668.1|  lipid binding protein                                 80.9    8e-16   
gb|AGZ80671.1|  lipid binding protein                                 80.9    9e-16   
gb|AGZ80667.1|  lipid binding protein                                 80.9    1e-15   
gb|AGZ80669.1|  lipid binding protein                                 80.5    1e-15   
ref|XP_006844404.1|  hypothetical protein AMTR_s00142p00106070        80.1    2e-15   
ref|XP_006854228.1|  hypothetical protein AMTR_s00048p00225010        77.4    2e-14   
gb|KFK22172.1|  hypothetical protein AALP_AAs71527U000100             77.0    2e-14   
ref|XP_006599600.1|  PREDICTED: protein YLS3-like                     74.3    2e-13   
ref|XP_006843664.1|  hypothetical protein AMTR_s00007p00185590        73.2    3e-13   
ref|XP_006856998.1|  hypothetical protein AMTR_s00964p00010390        73.9    3e-13   
gb|AFG47010.1|  hypothetical protein 2_5794_01                        73.6    5e-13   
ref|XP_006836021.1|  hypothetical protein AMTR_s00236p00020140        71.6    8e-13   
ref|XP_006836022.1|  hypothetical protein AMTR_s00236p00023830        72.8    2e-12   
gb|KDP20109.1|  hypothetical protein JCGZ_05878                       71.2    8e-12   
gb|EYU46558.1|  hypothetical protein MIMGU_mgv1a021050mg              67.4    9e-11   
emb|CCW28822.1|  putative lipid transfer/seed storage/trypsin-alp...  66.6    2e-10   
emb|CCW28756.1|  putative lipid transfer/seed storage/trypsin-alp...  66.6    2e-10   
ref|XP_009611500.1|  PREDICTED: non-specific lipid transfer prote...  67.0    2e-10   
ref|XP_009611499.1|  PREDICTED: non-specific lipid-transfer prote...  67.0    2e-10   
ref|XP_006836019.1|  hypothetical protein AMTR_s00236p00018010        66.6    2e-10   
ref|XP_010326386.1|  PREDICTED: protein YLS3                          66.6    3e-10   
ref|XP_009602114.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    3e-10   
ref|XP_006827906.1|  hypothetical protein AMTR_s00008p00146780        65.5    4e-10   
ref|XP_011079977.1|  PREDICTED: non-specific lipid-transfer prote...  66.2    4e-10   
ref|XP_004247577.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    4e-10   
ref|NP_001274812.1|  non-specific lipid-transfer protein-like pro...  65.5    5e-10   
ref|XP_004247576.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    5e-10   
ref|XP_006360770.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    5e-10   
emb|CDP03651.1|  unnamed protein product                              65.5    7e-10   
ref|NP_177530.1|  protease inhibitor/seed storage/lipid transfer ...  65.5    7e-10   
ref|XP_006489592.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    7e-10   
ref|XP_008354971.1|  PREDICTED: protein YLS3-like                     63.5    8e-10   
ref|XP_010045643.1|  PREDICTED: protein YLS3                          65.5    9e-10   
gb|KDO74530.1|  hypothetical protein CISIN_1g040530mg                 64.7    9e-10   
gb|KCW83850.1|  hypothetical protein EUGRSUZ_B00719                   66.2    9e-10   
ref|XP_010249032.1|  PREDICTED: non-specific lipid transfer prote...  65.1    1e-09   
ref|XP_009367612.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    1e-09   
ref|NP_001059015.1|  Os07g0175600                                     64.7    1e-09   
ref|XP_009367611.1|  PREDICTED: non-specific lipid-transfer prote...  65.1    1e-09   
ref|XP_006419979.1|  hypothetical protein CICLE_v10006862mg           63.9    2e-09   
ref|XP_006352768.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    2e-09   
ref|XP_011086802.1|  PREDICTED: non-specific lipid transfer prote...  65.1    2e-09   
ref|XP_011073612.1|  PREDICTED: non-specific lipid-transfer prote...  63.9    2e-09   
ref|NP_001235889.1|  uncharacterized protein LOC100500289 precursor   63.9    2e-09   
ref|XP_006352767.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    2e-09   
dbj|BAD11656.1|  lipid transfer protein-like                          63.9    2e-09   
ref|NP_001062343.1|  Os08g0532800                                     63.9    2e-09   
gb|EAZ07773.1|  hypothetical protein OsI_30026                        63.9    2e-09   
gb|KHG17412.1|  hypothetical protein F383_21409                       63.5    3e-09   
ref|XP_009598309.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    3e-09   
gb|KHN03811.1|  Non-specific lipid-transfer protein-like protein      63.9    3e-09   
ref|XP_004247575.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    3e-09   
ref|XP_009769034.1|  PREDICTED: non-specific lipid-transfer prote...  63.5    3e-09   
ref|XP_006360772.1|  PREDICTED: non-specific lipid-transfer prote...  63.2    3e-09   
gb|KDP21428.1|  hypothetical protein JCGZ_21899                       63.9    4e-09   
gb|EYU41467.1|  hypothetical protein MIMGU_mgv1a020765mg              63.2    4e-09   
ref|NP_001238368.1|  uncharacterized protein LOC100306151 precursor   63.5    4e-09   
gb|AFK46793.1|  unknown                                               63.2    4e-09   
ref|XP_002889436.1|  hypothetical protein ARALYDRAFT_311412           62.8    4e-09   
gb|ACJ83901.1|  unknown                                               62.8    5e-09   
gb|AAV97731.1|  lipid transfer protein                                62.8    5e-09   
gb|AAV97732.1|  lipid transfer protein                                62.8    5e-09   
ref|XP_010038081.1|  PREDICTED: non-specific lipid transfer prote...  62.8    6e-09   
gb|KEH43852.1|  Lipid transfer protein                                62.4    6e-09   
gb|AFK43872.1|  unknown                                               62.4    6e-09   
gb|KHN20721.1|  hypothetical protein glysoja_019038                   63.2    7e-09   
ref|XP_003572451.2|  PREDICTED: non-specific lipid transfer prote...  63.5    7e-09   
ref|XP_006356037.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    7e-09   
ref|XP_009758372.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    7e-09   
ref|XP_009106045.1|  PREDICTED: protein YLS3                          62.8    8e-09   
ref|XP_006583405.1|  PREDICTED: protein YLS3-like isoform X2          62.8    8e-09   
ref|XP_009611497.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    8e-09   
ref|XP_008386478.1|  PREDICTED: non-specific lipid-transfer prote...  62.8    8e-09   
ref|XP_009598308.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    9e-09   
ref|XP_007152775.1|  hypothetical protein PHAVU_004G158600g           62.4    9e-09   
gb|EYU33443.1|  hypothetical protein MIMGU_mgv1a014418mg              62.4    1e-08   
ref|XP_009598307.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    1e-08   
ref|XP_006418264.1|  hypothetical protein EUTSA_v10009479mg           62.0    1e-08   
ref|XP_008386477.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    1e-08   
ref|XP_010545093.1|  PREDICTED: non-specific lipid-transfer prote...  62.4    1e-08   
ref|XP_009779779.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    1e-08   
ref|XP_009612929.1|  PREDICTED: non-specific lipid transfer prote...  61.6    1e-08   
ref|XP_010435062.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    1e-08   
ref|XP_002524756.1|  Nonspecific lipid-transfer protein precursor...  62.4    2e-08   
emb|CDX96495.1|  BnaA07g31060D                                        62.0    2e-08   
ref|XP_006583404.1|  PREDICTED: protein YLS3-like isoform X1          62.4    2e-08   
ref|XP_007034805.1|  Non-specific lipid-transfer protein, putativ...  61.2    2e-08   
gb|KDP26810.1|  hypothetical protein JCGZ_17968                       61.6    2e-08   
ref|XP_010068505.1|  PREDICTED: protein YLS3-like                     61.6    2e-08   
emb|CDY26162.1|  BnaA06g12550D                                        61.6    2e-08   
gb|AFK43474.1|  unknown                                               61.2    2e-08   
ref|XP_009372275.1|  PREDICTED: non-specific lipid transfer prote...  61.6    2e-08   
gb|KHG17411.1|  hypothetical protein F383_21408                       61.2    2e-08   
ref|XP_007034804.1|  Non-specific lipid-transfer protein, putativ...  61.2    2e-08   
emb|CDY19210.1|  BnaC05g14110D                                        61.6    2e-08   
ref|XP_009791428.1|  PREDICTED: non-specific lipid transfer prote...  60.8    2e-08   
ref|XP_009118134.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    2e-08   
ref|XP_009149284.1|  PREDICTED: protein YLS3-like                     61.2    2e-08   
gb|AFK42199.1|  unknown                                               61.6    2e-08   
gb|EMS68280.1|  hypothetical protein TRIUR3_25393                     60.1    2e-08   
ref|XP_004310085.1|  PREDICTED: uncharacterized GPI-anchored prot...  61.2    2e-08   
emb|CDX73025.1|  BnaC06g34730D                                        61.2    2e-08   
ref|XP_006301497.1|  hypothetical protein CARUB_v10021923mg           61.2    3e-08   
ref|XP_010440386.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    3e-08   
emb|CBI15442.3|  unnamed protein product                              60.8    4e-08   
ref|XP_004495185.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    4e-08   
ref|XP_004495186.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    4e-08   
emb|CDY66095.1|  BnaA04g29630D                                        60.8    4e-08   
emb|CDY45869.1|  BnaC02g22510D                                        60.5    4e-08   
ref|XP_011082645.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    4e-08   
emb|CDP13346.1|  unnamed protein product                              60.8    4e-08   
ref|NP_973749.1|  bifunctional inhibitor/lipid-transfer protein/s...  60.1    5e-08   
ref|XP_002888950.1|  hypothetical protein ARALYDRAFT_339589           60.5    5e-08   
ref|XP_007143272.1|  hypothetical protein PHAVU_007G058500g           60.1    5e-08   
ref|XP_008240321.1|  PREDICTED: protein YLS3                          60.8    5e-08   
gb|ACM78624.1|  protease inhibitor/seed storage/lipid transfer pr...  58.9    5e-08   
ref|XP_003610781.1|  Non-specific lipid-transfer protein              60.1    5e-08   
gb|AFK42663.1|  unknown                                               60.1    5e-08   
gb|AAD25798.1|AC006550_6  F10O3.7                                     59.3    5e-08   
ref|XP_010471473.1|  PREDICTED: non-specific lipid-transfer prote...  60.5    5e-08   
ref|XP_011090697.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    6e-08   
ref|XP_009618189.1|  PREDICTED: non-specific lipid transfer prote...  59.7    6e-08   
ref|XP_010259100.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    6e-08   
ref|XP_006398011.1|  hypothetical protein EUTSA_v10001654mg           60.1    6e-08   
ref|XP_006374355.1|  hypothetical protein POPTR_0015s06360g           60.5    7e-08   
ref|XP_004242340.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    7e-08   
dbj|BAJ95928.1|  predicted protein                                    59.7    8e-08   
ref|XP_010416216.1|  PREDICTED: non-specific lipid-transfer prote...  60.8    9e-08   
ref|XP_010416218.1|  PREDICTED: non-specific lipid transfer prote...  60.8    9e-08   
ref|XP_010256112.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    1e-07   
ref|XP_007143273.1|  hypothetical protein PHAVU_007G058500g           59.3    1e-07   
dbj|BAJ85750.1|  predicted protein                                    59.3    1e-07   
ref|XP_009388486.1|  PREDICTED: non-specific lipid transfer prote...  59.3    1e-07   
ref|XP_010507801.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    1e-07   
gb|AAN60349.1|  unknown                                               59.3    1e-07   
gb|AAM63095.1|  unknown                                               58.9    1e-07   
ref|XP_002524760.1|  lipid binding protein, putative                  59.3    1e-07   
ref|XP_010507807.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    1e-07   
ref|XP_010938128.1|  PREDICTED: non-specific lipid transfer prote...  58.9    1e-07   
ref|NP_566712.1|  protease inhibitor/seed storage/lipid transfer ...  59.3    1e-07   
ref|XP_006349698.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    1e-07   
ref|XP_006349697.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    1e-07   
ref|XP_010497021.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    1e-07   
ref|XP_010507806.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    1e-07   
gb|KFK41828.1|  hypothetical protein AALP_AA2G176700                  59.7    1e-07   
ref|XP_010497022.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    1e-07   
ref|XP_010507800.1|  PREDICTED: non-specific lipid-transfer prote...  59.3    1e-07   
ref|NP_001151689.1|  lipid transfer protein precursor                 58.9    2e-07   
ref|XP_006838416.1|  hypothetical protein AMTR_s00002p00104040        58.9    2e-07   
ref|XP_009792638.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    2e-07   
ref|XP_003632312.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    2e-07   
ref|XP_008340225.1|  PREDICTED: non-specific lipid transfer prote...  58.9    2e-07   
ref|XP_006848247.1|  hypothetical protein AMTR_s00013p00038620        58.9    2e-07   
ref|XP_009611498.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    2e-07   
ref|XP_008390922.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    2e-07   
emb|CDY27459.1|  BnaC04g51000D                                        60.8    2e-07   
ref|XP_007050548.1|  Bifunctional inhibitor/lipid-transfer protei...  58.5    2e-07   
ref|XP_008224287.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    2e-07   
ref|XP_010265164.1|  PREDICTED: protein YLS3 isoform X1               58.5    3e-07   
ref|XP_007223624.1|  hypothetical protein PRUPE_ppa012613mg           58.2    3e-07   
ref|XP_007034803.1|  Non-specific lipid-transfer protein isoform 2    57.4    3e-07   
ref|XP_002885513.1|  predicted protein                                58.2    3e-07   
ref|XP_010038082.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    3e-07   
ref|XP_007050549.1|  Bifunctional inhibitor/lipid-transfer protei...  58.5    3e-07   
ref|XP_007034802.1|  Non-specific lipid-transfer protein, putativ...  58.2    3e-07   
ref|NP_001241396.1|  uncharacterized protein LOC100801492 precursor   58.2    3e-07   
ref|XP_004134131.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    3e-07   
ref|XP_003555341.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    3e-07   
ref|XP_004164321.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    3e-07   
ref|XP_010102693.1|  hypothetical protein L484_015489                 58.2    3e-07   
ref|XP_008222168.1|  PREDICTED: non-specific lipid transfer prote...  58.2    3e-07   
ref|XP_006419978.1|  hypothetical protein CICLE_v10006599mg           57.8    3e-07   
emb|CDO98441.1|  unnamed protein product                              58.5    3e-07   
gb|KHG16607.1|  hypothetical protein F383_20647                       57.8    3e-07   
ref|XP_004297113.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    3e-07   
ref|XP_009369867.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    4e-07   
ref|XP_009345870.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    4e-07   
ref|XP_010256110.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    4e-07   
ref|XP_002880347.1|  hypothetical protein ARALYDRAFT_322456           57.8    4e-07   
ref|XP_004247184.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    4e-07   
ref|XP_008353284.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    4e-07   
gb|KDP40200.1|  hypothetical protein JCGZ_02198                       57.4    5e-07   
ref|XP_009369865.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    5e-07   
ref|NP_001150532.1|  lipid transfer protein precursor                 57.8    5e-07   
gb|AAM64723.1|  unknown                                               57.8    5e-07   
ref|XP_007208861.1|  hypothetical protein PRUPE_ppa025857mg           57.8    5e-07   
ref|XP_008438652.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    5e-07   
ref|XP_010695498.1|  PREDICTED: non-specific lipid transfer prote...  57.0    5e-07   
ref|NP_566126.1|  protease inhibitor/seed storage/lipid transfer ...  57.8    5e-07   
ref|XP_006489422.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    5e-07   
ref|XP_008775111.1|  PREDICTED: non-specific lipid transfer prote...  57.4    5e-07   
ref|XP_007050550.1|  Bifunctional inhibitor/lipid-transfer protei...  57.8    5e-07   
ref|XP_004239214.1|  PREDICTED: non-specific lipid transfer prote...  57.4    5e-07   
ref|XP_004247182.1|  PREDICTED: protein YLS3-like                     57.0    6e-07   
ref|XP_002314685.2|  hypothetical protein POPTR_0010s09550g           57.4    6e-07   
gb|AGT16035.1|  lipid transfer protein                                57.4    6e-07   
gb|KGN51666.1|  hypothetical protein Csa_5G589340                     57.4    6e-07   
ref|XP_004955602.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    6e-07   
ref|XP_011091038.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    6e-07   
ref|XP_011026797.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    7e-07   
ref|XP_009758371.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    7e-07   
ref|XP_006416606.1|  hypothetical protein EUTSA_v10009608mg           57.4    8e-07   
ref|XP_010679071.1|  PREDICTED: non-specific lipid transfer prote...  57.0    8e-07   
ref|XP_004496708.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    8e-07   
ref|XP_011014639.1|  PREDICTED: protein YLS3-like                     57.4    8e-07   
ref|XP_004496707.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    8e-07   
ref|XP_011030671.1|  PREDICTED: non-specific lipid transfer prote...  57.0    8e-07   
ref|XP_007225920.1|  hypothetical protein PRUPE_ppa012022mg           57.0    8e-07   
gb|AFK46030.1|  unknown                                               57.0    9e-07   
ref|XP_009764787.1|  PREDICTED: protein YLS3-like                     57.0    9e-07   
ref|XP_009758370.1|  PREDICTED: non-specific lipid transfer prote...  56.6    9e-07   
ref|XP_002444694.1|  hypothetical protein SORBIDRAFT_07g026120        56.6    1e-06   
ref|XP_009412766.1|  PREDICTED: non-specific lipid transfer prote...  56.6    1e-06   
ref|XP_004159693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.0    1e-06   
ref|XP_010549290.1|  PREDICTED: non-specific lipid transfer prote...  57.0    1e-06   
ref|NP_567445.1|  bifunctional inhibitor/lipid-transfer protein/s...  56.2    1e-06   
gb|KHN02564.1|  Putative GPI-anchored protein                         56.2    1e-06   
ref|XP_006349699.1|  PREDICTED: non-specific lipid-transfer prote...  56.6    1e-06   
ref|XP_007162452.1|  hypothetical protein PHAVU_001G153500g           56.6    1e-06   
emb|CDP03652.1|  unnamed protein product                              56.6    1e-06   
emb|CBI26280.3|  unnamed protein product                              56.2    1e-06   
ref|XP_006349700.1|  PREDICTED: non-specific lipid-transfer prote...  56.6    1e-06   
ref|XP_010265166.1|  PREDICTED: protein YLS3 isoform X2               56.2    1e-06   
ref|XP_011072938.1|  PREDICTED: protein YLS3                          56.6    1e-06   



>ref|XP_009628615.1| PREDICTED: protein YLS3-like [Nicotiana tomentosiformis]
Length=177

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            S+ I  FLL LM+G  SSDFA+D+K CQ+QL+ LS CL++V GDA+ PT ACC ++RKDL
Sbjct  5    SVTISNFLLMLMIGFASSDFAEDRKECQNQLLHLSSCLSYVGGDAQLPTPACCAQLRKDL  64

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIf  290
             KT+ CLC++VKDRNEP +G KIN TLAL LP +C APTNVSEC  LL L PNSPDA++F
Sbjct  65   HKTKYCLCLIVKDRNEPDIGFKINATLALGLPYICGAPTNVSECPALLKLAPNSPDAQVF  124

Query  289  eefssssvsgnntstGDLNASSSTALFRKRWIDLLQAHAGFSLLLLIVTFIGVL  128
             +F+S S +GNNT+ GD+ +SSS     KRW    +   G +  +LI   I ++
Sbjct  125  IDFASHSKTGNNTNIGDVQSSSSIKFSNKRWFAAGR-DVGVAFCVLIFVMITMI  177



>ref|XP_009776706.1| PREDICTED: protein YLS3-like [Nicotiana sylvestris]
Length=178

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 119/167 (71%), Gaps = 1/167 (1%)
 Frame = -3

Query  628  LLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCL  449
            L+ LM+G  SSDFA+D+K CQ+QL+ LS CL++V GDA+ PT ACC ++RKDL KT+ CL
Sbjct  13   LMLLMIGFASSDFAEDRKECQNQLLHLSSCLSYVGGDAQLPTPACCAQLRKDLHKTKYCL  72

Query  448  CVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefssss  269
            C++VKDRNEP +G KIN TLAL LP +C APTNVSEC  +L L PNSPDA++F +F S S
Sbjct  73   CLIVKDRNEPNIGYKINATLALGLPYVCGAPTNVSECPAILKLAPNSPDAQVFIDFVSHS  132

Query  268  vsgnntstGDLNASSSTALFRKRWIDLLQAHAGFSLLLLIVTFIGVL  128
             +GNN S GD+ +SSS     KRW    +   G +  +LI   I ++
Sbjct  133  KTGNNASIGDVQSSSSIKFSNKRWFAAGR-DVGVAFCVLIFVMITMI  178



>gb|KCW57668.1| hypothetical protein EUGRSUZ_H00429, partial [Eucalyptus grandis]
Length=116

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            ++  GV+SD AQDK+ C+ QL+ LSPCL FV GD+K P+  CC  +RKDL +TR CLC+L
Sbjct  1    MLANGVTSDVAQDKQECEAQLVNLSPCLPFVGGDSKAPSVPCCANLRKDLNETRRCLCML  60

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            ++DR+EPGLG K+N TLAL+LPS+C +P++VS C  LLHL PNSPDA++
Sbjct  61   IRDRDEPGLGFKLNATLALALPSICHSPSDVSHCPALLHLDPNSPDAQV  109



>ref|XP_010069341.1| PREDICTED: protein YLS3-like [Eucalyptus grandis]
Length=163

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTR  458
            +  +  ++  GV+SD AQDK+ C+ QL+ LSPCL FV GD+K P+  CC  +RKDL +TR
Sbjct  1    MLLITTMLANGVTSDVAQDKQECEAQLVNLSPCLPFVGGDSKAPSVPCCANLRKDLNETR  60

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLC+L++DR+EPGLG K+N TLAL+LPS+C +P++VS C  LLHL PNSPDA++
Sbjct  61   RCLCMLIRDRDEPGLGFKLNATLALALPSICHSPSDVSHCPALLHLDPNSPDAQV  115



>ref|XP_002283442.1| PREDICTED: protein YLS3-like [Vitis vinifera]
Length=188

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 116/181 (64%), Gaps = 13/181 (7%)
 Frame = -3

Query  655  MGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRK  476
            +G L +L  ++ LM    S+DFA+D++ C DQL+GL+ CL +V G+ K PT  CC  +++
Sbjct  8    LGLLDMLVIMMLLM--SASADFAKDREECADQLVGLATCLPYVGGEGKSPTLDCCTGLKQ  65

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
             L+K R CLC+L+KDRN+P LGLKIN TLA+ LPS C AP N+S C  LL LP  SPDAK
Sbjct  66   VLQKARKCLCILIKDRNDPNLGLKINATLAMGLPSACHAPANISACPALLQLPAGSPDAK  125

Query  295  IfeefssssvsgnntstGDLNASSSTALF--------RKRWIDLLQAHAGFSLLLLIVTF  140
            IFEE+ +S+ +  +TS     A+SS+           R+RW+ +      F LL LIV+ 
Sbjct  126  IFEEYGNSTAASKSTSVASAKANSSSGSSAEMKSDGGRRRWVGV---ELVFGLLFLIVSH  182

Query  139  I  137
            +
Sbjct  183  L  183



>ref|XP_007029080.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY09582.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=205

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            + CF+  +++  VSSD+A+DKK C +QL+ LS C+ FV G+ K P + CC  +RK + +T
Sbjct  34   LFCFIFLILLSWVSSDWAEDKKECSNQLVALSTCIPFVGGNTKVPDSTCCTNLRKKINQT  93

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            + CLC+LV DRN+P LG K+N TLAL LPS+C AP+N SEC  LLHLPPNS DA++
Sbjct  94   KKCLCLLVADRNDPDLGFKVNATLALILPSICHAPSNASECPELLHLPPNSTDAQV  149



>ref|XP_011075093.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=168

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 106/167 (63%), Gaps = 9/167 (5%)
 Frame = -3

Query  628  LLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCL  449
            ++ +MV G  SD AQDKK+CQDQL+ LS C+ FVSGDAK PT +CC E+RKD+ K++LCL
Sbjct  11   IMVMMVCGGGSDSAQDKKKCQDQLVSLSSCIDFVSGDAKAPTPSCCSELRKDVIKSKLCL  70

Query  448  CVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefssss  269
            C+LVKDRN+P LG K+N TLAL+L  LC  P++ S C  LL L PNSP+A+I        
Sbjct  71   CILVKDRNDPQLGFKLNATLALTLIPLCHIPSDASVCPQLLELAPNSPEAQI----FEQF  126

Query  268  vsgnntstGDLNASSSTALFRKRWIDLLQAHAGFSLLLLIVTFIGVL  128
             + ++    D   SSST   R+  I     H      +L+  FI ++
Sbjct  127  NTTSSAVDSDTIPSSSTKGLRQAAI-----HGVVFTCILLSVFITII  168



>emb|CDP10170.1| unnamed protein product [Coffea canephora]
Length=179

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 3/115 (3%)
 Frame = -3

Query  628  LLCLMVGG---VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTR  458
            LL LM+ G   VSSDFAQDK+ CQDQL GLSPC++F+S + K P+  CC  +  +  + R
Sbjct  12   LLALMMAGCVRVSSDFAQDKRECQDQLAGLSPCVSFISEEEKHPSPVCCLRLGNNYDQKR  71

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLC+LV+DRNEPGLG KIN TLAL+LP +CR P N ++CL  LHL P SPDA+I
Sbjct  72   RCLCMLVRDRNEPGLGFKINATLALALPFICRIPANATQCLDFLHLDPRSPDAQI  126



>ref|XP_010257571.1| PREDICTED: protein YLS3 [Nelumbo nucifera]
Length=192

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            +L +   L+ +MVG V  D AQD+  C +QLIGLS CL +V G+AK PT  CC  +++ L
Sbjct  10   TLGVWYVLVLMMVGSVRPDVAQDRSECANQLIGLSTCLPYVGGEAKAPTLDCCTGLKQIL  69

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             K++ CLC+LVKDRN+P LGLKIN TLALSLP+ C AP NVS+C  LLHL PNSP+A++
Sbjct  70   DKSKKCLCILVKDRNDPDLGLKINATLALSLPTTCHAPANVSDCPALLHLAPNSPEAQV  128



>ref|XP_008451096.1| PREDICTED: protein YLS3-like [Cucumis melo]
Length=187

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -3

Query  655  MGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRK  476
            + +   +C  L L+    +S+  QD+  C DQLIGL+PCL +VSGDAK PT  CC  +++
Sbjct  5    LATFSFICNFLLLLASFAASNIDQDRTECSDQLIGLAPCLPYVSGDAKTPTIDCCSGLKQ  64

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
             ++K++ CLCVL+KD+++P LGLKING+LAL+LP  C AP N++EC++LLHL PNS +AK
Sbjct  65   VVQKSKKCLCVLIKDKDDPNLGLKINGSLALALPHACHAPANITECISLLHLSPNSTEAK  124

Query  295  I  293
            I
Sbjct  125  I  125



>emb|CBI16491.3| unnamed protein product [Vitis vinifera]
Length=171

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 110/169 (65%), Gaps = 11/169 (7%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            +++   S+DFA+D++ C DQL+GL+ CL +V G+ K PT  CC  +++ L+K R CLC+L
Sbjct  1    MLLMSASADFAKDREECADQLVGLATCLPYVGGEGKSPTLDCCTGLKQVLQKARKCLCIL  60

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefssssvsg  260
            +KDRN+P LGLKIN TLA+ LPS C AP N+S C  LL LP  SPDAKIFEE+ +S+ + 
Sbjct  61   IKDRNDPNLGLKINATLAMGLPSACHAPANISACPALLQLPAGSPDAKIFEEYGNSTAAS  120

Query  259  nntstGDLNASSSTALF--------RKRWIDLLQAHAGFSLLLLIVTFI  137
             +TS     A+SS+           R+RW+ +      F LL LIV+ +
Sbjct  121  KSTSVASAKANSSSGSSAEMKSDGGRRRWVGV---ELVFGLLFLIVSHL  166



>ref|XP_010243423.1| PREDICTED: protein YLS3-like [Nelumbo nucifera]
Length=247

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTR  458
            L F+L  MVG V SD AQDK  C++QLIGLS CL +V G AK PT  CC  +++ + K++
Sbjct  13   LSFVLVXMVGSVRSDIAQDKNECENQLIGLSTCLPYVGGQAKAPTLDCCSGLKEVVDKSK  72

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLC+LVKDRN+P LG+K+N TLALSLP+ C    NVS+C  LLHL PNSPDA++
Sbjct  73   KCLCILVKDRNDPDLGIKVNVTLALSLPTACHTSANVSDCPALLHLAPNSPDAQV  127



>ref|XP_002309285.2| hypothetical protein POPTR_0006s21040g [Populus trichocarpa]
 gb|EEE92808.2| hypothetical protein POPTR_0006s21040g [Populus trichocarpa]
Length=183

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             ++ +M   V SD A DK+ C +QL  LS CL FV GD K PT  CC  +R+++ KT  C
Sbjct  5    IVVLMMFNFVFSDLAADKRECNEQLASLSACLPFVGGDTKVPTPTCCSGLRQEISKTEKC  64

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LC+LVKDRNEP LG KIN TLALSLPS+C AP NVS C  +LHL PNS DA++
Sbjct  65   LCILVKDRNEPDLGFKINATLALSLPSICHAPANVSACPEMLHLAPNSTDAQV  117



>ref|XP_004165809.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cucumis sativus]
Length=187

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -3

Query  655  MGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRK  476
            + +   +C  L L+    +SD  QD+  C DQLIGL+ CL +VSGDAK PT  CC  +++
Sbjct  5    LSTFSFICNFLLLLASFAASDIDQDRTDCSDQLIGLAQCLPYVSGDAKTPTIDCCSGLKQ  64

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
             ++K++ CLCVL+KD+++P LGLKING+LAL+LP  C AP N++EC++LLHL PNS +AK
Sbjct  65   VVQKSKKCLCVLIKDKDDPNLGLKINGSLALALPHACHAPANITECISLLHLSPNSTEAK  124

Query  295  I  293
            I
Sbjct  125  I  125



>ref|XP_004144111.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cucumis sativus]
 gb|KGN66415.1| hypothetical protein Csa_1G602030 [Cucumis sativus]
Length=187

 Score =   139 bits (350),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = -3

Query  655  MGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRK  476
            + +   +C  L L+    +SD  QD+  C DQLIGL+ CL +VSGDAK PT  CC  +++
Sbjct  5    LSTFSFICNFLLLLASFSASDIDQDRTDCSDQLIGLAQCLPYVSGDAKTPTIDCCSGLKQ  64

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
             ++K++ CLCVL+KD+++P LGLKING+LAL+LP  C AP N++EC++LLHL PNS +AK
Sbjct  65   VVQKSKKCLCVLIKDKDDPNLGLKINGSLALALPHACHAPANITECISLLHLSPNSTEAK  124

Query  295  I  293
            I
Sbjct  125  I  125



>ref|XP_011025176.1| PREDICTED: protein YLS3 [Populus euphratica]
Length=190

 Score =   139 bits (350),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 87/128 (68%), Gaps = 7/128 (5%)
 Frame = -3

Query  655  MGSLKILC-------FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTA  497
            MGS  +L         +L ++VG   SDF QD+  C DQL+GL+ CL +VSGDAK PT  
Sbjct  1    MGSKNVLTTSAISYILVLLMLVGSAKSDFQQDRAECADQLVGLATCLPYVSGDAKAPTLD  60

Query  496  CCDEIRKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLP  317
            CC  +++ L K++ CLCVL+KDR+ P LG+K N +L   LPSLC +P NV+EC+ LLHLP
Sbjct  61   CCSGLKQVLDKSKKCLCVLIKDRDNPNLGVKFNVSLVAKLPSLCHSPVNVTECIDLLHLP  120

Query  316  PNSPDAKI  293
             NSPDAK 
Sbjct  121  ANSPDAKF  128



>ref|XP_011047088.1| PREDICTED: protein YLS3 isoform X1 [Populus euphratica]
Length=176

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 98/148 (66%), Gaps = 2/148 (1%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             ++ +M   V SD A DK+ C +QL  LS CL FV GD K P   CC  +R+++ KT  C
Sbjct  17   IVVLMMFNFVFSDLAADKRECNEQLASLSACLPFVGGDTKVPPPTCCSGLRQEISKTEKC  76

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefsss  272
            LC++VKDRNEP LG KIN TLALSLPS+C AP NVS C  +LHL PNS DA++FE+F++S
Sbjct  77   LCIIVKDRNEPDLGFKINATLALSLPSICNAPANVSACPEMLHLAPNSTDAQVFEDFAAS  136

Query  271  svsgnntstGDLNASSSTALFRKRWIDL  188
            + S    +      SSS  +  K+W+++
Sbjct  137  NKSNAAVAGD--RTSSSNTMKEKKWLEV  162



>ref|XP_009397688.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=199

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -3

Query  601  SSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
            SSDFAQDK  CQD L+ L+ CLT+V G AK PT  CCD + K L K R CLCVL+KDRNE
Sbjct  25   SSDFAQDKANCQDTLVSLATCLTYVEGQAKAPTPDCCDGLSKILSKNRTCLCVLIKDRNE  84

Query  421  PGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            PGLG+  N TLA++LP++C A +N+SEC  LLHLPP+S +A+I
Sbjct  85   PGLGITFNATLAMNLPTVCHASSNISECPELLHLPPHSKEAQI  127



>ref|XP_006445830.1| hypothetical protein CICLE_v10016842mg [Citrus clementina]
 gb|ESR59070.1| hypothetical protein CICLE_v10016842mg [Citrus clementina]
 gb|KDO63000.1| hypothetical protein CISIN_1g029705mg [Citrus sinensis]
Length=189

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 110/175 (63%), Gaps = 10/175 (6%)
 Frame = -3

Query  634  CFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRL  455
            C L+ +++G  SS+  QDK  C D+++ L+ CL +V GDAK PT  CC  +++ L K++ 
Sbjct  13   CILVLMLLGLASSNIDQDKAECADKVVALATCLPYVGGDAKTPTVDCCGGLKQLLDKSKK  72

Query  454  CLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefss  275
            CLC+L+KD+++P LGLKIN TLA +LP+ C +P NVSEC+ LLHLPPNSPDAK+F+ FS+
Sbjct  73   CLCLLIKDKDDPSLGLKINSTLAANLPTACHSPANVSECINLLHLPPNSPDAKVFQGFSN  132

Query  274  ssvsgnntstGDLNASS----------STALFRKRWIDLLQAHAGFSLLLLIVTF  140
             +     T    + ++S          S      R + L  A  GFSL  L+VT 
Sbjct  133  LTQGHGGTPATAVGSNSKNGSPSADQKSDGGKASRLLGLEMAVWGFSLHFLLVTL  187



>ref|XP_006386057.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
 gb|ERP63854.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
Length=165

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             +L ++VG   SDF QD+  C DQL+GL+ CL +VS DAK PT  CC  +++ L K++ C
Sbjct  16   LVLLMLVGSAKSDFQQDRAECADQLVGLATCLPYVSDDAKAPTLDCCSGLKQVLDKSKKC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LCVL+KDR+ P LG+K N +L   LPSLC +P NV+EC+ LLHLP NSPDAK 
Sbjct  76   LCVLIKDRDNPNLGIKFNVSLVAKLPSLCHSPVNVTECINLLHLPANSPDAKF  128



>ref|XP_011047089.1| PREDICTED: protein YLS3 isoform X2 [Populus euphratica]
Length=156

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            +M   V SD A DK+ C +QL  LS CL FV GD K P   CC  +R+++ KT  CLC++
Sbjct  21   MMFNFVFSDLAADKRECNEQLASLSACLPFVGGDTKVPPPTCCSGLRQEISKTEKCLCII  80

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            VKDRNEP LG KIN TLALSLPS+C AP NVS C  +LHL PNS DA++
Sbjct  81   VKDRNEPDLGFKINATLALSLPSICNAPANVSACPEMLHLAPNSTDAQV  129



>ref|XP_011089694.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=193

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTR  458
            + ++L L+ G  S D  +DK++C +QLIGL+ CL +VSG++KFP   CC   ++ L+K++
Sbjct  12   ISYILVLLFGLTSCDVEKDKEKCTNQLIGLATCLPYVSGESKFPPMDCCTGFKEVLQKSK  71

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTN--VSECLTLLHLPPNSPDAKI  293
             CLC+LVKDRN+P LG KIN TLALSLPS C AP N  +++C  +LHLPPNSPDAK+
Sbjct  72   ECLCLLVKDRNDPSLGFKINATLALSLPSKCNAPVNQSITDCPAVLHLPPNSPDAKV  128



>ref|XP_002304871.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
 gb|EEE79850.1| hypothetical protein POPTR_0003s21390g [Populus trichocarpa]
Length=190

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             +L ++VG   SDF QD+  C DQL+GL+ CL +VS DAK PT  CC  +++ L K++ C
Sbjct  16   LVLLMLVGSAKSDFQQDRAECADQLVGLATCLPYVSDDAKAPTLDCCSGLKQVLDKSKKC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LCVL+KDR+ P LG+K N +L   LPSLC +P NV+EC+ LLHLP NSPDAK 
Sbjct  76   LCVLIKDRDNPNLGIKFNVSLVAKLPSLCHSPVNVTECINLLHLPANSPDAKF  128



>gb|KDP44350.1| hypothetical protein JCGZ_19217 [Jatropha curcas]
Length=181

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -3

Query  655  MGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRK  476
            M S  +   +  L++G   SD AQ++  C +QL+GL+PCL +V G AK PT  CC  +++
Sbjct  1    MESKHLAMGIFLLLIGIARSDIAQERAECANQLVGLAPCLPYVGGTAKAPTLDCCTGLKQ  60

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
             L+K++ CLC+L+KDR++P LGLKIN TLA +LPS C AP N+++C+ LLHL P+SP+AK
Sbjct  61   VLEKSKKCLCILIKDRDDPSLGLKINATLAATLPSACHAPANITQCIDLLHLAPSSPEAK  120

Query  295  I  293
            +
Sbjct  121  V  121



>ref|XP_002270671.1| PREDICTED: protein YLS3 [Vitis vinifera]
 emb|CBI32156.3| unnamed protein product [Vitis vinifera]
Length=188

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            ++  ++ +++  V+SD A+DK+ C +QL+G++ CL +V GDAK PT  CC  +++ L+K 
Sbjct  8    MILVIVSMVITCVTSDSAKDKQECTEQLVGMATCLPYVGGDAKAPTPDCCSGLKQVLQKN  67

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            + CLCV++KDRN+P LGL +N TLAL LPS+C AP NVS+C  LLHL PNSPDA++
Sbjct  68   KKCLCVIIKDRNDPDLGLNLNATLALGLPSVCHAPANVSQCPALLHLAPNSPDAQV  123



>ref|XP_011009645.1| PREDICTED: protein YLS3-like [Populus euphratica]
 ref|XP_011009646.1| PREDICTED: protein YLS3-like [Populus euphratica]
Length=195

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQ---DKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIR  479
            ++++  F++ LM   VS   A+   D + C +QL+GL+ CL +V GDAK PT  CC+ ++
Sbjct  7    TIRLTMFVIVLMSVMVSLAMAEKDKDTEECAEQLVGLATCLPYVGGDAKAPTPDCCNGLK  66

Query  478  KDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDA  299
            + LK  + CLCV++KDRN+P LGLKIN TLALSLPS+C AP NVS+C  LL+LPPNSPDA
Sbjct  67   QVLKDNKKCLCVIIKDRNDPDLGLKINATLALSLPSVCHAPANVSQCPALLNLPPNSPDA  126

Query  298  KI  293
            +I
Sbjct  127  QI  128



>ref|XP_004228722.1| PREDICTED: protein YLS3 [Solanum lycopersicum]
Length=193

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 115/170 (68%), Gaps = 16/170 (9%)
 Frame = -3

Query  601  SSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
            S++  +D++ C +QL+GL+ CL +VSG+AK PT  CC  +++ L K+++CLC+LVKDRN+
Sbjct  24   SANLDKDREECANQLVGLATCLPYVSGEAKSPTPDCCTGLKEVLDKSKICLCILVKDRND  83

Query  421  PGLGLKINGTLALSLPSLCRAP---TNVSECLTLLHLPPNSPDAKIfeefssssvsgnnt  251
            P LGLKIN TLALSLP+LC AP   +NVS C  LLHL PNSPDAK+F++F+ S+   +  
Sbjct  84   PSLGLKINATLALSLPTLCHAPPNMSNVSMCPELLHLAPNSPDAKVFQDFAKSAKGSSAA  143

Query  250  stGDLNASSS------------TALFRKRWIDLLQAHAGFSLLLLIVTFI  137
             +  ++ +SS                ++RW+  ++   GF L++L+++++
Sbjct  144  PSAPVSGNSSGKPANSSTNDKNDGGHKRRWMGFVEMTMGF-LVILMLSYL  192



>ref|XP_009375461.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=193

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             LL  +VG  S +  QDK  C DQL+GL+PCL +V GDAK PT  CC  I+  ++K++ C
Sbjct  16   LLLIFLVGFGSCNIDQDKAECADQLVGLAPCLPYVGGDAKSPTIDCCSGIKVVVQKSKKC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LCVL+KDR++P LGLKIN TLAL+LPS C  P N+S C+ LL+LP NSPDAK+
Sbjct  76   LCVLIKDRDDPKLGLKINATLALNLPSSCHVPINISRCVDLLNLPSNSPDAKM  128



>ref|XP_002530873.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF31513.1| lipid binding protein, putative [Ricinus communis]
Length=145

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            VG  SSDFAQD+  C +QL+GL+ CL +V G AK PT  CC  ++  L K+R CLCVL+K
Sbjct  16   VGCGSSDFAQDRAECANQLVGLATCLPYVGGTAKTPTLDCCTGLKSVLDKSRKCLCVLIK  75

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR+ P LG+K N TLA  LP+ C AP NV+EC+ LLHLPP+SPDAK+
Sbjct  76   DRDNPDLGIKFNATLAAFLPAACHAPVNVTECIDLLHLPPSSPDAKV  122



>ref|XP_007205970.1| hypothetical protein PRUPE_ppa012060mg [Prunus persica]
 gb|EMJ07169.1| hypothetical protein PRUPE_ppa012060mg [Prunus persica]
Length=185

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             +L L+V   SS+  QD+  C +QL+GL+PCL +V GDAK PT  CC  I++  +K++ C
Sbjct  15   LVLMLLVDFGSSNIDQDRAECAEQLVGLAPCLPYVGGDAKAPTLDCCTGIKEVEQKSKKC  74

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LCVL+KDRN+P LGLKIN TLAL LP+ C  P N+S C+ LL+LP NSPDAK+
Sbjct  75   LCVLIKDRNDPNLGLKINATLALQLPTSCHVPVNISRCVDLLNLPSNSPDAKM  127



>emb|CBI16494.3| unnamed protein product [Vitis vinifera]
Length=174

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            +++   S+DFA+D++ C DQL+GL+ CL +V G+ K PT  CC  +++ L+K++ CLCVL
Sbjct  2    MLLMSASADFAKDRQECADQLVGLATCLPYVQGEGKAPTLDCCTGLKQVLQKSKKCLCVL  61

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +KDR++P LG KIN TLALSLP+ C  P N+SEC  LL LPP SPDAKI
Sbjct  62   IKDRDDPNLGFKINTTLALSLPTACNTPANMSECPALLQLPPGSPDAKI  110



>emb|CDP17362.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +L  LL       ++D  +D+++C +QL+GL  CL +V GDAK PT  CC  ++  L+ +
Sbjct  13   MLVLLLMFFSTFCNADLNKDREKCANQLVGLEGCLPYVGGDAKSPTIDCCSGLKGVLQHS  72

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            R CLC+LVKDRN+P LGLKIN TLALSLP  C AP NVSEC  LLHL PNSPDAK+
Sbjct  73   RECLCILVKDRNDPNLGLKINATLALSLPDKCHAPANVSECPALLHLAPNSPDAKV  128



>emb|CCH50970.1| T4.9 [Malus x robusta]
Length=193

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             +L  +VG  S +  QDK  C DQL+GL+PCL +V GDAK PT  CC  I+  ++K++ C
Sbjct  16   LVLIFLVGFGSCNIDQDKAECADQLVGLAPCLPYVGGDAKSPTIDCCSGIKVVVQKSKKC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LCVL+KDR++P LGLKIN TLAL+LPS C  P N+S C+ LL+LP NSPDAK+
Sbjct  76   LCVLIKDRDDPKLGLKINATLALNLPSSCHVPINISRCVDLLNLPSNSPDAKM  128



>ref|XP_008351727.1| PREDICTED: protein YLS3-like [Malus domestica]
Length=193

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             +L  +VG  S +  QDK  C DQL+GL+PCL +V GDAK PT  CC  I+  ++K++ C
Sbjct  16   LVLIFLVGFGSCNIDQDKAECADQLVGLAPCLPYVGGDAKSPTIDCCSGIKVVVQKSKKC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LCVL+KDR++P LGLKIN TLAL+LPS C  P N+S C+ LL+LP NSPDAK+
Sbjct  76   LCVLIKDRDDPKLGLKINATLALNLPSSCHVPINISRCVDLLNLPSNSPDAKM  128



>ref|XP_007014734.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY32353.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=187

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 102/165 (62%), Gaps = 11/165 (7%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G  SSD  QDK  C +QL+GL+ CL +V G +K PT  CC  +++ L K+R CLCVL+KD
Sbjct  20   GFASSDVNQDKTECANQLVGLASCLPYVGGQSKTPTIDCCSGLKQVLDKSRKCLCVLIKD  79

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefssssvsgnnt  251
            R++P LGLKIN TLA +LPS C AP N++EC++LLHL PNS +AK FE +   +    NT
Sbjct  80   RDDPSLGLKINATLAATLPSTCHAPVNMTECISLLHLAPNSQEAKAFEGYEKLTEGHANT  139

Query  250  stGDLNASSSTALFR--------KRWIDLLQAHAGFSLLLLIVTF  140
               + N++SS +           KRW+ +  A   F + L I T 
Sbjct  140  PAANGNSTSSASTAAEKSDGGKGKRWVGVEMA---FGVSLWIFTL  181



>ref|XP_006369482.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
 gb|ERP66051.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
Length=161

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  628  LLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCL  449
            L+ +MV    +   +D + C +QL+GL+ CL +V GDAK PT  CC+ +++ LK  + CL
Sbjct  19   LMSVMVSLAMAGKDKDSEECAEQLVGLATCLPYVGGDAKAPTPDCCNGLKQVLKDNKKCL  78

Query  448  CVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            CV++KDRN+P LGLKIN TLALSLPS+C AP NVS+C  LL+LPPNSPDA+I
Sbjct  79   CVIIKDRNDPELGLKINATLALSLPSVCHAPANVSQCPALLNLPPNSPDAQI  130



>ref|XP_009628973.1| PREDICTED: protein YLS3-like [Nicotiana tomentosiformis]
Length=193

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 112/168 (67%), Gaps = 15/168 (9%)
 Frame = -3

Query  598  SDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEP  419
            ++  +DK+ C +QL+GL+ CL +VSGDAK PT  CC  +++ L K++ CLCVLVKDRN+P
Sbjct  26   ANIDKDKEECANQLVGLATCLPYVSGDAKAPTPDCCTGLKEVLDKSKKCLCVLVKDRNDP  85

Query  418  GLGLKINGTLALSLPSLCRAP---TNVSECLTLLHLPPNSPDAKI----feefssssvsg  260
             LGLKIN TLALSLP+LC AP    NVS C  LLHLPPNSPDAK+     +   +SS + 
Sbjct  86   SLGLKINATLALSLPTLCHAPANSANVSMCPELLHLPPNSPDAKVFEDFAKSAKASSSAS  145

Query  259  nntstGDLNASSSTALF-------RKRWIDLLQAHAGFSLLLLIVTFI  137
            +   +G  N  ++T          R++W+ +++   GF L++++++++
Sbjct  146  SAPVSGSSNGKAATTANEKNDGGDRRKWMGIVEMTMGF-LVIMVLSYL  192



>ref|XP_009364110.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=193

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             +L  +VG  S +  QD+  C DQL+GL+PC+ +V GDAK PT  CC  I++ ++K++ C
Sbjct  16   LVLIFLVGFGSCNIDQDRAECTDQLVGLAPCIPYVGGDAKTPTLDCCSGIKEVVQKSKKC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LC+L+KDR++P LGLKIN TLAL+LPS C  P N+S C+ LL+LP NSPDAK+
Sbjct  76   LCILIKDRDDPKLGLKINSTLALNLPSSCHVPVNISTCIDLLNLPSNSPDAKM  128



>ref|XP_002285691.1| PREDICTED: protein YLS3-like [Vitis vinifera]
Length=190

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
             S+DFA+D++ C DQL+GL+ CL +V G+ K PT  CC  +++ L+K++ CLCVL+KDR+
Sbjct  23   ASADFAKDRQECADQLVGLATCLPYVQGEGKAPTLDCCTGLKQVLQKSKKCLCVLIKDRD  82

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +P LG KIN TLALSLP+ C  P N+SEC  LL LPP SPDAKI
Sbjct  83   DPNLGFKINTTLALSLPTACNTPANMSECPALLQLPPGSPDAKI  126



>ref|XP_009766807.1| PREDICTED: protein YLS3-like [Nicotiana sylvestris]
Length=190

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 111/164 (68%), Gaps = 14/164 (9%)
 Frame = -3

Query  598  SDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEP  419
            +D  +DKK C +QL+GL+ CL +VSG AK PT  CC  +++ L K++ CLCVLVKDR++P
Sbjct  27   ADIDKDKKECANQLVGLATCLPYVSGGAKAPTPDCCTGLKEVLDKSKKCLCVLVKDRDDP  86

Query  418  GLGLKINGTLALSLPSLCRAP---TNVSECLTLLHLPPNSPDAKIfeefssssvsgnnts  248
             LGLKIN TLALSLP+LC AP    NVS C  LLHLPPNSPDAK+FE+F+ S+ + ++  
Sbjct  87   SLGLKINATLALSLPTLCHAPVNAANVSMCPELLHLPPNSPDAKVFEDFAKSAKASSSAP  146

Query  247  tGDLNASSSTALF-----------RKRWIDLLQAHAGFSLLLLI  149
            +  ++ SS+               R++W+ +++   GF +++++
Sbjct  147  SAPVSGSSNGKAATTANEKNDGGDRRKWMGIVEMTMGFLVIMVL  190



>ref|XP_006369483.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
 gb|ERP66052.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
Length=197

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  628  LLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCL  449
            L+ +MV    +   +D + C +QL+GL+ CL +V GDAK PT  CC+ +++ LK  + CL
Sbjct  19   LMSVMVSLAMAGKDKDSEECAEQLVGLATCLPYVGGDAKAPTPDCCNGLKQVLKDNKKCL  78

Query  448  CVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            CV++KDRN+P LGLKIN TLALSLPS+C AP NVS+C  LL+LPPNSPDA+I
Sbjct  79   CVIIKDRNDPELGLKINATLALSLPSVCHAPANVSQCPALLNLPPNSPDAQI  130



>ref|XP_007159392.1| hypothetical protein PHAVU_002G234400g [Phaseolus vulgaris]
 gb|ESW31386.1| hypothetical protein PHAVU_002G234400g [Phaseolus vulgaris]
Length=187

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G  +SD  QDK  C +++IGL+ CLT+ SG+A  PT  CC  +++ + K++ CLC+L+KD
Sbjct  18   GFATSDINQDKSECMNKIIGLAGCLTYASGEAAVPTMDCCFGLKEVIDKSKRCLCILIKD  77

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            RN+P LGLK+N TLAL LP +C+ PTN++EC+ LLHLPPNS DAK+
Sbjct  78   RNDPSLGLKVNVTLALKLPEVCKTPTNITECVDLLHLPPNSADAKV  123



>ref|XP_006492750.1| PREDICTED: uncharacterized protein LOC102613530 [Citrus sinensis]
Length=393

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 110/174 (63%), Gaps = 10/174 (6%)
 Frame = -3

Query  634  CFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRL  455
            C L+ +++G  SS+  QDK  C D+++ L+ CL +V GDAK PT  CC  +++ L K++ 
Sbjct  13   CILVLMLLGLASSNIDQDKAECADKVVALATCLPYVGGDAKTPTVDCCGGLKQLLDKSKK  72

Query  454  CLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefss  275
            CLC+L+KD+++P LGLKIN TLA +LP+ C +P NVSEC+ LLHLPPNSPDAK+F+ FS+
Sbjct  73   CLCLLIKDKDDPSLGLKINSTLAANLPTACHSPANVSECINLLHLPPNSPDAKVFQGFSN  132

Query  274  ssvsgnntstGDLNASS----------STALFRKRWIDLLQAHAGFSLLLLIVT  143
             +     T    + ++S          S      R + L  A  GFSL  L+VT
Sbjct  133  LTQGHGGTPATAVGSNSKNGSPSADQKSDGGKASRLLGLEMAVWGFSLHFLLVT  186



>ref|XP_011010692.1| PREDICTED: protein YLS3-like [Populus euphratica]
Length=190

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             +L ++VG   SDF QD+  C DQL+GL+ CL +V GDAK PT  CC  +++ L K+  C
Sbjct  16   LVLLMLVGTARSDFQQDRTECADQLVGLATCLPYVGGDAKAPTIDCCSGLKQVLDKSVKC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LCVL+KDR+ P LG+K N +L   LPSLC AP NV++C+ +LHLP  SPDAK+
Sbjct  76   LCVLIKDRDNPDLGIKFNVSLVAKLPSLCHAPVNVTKCIDILHLPAGSPDAKV  128



>ref|XP_002299127.1| hypothetical protein POPTR_0001s04590g [Populus trichocarpa]
 gb|ABK96104.1| unknown [Populus trichocarpa]
 gb|EEE83932.1| hypothetical protein POPTR_0001s04590g [Populus trichocarpa]
Length=189

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = -3

Query  640  ILCFLLCLM-VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK  464
            I C L+ LM VG   SDF QD+  C DQL+GL+ CL +V GDAK PT  CC  +++ L K
Sbjct  12   IPCILVLLMLVGTARSDFQQDRTECADQLVGLATCLPYVGGDAKAPTIDCCSGLKQVLDK  71

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +  CLCVL+KDR+ P LG+K N +L   LPSLC AP NV+ C+ +LHLP  SPDAK+
Sbjct  72   SVKCLCVLIKDRDNPDLGIKFNVSLVAKLPSLCHAPVNVTNCIDILHLPAGSPDAKV  128



>ref|XP_011089118.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=196

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            L + C L+ L+    + D  +DK +C D+L+GL+ CL +VSG++K P   CC  +++ L 
Sbjct  18   LPLQCTLVLLLSSIATCDVDKDKLKCGDELVGLATCLPYVSGESKTPPIDCCAGLKQVLH  77

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            K+  C+C+LVKDRN+P LGLKIN TLAL+LPS C AP NVS C  LLHLPPNSPDAK+
Sbjct  78   KSPECICLLVKDRNDPSLGLKINATLALTLPSQCHAPANVSHCPALLHLPPNSPDAKV  135



>ref|XP_008225280.1| PREDICTED: protein YLS3-like [Prunus mume]
Length=185

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 4/124 (3%)
 Frame = -3

Query  664  SCPMGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDE  485
            S  + S+ +L FL    V   SS+  QD+  C DQL+GL+PCL +V GDAK PT  CC  
Sbjct  8    SVALSSILVLMFL----VDFGSSNIDQDRAECADQLVGLAPCLPYVGGDAKAPTLDCCTG  63

Query  484  IRKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSP  305
            I++  +K++ CLCVL+KD ++P LGLKIN TLAL LP+ C  P N+S C+ LL+LP NSP
Sbjct  64   IKEVEQKSKKCLCVLIKDHDDPNLGLKINATLALQLPTSCHVPVNISRCVDLLNLPSNSP  123

Query  304  DAKI  293
            DAK+
Sbjct  124  DAKM  127



>emb|CAN59826.1| hypothetical protein VITISV_016657 [Vitis vinifera]
Length=595

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -3

Query  628  LLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCL  449
            ++ +++  V+SD A+DK+ C +QL+G++ CL +V GDAK PT  CC  +++ L+K + CL
Sbjct  12   IVSMVITCVTSDSAKDKQECTEQLVGMATCLPYVGGDAKAPTPDCCSGLKQVLQKNKKCL  71

Query  448  CVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            CV++KDRN+P LGL +N TLAL LPS+C AP NVS+C  LLHL PNSPDA++
Sbjct  72   CVIIKDRNDPDLGLNLNATLALGLPSVCHAPANVSQCPALLHLAPNSPDAQV  123



>gb|KGN54079.1| hypothetical protein Csa_4G280560 [Cucumis sativus]
Length=185

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  658  PMGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIR  479
            P  +  +   L  L VG VSS+  QD+  C DQ++GL+ CL +V G+AK PT  CC  ++
Sbjct  3    PSSAHFLFAALALLSVGFVSSNIDQDRAECADQVVGLATCLPYVGGEAKAPTPDCCSGLK  62

Query  478  KDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDA  299
              L K+R CLCVL+KDR++P LGLK+N +LAL LPS C AP N+ +C+ LLHL PNSP+A
Sbjct  63   LVLDKSRKCLCVLIKDRDDPSLGLKVNLSLALGLPSACHAPANIKDCVGLLHLSPNSPEA  122

Query  298  K  296
            K
Sbjct  123  K  123



>ref|XP_007163836.1| hypothetical protein PHAVU_001G268300g [Phaseolus vulgaris]
 gb|ESW35830.1| hypothetical protein PHAVU_001G268300g [Phaseolus vulgaris]
Length=203

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            VG  +SD  +D++ C D+L+GL+ C+ +V G+AK PT  CC  ++  L K++ C+C+L+K
Sbjct  38   VGFANSDLGKDREECADKLVGLASCVPYVGGEAKTPTIDCCSGLKVVLDKSKKCICILIK  97

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR++P LG+KIN TLA+ LPS C AP N+S C+ LLHL PNSPDAK+
Sbjct  98   DRDDPNLGIKINATLAIQLPSACHAPANISHCVDLLHLAPNSPDAKV  144



>emb|CDP07663.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  628  LLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCL  449
            L+ LM     SD A+DK+ C + L+GL+ CL +V G+AKFPT  CC  +++ LK  + CL
Sbjct  15   LVSLMFECAISDDAKDKQECTNALVGLATCLPYVGGNAKFPTPDCCSGLKEVLKTNKKCL  74

Query  448  CVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            C+++KDRN+P LGL IN TLAL LPS+C AP N+SEC  LLHL PNSPDA++
Sbjct  75   CLVIKDRNDPDLGLSINVTLALGLPSVCNAPANISECPALLHLDPNSPDAQV  126



>ref|XP_008384404.1| PREDICTED: protein YLS3-like [Malus domestica]
 ref|XP_008384405.1| PREDICTED: protein YLS3-like [Malus domestica]
 ref|XP_008366146.1| PREDICTED: protein YLS3-like [Malus domestica]
Length=193

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             +L  +VG  S +  QD+  C DQL+GL+PCL +V GDAK PT  CC  I++ ++K++ C
Sbjct  16   LVLIFLVGFGSCNIDQDRAECTDQLVGLAPCLPYVGGDAKTPTLDCCSGIKEVVQKSKKC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LC+L+KDR++P LGLKIN TLAL+LPS C  P N+S C+ LL+LP NS DAK+
Sbjct  76   LCILLKDRDDPKLGLKINSTLALNLPSSCHVPVNISTCIDLLNLPSNSSDAKM  128



>gb|KDO46035.1| hypothetical protein CISIN_1g029183mg [Citrus sinensis]
Length=197

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            ++  L+ +   G  +D A+D++ C +QL+GLS CL +V GDAK PT  CC  +++ LK  
Sbjct  2    LVIVLMMISSSGTMADKAKDREECTNQLVGLSTCLPYVGGDAKAPTPDCCSGLKQVLKND  61

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            + CLCV+++DRN+P LGL IN TLAL LPS+C AP NVS+C  LLHL PNSP+A++
Sbjct  62   KKCLCVIIRDRNDPELGLNINVTLALGLPSVCHAPANVSQCPALLHLDPNSPEAQV  117



>ref|XP_010044958.1| PREDICTED: protein YLS3-like [Eucalyptus grandis]
 gb|KCW87092.1| hypothetical protein EUGRSUZ_B03623 [Eucalyptus grandis]
Length=202

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            +G   SD  QD+  C DQL+GL+ CL +V GDAK PT  CC  ++  L+K++ CLC+L+K
Sbjct  28   MGSGRSDMDQDRAECADQLVGLASCLPYVGGDAKSPTIDCCTGLKGVLQKSKKCLCILIK  87

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR++P LGLKIN TLAL LP+ C AP N+S C+ LLHLP NS DAK+
Sbjct  88   DRDDPNLGLKINATLALGLPTACHAPANISACVDLLHLPANSTDAKL  134



>ref|XP_008449799.1| PREDICTED: protein YLS3 [Cucumis melo]
Length=186

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  658  PMGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIR  479
            P  +  +   L  L VG VSS+  QD+  C DQ++GL+ CL +V G+AK PT  CC  ++
Sbjct  3    PSSAHFLFAALALLSVGFVSSNIDQDRAECADQVVGLATCLPYVGGEAKAPTPDCCSGLK  62

Query  478  KDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDA  299
              L K+R CLCVL+KDR++P LGLK+N TLAL LPS C AP ++ +C+ LLHL PNSP+A
Sbjct  63   LVLDKSRKCLCVLIKDRDDPSLGLKVNLTLALGLPSACHAPADIKDCIGLLHLSPNSPEA  122

Query  298  K  296
            K
Sbjct  123  K  123



>gb|KHG12536.1| hypothetical protein F383_03102 [Gossypium arboreum]
Length=186

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 99/158 (63%), Gaps = 5/158 (3%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
             SSD  QDK  C DQL+GL+PCL +V G AK PT  CC  +++ L K++ CLCVL+KDR+
Sbjct  23   ASSDVNQDKAECTDQLVGLAPCLPYVGGQAKAPTMDCCGGLKQVLVKSKKCLCVLIKDRD  82

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefssssvsgnntst  245
            +P LGL IN +LA +LP  C    N++EC++LLHL PNS +AK+F+ +   +   + +  
Sbjct  83   DPSLGLNINASLAATLPHTCHDTVNITECISLLHLAPNSQEAKLFQGYQKLTEKHSTSPP  142

Query  244  GDLNASSSTAL-----FRKRWIDLLQAHAGFSLLLLIV  146
               N++SS A        K+ + +++   GFSL +  +
Sbjct  143  ASGNSTSSAAEKSDGGMGKKRVGVVEIAVGFSLWVFHI  180



>gb|EYU39237.1| hypothetical protein MIMGU_mgv1a014178mg [Erythranthe guttata]
Length=198

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = -3

Query  640  ILCFLLCLMVGG--VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            + C L  +M+ G   + D  +DK++C + L+GL+ CL +VSG+AK P   CC  +++ L+
Sbjct  7    VPCILAVVMLWGSLATCDVDKDKEKCANDLVGLATCLPYVSGEAKAPPVDCCTGLKQILQ  66

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            K+  C+C+LVKDRN+P LGL+IN TLAL LPS C AP N+S C  LLHLPPNSPDAK+
Sbjct  67   KSPQCICLLVKDRNDPTLGLQINATLALGLPSQCHAPANISACPALLHLPPNSPDAKV  124



>ref|NP_001235687.1| uncharacterized protein LOC100306483 precursor [Glycine max]
 gb|ACU14687.1| unknown [Glycine max]
Length=192

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            VG  +SD  QDK  C D+L+GL+ CL +V G+AK P   CC  IR+ + K++ CLC+L+K
Sbjct  20   VGFATSDINQDKAECTDKLLGLAGCLPYVGGEAKVPAMDCCSGIREVIDKSKRCLCILIK  79

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR++P LGLKIN TLALSLP  C+ PTN+++C+ LLHL PNS +AK+
Sbjct  80   DRDDPNLGLKINVTLALSLPDACQTPTNITQCVDLLHLAPNSTEAKV  126



>ref|XP_006579354.1| PREDICTED: uncharacterized protein LOC100306483 isoform X1 [Glycine 
max]
Length=193

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            VG  +SD  QDK  C D+L+GL+ CL +V G+AK P   CC  IR+ + K++ CLC+L+K
Sbjct  20   VGFATSDINQDKAECTDKLLGLAGCLPYVGGEAKVPAMDCCSGIREVIDKSKRCLCILIK  79

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR++P LGLKIN TLALSLP  C+ PTN+++C+ LLHL PNS +AK+
Sbjct  80   DRDDPNLGLKINVTLALSLPDACQTPTNITQCVDLLHLAPNSTEAKV  126



>ref|XP_006492820.1| PREDICTED: protein YLS3-like isoform X2 [Citrus sinensis]
Length=177

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 102/164 (62%), Gaps = 3/164 (2%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +    +    G V SDF + +K C DQL   S CL FV G AK P+  CC  I K+  KT
Sbjct  15   LFTVFIVTSAGFVRSDFNKGRKGCGDQLADFSACLPFVGGKAKSPSPTCCSSITKEGSKT  74

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeef  281
            R CLC+LVKDRNEP  G K+N TLALSLPS+  AP  VS+C  LL+LPPNS DA++ E+ 
Sbjct  75   RKCLCLLVKDRNEPRHGFKMNATLALSLPSVRHAPATVSDCPALLNLPPNSTDAQVVEQL  134

Query  280  ssssvsgnntstGDLNASSSTALFRKRWIDLLQAHAGFSLLLLI  149
            +++S   N+T+   + +SSS  +  +RW  ++ A    SL L+I
Sbjct  135  AANSGGNNSTAVTVVPSSSSNTVKGRRWRGMVCA---VSLWLVI  175



>ref|XP_009592817.1| PREDICTED: protein YLS3-like isoform X2 [Nicotiana tomentosiformis]
Length=170

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +L F+LC+     +SD  +DK+ C   LIGL+ CL +V+ +A  PT  CC  +++ LK +
Sbjct  13   VLFFMLCVFG---NSDTEKDKEECTQSLIGLATCLPYVTANAPAPTPDCCTGLKQVLKAS  69

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            + CLC+L+KDRN+P LGL +N TLALSLPS+C+AP N+S+C  LLHLPPNSPDA++
Sbjct  70   KKCLCLLIKDRNDPDLGLNLNVTLALSLPSVCQAPANISQCPALLHLPPNSPDAQV  125



>ref|NP_001238362.1| uncharacterized protein LOC100499687 precursor [Glycine max]
 gb|ACU13241.1| unknown [Glycine max]
Length=193

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            VG  +SD  QDK  C D+L+GL+ CL++V G+AK PT  CC  I++ + K++ CLC+L+K
Sbjct  20   VGFATSDINQDKAECTDKLLGLAGCLSYVGGEAKVPTMDCCSGIKEVINKSKRCLCILIK  79

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR++P LGLKIN TLAL+LP +C  PTN+++C+ LLHL P S +AK+
Sbjct  80   DRDDPSLGLKINVTLALNLPDVCETPTNITQCVDLLHLAPKSQEAKV  126



>ref|XP_009770685.1| PREDICTED: protein YLS3-like [Nicotiana sylvestris]
Length=192

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +L F+LC+     +SD  +DK+ C   LIGL+ CL +V+ +A  PT  CC  +++ LK +
Sbjct  8    VLFFMLCVFG---NSDTEKDKEECTQSLIGLATCLPYVTANAPAPTPDCCTGLKQVLKAS  64

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            + CLC+L+KDRN+P LGL +N TLALSLPS+C+AP N+S+C  LLHLPPNSPDA++
Sbjct  65   KKCLCLLIKDRNDPDLGLNLNVTLALSLPSVCQAPANISQCPALLHLPPNSPDAQV  120



>ref|XP_002512201.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF50235.1| lipid binding protein, putative [Ricinus communis]
Length=133

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -3

Query  616  MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLV  437
            M G   +D  +DK+ C +QL+GL+ CL +V G+AK PT  CC  +++ LK  + CLCV++
Sbjct  1    MAGFAMADADKDKEECAEQLVGLATCLPYVGGNAKSPTPDCCTGLKEVLKNNKKCLCVVI  60

Query  436  KDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            KDRN+P LGLKIN TLAL LP++C A  NVS+C  LLHL PNSPDA++
Sbjct  61   KDRNDPDLGLKINVTLALGLPTVCHATANVSQCPALLHLAPNSPDAQV  108



>ref|XP_006354156.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Solanum tuberosum]
Length=190

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 110/167 (66%), Gaps = 13/167 (8%)
 Frame = -3

Query  601  SSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
            S+   +D++ C +QL+GL+ CL FVS +AK PT  CC  +++ L K+++CLC+LVKDRN+
Sbjct  24   SASLDKDREECANQLVGLATCLPFVSSEAKAPTPDCCTGLKEVLDKSKICLCILVKDRND  83

Query  421  PGLGLKINGTLALSLPSLCRAP---TNVSECLTLLHLPPNSPDAKI----feefssssvs  263
            P LGLKIN TLALSLP+LC AP    NVS C  LLHL PNSPDAK+     +  S++  +
Sbjct  84   PSLGLKINATLALSLPTLCHAPPNIANVSMCTDLLHLAPNSPDAKVFQDFAKGSSAAPSA  143

Query  262  gnntstGDLNASSST-----ALFRKRWIDLLQAHAGFSLLLLIVTFI  137
              + ++    A+SST        R+R +  ++   GF L++L+++++
Sbjct  144  PVSGNSSGKPANSSTNDKNDGGHRRRCMGFIEMTMGF-LVILVLSYL  189



>ref|XP_010542451.1| PREDICTED: protein YLS3-like isoform X2 [Tarenaya hassleriana]
Length=191

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            S ++      L++G  +SD AQD+  C +QL+GL+ CL +V G+AK PT  CC   +  +
Sbjct  7    SWEMWIMAAFLLLGSGNSDLAQDRAECSEQLVGLATCLPYVGGEAKAPTRDCCAGFKDVV  66

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPT-NVSECLTLLHLPPNSPDAK  296
             K+R C+C+L+KDRN+P LGLKIN TLA+ LP+LC   + N+S C +LLHLPPNSP+AK
Sbjct  67   DKSRKCICILIKDRNDPQLGLKINATLAVLLPTLCHQSSPNISACTSLLHLPPNSPEAK  125



>gb|KHN47957.1| Putative GPI-anchored protein [Glycine soja]
Length=193

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            VG  +SD  QDK  C D+L+GL+ CL++V G+AK PT  CC  I++ + K++ CLC+L+K
Sbjct  20   VGFATSDINQDKAECTDKLLGLAGCLSYVGGEAKVPTMDCCSGIKEVIDKSKRCLCILIK  79

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR++P LGLKIN TLAL+LP +C  PTN+++C+ LLHL P S +AK+
Sbjct  80   DRDDPSLGLKINVTLALNLPDVCETPTNITQCVDLLHLAPKSQEAKV  126



>ref|XP_010542450.1| PREDICTED: protein YLS3-like isoform X1 [Tarenaya hassleriana]
Length=194

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            S ++      L++G  +SD AQD+  C +QL+GL+ CL +V G+AK PT  CC   +  +
Sbjct  7    SWEMWIMAAFLLLGSGNSDLAQDRAECSEQLVGLATCLPYVGGEAKAPTRDCCAGFKDVV  66

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPT-NVSECLTLLHLPPNSPDAK  296
             K+R C+C+L+KDRN+P LGLKIN TLA+ LP+LC   + N+S C +LLHLPPNSP+AK
Sbjct  67   DKSRKCICILIKDRNDPQLGLKINATLAVLLPTLCHQSSPNISACTSLLHLPPNSPEAK  125



>ref|XP_009592816.1| PREDICTED: protein YLS3-like isoform X1 [Nicotiana tomentosiformis]
Length=197

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +L F+LC+     +SD  +DK+ C   LIGL+ CL +V+ +A  PT  CC  +++ LK +
Sbjct  13   VLFFMLCVFG---NSDTEKDKEECTQSLIGLATCLPYVTANAPAPTPDCCTGLKQVLKAS  69

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            + CLC+L+KDRN+P LGL +N TLALSLPS+C+AP N+S+C  LLHLPPNSPDA++
Sbjct  70   KKCLCLLIKDRNDPDLGLNLNVTLALSLPSVCQAPANISQCPALLHLPPNSPDAQV  125



>ref|XP_010917572.1| PREDICTED: protein YLS3-like [Elaeis guineensis]
 ref|XP_010917573.1| PREDICTED: protein YLS3-like [Elaeis guineensis]
Length=187

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +L  +LCL     SSD + D+K C DQL+GL+ CL+FV G+AK PT  CC  +++ L K+
Sbjct  12   VLLLVLCLF-STASSDVSSDQKECSDQLVGLATCLSFVQGNAKAPTPDCCTGLKQVLAKS  70

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              CLC+L+KD ++P LG+K N +LAL LPSLC AP N+SEC  LL+LPPNS DA+I
Sbjct  71   PKCLCILIKDSDDPQLGIKFNVSLALRLPSLCSAPANISECPKLLNLPPNSQDAEI  126



>ref|XP_006482799.1| PREDICTED: protein YLS3-like [Citrus sinensis]
Length=159

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            + ++  L+ +   G  +D A+D++ C +QL+GLS CL +V GDAK PT  CC  +++ LK
Sbjct  11   IMLVIVLMMISSSGTMADKAKDREECTNQLVGLSTCLPYVGGDAKAPTPDCCSGLKQVLK  70

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              + CLCV+++D N+P LGL IN TL L LPS+C AP NVS+C  LLHL PNSP+A++
Sbjct  71   NDKKCLCVIIRDMNDPELGLNINVTLTLGLPSVCHAPANVSQCPALLHLDPNSPEAQV  128



>gb|KHG18912.1| hypothetical protein F383_24909 [Gossypium arboreum]
Length=182

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = -3

Query  598  SDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEP  419
            +D  QDK  C ++L+GL+PCL +V GDAK PT  CC  +++ L K+R CLCVL+KDR++P
Sbjct  24   ADINQDKTECSNELVGLAPCLPYVGGDAKTPTIDCCSGLKQVLDKSRKCLCVLLKDRDDP  83

Query  418  GLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             LGL IN TLA +LP+ CRAP N+++C++LLHL P+S +AK+
Sbjct  84   SLGLNINATLAATLPTTCRAPVNMTDCISLLHLTPDSQEAKL  125



>gb|KFK38683.1| hypothetical protein AALP_AA3G147000 [Arabis alpina]
Length=187

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            SL  +  +  ++VG  SSD  +D++ C DQL+ L+PCLT+V GDAK PT  CC    + +
Sbjct  4    SLVTMVIITFMLVGFGSSDLTKDREECTDQLLALAPCLTYVGGDAKAPTKDCCGGFGQVI  63

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR-APTNVSECLTLLHLPPNSPDAK  296
             K+  C+CVL+KD+++P LG+K N TLA+ LPS C  AP N++EC++LLH+PPNS  AK
Sbjct  64   AKSEKCVCVLIKDKDDPQLGIKFNATLAVHLPSACHIAPPNITECISLLHIPPNSTLAK  122



>gb|KFK38682.1| hypothetical protein AALP_AA3G147000 [Arabis alpina]
Length=188

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            SL  +  +  ++VG  SSD  +D++ C DQL+ L+PCLT+V GDAK PT  CC    + +
Sbjct  4    SLVTMVIITFMLVGFGSSDLTKDREECTDQLLALAPCLTYVGGDAKAPTKDCCGGFGQVI  63

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR-APTNVSECLTLLHLPPNSPDAK  296
             K+  C+CVL+KD+++P LG+K N TLA+ LPS C  AP N++EC++LLH+PPNS  AK
Sbjct  64   AKSEKCVCVLIKDKDDPQLGIKFNATLAVHLPSACHIAPPNITECISLLHIPPNSTLAK  122



>ref|XP_010101137.1| hypothetical protein L484_016701 [Morus notabilis]
 gb|EXB87355.1| hypothetical protein L484_016701 [Morus notabilis]
Length=185

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
            V ++  QD+  C D+L+GL+ CL +V GDAK PT  CC  +++ + K++ CLCVL+KDR+
Sbjct  21   VGANLEQDRAECADKLVGLATCLPYVGGDAKTPTMDCCSGLKEVVDKSKKCLCVLIKDRD  80

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +P LG+KIN TLA+ LP+ C  PTN+S+C+ LLHL PNS DAK+
Sbjct  81   DPNLGVKINSTLAMQLPNACHIPTNISKCVDLLHLAPNSSDAKV  124



>ref|XP_010044960.1| PREDICTED: protein YLS3-like [Eucalyptus grandis]
 gb|KCW87093.1| hypothetical protein EUGRSUZ_B03624 [Eucalyptus grandis]
Length=196

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  589  AQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPGLG  410
            AQD+  C DQL+GL+ CL +V G+A+ PT  CC  +++ L+K+  CLC+LV+DRN+P LG
Sbjct  27   AQDRAECADQLVGLATCLPYVGGEARAPTLECCSGLKQVLQKSLKCLCILVRDRNDPSLG  86

Query  409  LKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LKIN TLALSLP+ C +P N+S+C+ LLHL PNS DA++
Sbjct  87   LKINTTLALSLPTSCHSPVNISQCIDLLHLAPNSTDAEV  125



>ref|XP_006359139.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Solanum tuberosum]
Length=193

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +L F+LC+     +SD  +DK+ C   LIGL+ CL +V G+A  PT  CC  +++ LK +
Sbjct  13   VLFFILCVFG---NSDTEKDKEECTQSLIGLATCLPYVGGNAPAPTPDCCTGLKQVLKAS  69

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            + CLC+L+KDRN+P LGL++N TLAL+LPS+C+AP N+SEC  LLHLP NSP+A++
Sbjct  70   KKCLCLLIKDRNDPDLGLQLNVTLALTLPSVCKAPANISECPALLHLPANSPEAQV  125



>gb|ACU14650.1| unknown [Glycine max]
Length=193

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            VG  +SD  QDK  C D+L+GL+ CL +V G+AK P   CC  IR+ + K++ CLC+L+K
Sbjct  20   VGFATSDINQDKAECTDKLLGLAGCLPYVGGEAKVPAMDCCSGIREVIDKSKRCLCILIK  79

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR++P  GLKIN TLALSLP  C+ PTN+++C+ LLHL PNS +AK+
Sbjct  80   DRDDPNPGLKINVTLALSLPDACQTPTNITQCVDLLHLAPNSTEAKV  126



>ref|XP_010934252.1| PREDICTED: protein YLS3 [Elaeis guineensis]
Length=204

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = -3

Query  649  SLKILCFLLCL--MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRK  476
            S ++L FLL +  +    SSDFA D+  C DQL GL+ CLT+V   A  PT  CC  +++
Sbjct  24   SSQLLYFLLVIPGLFSFASSDFASDRAECADQLTGLATCLTYVENRASAPTPDCCSGLKQ  83

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
             L K+R CLCVL+KDR+ P LG+KIN T A++LP++C A  N+SEC  LL+LPPNS DA+
Sbjct  84   VLAKSRKCLCVLIKDRDNPSLGVKINVTTAMALPTVCHASANISECPKLLNLPPNSKDAQ  143

Query  295  I  293
            I
Sbjct  144  I  144



>ref|XP_010544520.1| PREDICTED: protein YLS3-like [Tarenaya hassleriana]
Length=199

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            L +L  ++ + + G S D AQDK+ C  +L+GL+ CLT+V G AK PT  CC  +R+ LK
Sbjct  8    LILLVIIMSVFLVGSSGDKAQDKEECTQELVGLATCLTYVQGQAKAPTPDCCSGLRQVLK  67

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              + CLC L++DRN+P LGL+IN +LAL LPS+C A  +V++C +LLHL PNSP+A++
Sbjct  68   TNKKCLCELIRDRNDPDLGLQINVSLALGLPSVCHAAADVTKCPSLLHLDPNSPEAQV  125



>ref|XP_004504343.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Cicer arietinum]
Length=193

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = -3

Query  667  TSCPMGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCD  488
            T+ P     IL FL+ LM G  +SD  QDK  C D+L+ L+ CL FV+G AK P   CC 
Sbjct  7    TTNPSLFFSILIFLV-LMFGLANSDVNQDKAECTDKLLTLANCLPFVTGQAKSPNIDCCT  65

Query  487  EIRKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNS  308
             ++  +  ++ CLC+L+KDR++P LGLKIN TLAL LP+ C+ PTN+++C+ +LHL P S
Sbjct  66   GVKDVINNSKRCLCILIKDRDDPNLGLKINVTLALELPNDCKTPTNITKCVDILHLAPKS  125

Query  307  PDAKI  293
            P+AKI
Sbjct  126  PEAKI  130



>ref|XP_010693844.1| PREDICTED: protein YLS3 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=176

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
            VSSDF++DK  CQ+QLI LS CL +V+G+AK P+  CC  + K L  ++ CLC+LVKDRN
Sbjct  23   VSSDFSKDKAECQEQLITLSSCLNYVAGEAKAPSPQCCTVLHKKLNVSKKCLCILVKDRN  82

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            EP LGLK+N T AL LPS+C  P++   C+ LLHL P SP+A++
Sbjct  83   EPSLGLKLNATRALMLPSICHTPSSSLVCIGLLHLDPKSPEARV  126



>ref|XP_010693842.1| PREDICTED: protein YLS3 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=179

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
            VSSDF++DK  CQ+QLI LS CL +V+G+AK P+  CC  + K L  ++ CLC+LVKDRN
Sbjct  23   VSSDFSKDKAECQEQLITLSSCLNYVAGEAKAPSPQCCTVLHKKLNVSKKCLCILVKDRN  82

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            EP LGLK+N T AL LPS+C  P++   C+ LLHL P SP+A++
Sbjct  83   EPSLGLKLNATRALMLPSICHTPSSSLVCIGLLHLDPKSPEARV  126



>ref|XP_006492819.1| PREDICTED: protein YLS3-like isoform X1 [Citrus sinensis]
Length=178

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 102/165 (62%), Gaps = 4/165 (2%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +    +    G V SDF + +K C DQL   S CL FV G AK P+  CC  I K+  KT
Sbjct  15   LFTVFIVTSAGFVRSDFNKGRKGCGDQLADFSACLPFVGGKAKSPSPTCCSSITKEGSKT  74

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeef  281
            R CLC+LVKDRNEP  G K+N TLALSLPS+  AP  VS+C  LL+LPPNS DA++ E+ 
Sbjct  75   RKCLCLLVKDRNEPRHGFKMNATLALSLPSVRHAPATVSDCPALLNLPPNSTDAQVVEQL  134

Query  280  ssssvsgnntstGDLNASSSTALFR-KRWIDLLQAHAGFSLLLLI  149
            +++S   N+T+   +  SSS+   + +RW  ++ A    SL L+I
Sbjct  135  AANSGGNNSTAVTAVVPSSSSNTVKGRRWRGMVCA---VSLWLVI  176



>gb|KDO70843.1| hypothetical protein CISIN_1g043293mg, partial [Citrus sinensis]
Length=147

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +    +    G V SDF + +K C DQL   S CL FV G AK P+  CC  I K+  KT
Sbjct  15   LFTVFIVTSAGFVRSDFNKGRKGCGDQLADFSACLPFVGGKAKSPSPTCCSSITKEGSKT  74

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            R CLC+LVKDRNEP  G K+N TLALSLPS+  AP  VS+C  LL+LPPNS DA++
Sbjct  75   RKCLCLLVKDRNEPRHGFKMNATLALSLPSVRHAPATVSDCPALLNLPPNSTDAQV  130



>gb|KHN44488.1| Putative GPI-anchored protein [Glycine soja]
Length=182

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G   SD ++D++ C D+LI L+ C+ +V G+AK PT  CC  ++  L +++ CLC+L+KD
Sbjct  18   GFAKSDLSKDREECADKLIDLASCVPYVGGEAKTPTIDCCTGLKAVLDRSKKCLCILIKD  77

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            R++P LG+KIN TLA+ LPS C +P N+++C+ LLHL PNSPDAK+
Sbjct  78   RDDPNLGIKINATLAIQLPSACHSPANITQCVDLLHLAPNSPDAKV  123



>ref|XP_011093401.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=197

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = -3

Query  664  SCPMGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDE  485
            SC   SL +   L+ L +   +SD ++D++ C D L+GL+ CL +V G AK PT  CC  
Sbjct  3    SCARTSLFLTSTLILLAL--TTSDNSKDRQECADSLVGLATCLPYVGGTAKTPTPDCCSG  60

Query  484  IRKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSP  305
            +++ LK  + CLC+++KDRN+P LGL IN TLAL LP++C AP N+S+C  LL+LPPNSP
Sbjct  61   LKQVLKTNKKCLCIVIKDRNDPDLGLNINVTLALGLPAVCNAPANISQCPALLNLPPNSP  120

Query  304  DAKI  293
            +A+I
Sbjct  121  EAQI  124



>ref|XP_010534886.1| PREDICTED: protein YLS3-like [Tarenaya hassleriana]
Length=191

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            ++ I+  L+ L +G  +SD AQD+  C +QL+GL+ CL +V GDAK PT  CC   +  +
Sbjct  9    TISIMVGLMFLGIG--NSDLAQDRAECSEQLVGLATCLPYVGGDAKVPTKDCCAGFKAVI  66

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPT-NVSECLTLLHLPPNSPDAK  296
             K++ C+C+L+KDR++P LGLKIN TLA+ LP++C  P  N+S+C +LL LPPNSP AK
Sbjct  67   DKSKKCICILIKDRDDPELGLKINATLAVHLPTVCHQPAPNISDCTSLLKLPPNSPAAK  125



>ref|XP_004229337.1| PREDICTED: protein YLS3 [Solanum lycopersicum]
Length=194

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -3

Query  601  SSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
            +SD  +DK+ C   LIGL+ CL +V G+A  PT  CC  +++ LK ++ CLC+L+KDRN+
Sbjct  23   NSDTEKDKEECTQSLIGLATCLPYVGGNAPAPTPDCCTGLKQVLKDSKKCLCLLIKDRND  82

Query  421  PGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            P LGL++N TLAL+LPS+C+AP N+SEC  LLHLP NSPDA++
Sbjct  83   PDLGLQLNVTLALTLPSVCKAPANISECPALLHLPANSPDAQV  125



>gb|KHG04910.1| hypothetical protein F383_07676 [Gossypium arboreum]
Length=208

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            V G  S   +DK+ C +QLIGL+ CL +V G+AK PT  CC  +++ LK  + CLC+++K
Sbjct  29   VMGGDSGEDKDKEECTEQLIGLATCLPYVGGNAKAPTPDCCSGLKQVLKNNKKCLCIIIK  88

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DRN+P LGL IN TLALSLPS+C AP N+S+C  LLH+ PNSP+A++
Sbjct  89   DRNDPDLGLNINVTLALSLPSVCNAPANISKCPELLHMDPNSPEAQV  135



>ref|NP_001237564.1| uncharacterized protein LOC100305590 precursor [Glycine max]
 gb|ACU13345.1| unknown [Glycine max]
Length=182

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G   SD ++D++ C D+LI L+ C+ +V G+AK PT  CC  ++  L +++ CLC+L+KD
Sbjct  18   GFAKSDLSKDREGCADKLIDLASCVPYVGGEAKTPTIDCCTGLKAVLDRSKKCLCILIKD  77

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            R++P LG+KIN TLA+ LPS C +P N+++C+ LLHL PNSPDAK+
Sbjct  78   RDDPNLGIKINATLAIQLPSACHSPANITQCVDLLHLAPNSPDAKV  123



>gb|KHG28399.1| hypothetical protein F383_02239 [Gossypium arboreum]
Length=181

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             L+  + G  SSD  QDK  C++ L+GL+PCL+FV G+AK PT  CC  +++ L K++ C
Sbjct  10   LLITALFGLASSDVNQDKAECKNHLMGLAPCLSFVDGEAKTPTVDCCGGLKQVLGKSKKC  69

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LCV+++D+++   GLKIN TLA +LP  CRA  N+++C++LLHL PNS +AK+
Sbjct  70   LCVVIRDKDDSSAGLKINATLAAALPYACRAKVNMTDCISLLHLAPNSQEAKL  122



>ref|XP_006439006.1| hypothetical protein CICLE_v10033694mg [Citrus clementina]
 gb|ESR52246.1| hypothetical protein CICLE_v10033694mg [Citrus clementina]
Length=205

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            + ++  L+ +   G  +D A+DK+ C +QL+GLS CL +V GDAK PT  CC  +++ LK
Sbjct  11   IMLVIVLMMISSSGTMADKAKDKEECTNQLVGLSTCLPYVGGDAKAPTPDCCSGLKQVLK  70

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              + CLCV+++D N+P LGL IN TL L LPS+C A  NVS+C  LLHL PNSP+A++
Sbjct  71   NDKKCLCVIIRDMNDPELGLNINVTLTLGLPSVCHATANVSQCPALLHLDPNSPEAQV  128



>ref|XP_004294978.1| PREDICTED: uncharacterized protein LOC101298982 [Fragaria vesca 
subsp. vesca]
Length=198

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 84/123 (68%), Gaps = 4/123 (3%)
 Frame = -3

Query  649  SLKILC-FLLCLMVGGV-SSDFAQDKKRCQDQLIGLSPCLTFVSGD--AKFPTTACCDEI  482
            S+ I C F++ +M+ G  SSD  QD+ +C DQLIGL+PCL++V GD  AK PT  CC  +
Sbjct  9    SVGISCIFVVVMMLAGFGSSDIDQDRAQCADQLIGLAPCLSYVGGDKDAKTPTIDCCTGL  68

Query  481  RKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPD  302
            ++   K+  CLCVL+KD ++P LGL IN TLAL+LP  C  P N++ C+ LLHL P S D
Sbjct  69   KQVDAKSHKCLCVLIKDHDDPKLGLTINATLALNLPGACHVPVNITSCVDLLHLDPKSAD  128

Query  301  AKI  293
             K+
Sbjct  129  GKM  131



>ref|XP_004504341.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Cicer arietinum]
Length=194

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
              L LM G   SD  QDK  C D+L+ L+ CL FV+G AK P   CC  ++  +  ++ C
Sbjct  18   IFLVLMFGLAYSDVNQDKAECTDKLLILANCLPFVTGQAKSPNIDCCTGVKDVINNSKRC  77

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LC+L+KD ++P LGLKIN TLAL LP+ C+ PTN+++C+ +LHLPP SP+AKI
Sbjct  78   LCILIKDHDDPNLGLKINVTLALQLPNDCKTPTNITKCVGILHLPPKSPEAKI  130



>ref|XP_008378010.1| PREDICTED: protein YLS3-like [Malus domestica]
Length=198

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFA-----QDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKD  473
            L  +L +M+   ++ FA     +D++ C  QL+G++ CL +V G AK PT  CC  +++ 
Sbjct  8    LVLVLLVMISSYTASFATADSAKDREECTQQLVGMATCLPYVGGQAKAPTPDCCSGLKQV  67

Query  472  LKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            L   + CLCV++KDRN+P LGL+IN TLAL LPS+C+AP NVS+C  LLHL P SP+A++
Sbjct  68   LNNNKKCLCVIIKDRNDPELGLQINVTLALGLPSVCKAPANVSKCPELLHLDPKSPEAQV  127



>ref|XP_009354800.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=149

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 83/120 (69%), Gaps = 5/120 (4%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFA-----QDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKD  473
            L  +L +M+   ++ FA     +D++ C  QL+G++ CL +V G AK PT  CC  +++ 
Sbjct  8    LVLVLLVMISSYTASFATADSAKDREECTQQLVGMATCLPYVGGQAKAPTPDCCSGLKQV  67

Query  472  LKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            L   + CLCV++KDRN+P LGL++N TLAL LPS+C+AP NVS+C  LLHL P SP+A++
Sbjct  68   LNNNKKCLCVIIKDRNDPELGLQMNVTLALGLPSVCKAPANVSKCPELLHLDPKSPEAQV  127



>ref|XP_007052623.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96780.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=177

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = -3

Query  616  MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLV  437
            MV    +D  QDK+ C  QL+ L+ CL +V GDAK PT  CC  +++ L   + CLCV++
Sbjct  1    MVSSAMADSDQDKEECTQQLVALATCLPYVGGDAKAPTPDCCSGLKQVLNNNKKCLCVII  60

Query  436  KDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            KDRN+P LGL IN TLAL+LPS+C AP NVS+C  LLH+ PNS +A++
Sbjct  61   KDRNDPDLGLNINVTLALALPSVCNAPANVSKCPELLHMDPNSREAQV  108



>gb|EEE66751.1| hypothetical protein OsJ_23458 [Oryza sativa Japonica Group]
Length=198

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 4/115 (3%)
 Frame = -3

Query  625  LCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFV----SGDAKFPTTACCDEIRKDLKKTR  458
            + + +  V  DFA D+  C D+L+ LS CLTFV    SG A  PT  CC  ++  L  +R
Sbjct  1    MAMAMSAVRGDFAADRAECADKLMALSTCLTFVQDGASGGAAAPTPDCCSGLKAVLAASR  60

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLCVL+KDR++P LGLKIN T ALSLP LC AP N+S+C  LL+LPPNS DA+I
Sbjct  61   KCLCVLIKDRDDPNLGLKINVTKALSLPQLCNAPANISDCPRLLNLPPNSKDAQI  115



>gb|AFK48341.1| unknown [Lotus japonicus]
Length=149

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            VG  SSD A D + C D+L+GL+ C  +V GDAK P+  CC  ++  L++++ CLC+L+K
Sbjct  16   VGFGSSDLAADIQDCGDKLVGLAGCRPYVGGDAKVPSIDCCSGLKVVLEQSKKCLCILIK  75

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR++P LG K+N TLA+ LPS C AP N+++C+ LLHL P SP+AK+
Sbjct  76   DRDDPDLGFKMNATLAVHLPSACHAPANITQCVDLLHLSPKSPEAKV  122



>ref|XP_010673513.1| PREDICTED: protein YLS3 [Beta vulgaris subsp. vulgaris]
Length=189

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            +  L  L+ ++V   S D  +DK+ C +QL+GL+ CL +V G AK PT  CC  +++ +K
Sbjct  8    VSFLSILILVLVTLCSCDINKDKEECANQLVGLATCLPYVGGQAKAPTQDCCTGLKQVIK  67

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPT--NVSECLTLLHLPPNSPDAKI  293
             ++ C+C+L+KDR++P LGLKIN TL L+LP  C  P   NV +C  LLHLPPNSPDAK+
Sbjct  68   ASKKCVCILIKDRDDPSLGLKINATLGLTLPQACHLPASDNVDQCPALLHLPPNSPDAKM  127



>ref|XP_008775497.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=195

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
             SSDFA D+  C +QL GL+ CLT+V   A  PT  CC  +++ L   R CLCVL+KDR+
Sbjct  28   ASSDFASDRAECANQLTGLATCLTYVENRALTPTPDCCSGLKQVLATNRKCLCVLIKDRD  87

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            EPGLG+K+N T A++LPS+CRA +N+SEC  LL+LPP S +A+I
Sbjct  88   EPGLGIKLNVTTAMALPSVCRASSNISECPKLLNLPPGSAEAQI  131



>gb|AFK37798.1| unknown [Lotus japonicus]
Length=186

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
            VG  SSD A D + C D+L+GL+ C  +V GDAK P+  CC  ++  L++++ CLC+L+K
Sbjct  16   VGFGSSDLAADIQDCGDKLVGLAGCRPYVGGDAKVPSIDCCSGLKVVLEQSKKCLCILIK  75

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            DR++P LG K+N TLA+ LPS C AP N+++C+ LLHL P SP+AK+
Sbjct  76   DRDDPDLGFKMNATLAVHLPSACHAPANITQCVDLLHLSPKSPEAKV  122



>ref|XP_002881958.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58217.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            I+  ++  MV     D A+DK+ C +QL+G++ CL +V G AK PT  CC  +++ L   
Sbjct  13   IVLIMVVAMVVDAGDDKAKDKEECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSN  72

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            + CLCV+++DRN+P LGL+IN +LAL+LPS+C A  +V++C  LLHL PNSPDA++
Sbjct  73   KKCLCVIIQDRNDPDLGLQINVSLALALPSVCHATADVTKCPALLHLDPNSPDAQV  128



>gb|KDO35899.1| hypothetical protein CISIN_1g039949mg, partial [Citrus sinensis]
Length=147

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 73/116 (63%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +    +    G VSSDF Q +K C DQL   S CL FV G AK PT  CC  I K+  KT
Sbjct  15   LFTVFIVTSAGFVSSDFNQGRKECGDQLADFSACLPFVGGKAKSPTPTCCSNITKEGSKT  74

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            R CLC+LVKDRN+P  G K+N TLALSLPS+  AP  VS+C  LL+ P N  DA++
Sbjct  75   RKCLCLLVKDRNDPRHGFKMNATLALSLPSVRHAPAKVSDCPALLNPPSNPTDAQV  130



>gb|KEH35234.1| Lipid transfer protein [Medicago truncatula]
Length=143

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVK  434
             G VSSD  +D+K C D+L+ L+ CL +V G A  PT  CC  +++ L  T+ C+C+L+K
Sbjct  17   AGFVSSDLTEDRKDCADKLVTLASCLPYVGGSANTPTIDCCTNLKQVLNNTKKCICILIK  76

Query  433  DRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            D N+P LG  +N TLA+ LP+ C  P+N+SEC+ LLHL P SP+AK+
Sbjct  77   DSNDPKLGFPMNATLAVQLPNACHIPSNISECVDLLHLSPKSPEAKV  123



>gb|EEC74584.1| hypothetical protein OsI_10163 [Oryza sativa Indica Group]
Length=177

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            D + D+  C DQL+GL+PCL +V G+AK P   CC  +R+ L K+  CLCVLVKD+++P 
Sbjct  10   DMSADRTECADQLVGLAPCLQYVQGEAKAPAPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  69

Query  415  LGLKINGTLALSLPSLCRAP-TNVSECLTLLHLPPNSPDAKI  293
            LG+KIN TLAL+LPS C A   NVS C  LLH+PPNS DA I
Sbjct  70   LGIKINATLALALPSACGATHANVSHCPQLLHIPPNSKDAAI  111



>ref|XP_009138957.1| PREDICTED: protein YLS3 [Brassica rapa]
Length=173

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 99/165 (60%), Gaps = 5/165 (3%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            LC  L +M  GV SD  QD K CQD +  L  CL FV+  AK P + CC  +++ L K  
Sbjct  12   LCITLTIMFLGVRSDLNQDIKGCQDSMSDLYSCLHFVTNKAKAPDSTCCTTLKEKLDKGQ  71

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfee  284
            T+ CLC LVKDR++PGLG K++   A+SLPS C  P N+++C  LLHLPP+S  AKIF++
Sbjct  72   TKRCLCTLVKDRDDPGLGFKVDANRAMSLPSACHVPANITQCPELLHLPPDSAAAKIFKQ  131

Query  283  fssssvsgnntstGDLNASSSTALFRKRWIDLLQAHAGFSLLLLI  149
            F+ SS          ++ SSS     K+   L+ A A FS+  L+
Sbjct  132  FTESSSQNVGHKA--VSTSSSVKGRDKKQFGLMMAGA-FSVWYLM  173



>ref|XP_008231394.1| PREDICTED: protein YLS3-like isoform X1 [Prunus mume]
Length=191

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G  ++D A+D+  C  QL+G++ CL +V G AK PT  CC  +++ L   + CLCV++KD
Sbjct  21   GMAAADSAKDRDECTQQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIKD  80

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            RN+P LGL+IN TLAL LPS+C+ P NVS+C  LLHL P SP+A++
Sbjct  81   RNDPELGLQINVTLALGLPSVCQVPANVSKCPELLHLDPKSPEAQV  126



>ref|XP_010934234.1| PREDICTED: protein YLS3-like isoform X1 [Elaeis guineensis]
Length=183

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = -3

Query  658  PMGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIR  479
            P  S+ I+   + L+    SSD+A D+  C DQ+I LS CLT++ G A+ PT  CC  ++
Sbjct  10   PQSSVLIVLLAMSLITF-ASSDYASDRAECADQVIKLSTCLTYMQGSARAPTPDCCSSLK  68

Query  478  KDLKKTRLCLCVLVKDRNEPGLG-LKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPD  302
            + + K+  CLC+LVKDRNEP L   K+N T AL LPS C  P N S C  LL+LPPNSPD
Sbjct  69   QVVDKSFKCLCILVKDRNEPELASFKVNVTFALRLPSKCGVPANASACPRLLNLPPNSPD  128

Query  301  AKI  293
            AKI
Sbjct  129  AKI  131



>ref|XP_008231395.1| PREDICTED: protein YLS3-like isoform X2 [Prunus mume]
Length=190

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G  ++D A+D+  C  QL+G++ CL +V G AK PT  CC  +++ L   + CLCV++KD
Sbjct  21   GMAAADSAKDRDECTQQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIKD  80

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            RN+P LGL+IN TLAL LPS+C+ P NVS+C  LLHL P SP+A++
Sbjct  81   RNDPELGLQINVTLALGLPSVCQVPANVSKCPELLHLDPKSPEAQV  126



>ref|XP_010506351.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=201

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTR  458
            +  ++  MV     D A+DK  C +QL+G++ CL +V G AK PT  CC  +++ L   +
Sbjct  13   IALIMLAMVVAAGDDKAKDKDECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNK  72

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLCV+++DRN+P LGL++N +LAL+LPS+C A  ++++C  LLHL PNSPDA++
Sbjct  73   KCLCVIIQDRNDPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQV  127



>ref|XP_010516504.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=178

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 78/117 (67%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            LC  + +M  GV SD  QD K CQD +  L  CL +VS  AK P + CC +++ ++ K  
Sbjct  16   LCITVAVMFLGVRSDLNQDIKGCQDAMSDLYSCLPYVSNKAKAPDSTCCSKLKVNIDKGQ  75

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            T+ CLC LVKDR++PGLG K++   A+SLPS C  P N+S+C  LLHLP NSPD++I
Sbjct  76   TKRCLCTLVKDRDDPGLGFKVDANRAMSLPSACHVPANISKCPELLHLPLNSPDSQI  132



>gb|ABF94168.1| Protease inhibitor/seed storage/LTP family protein, expressed 
[Oryza sativa Japonica Group]
Length=187

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            D + D+  C DQL+GL+PCL +V G+AK P   CC  +R+ L K+  CLCVLVKD+++P 
Sbjct  20   DMSADRTECADQLVGLAPCLQYVQGEAKAPAPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  79

Query  415  LGLKINGTLALSLPSLCRAP-TNVSECLTLLHLPPNSPDAKI  293
            LG+KIN TLAL+LPS C A   NVS C  LLH+PPNS DA I
Sbjct  80   LGIKINATLALALPSACGATHANVSHCPQLLHIPPNSKDAAI  121



>ref|XP_010518028.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=201

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTR  458
            +  ++  MV     D A+DK  C +QL+G++ CL +V G AK PT  CC  +++ L   +
Sbjct  13   IALIMLAMVVAAGDDKAKDKDECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNK  72

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLCV+++DRN+P LGL++N +LAL+LPS+C A  ++++C  LLHL PNSPDA++
Sbjct  73   KCLCVIIQDRNDPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQV  127



>ref|XP_003601632.1| Non-specific lipid-transfer protein-like protein [Medicago truncatula]
Length=186

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G VSSD  +D+K C D+L+ L+ CL +V G A  PT  CC  +++ L  T+ C+C+L+KD
Sbjct  18   GFVSSDLTEDRKDCADKLVTLASCLPYVGGSANTPTIDCCTNLKQVLNNTKKCICILIKD  77

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             N+P LG  +N TLA+ LP+ C  P+N+SEC+ LLHL P SP+AK+
Sbjct  78   SNDPKLGFPMNATLAVQLPNACHIPSNISECVDLLHLSPKSPEAKV  123



>ref|XP_006295014.1| hypothetical protein CARUB_v10024085mg [Capsella rubella]
 gb|EOA27912.1| hypothetical protein CARUB_v10024085mg [Capsella rubella]
Length=201

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTR  458
            +  ++  MV     D A+DK+ C +QL+G++ CL +V G AK PT  CC  +++ L   +
Sbjct  13   IALVMFAMVVAAGDDKAKDKEECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNK  72

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLCV+++DRN+P LGL++N +LAL+LPS+C A  ++++C  LLHL PNSPDA++
Sbjct  73   KCLCVIIQDRNDPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQV  127



>ref|XP_010098644.1| putative GPI-anchored protein [Morus notabilis]
 gb|EXB75445.1| putative GPI-anchored protein [Morus notabilis]
Length=177

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = -3

Query  601  SSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
            + D A+D++ C +QL+GL+ CL +V G AK PT  CC  +++ LK  + CLCV+++DRN+
Sbjct  7    TEDPAKDREECTEQLVGLATCLPYVGGQAKAPTPDCCSGLKQVLKDNKKCLCVVIRDRND  66

Query  421  PGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            P LGL+IN TLALSLPS+C AP NVS+C  LL + P+SP+A++
Sbjct  67   PDLGLQINVTLALSLPSVCNAPANVSKCPELLKMDPHSPEAQV  109



>gb|EEC81687.1| hypothetical protein OsI_25271 [Oryza sativa Indica Group]
Length=198

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 4/115 (3%)
 Frame = -3

Query  625  LCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFV----SGDAKFPTTACCDEIRKDLKKTR  458
            + + +  V  DFA D+  C D+L+ LS CLTFV    SG A  PT  CC  ++  L  +R
Sbjct  1    MAMAMSAVRGDFAADRAECADKLMALSTCLTFVQDGASGGAAAPTPDCCSGLKAVLAASR  60

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLCVL+KDR++P L LKIN T ALSLP LC AP N+S+C  LL+LPPNS DA+I
Sbjct  61   KCLCVLIKDRDDPNLDLKINVTKALSLPQLCNAPANISDCPRLLNLPPNSKDAQI  115



>ref|XP_011088858.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=202

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            S  +L  L+ +     +SD ++D++ C + L+GL+ CL +V G AK PT  CC  +++ L
Sbjct  10   SPPLLLVLILMFSALATSDTSKDREECAESLVGLATCLPYVGGTAKAPTPDCCTALKQLL  69

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
               + CLCV++KDRN+P LGL IN TLAL LP +C AP NVS+C  LL LPP+SP+A+I
Sbjct  70   NTKKKCLCVIIKDRNDPDLGLNINVTLALGLPQVCNAPANVSQCPALLKLPPDSPEAQI  128



>ref|XP_003561314.1| PREDICTED: protein YLS3-like isoform X2 [Brachypodium distachyon]
Length=196

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            DFA D+  C D+L+ L+ CLTFV G A  PT  CC  ++  L+ +R CLCVLVKDR++PG
Sbjct  25   DFAADRAECSDKLVALATCLTFVQGQAPAPTPDCCAGLKTVLQSSRKCLCVLVKDRDDPG  84

Query  415  LGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LGLKIN T AL LP+ C A  N+S+C  LL+LPPNS DA++
Sbjct  85   LGLKINVTRALGLPAACSAAANISDCPRLLNLPPNSKDAQV  125



>gb|KDP20375.1| hypothetical protein JCGZ_05258 [Jatropha curcas]
Length=196

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -3

Query  586  QDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPGLGL  407
            +D++ C +QL+GL+ CL +V   +K PT  CC+ +++ L+  + CLCV++KDRN+P LGL
Sbjct  28   KDREECAEQLVGLATCLPYVGATSKSPTPDCCNGLKQVLRDNKKCLCVIIKDRNDPDLGL  87

Query  406  KINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            KIN TLAL LPS+C A  NVS+C  LLHL PNSPDA++
Sbjct  88   KINVTLALGLPSVCHATANVSQCPALLHLAPNSPDAQV  125



>ref|XP_009409233.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=196

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTR  458
            L FL   ++G V SDFA D+  C  QLIGL+ CLT++ G AK PT  CC   ++ + K+ 
Sbjct  12   LVFLGLSLLGSVRSDFASDRAECAGQLIGLATCLTYIGGSAKAPTVDCCSGFKQVVTKSL  71

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLCVL+++R+ P LG KIN T AL LPS C  P  V+EC  LL+LP NS +AK+
Sbjct  72   KCLCVLIRNRDNPNLGFKINVTRALLLPSKCDTPAQVTECPRLLNLPQNSAEAKV  126



>gb|EEE58386.1| hypothetical protein OsJ_09548 [Oryza sativa Japonica Group]
Length=177

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            D + D+  C DQL+GL+PCL +V G+AK P   CC  +R+ L K+  CLCVLVKD+++P 
Sbjct  10   DMSADRTECADQLVGLAPCLQYVQGEAKAPAPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  69

Query  415  LGLKINGTLALSLPSLCRAP-TNVSECLTLLHLPPNSPDAKI  293
            LG+KIN TLAL+LP  C A   NVS C  LLH+PPNS DA I
Sbjct  70   LGIKINATLALALPCACGATHANVSHCPQLLHIPPNSKDAAI  111



>ref|XP_002459511.1| hypothetical protein SORBIDRAFT_02g005900 [Sorghum bicolor]
 gb|EER96032.1| hypothetical protein SORBIDRAFT_02g005900 [Sorghum bicolor]
Length=210

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 80/125 (64%), Gaps = 7/125 (6%)
 Frame = -3

Query  646  LKILCFLLCLMV-----GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDA--KFPTTACCD  488
            L +      LMV      GV  DFA D+  C D+L+GL+ CLT+V  DA    PT  CC 
Sbjct  8    LAVSAMAAALMVVLSAPAGVGGDFAADRAECSDKLVGLATCLTYVQEDATAAAPTPDCCA  67

Query  487  EIRKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNS  308
             +   L+ +R CLCVLVKDR++P LGLKIN T AL LP++C AP N+S+C  LL+LPP S
Sbjct  68   GLETVLQSSRKCLCVLVKDRDDPNLGLKINVTKALRLPAVCNAPANISDCPRLLNLPPGS  127

Query  307  PDAKI  293
             DA++
Sbjct  128  KDAQV  132



>ref|XP_010228246.1| PREDICTED: protein YLS3-like isoform X1 [Brachypodium distachyon]
Length=199

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            DFA D+  C D+L+ L+ CLTFV G A  PT  CC  ++  L+ +R CLCVLVKDR++PG
Sbjct  25   DFAADRAECSDKLVALATCLTFVQGQAPAPTPDCCAGLKTVLQSSRKCLCVLVKDRDDPG  84

Query  415  LGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LGLKIN T AL LP+ C A  N+S+C  LL+LPPNS DA++
Sbjct  85   LGLKINVTRALGLPAACSAAANISDCPRLLNLPPNSKDAQV  125



>gb|AFK48853.1| unknown [Medicago truncatula]
Length=186

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G V SD  +D+K C D+L+ L+ CL +V G A  PT  CC  +++ L  T+ C+C+L+KD
Sbjct  18   GFVGSDLTEDRKDCADKLVTLASCLPYVGGSANTPTIDCCTNLKQVLNNTKKCICILIKD  77

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             N+P LG  +N TLA+ LP+ C  P+N+SEC+ LLHL P SP+AK+
Sbjct  78   SNDPKLGFPMNATLAVQLPNACHIPSNISECVDLLHLSPKSPEAKV  123



>dbj|BAG92716.1| unnamed protein product [Oryza sativa Japonica Group]
Length=208

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = -3

Query  598  SDFAQDKKRCQDQLIGLSPCLTFV----SGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
             DFA D+  C D+L+ LS CLTFV    SG A  PT  CC  ++  L  +R CLCVL+KD
Sbjct  28   GDFAADRAECADKLMALSTCLTFVQDGASGGAAAPTPDCCSGLKAVLAASRKCLCVLIKD  87

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            R++P LGLKIN T ALSLP LC AP N+S+C  LL+LPPNS DA+I
Sbjct  88   RDDPNLGLKINVTKALSLPQLCNAPANISDCPRLLNLPPNSKDAQI  133



>ref|XP_008802527.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
 ref|XP_008802528.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=187

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = -3

Query  616  MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLV  437
            ++G  SSD+A D+  C D+++ LS CLT++ G A+ PT  CC  +++ ++K+  C+CVLV
Sbjct  23   LIGFASSDYASDRAECADKVMALSTCLTYMQGSARAPTPDCCSSVKQVVEKSFKCVCVLV  82

Query  436  KDRNEPGLG-LKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            KDRNEP L   K+N TLAL LPS C  P N S+C  LL+LP NS DAK+
Sbjct  83   KDRNEPELASFKVNVTLALGLPSRCHVPANASDCPRLLNLPLNSTDAKV  131



>ref|NP_001059125.1| Os07g0198300 [Oryza sativa Japonica Group]
 dbj|BAC84186.1| lipid transfer protein-like [Oryza sativa Japonica Group]
 dbj|BAF21039.1| Os07g0198300 [Oryza sativa Japonica Group]
 dbj|BAG87637.1| unnamed protein product [Oryza sativa Japonica Group]
Length=207

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = -3

Query  598  SDFAQDKKRCQDQLIGLSPCLTFV----SGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
             DFA D+  C D+L+ LS CLTFV    SG A  PT  CC  ++  L  +R CLCVL+KD
Sbjct  28   GDFAADRAECADKLMALSTCLTFVQDGASGGAAAPTPDCCSGLKAVLAASRKCLCVLIKD  87

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            R++P LGLKIN T ALSLP LC AP N+S+C  LL+LPPNS DA+I
Sbjct  88   RDDPNLGLKINVTKALSLPQLCNAPANISDCPRLLNLPPNSKDAQI  133



>ref|XP_010504811.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=179

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            LC  + +M  GV SD  QD K CQD +  L  CL +VS  AK P + CC +++ ++ K  
Sbjct  16   LCITVAVMFLGVRSDLNQDIKGCQDAMSDLYSCLPYVSNKAKAPDSTCCSKLKVNIDKGQ  75

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            T+ CLC LVKDR++PGLG K++   A+SLPS C  P N+S+C  LLHLP NSP ++I
Sbjct  76   TKRCLCTLVKDRDDPGLGFKVDANRAMSLPSACHVPANISKCPELLHLPLNSPASQI  132



>ref|XP_003629697.1| Non-specific lipid-transfer protein-like protein [Medicago truncatula]
 gb|AET04173.1| protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
 gb|AFK34908.1| unknown [Medicago truncatula]
Length=194

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
              L LM G V+SD  QDK  C ++L+ L+ CL FV+  AK PT  CC  +++ + K++ C
Sbjct  16   IFLVLMFGLVTSDINQDKAECTNKLLTLAGCLPFVTNQAKSPTIDCCTGVKEVVDKSKRC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LC+L+KD ++P LGL IN TLAL LP+ C +PTN+++C+ +LHL P S +AK+
Sbjct  76   LCILIKDHDDPNLGLTINVTLALKLPNDCNSPTNITQCIDILHLKPKSHEAKV  128



>ref|XP_010508309.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=204

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTR  458
            +  ++   V     D A+DK  C +QL+G++ CL +V G AK PT  CC  +++ L   +
Sbjct  13   IALIMLATVVAAGDDKAKDKDECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNK  72

Query  457  LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             CLCV+++DRN+P LGL++N +LAL+LPS+C A  ++++C  LLHL PNSPDA++
Sbjct  73   KCLCVIIQDRNDPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQV  127



>ref|XP_003558736.1| PREDICTED: protein YLS3-like [Brachypodium distachyon]
Length=193

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +L  +L   V  V +D + D+  C +QL+GL+PCL +V G A+ P   CC  +R+ L K+
Sbjct  8    VLLVMLLAAVVCVRADMSADRSECAEQLVGLAPCLQYVQGQARSPAPDCCGGLRQVLGKS  67

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRA-PTNVSECLTLLHLPPNSPDAKI  293
              CLCVLVKD+++P LG+ IN +LAL+LPS C A   NVS C  LLHLPPNS DA I
Sbjct  68   PKCLCVLVKDKDDPNLGININASLALALPSACGATKANVSHCPELLHLPPNSKDAAI  124



>emb|CDY02452.1| BnaA08g00590D [Brassica napus]
Length=196

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            SL I   +  ++ G  SSD  QD++ C DQLI LSPCL +V G+AK PT  CC    + +
Sbjct  7    SLIITIVITSMLAGFGSSDLDQDREECTDQLIALSPCLPYVGGNAKAPTKDCCGGFDQVI  66

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
             K+  C+C+LVKD+++P LGLK N TLA  +P+LC   AP N+++C++LLHL PNS  AK
Sbjct  67   TKSEKCVCILVKDKDDPNLGLKFNATLAAHIPTLCHITAP-NITKCISLLHLSPNSTLAK  125



>ref|XP_004158216.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized GPI-anchored 
protein At1g27950-like [Cucumis sativus]
Length=186

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = -3

Query  625  LCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLC  446
            + ++V  V  D  +D++ C  QL G++ CL +VSGDAK PT  CC  +++ LK  + CLC
Sbjct  11   VTVVVRFVGGDDKKDREECTPQLAGMATCLPYVSGDAKAPTPDCCSGLKEVLKNDKKCLC  70

Query  445  VLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            V+V+DRN+P LGL+IN TLALSLP +C A  NVS C  LL++P NS DA++
Sbjct  71   VIVRDRNDPDLGLQINVTLALSLPDICHATANVSNCPALLNMPSNSSDAQV  121



>ref|XP_006402776.1| hypothetical protein EUTSA_v10006273mg [Eutrema salsugineum]
 gb|ESQ44229.1| hypothetical protein EUTSA_v10006273mg [Eutrema salsugineum]
Length=172

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            LC  + +M  GV S+  QD K CQD L  L  CL FV+  AK P + CC  +++ L K  
Sbjct  12   LCITVAIMFLGVRSELNQDIKGCQDSLSDLYSCLPFVTSKAKAPDSTCCTTLKEILDKGQ  71

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            T+ CLC LVKDR++PGLG K+    A+SLPS C  PTN+S+C  LLHLPP+S  A+I
Sbjct  72   TKRCLCTLVKDRDDPGLGFKVEANRAMSLPSTCHVPTNISQCPELLHLPPDSLAAQI  128



>ref|XP_009106891.1| PREDICTED: protein YLS3-like [Brassica rapa]
Length=197

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 80/117 (68%), Gaps = 3/117 (3%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            I   +  ++VG  SSD  QD++ C DQLI LSPCL +V G+AK PT  CC    + + K+
Sbjct  11   ITIVITSMLVGFGSSDLDQDREECTDQLIALSPCLPYVGGNAKAPTKDCCGGFDQVITKS  70

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
              C+C+LVKD+++P LGLK N TLA  +P+LC   AP N+++C++LLHL PNS  AK
Sbjct  71   EKCVCILVKDKDDPNLGLKFNATLAAHIPTLCHITAP-NITKCISLLHLSPNSTLAK  126



>ref|XP_006402775.1| hypothetical protein EUTSA_v10006273mg [Eutrema salsugineum]
 gb|ESQ44228.1| hypothetical protein EUTSA_v10006273mg [Eutrema salsugineum]
Length=171

 Score =   115 bits (288),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            LC  + +M  GV S+  QD K CQD L  L  CL FV+  AK P + CC  +++ L K  
Sbjct  12   LCITVAIMFLGVRSELNQDIKGCQDSLSDLYSCLPFVTSKAKAPDSTCCTTLKEILDKGQ  71

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            T+ CLC LVKDR++PGLG K+    A+SLPS C  PTN+S+C  LLHLPP+S  A+I
Sbjct  72   TKRCLCTLVKDRDDPGLGFKVEANRAMSLPSTCHVPTNISQCPELLHLPPDSLAAQI  128



>ref|XP_003549048.1| PREDICTED: protein YLS3-like [Glycine max]
Length=191

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -3

Query  643  KILCFLLCL-MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
             +L F + L +V     D AQDK+RC + L G++ CL ++ GD K PT  CC  + + +K
Sbjct  9    HLLVFAITLVLVSHAMGDSAQDKQRCAESLTGVTTCLPYLGGDTKSPTADCCSGLTQAMK  68

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
              + C+CV++KDR++P LGLKIN T+A  LPSLC+ P N S+C  LLHL P SP+A+
Sbjct  69   TNKKCVCVILKDRDDPDLGLKINMTIAAGLPSLCKTPDNFSQCSALLHLDPKSPEAQ  125



>ref|XP_010554897.1| PREDICTED: protein YLS3 [Tarenaya hassleriana]
Length=178

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 97/163 (60%), Gaps = 11/163 (7%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--TRLCLCVLV  437
             GV SD  QD K C+D +  LS CL FV+ +AK P   CC  ++K++ K  T+ CLC LV
Sbjct  19   AGVRSDLTQDIKGCEDAMSDLSSCLPFVTREAKAPDPTCCSSLKKEIDKGQTKRCLCTLV  78

Query  436  KDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefssssvsgn  257
            KDR++P LG K++  LA+SLPS+C  P NVS+C  LLHLP +S DA+IF++FS SS +  
Sbjct  79   KDRDDPSLGFKVDANLAMSLPSICHVPANVSQCPELLHLPLDSADARIFKQFSGSSQNNG  138

Query  256  ntstGDLNASSSTALFRKR----WIDLLQAHAGFSLLLLIVTF  140
                     ++S+++ RKR    W  +       S   LI T 
Sbjct  139  MG-----GVAASSSVKRKRPVAVWFRVGMVGGALSTWYLISTL  176



>ref|NP_191414.1| protease inhibitor/(LTP) family protein [Arabidopsis thaliana]
 emb|CAB68193.1| putative protein [Arabidopsis thaliana]
 dbj|BAC43656.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|AAO39966.1| At3g58550 [Arabidopsis thaliana]
 gb|AEE79798.1| protease inhibitor/(LTP) family protein [Arabidopsis thaliana]
Length=177

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCD--EIRKDLKK  464
            LC  + +M  GV S+ +QD K CQD +  L  CL FV+  AK P + CC   +++ D  +
Sbjct  16   LCITVAVMFLGVRSELSQDIKGCQDAMSDLYSCLPFVTNKAKAPDSTCCSTLKVKIDKGQ  75

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            TR CLC LVKDR++PGLG K++   A+SLPS C  P N+S+C  LLHL P+SP ++I
Sbjct  76   TRKCLCTLVKDRDDPGLGFKVDANRAMSLPSACHVPANISQCPDLLHLLPDSPASQI  132



>ref|XP_002878226.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54485.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=177

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            LC  + +M  GV S+ +QD K CQ+ +  L  CL FVS  AK P + CC  ++  + K  
Sbjct  16   LCITVAVMFLGVRSELSQDIKGCQEAMSDLYSCLPFVSNKAKAPDSTCCSTLKAKIDKGQ  75

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            T+ CLC LVKDR++PGLG K++G  A+SLPS C  P N+S+C  LLHL P+SP ++I
Sbjct  76   TKKCLCTLVKDRDDPGLGFKVDGNRAMSLPSACHVPANISQCPDLLHLLPDSPASQI  132



>gb|AAM63806.1| unknown [Arabidopsis thaliana]
Length=165

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCD--EIRKDLKK  464
            LC  + +M  GV S+ +QD K CQD +  L  CL FV+  AK P + CC   +++ D  +
Sbjct  4    LCITVAVMFLGVRSELSQDIKGCQDAMSDLYSCLPFVTNKAKAPDSTCCSTLKVKIDKGQ  63

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            TR CLC LVKDR++PGLG K++   A+SLPS C  P N+S+C  LLHL P+SP ++I
Sbjct  64   TRKCLCTLVKDRDDPGLGFKVDANRAMSLPSACHVPANISQCPDLLHLLPDSPASQI  120



>ref|XP_007219100.1| hypothetical protein PRUPE_ppa015466mg, partial [Prunus persica]
 gb|EMJ20299.1| hypothetical protein PRUPE_ppa015466mg, partial [Prunus persica]
Length=147

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G  ++D A+D+  C  QL G++ CL +V G AK PT  CC  +++ L   + CLCV+++D
Sbjct  21   GMAAADSAKDRDECTQQLAGMATCLPYVQGQAKTPTPDCCSGLKQVLNSNKKCLCVIIQD  80

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            RN+P L L+IN TLAL LPS+C+ P NVS+C  LLHL P SP+A++
Sbjct  81   RNDPELDLQINVTLALGLPSVCQVPANVSKCPELLHLDPKSPEAQV  126



>ref|NP_181959.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AAC16080.1| unknown protein [Arabidopsis thaliana]
 gb|AAP12845.1| At2g44300 [Arabidopsis thaliana]
 dbj|BAE73266.1| xylogen like protein 10 [Arabidopsis thaliana]
 gb|AEC10405.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=204

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            D  +DK+ C +QL+G++ CL +V G AK PT  CC  +++ L   + CLCV+++DRN+P 
Sbjct  27   DKTKDKEECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSNKKCLCVIIQDRNDPD  86

Query  415  LGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LGL+IN +LAL+LPS+C A  +V++C  LLHL PNSPDA++
Sbjct  87   LGLQINVSLALALPSVCHAAADVTKCPALLHLDPNSPDAQV  127



>gb|ACR37836.1| unknown [Zea mays]
 tpg|DAA43565.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=192

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = -3

Query  601  SSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
              D + DK  C DQL+GL+PCL +V G A+ P   CC  +R+ L K+  CLCVLVKD+++
Sbjct  23   GGDMSADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDD  82

Query  421  PGLGLKINGTLALSLPSLCRAP-TNVSECLTLLHLPPNSPDAKI  293
            P LG+KIN TLAL+LP+ C A   NVS C  LLH+PP S DA +
Sbjct  83   PNLGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAV  126



>ref|XP_010427760.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=180

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            LC  + +M  GV SD  QD K CQD +  L  CL +VS  AK P + CC +++ ++ K  
Sbjct  16   LCITVAVMFLGVRSDLNQDIKGCQDAMSDLYSCLPYVSNKAKAPDSTCCSKLKVNIDKGQ  75

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            T+ CLC LVKDR++PGLG K++   A+SLPS C  P N+S+C  LLHLP +SP ++I
Sbjct  76   TKRCLCTLVKDRDDPGLGFKVDANRAMSLPSACHVPANISKCPELLHLPLDSPASQI  132



>ref|XP_004502215.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Cicer arietinum]
Length=184

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G V+SD  +D++ C D+L+ L+ CL +V GDA  P   CC  ++  L KT+ C+C+L+KD
Sbjct  21   GFVNSDLTKDREECADKLVTLASCLPYVGGDANTPAIDCCTALKLVLDKTKKCICILIKD  80

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            RN+P LG  +N TLA+ LP+ C  P+N+S+C+ LLHL P S +AK+
Sbjct  81   RNDPKLGFTLNATLAVQLPNACHIPSNISQCVDLLHLSPKSAEAKV  126



>ref|XP_008461230.1| PREDICTED: protein YLS3-like [Cucumis melo]
Length=192

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
            V  D  +DK+ C  QL G++ CL +VSGDAK PT  CC  +++ LK  + CLCV+VKDRN
Sbjct  26   VGGDDKKDKEECTPQLAGMATCLPYVSGDAKTPTPDCCSGLKEVLKNNKKCLCVIVKDRN  85

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +P LGL+IN TLAL LP +C A  NVS C  LL+LP NS +A++
Sbjct  86   DPDLGLQINVTLALGLPDICHATANVSNCPALLNLPSNSSEAQV  129



>emb|CDX98302.1| BnaC06g16630D [Brassica napus]
Length=176

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 2/111 (2%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--TRLCLC  446
            +M  GV SD  QD K CQD +  L  CL FV+  AK P + CC  +++ + K  T+ CLC
Sbjct  22   IMFLGVRSDLNQDIKGCQDSMSDLYSCLPFVTSKAKAPDSTCCTTLKEKINKGQTKRCLC  81

Query  445  VLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             LVKDR++PGLG K++   A+SLPS C  P N+S+C  LLHLPP+S  AKI
Sbjct  82   TLVKDRDDPGLGFKVDANRAMSLPSTCHVPANISQCPELLHLPPDSVAAKI  132



>ref|XP_004955761.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Setaria italica]
Length=204

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
            V  DFA D+  C D+L+GL+ CLT+V  +A  PT  CC  ++  L+ +R CLCVLVKD++
Sbjct  24   VVGDFAADRAECSDKLVGLATCLTYVQDEASAPTPDCCAGLKTVLQSSRKCLCVLVKDKD  83

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +P LGLK+N T AL LP++C AP N+S+C  LL+L PNS +A++
Sbjct  84   DPNLGLKLNVTKALGLPAVCNAPANISDCPRLLNLAPNSKEAQV  127



>ref|XP_004985580.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
isoform X2 [Setaria italica]
Length=194

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = -3

Query  601  SSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
              D   D+  C DQL+GL+PCL +V G A+ P   CC  +R+ L K+  CLCVLVKD+++
Sbjct  24   GGDMNADRTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDD  83

Query  421  PGLGLKINGTLALSLPSLCRAP-TNVSECLTLLHLPPNSPDAKI  293
            P LG+KIN TLAL+LPS C A   N S C  LLH+PP S DA I
Sbjct  84   PNLGIKINATLALALPSACGATRANASHCAQLLHIPPGSKDAAI  127



>ref|XP_002468449.1| hypothetical protein SORBIDRAFT_01g046080 [Sorghum bicolor]
 gb|EER95447.1| hypothetical protein SORBIDRAFT_01g046080 [Sorghum bicolor]
Length=195

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 1/103 (1%)
 Frame = -3

Query  598  SDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEP  419
             D   DK  C DQL+GL+PCL +V G A+ P   CC  +R+ L K+  CLCVLVKD+++P
Sbjct  26   GDMNADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDP  85

Query  418  GLGLKINGTLALSLPSLCRAP-TNVSECLTLLHLPPNSPDAKI  293
             LG+KIN TLAL+LP+ C A   NVS C  LLH+PP S DA +
Sbjct  86   NLGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAV  128



>gb|ACG31262.1| lipid transfer protein [Zea mays]
Length=192

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            D   DK  C DQL+GL+PCL +V G A+ P   CC  +R+ L K+  CLCVLVKD+++P 
Sbjct  25   DMNADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDDPN  84

Query  415  LGLKINGTLALSLPSLCRAP-TNVSECLTLLHLPPNSPDAKI  293
            LG+KIN TLAL+LP+ C A   NVS C  LLH+PP S DA +
Sbjct  85   LGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAV  126



>ref|XP_003549079.1| PREDICTED: protein YLS3-like isoform X1 [Glycine max]
Length=191

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            D AQDK+RC + L G + CL ++ GD K PT  CC  + + +K  + C+C+++KDR++P 
Sbjct  26   DSAQDKQRCAESLAGAATCLPYLGGDTKAPTADCCSRLTQAMKTNKKCVCLILKDRDDPD  85

Query  415  LGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
            LGLKIN T+A+ LPSLC+ P N+S+C  LLHL P SP+A+
Sbjct  86   LGLKINMTIAVGLPSLCKTPDNLSQCSALLHLDPKSPEAQ  125



>ref|XP_004135899.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cucumis sativus]
 gb|KGN45178.1| Non-specific lipid-transfer protein [Cucumis sativus]
Length=197

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = -3

Query  649  SLKILCFLLCLM-----VGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDE  485
            S K L  ++ L+     V  V  D  +D++ C  QL G++ CL +VSGDAK PT  CC  
Sbjct  8    SFKWLWLIMLLLRSPSWVRFVGGDDKKDREECTPQLAGMATCLPYVSGDAKAPTPDCCSG  67

Query  484  IRKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSP  305
            +++ L+  + CLCV+V+DRN+P LGL+IN TLALSLP +C A  NVS C  LL++P NS 
Sbjct  68   LKEVLQNDKKCLCVIVRDRNDPDLGLQINVTLALSLPDICHATANVSNCPALLNMPSNSS  127

Query  304  DAKI  293
            DA++
Sbjct  128  DAQV  131



>ref|XP_003549102.1| PREDICTED: protein YLS3-like isoform X1 [Glycine max]
Length=191

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            ++V     D AQDK+RC + L G++ CL ++  DAK PT  CC  + + +K  + C+C++
Sbjct  18   VLVSHAMEDSAQDKQRCAESLTGVATCLPYLGADAKAPTADCCGGLTQAMKTNKKCVCLI  77

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
            +KDR+ P LGLKIN T+A+ LPSLC+ P N+S+C  LLHL P SP+A+
Sbjct  78   LKDRDVPDLGLKINMTIAVGLPSLCKTPDNLSQCSALLHLDPKSPEAQ  125



>ref|XP_006292695.1| hypothetical protein CARUB_v10018941mg [Capsella rubella]
 gb|EOA25593.1| hypothetical protein CARUB_v10018941mg [Capsella rubella]
Length=171

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            LC  + +M  GV SD  QD K CQD +  L  CL FV+  AK P + CC  ++ ++ K  
Sbjct  11   LCITVAVMFLGVRSDLKQDLKGCQDAMSDLYSCLPFVTNKAKAPDSTCCSTLKVNIDKGQ  70

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            T+ CLC LVKDR++PGLG K++   A+SLPS C  P N+S+C  LLHLP +SP ++I
Sbjct  71   TKKCLCTLVKDRDDPGLGFKVDANRAMSLPSACHVPANISKCPELLHLPLDSPASQI  127



>gb|ACG45950.1| lipid transfer protein [Zea mays]
Length=192

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -3

Query  601  SSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
              D   DK  C DQL+GL+PCL +V G A+ P   CC  +R+ L K+  CLCVLVKD+++
Sbjct  23   GGDMNADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDD  82

Query  421  PGLGLKINGTLALSLPSLCRAP-TNVSECLTLLHLPPNSPDAKI  293
            P LG+KIN TLAL+LP+ C A   NVS C  LLH+PP S DA +
Sbjct  83   PNLGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAV  126



>gb|ACG37967.1| lipid transfer protein [Zea mays]
Length=192

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -3

Query  601  SSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
              D   DK  C DQL+GL+PCL +V G A+ P   CC  +R+ L K+  CLCVLVKD+++
Sbjct  23   GGDMNADKTECADQLVGLAPCLQYVQGQARAPPPDCCGGLRQVLGKSPKCLCVLVKDKDD  82

Query  421  PGLGLKINGTLALSLPSLCRAP-TNVSECLTLLHLPPNSPDAKI  293
            P LG+KIN TLAL+LP+ C A   NVS C  LLH+PP S DA +
Sbjct  83   PNLGIKINATLALALPNACGATRANVSHCAQLLHIPPGSKDAAV  126



>ref|XP_006369481.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
 gb|ERP66050.1| hypothetical protein POPTR_0001s23850g [Populus trichocarpa]
Length=125

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             L+ +MV    +   +D + C +QL+GL+ CL +V GDAK PT  CC+ +++ LK  + C
Sbjct  18   VLMSVMVSLAMAGKDKDSEECAEQLVGLATCLPYVGGDAKAPTPDCCNGLKQVLKDNKKC  77

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSEC  338
            LCV++KDRN+P LGLKIN TLALSLPS+C AP NVS+C
Sbjct  78   LCVIIKDRNDPELGLKINATLALSLPSVCHAPANVSQC  115



>ref|NP_001240276.1| uncharacterized protein LOC100792950 precursor [Glycine max]
 gb|ACU24068.1| unknown [Glycine max]
 gb|KHN38165.1| Putative GPI-anchored protein [Glycine soja]
Length=195

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            SL     L  ++VG    D ++DK+ C +QL GL+ CL +V G A+ PT  CC  +++ L
Sbjct  8    SLAHFMLLTTIVVGIAMGDSSKDKEECTEQLAGLATCLPYVGGQAQAPTPDCCSGLKQVL  67

Query  469  KKTRLCLCVLVKDRNEPGL-GLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            K  + CLCV++KDRN+P L GL+IN TLAL+LP+ C +P NVS+C  LLH+ P S +A++
Sbjct  68   KNNKKCLCVIIKDRNDPDLGGLQINVTLALNLPTACNSPVNVSKCPELLHMDPKSAEAQV  127



>ref|NP_181958.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 sp|O64864.1|YLS3_ARATH RecName: Full=Protein YLS3; AltName: Full=Protein YELLOW-LEAF-SPECIFIC 
GENE 3; AltName: Full=Xylogen-like protein 9; Short=AtXYLP9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16079.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42777.1| putative non-specific lipid transfer protein nLTP [Arabidopsis 
thaliana]
 gb|AAO63932.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE73265.1| xylogen like protein 9 [Arabidopsis thaliana]
 gb|AEC10404.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=205

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            I   ++ ++V    +D  +DK+ C  QL+G++ CL +V G AK PT  CC  +++ +   
Sbjct  13   IALIMVAMVVDAAGADKGKDKEECTAQLVGMATCLPYVQGKAKSPTPDCCSGLKQVINSD  72

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              CLC+++++RN+P LGL++N +LAL+LPS+C A  ++++C  LLHL PNSPDA++
Sbjct  73   MKCLCMIIQERNDPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQV  128



>gb|ACU15623.1| unknown [Glycine max]
Length=193

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            SL     L  ++VG    D ++DK+ C +QL GL+ CL +V G A+ PT  CC  +++ L
Sbjct  8    SLAHFMLLTTIVVGIAMGDSSKDKEECTEQLAGLATCLPYVGGQAQAPTPDCCSGLKQVL  67

Query  469  KKTRLCLCVLVKDRNEPGL-GLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            K  + CLCV++KDRN+P L GL+IN TLAL+LP+ C +P NVS+C  LLH+ P S +A++
Sbjct  68   KNNKKCLCVIIKDRNDPDLGGLQINVTLALNLPTACNSPVNVSKCPELLHMDPKSAEAQV  127



>gb|KEH19312.1| Lipid transfer protein [Medicago truncatula]
Length=195

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            ++     L  ++VG   SD +++K+ C  QL GL+ CL +V G+ K P   CCD ++  L
Sbjct  8    AMAYFLLLASMIVGIGMSDSSKEKQECTAQLTGLASCLPYVEGEGKTPAPDCCDGLKTLL  67

Query  469  KKTRLCLCVLVKDRNEPGL-GLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            K  + CLCV++KDRN+P L G+ IN TLAL+LP++C AP N+S+C  LLH+ PNS +A++
Sbjct  68   KTNKKCLCVIIKDRNDPDLGGIVINVTLALNLPTVCNAPANISKCPELLHMDPNSAEAQV  127



>gb|KFK37241.1| hypothetical protein AALP_AA4G232200 [Arabis alpina]
Length=205

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             +  ++V G   D A+DK+ C +QL+G++ CL +V G AK PT  CC  +++ L   + C
Sbjct  18   IMATMVVAG--EDKAKDKEECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNTDKKC  75

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LCV+++DRN+P LGL+IN +LAL+LP++C A  +V++C  LLHL P SP+A++
Sbjct  76   LCVIIQDRNDPDLGLQINVSLALALPTVCHATADVTKCPALLHLDPKSPEAQV  128



>ref|XP_009147517.1| PREDICTED: protein YLS3-like [Brassica rapa]
Length=196

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            SL I   +  ++VG  SSD  QD++ C +QL+ LSPCLT+V G+AK PT  CC    + +
Sbjct  7    SLIITIVITSMLVGFGSSDLDQDREECTNQLVVLSPCLTYVGGNAKAPTKDCCGGFGQVI  66

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
             +++ C+C+LVKD+++P LGLK N +LA  LP+ C   AP N+++C++LLHL PNS  A+
Sbjct  67   TQSQKCVCILVKDKDDPNLGLKFNASLAAHLPTACHITAP-NITKCISLLHLSPNSTLAR  125



>ref|XP_008803424.1| PREDICTED: protein YLS3-like [Phoenix dactylifera]
Length=187

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -3

Query  580  KKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPGLGLKI  401
            +K C DQL+GL+ CL++V G+AK PT  CC  + + L K+  CLC+L+KD ++P L +K 
Sbjct  31   QKECSDQLVGLATCLSYVQGNAKAPTPDCCTGLEQVLVKSPKCLCILIKDSDDPQLSIKF  90

Query  400  NGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            N TLAL LPSLC AP N+SEC  LL+LPPNS DA I
Sbjct  91   NVTLALRLPSLCSAPANISECPKLLNLPPNSKDAAI  126



>ref|XP_009143014.1| PREDICTED: protein YLS3-like [Brassica rapa]
Length=202

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            + I   LL   +     D A+DK+ C +QL+G++ CL +V G AK PT  CC  +++ LK
Sbjct  9    VAIAIALLMATLVSAGEDKAKDKEECTEQLVGMATCLPYVQGQAKTPTPDCCSGLKQVLK  68

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              + CLCV+++DRN+P LGL+IN +LAL+LPS+C A  +V++C  LLH+ P S +A++
Sbjct  69   SDKKCLCVIIQDRNDPDLGLQINVSLALALPSVCHAVADVTKCPALLHMDPKSQEAQV  126



>emb|CDY64362.1| BnaAnng19290D [Brassica napus]
Length=202

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            + I   LL   +     D A+DK+ C +QL+G++ CL +V G AK PT  CC  +++ LK
Sbjct  9    VAIAIALLMATLVSAGEDKAKDKEECTEQLVGMATCLPYVQGQAKTPTPDCCSGLKQVLK  68

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              + CLCV+++DRN+P LGL+IN +LAL+LPS+C A  +V++C  LLH+ P S +A++
Sbjct  69   SDKKCLCVIIQDRNDPDLGLQINVSLALALPSVCHAVADVTKCPALLHMDPKSQEAQV  126



>ref|XP_006392665.1| hypothetical protein EUTSA_v10011802mg [Eutrema salsugineum]
 gb|ESQ29951.1| hypothetical protein EUTSA_v10011802mg [Eutrema salsugineum]
Length=191

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            ++VG   SD AQD+  C +QLI LSPCL +V GDAK PT  CC    + + K+  C+C+L
Sbjct  19   MLVGFGGSDLAQDRDECTNQLIALSPCLPYVGGDAKAPTKDCCGGFGQVIVKSVKCVCIL  78

Query  439  VKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            +KD+++P LGLK N TLA  LP+ C   AP N+++C++LLHL PNS  A+
Sbjct  79   IKDKDDPNLGLKFNATLAAYLPTACHITAP-NITKCISLLHLSPNSTLAR  127



>emb|CDY54411.1| BnaC06g41560D [Brassica napus]
Length=196

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 82/120 (68%), Gaps = 3/120 (3%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            SL I   +  ++ G  SSD  QD++ C +QLI LSPCLT+V G+AK PT  CC    + +
Sbjct  7    SLIITIVITSMLAGFGSSDLDQDREECTNQLIVLSPCLTYVGGNAKAPTKDCCGGFGQVI  66

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
             +++ C+C+LVKD+++P LGLK N +LA  LP+ C   AP N+++C++LLHL PNS  A+
Sbjct  67   TQSQKCVCILVKDKDDPNLGLKFNASLAAHLPTACHITAP-NITKCISLLHLSPNSTLAR  125



>ref|XP_006397606.1| hypothetical protein EUTSA_v10001634mg [Eutrema salsugineum]
 gb|ESQ39059.1| hypothetical protein EUTSA_v10001634mg [Eutrema salsugineum]
Length=208

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = -3

Query  628  LLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCL  449
            L+   +   + D A+DK  C +QL+GL+ CL +V   AK PT  CC  +++ +   + CL
Sbjct  15   LIMATLVAAAEDKAKDKAECTEQLVGLATCLPYVQEQAKSPTPDCCSGLKQVINSDKKCL  74

Query  448  CVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            CV+++DRN+P LGLKIN +LAL+LPS+C    +V++C  LLHL PNSPDA+ 
Sbjct  75   CVIIQDRNDPDLGLKINVSLALALPSVCHVTADVTKCPALLHLDPNSPDAQF  126



>ref|XP_004142249.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like 
[Cucumis sativus]
Length=146

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -3

Query  658  PMGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIR  479
            P  +  +   L  L VG VSS+  QD+  C DQ++GL+ CL +V G+AK PT  CC  ++
Sbjct  3    PSSAHFLFAALALLSVGFVSSNIDQDRAECADQVVGLATCLPYVGGEAKAPTPDCCSGLK  62

Query  478  KDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLT  332
              L K+R CLCVL+KDR++P LGLK+N +LAL LPS C AP N+ +C+ 
Sbjct  63   LVLDKSRKCLCVLIKDRDDPSLGLKVNLSLALGLPSACHAPANIKDCVV  111



>ref|NP_001185235.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE33215.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=224

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            +L I   +  +++G  +SD AQD++ C +QLI LS C+ +V GDAK PT  CC    + +
Sbjct  50   TLFITIVITSMLLGFGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVI  109

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            +K+  C+C+LV+D+++P LG+KIN TLA  LPS C   AP N+++C+++LHLP NS  AK
Sbjct  110  RKSEKCVCILVRDKDDPQLGIKINATLAAHLPSACHITAP-NITDCISILHLPRNSTLAK  168



>ref|XP_007152276.1| hypothetical protein PHAVU_004G115800g [Phaseolus vulgaris]
 gb|ESW24270.1| hypothetical protein PHAVU_004G115800g [Phaseolus vulgaris]
Length=193

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +L   L L++  +  D AQ+K++C + L G++ CL ++ G+AK PT  CC  + + +   
Sbjct  12   VLAITLVLIMHAMG-DSAQEKQKCAESLTGVATCLPYLGGEAKSPTEDCCSGLTQAMTSN  70

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
            + C+CV++KDR++P LGLKIN T+A+ LPSLC+ P N+S+C  LLHL P SP+A+
Sbjct  71   KKCICVILKDRDDPDLGLKINITIAVGLPSLCKTPDNLSQCPALLHLDPKSPEAQ  125



>emb|CDY24046.1| BnaA06g00440D [Brassica napus]
Length=133

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            ++VG  SSD  QD++ C +QL+ LSPCLT+V G+AK PT  CC    + + +++ C+C+L
Sbjct  1    MLVGFGSSDLDQDREECTNQLVVLSPCLTYVGGNAKAPTKDCCGGFGQVITQSQKCVCIL  60

Query  439  VKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            VKD+++P LGLK N +LA  LP+ C   AP N+++C++LLHL PNS  A+
Sbjct  61   VKDKDDPNLGLKFNASLAAHLPTACHITAP-NITKCISLLHLSPNSTLAR  109



>ref|XP_010501137.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=183

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            +++G  SSD AQD+  C +QLI LS CL +V GDAK PT  CC    + + K+  C+C+L
Sbjct  17   MLLGFGSSDLAQDRDECTNQLIALSTCLPYVGGDAKAPTKDCCAGFGQVITKSEKCICIL  76

Query  439  VKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            VKD+++P LGLK N +LA  LP+ C   AP N++EC+++LHLP NS  AK
Sbjct  77   VKDKDDPQLGLKFNASLAAHLPTACHITAP-NITECISILHLPRNSTLAK  125



>ref|XP_009104149.1| PREDICTED: protein YLS3-like [Brassica rapa]
Length=172

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            L   + +M  GV SD   D K CQD +  L  CL FV+  AK P + CC  +++ + K  
Sbjct  12   LFITVAIMFLGVRSDLNLDIKGCQDSMSDLYSCLPFVTSKAKAPDSTCCTTLKEKIDKGQ  71

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            T+ CLC LVKDR++PGLG K++   A+SLPS C  P N+S+C  LLHLPP+S  AKI
Sbjct  72   TKRCLCTLVKDRDDPGLGFKVDANRAMSLPSTCHVPANISQCPELLHLPPDSVAAKI  128



>ref|NP_564682.2| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE33214.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=227

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            +L I   +  +++G  +SD AQD++ C +QLI LS C+ +V GDAK PT  CC    + +
Sbjct  50   TLFITIVITSMLLGFGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVI  109

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            +K+  C+C+LV+D+++P LG+KIN TLA  LPS C   AP N+++C+++LHLP NS  AK
Sbjct  110  RKSEKCVCILVRDKDDPQLGIKINATLAAHLPSACHITAP-NITDCISILHLPRNSTLAK  168



>gb|AAG51569.1|AC027034_15 unknown protein; 63629-62263 [Arabidopsis thaliana]
 gb|AAL06529.1|AF412076_1 At1g55260/F7A10_16 [Arabidopsis thaliana]
 gb|AAL90923.1| At1g55260/F7A10_16 [Arabidopsis thaliana]
 dbj|BAE73268.1| xylogen like protein 12 [Arabidopsis thaliana]
Length=184

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            +L I   +  +++G  +SD AQD++ C +QLI LS C+ +V GDAK PT  CC    + +
Sbjct  7    TLFITIVITSMLLGFGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVI  66

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            +K+  C+C+LV+D+++P LG+KIN TLA  LPS C   AP N+++C+++LHLP NS  AK
Sbjct  67   RKSEKCVCILVRDKDDPQLGIKINATLAAHLPSACHITAP-NITDCISILHLPRNSTLAK  125



>ref|XP_010480053.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=183

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            +++G  SSD AQD+  C +QLI LS CL +V GDAK PT  CC    + + K++ C+C+L
Sbjct  17   MLLGFGSSDLAQDRDECTNQLIALSTCLPYVGGDAKAPTKDCCAGFGQVITKSQKCVCIL  76

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPT-NVSECLTLLHLPPNSPDAK  296
            VKD+++P LGLK N +LA  LP+ C     N++EC+++LHLP NS  AK
Sbjct  77   VKDKDDPQLGLKFNASLAAHLPAACHITAFNITECISVLHLPRNSTLAK  125



>ref|XP_002891826.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68085.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=190

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            SL I   +  +++G  +SD AQD++ C +QLI LS C+ +V GDAK PT  CC    + +
Sbjct  7    SLFITIVITSMLLGIGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVI  66

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            +K+  C+C+LV+D+++P LG+KIN +LA  LPS C   AP N+++C+++LH+P NS  AK
Sbjct  67   RKSEKCVCILVRDKDDPQLGIKINASLAAHLPSACHITAP-NITDCISILHIPRNSTLAK  125



>ref|XP_007133468.1| hypothetical protein PHAVU_011G181000g [Phaseolus vulgaris]
 gb|ESW05462.1| hypothetical protein PHAVU_011G181000g [Phaseolus vulgaris]
Length=196

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            ++VG    D +++K+ C  QL+GL+ CL +V G A  PT  CC  +++ LK  + CLCV+
Sbjct  19   MVVGIAMGDSSKEKEECTQQLVGLATCLPYVGGQAHAPTPDCCSGLKELLKNNKKCLCVI  78

Query  439  VKDRNEPGL-GLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +KDRN+P L GL+IN TLAL+LP+ C +P NVS+C  LLH+ P S +A++
Sbjct  79   IKDRNDPDLSGLQINVTLALNLPTACNSPVNVSKCPELLHMDPKSQEAQV  128



>ref|NP_001170312.1| putative bifunctional inhibitor/LTP/seed storage protein family 
precursor [Zea mays]
 gb|ACN36566.1| unknown [Zea mays]
 tpg|DAA59932.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=206

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 78/122 (64%), Gaps = 3/122 (2%)
 Frame = -3

Query  649  SLKILCFLLCLMVG-GVSSDFAQDKKRCQDQLIGLSPCLTFVS--GDAKFPTTACCDEIR  479
            ++ +   LL +M   GV  DFA D+  C +QL GL+ CLT+V     A  PT  CC  ++
Sbjct  13   AVAVATLLLTMMTSSGVGGDFAADRAECSEQLAGLATCLTYVQEQATATAPTPDCCAGLK  72

Query  478  KDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDA  299
              L+ +R CLCVLVKDR++P LGLK+N   AL LP++C AP N+S+C  LL LP  S DA
Sbjct  73   AVLQSSRKCLCVLVKDRDDPNLGLKLNVDKALGLPAVCHAPANISDCPRLLDLPAGSKDA  132

Query  298  KI  293
            ++
Sbjct  133  QV  134



>ref|NP_001152231.1| LOC100285869 precursor [Zea mays]
 gb|ACG46517.1| lipid binding protein [Zea mays]
Length=183

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 2/108 (2%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVS--GDAKFPTTACCDEIRKDLKKTRLCLCVLV  437
            G   +DFAQD+  C D+L+GL+ CLTFV     A+ PT  CC  +++ +  ++LC+CVLV
Sbjct  12   GVARADFAQDRAMCADRLMGLATCLTFVQDKATARAPTPDCCAGLKQVVAASKLCMCVLV  71

Query  436  KDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            KDR+EP LG KIN T A+ LPSLC  P   S+C  +L + P++P+A+I
Sbjct  72   KDRDEPALGFKINVTRAMDLPSLCSNPATFSDCPKILGMSPDAPEAEI  119



>ref|XP_007152277.1| hypothetical protein PHAVU_004G115900g [Phaseolus vulgaris]
 gb|ESW24271.1| hypothetical protein PHAVU_004G115900g [Phaseolus vulgaris]
Length=193

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            ++V     D AQ+K++C + L G++ CL ++ G+AK PT  CC  + + +K  + C+C++
Sbjct  18   VLVMHAMGDSAQEKQKCAESLTGVTTCLPYLGGEAKTPTEDCCSGLTQAMKSNKKCICII  77

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
            +KDR++P LGLKIN T+A+ LPS+C+ P N S C  LLHL P SP+A+
Sbjct  78   LKDRDDPDLGLKINITIAVGLPSICKTPDNFSRCPALLHLDPKSPEAQ  125



>gb|AAM61728.1| unknown [Arabidopsis thaliana]
Length=168

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            +++G  +SD AQD++ C +QLI LS C+ +V GDAK PT  CC    + ++K+  C+C+L
Sbjct  1    MLLGFGNSDLAQDREECTNQLIELSTCIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCIL  60

Query  439  VKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            V+D+++P LG+KIN TLA  LPS C   AP N+++C+++LHLP NS  AK
Sbjct  61   VRDKDDPQLGIKINATLAAHLPSACHITAP-NITDCISILHLPRNSTLAK  109



>ref|XP_010088879.1| hypothetical protein L484_020867 [Morus notabilis]
 gb|EXB37076.1| hypothetical protein L484_020867 [Morus notabilis]
Length=199

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = -3

Query  643  KILCFLLCLMVGGVSS--DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            KIL F +  +   V+S    A D+K C DQL  L+ C+ FVSG AK PT  CC++ RK  
Sbjct  6    KILVFCMVTVSLAVASMGTMADDEKDCADQLGNLASCIPFVSGTAKKPTPECCEDTRKVK  65

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +    CLCVL+K+  +P +GL IN TLAL +PS C     VS+C ++L+LPPNSPDAKI
Sbjct  66   ETKPKCLCVLIKESTDPSVGLPINTTLALQMPSACNIDAKVSDCPSILNLPPNSPDAKI  124



>ref|XP_006658373.1| PREDICTED: protein YLS3-like [Oryza brachyantha]
Length=203

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -3

Query  580  KKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPGLGLKI  401
            +  C D+L+ L+ CLTFV  +A  PT  CC  +R  L+ +R CLCVL+KDR++P L LKI
Sbjct  27   RAECSDKLVALATCLTFVQDEAAAPTPDCCAGLRTVLQASRKCLCVLIKDRDDPNLNLKI  86

Query  400  NGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            N T ALSLPSLC AP N+S+C  LL+LPPNS +A++
Sbjct  87   NVTKALSLPSLCNAPANISDCPRLLNLPPNSTEAQV  122



>gb|ABR16730.1| unknown [Picea sitchensis]
Length=188

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = -3

Query  598  SDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEP  419
            SDFA D+K C  QL  L+ C+ +V G AKFP   CCD + K   K   CLCVL+KD ++P
Sbjct  21   SDFAADQKECGSQLATLATCIPYVQGSAKFPAKDCCDGLLKLHLKDPKCLCVLIKDSSDP  80

Query  418  GLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             LG+ IN TLAL LP  C+   NVS C  LLH+ PNSPDA++
Sbjct  81   QLGITINKTLALQLPDDCKVAANVSRCPALLHISPNSPDAQV  122



>gb|ABB90545.1| lipid transfer protein [Triticum aestivum]
Length=185

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 80/121 (66%), Gaps = 2/121 (2%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFV--SGDAKFPTTACCDEIRK  476
            S  ++  L+ L+VG   +DFA D+  C D+L+GL+ CLT+V  +  A+ PT  CC   R+
Sbjct  6    SGAVVAALMALLVGLAGADFAADRAECADKLMGLATCLTYVQLAATARSPTPDCCSGFRQ  65

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
             L  ++ CLCVLVKDR+EP LG+K N T A++LPS C  P   S+C  +L++ P+S +A+
Sbjct  66   VLGVSKKCLCVLVKDRDEPTLGIKFNVTRAMNLPSACNIPATFSDCPKILNMSPDSKEAE  125

Query  295  I  293
            I
Sbjct  126  I  126



>ref|XP_002515567.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF47016.1| lipid binding protein, putative [Ricinus communis]
Length=188

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 81/124 (65%), Gaps = 3/124 (2%)
 Frame = -3

Query  655  MGSLK--ILCFLLCL-MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDE  485
            MGS+K   +C+++ + ++ G  +   QD++ C DQL  L+ C+ +VSG AK PT  CC +
Sbjct  1    MGSVKKMAVCWIVVVSLIIGSEASLQQDEQDCADQLTNLASCIPYVSGTAKNPTPQCCQD  60

Query  484  IRKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSP  305
             +K       CLCVL+K+  +P +GL +N TLAL +PS C     VS+C ++L+LPP+SP
Sbjct  61   TQKVKASKPKCLCVLIKESTDPSMGLPVNTTLALHMPSACNIDAEVSDCPSILNLPPDSP  120

Query  304  DAKI  293
            DAKI
Sbjct  121  DAKI  124



>tpg|DAA52009.1| TPA: putative bifunctional inhibitor/LTP/seed storage protein 
family [Zea mays]
Length=202

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVS--GDAKFPTTACCDEIRKDLKKTRLCLCVL  440
             G   +DFAQD+  C D+L+GL+ CLTFV     A+ PT  CC  +++ +  ++LC+CVL
Sbjct  30   AGVARADFAQDRAMCADRLMGLATCLTFVQDKATARAPTPDCCAGLKQVVAASKLCMCVL  89

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            VKDR+EP LG KIN T A+ LPSLC  P   S+C  +L + P++P+A+I
Sbjct  90   VKDRDEPALGFKINVTRAMDLPSLCSNPATFSDCPKILGMSPDAPEAEI  138



>ref|XP_010101138.1| putative GPI-anchored protein [Morus notabilis]
 gb|EXB87356.1| putative GPI-anchored protein [Morus notabilis]
Length=182

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 74/116 (64%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            ++   L   VG  SS   QDK  C ++L+GL+ CL FV G A  PT+ CC  ++  ++K+
Sbjct  13   VVLLGLVGFVGFGSSTLEQDKAECGEKLVGLATCLNFVGGQASSPTSDCCRGLKTVVEKS  72

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              CLCVLVKDR++P L +K N T AL LPS C  P N++ C+ LL L PNS DAK+
Sbjct  73   TKCLCVLVKDRDDPELDIKFNVTRALQLPSTCHVPLNLTACVDLLGLAPNSTDAKV  128



>ref|NP_001266562.1| lipid binding protein [Zea mays]
 gb|ACG36478.1| lipid binding protein [Zea mays]
Length=205

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVS--GDAKFPTTACCDEIRKDLKKTRLCLCVL  440
             G   +DFAQD+  C D+L+GL+ CLTFV     A+ PT  CC  +++ +  ++LC+CVL
Sbjct  30   AGVARADFAQDRAMCADRLMGLATCLTFVQDKATARAPTPDCCAGLKQVVAASKLCMCVL  89

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            VKDR+EP LG KIN T A+ LPSLC  P   S+C  +L + P++P+A+I
Sbjct  90   VKDRDEPALGFKINVTRAMDLPSLCSNPATFSDCPKILGMSPDAPEAEI  138



>ref|NP_001152188.1| lipid binding protein precursor [Zea mays]
 gb|ACG46301.1| lipid binding protein [Zea mays]
Length=206

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = -3

Query  616  MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVS--GDAKFPTTACCDEIRKDLKKTRLCLCV  443
            M  GV  DFA D+  C +QL GL+ CLT+V     A  PT  CC  ++  L+ +R CLCV
Sbjct  24   MSSGVGGDFAADRAECSEQLAGLATCLTYVQEQATATAPTPDCCAGLKAVLQSSRKCLCV  83

Query  442  LVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LVKDR++P LGLK+N   AL LP++C AP N+S+C  LL LP  S DA++
Sbjct  84   LVKDRDDPNLGLKLNVDKALGLPAVCHAPANISDCPRLLDLPAGSKDAQV  133



>gb|KEH21671.1| RALF [Medicago truncatula]
Length=191

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            + +      L++     + AQ+K++C +QL  L+ CL ++ G A  PT+ CC  + +  K
Sbjct  10   MVVFTLSFMLIISHTMGESAQEKQKCAEQLTDLTTCLPYLGGSANSPTSDCCSGLIQSTK  69

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
              + C+C+++KDR++P LGLKIN TLAL LPSLC  P N S+C +LLHL P S +A+
Sbjct  70   NNKKCICIIIKDRDDPDLGLKINITLALGLPSLCNTPDNFSQCSSLLHLDPKSSEAQ  126



>dbj|BAJ87912.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=185

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFV--SGDAKFPTTACCDEIRKDLKK  464
            L  +  +MVG   +DFA DK  C D+L+GL+ CLT+V  S  A+ PT  CC   R+ L  
Sbjct  14   LMAVAAVMVGLAGADFAADKAECVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGV  73

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            ++ CLCVLVKDR+EP LG+K N T A++LPS C  P   S+C  +L++ P+S +A+I
Sbjct  74   SKKCLCVLVKDRDEPTLGIKFNVTRAMNLPSACNIPATFSDCPKILNMSPDSKEAEI  130



>gb|ABK22783.1| unknown [Picea sitchensis]
Length=182

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 0/113 (0%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
            F+   +VG   +D   D+K C  QL  ++ C ++V G  K P+T CC  ++   +    C
Sbjct  13   FVAACLVGSALADLEADQKECSSQLTSMTKCFSYVQGTDKSPSTDCCANLKNVYQTAPKC  72

Query  451  LCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LC+LVKD   P LGL IN TLAL LPS C+   N+S C  LL+L PNSPDAKI
Sbjct  73   LCILVKDSTSPALGLSINQTLALGLPSACKVNANISACPALLNLSPNSPDAKI  125



>ref|XP_010462370.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=183

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 3/110 (3%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            +++G  SSD AQD+  C +QL+ LS CL +V GDAK PT  CC    + +  +  C+C+L
Sbjct  17   MLLGFGSSDLAQDRDECMNQLVALSTCLPYVGGDAKAPTKDCCAGFGQVITNSEKCVCIL  76

Query  439  VKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            VKD+++P LGLK N +LA  LP+ C   AP N++EC+++LHLP NS  AK
Sbjct  77   VKDKDDPQLGLKFNASLAAHLPTACHITAP-NITECISILHLPRNSTLAK  125



>emb|CDY69589.1| BnaC04g53090D [Brassica napus]
Length=197

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            + I   LL   +     D A+DK+ C +QL+G++ CL +V G AK PT  CC  +++ LK
Sbjct  9    VAIAIALLMATLVSAGEDKAKDKEECTEQLVGMATCLPYVQGQAKTPTPDCCSGLKQVLK  68

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              +  LCV+++DRN+P LGL+IN +LAL+LPS+C A  +V++C  LLH+ P S +A++
Sbjct  69   SDKKFLCVIIQDRNDPDLGLQINVSLALALPSVCHAVADVTKCPALLHMDPKSQEAQV  126



>ref|XP_002281585.1| PREDICTED: protein YLS3 [Vitis vinifera]
Length=194

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 71/116 (61%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +  F++ L+V G       D+K C DQL  L+ C+ FVSG AK PT  CC + +K     
Sbjct  9    VFSFVVGLLVVGSMGTMEDDEKDCADQLTNLAACIPFVSGTAKKPTQQCCQDTQKVKSSK  68

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              CLCVL+K+  +P LGL +N TLAL +PS C     VS+C TLL LPP+S DAKI
Sbjct  69   PKCLCVLIKESTDPSLGLPVNTTLALQMPSACNIDAKVSDCPTLLSLPPDSADAKI  124



>ref|XP_004306485.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Fragaria vesca subsp. vesca]
Length=207

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  574  RCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPGLGLKING  395
             C  QL+G++ CL +V G+A  PT  CC  +++ L   + CLCV+++DRN+P LGL+IN 
Sbjct  45   ECAQQLVGMATCLPYVGGEAMAPTPDCCSGLKQVLNNNKKCLCVIIQDRNDPDLGLQINV  104

Query  394  TLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            TLAL LPS+C A  NVS+C  LLHL P SP+A++
Sbjct  105  TLALGLPSVCHAAANVSKCPELLHLDPKSPEAQV  138



>gb|KDP32327.1| hypothetical protein JCGZ_13252 [Jatropha curcas]
Length=200

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            + I C  +  +V        QD++ C DQL  L+ C+ FVSG AK PT  CC + +K LK
Sbjct  7    IGIFCIAVASLVMVSVGSLQQDEQDCADQLTNLASCIPFVSGTAKKPTPECCQDTQK-LK  65

Query  466  KTR-LCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
             T+  CLCVL+K+ ++P +GL +N TLAL +PS+C     VS+C T+L+LPP+SPDAKI
Sbjct  66   STKPKCLCVLIKESSDPSVGLPVNTTLALQMPSVCNIDAKVSDCPTILNLPPDSPDAKI  124



>gb|AES71883.2| Lipid transfer protein [Medicago truncatula]
Length=203

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 74/123 (60%), Gaps = 17/123 (14%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G VSSD  +D+K C D+L+ L+ CL +V G A  PT  CC  +++ L  T+ C+C+L+KD
Sbjct  18   GFVSSDLTEDRKDCADKLVTLASCLPYVGGSANTPTIDCCTNLKQVLNNTKKCICILIKD  77

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECL-----------------TLLHLPPNSPD  302
             N+P LG  +N TLA+ LP+ C  P+N+SEC+                  LLHL P SP+
Sbjct  78   SNDPKLGFPMNATLAVQLPNACHIPSNISECVGNGIDLEPRSVLLLKVSDLLHLSPKSPE  137

Query  301  AKI  293
            AK+
Sbjct  138  AKV  140



>dbj|BAJ95766.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -3

Query  574  RCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPGLGLKING  395
             C D+L+ L+ CLTFV G  + PT  CC  ++  L+ +  CLCVLVKDR++PGL LK+N 
Sbjct  33   ECSDKLVALATCLTFVQGQGQAPTPDCCGGLKTVLQTSPKCLCVLVKDRDDPGLDLKLNV  92

Query  394  TLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            T AL LP+ C AP N+S+C  LLHLPPNS DA++
Sbjct  93   TRALGLPAACSAPANISDCPRLLHLPPNSKDAQV  126



>ref|XP_002881957.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58216.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            I   ++  MV     D  +DK+ C ++L+G++ CL +V G AK PT  CC  +++ L   
Sbjct  13   IALIMVVAMVVDAGDDKEKDKEGCTEKLVGMATCLPYVQGQAKSPTPDCCSGLKQVLNSD  72

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              CLCV+++DRN+P LGL++N +LAL LPS+C A  ++++C  LLHL P SP+A +
Sbjct  73   MKCLCVIIQDRNDPDLGLQVNVSLALGLPSVCHATADITKCPALLHLDPKSPEAHV  128



>ref|XP_006305662.1| hypothetical protein CARUB_v10010370mg [Capsella rubella]
 gb|EOA38560.1| hypothetical protein CARUB_v10010370mg [Capsella rubella]
Length=188

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 75/110 (68%), Gaps = 3/110 (3%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            +++G  +SD AQD+  C +QLI LS CL +V G AK PT  CC    + + K+  C+C+L
Sbjct  17   MLLGFGNSDLAQDRDECTNQLIALSTCLPYVGGGAKAPTKDCCAGFNQVITKSEKCVCIL  76

Query  439  VKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            VKD+++P LGLKIN TLA  LP+ C   AP N++EC+++LHL  NS  AK
Sbjct  77   VKDKDDPQLGLKINATLAAHLPTACHITAP-NITECISILHLARNSTLAK  125



>ref|XP_006295054.1| hypothetical protein CARUB_v10024122mg [Capsella rubella]
 gb|EOA27952.1| hypothetical protein CARUB_v10024122mg [Capsella rubella]
Length=191

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 96/170 (56%), Gaps = 10/170 (6%)
 Frame = -3

Query  616  MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLV  437
            +VGG   D A+++++C ++ + ++ CL ++ G AK PT  CC  +++ L   + C+CV++
Sbjct  22   VVGGGEEDKAKNEEQCTEEKLSMAKCLPYMKGQAKSPTPVCCSGLKQILDSDKNCICVII  81

Query  436  KDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIfeefssssvsgn  257
            +DRN+P LGL+IN +L+ +LPS C    +V++C   LHL   SP+A++F +   +     
Sbjct  82   QDRNDPALGLQINISLSYTLPSACHVTADVAKCPAFLHLDEKSPEAQVFYQIDQALHKMG  141

Query  256  ----------ntstGDLNASSSTALFRKRWIDLLQAHAGFSLLLLIVTFI  137
                         + + N+  +T  F KRW+ L++  A F ++  I   +
Sbjct  142  LASDPPSGPPTAGSDNNNSGRTTHFFGKRWLGLIKVVAHFFVMFYIFMLV  191



>ref|XP_006305663.1| hypothetical protein CARUB_v10010370mg [Capsella rubella]
 gb|EOA38561.1| hypothetical protein CARUB_v10010370mg [Capsella rubella]
Length=191

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 75/110 (68%), Gaps = 3/110 (3%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            +++G  +SD AQD+  C +QLI LS CL +V G AK PT  CC    + + K+  C+C+L
Sbjct  17   MLLGFGNSDLAQDRDECTNQLIALSTCLPYVGGGAKAPTKDCCAGFNQVITKSEKCVCIL  76

Query  439  VKDRNEPGLGLKINGTLALSLPSLCR--APTNVSECLTLLHLPPNSPDAK  296
            VKD+++P LGLKIN TLA  LP+ C   AP N++EC+++LHL  NS  AK
Sbjct  77   VKDKDDPQLGLKINATLAAHLPTACHITAP-NITECISILHLARNSTLAK  125



>ref|XP_011086771.1| PREDICTED: protein YLS3-like [Sesamum indicum]
Length=197

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 77/118 (65%), Gaps = 3/118 (3%)
 Frame = -3

Query  637  LCFLLCLMVG---GVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            + F++  + G    V+++  +D+K C +QL  L+ C+ FVSG AK PT  CCD+ +K   
Sbjct  11   MIFIMLAITGFLSAVAANLEEDEKECAEQLTNLAACIPFVSGTAKQPTKECCDDTKKVKT  70

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
                CLCVL+K+ ++P +GL IN TLAL +P+ C     VS+C +LL+LP +SPDAKI
Sbjct  71   AQPKCLCVLIKESSDPSMGLPINTTLALQMPAACNIDAKVSDCPSLLNLPADSPDAKI  128



>ref|XP_009602101.1| PREDICTED: protein YLS3-like [Nicotiana tomentosiformis]
Length=184

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 73/121 (60%), Gaps = 0/121 (0%)
 Frame = -3

Query  655  MGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRK  476
            M  L ++C L+  +     +    D+K C DQL  L+ C+ +VSG AK PT  CC++ +K
Sbjct  1    MKKLSMVCMLVVTLAVAAMATIEDDEKDCADQLTTLAACIPYVSGTAKKPTAECCEDTQK  60

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
                   CLCVL+K+  +P LGL IN TLAL +PS C     VS+C ++L LP +SPDAK
Sbjct  61   VRAAKPKCLCVLIKESTDPSLGLPINTTLALQMPSACNIDAKVSDCPSILKLPADSPDAK  120

Query  295  I  293
            I
Sbjct  121  I  121



>ref|XP_003564265.1| PREDICTED: protein YLS3-like [Brachypodium distachyon]
Length=202

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 2/110 (2%)
 Frame = -3

Query  616  MVGGVSSDFAQDKKRCQDQLIGLSPCLTFV--SGDAKFPTTACCDEIRKDLKKTRLCLCV  443
            +VG   +DFA D+  C D+L+GL+ CLTFV  +  A+ PT  CC   +  L  ++ CLCV
Sbjct  28   LVGPAGADFAADRAECADRLMGLATCLTFVEATATARAPTPDCCSGFKTVLGASKKCLCV  87

Query  442  LVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LVKDR+EP LGLKIN T A++LPS C  P   S+C  +L++ P+S +A+I
Sbjct  88   LVKDRDEPALGLKINVTRAMNLPSACSIPATFSDCPKILNMSPDSKEAEI  137



>gb|AII99869.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=182

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 72/106 (68%), Gaps = 2/106 (2%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKD  431
            G V+SD  +D++ C D+L+ L+ CL +V GDA  P   CC  ++  L KT+ C+C+L+KD
Sbjct  21   GFVNSDLTKDREECADKLVTLASCLPYVGGDANTPAIDCCTALKLVLDKTKKCICILIKD  80

Query  430  RNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            RN+P LG  +N TLA+ LP+ C  P+N+S+   LLHL P S +AK+
Sbjct  81   RNDPKLGFTLNATLAVQLPNACHIPSNISQ--YLLHLSPKSAEAKV  124



>ref|XP_002466262.1| hypothetical protein SORBIDRAFT_01g004610 [Sorghum bicolor]
 gb|EER93260.1| hypothetical protein SORBIDRAFT_01g004610 [Sorghum bicolor]
Length=195

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -3

Query  613  VGGVSSDFAQDKKRCQDQLIGLSPCLTFVS--GDAKFPTTACCDEIRKDLKKTRLCLCVL  440
             G   +DFA+D+  C D+L+GL+ CLTFV     A+ PT  CC  +++ +  +++C+CVL
Sbjct  24   AGVARADFAKDRAMCADKLMGLATCLTFVQDKATARAPTPDCCAGLKQVVAASKMCMCVL  83

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            VKDR+EP LG KIN T A+ LPSLC  P   S+C  +L + P++P+A+I
Sbjct  84   VKDRDEPALGFKINVTRAMDLPSLCSNPATFSDCPKILGMSPDAPEAEI  132



>ref|XP_006397607.1| hypothetical protein EUTSA_v10001638mg [Eutrema salsugineum]
 gb|ESQ39060.1| hypothetical protein EUTSA_v10001638mg [Eutrema salsugineum]
Length=200

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -3

Query  574  RCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPGLGLKING  395
             C +QL+G++ CL +V G AK PT  CC  +++ +   + CLCV+++DRN+P LGL+IN 
Sbjct  33   ECTEQLVGMATCLPYVQGQAKSPTPDCCSGLKQVINSDKKCLCVIIQDRNDPDLGLQINV  92

Query  394  TLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +LAL+LPS+C    +V++C  LLHL PNSPDA++
Sbjct  93   SLALALPSVCHVTADVTKCPALLHLDPNSPDAQV  126



>ref|XP_009781023.1| PREDICTED: protein YLS3-like [Nicotiana sylvestris]
Length=184

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 73/121 (60%), Gaps = 0/121 (0%)
 Frame = -3

Query  655  MGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRK  476
            M  L ++C L+  +     +    D+K C DQL  L+ C+ +VSG AK PT  CC++ +K
Sbjct  1    MKKLSMVCMLVVTLAVAAMATIEDDEKDCADQLTTLAACIPYVSGTAKKPTPECCEDTQK  60

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
                   CLCVL+K+  +P LGL IN TLAL +PS C     VS+C ++L LP +SPDAK
Sbjct  61   VRAAKPKCLCVLIKESTDPSLGLPINTTLALQMPSACNIDAKVSDCPSILKLPADSPDAK  120

Query  295  I  293
            I
Sbjct  121  I  121



>ref|XP_006838654.1| hypothetical protein AMTR_s00002p00240480 [Amborella trichopoda]
 gb|ERN01223.1| hypothetical protein AMTR_s00002p00240480 [Amborella trichopoda]
Length=190

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
            V  D A+D+K C +QL GL+ CL +V G+A  PT  CC   ++ ++K+  C C+L+KD  
Sbjct  23   VGGDLAEDRKECTEQLTGLATCLPYVQGEAASPTKDCCRGFKQVVEKSDKCFCILIKDST  82

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +P LG+KIN +LA  LP  C    N+S C  +LH+ PN+P+A+I
Sbjct  83   DPNLGIKINTSLAAKLPHSCSTSVNISRCPEILHISPNAPEAQI  126



>emb|CBI28121.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 71/116 (61%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            +  F++ L+V G       D+K C DQL  L+ C+ FVSG AK PT  CC + +K     
Sbjct  49   VFSFVVGLLVVGSMGTMEDDEKDCADQLTNLAACIPFVSGTAKKPTQQCCQDTQKVKSSK  108

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              CLCVL+K+  +P LGL +N TLAL +PS C     VS+C TLL LPP+S DAKI
Sbjct  109  PKCLCVLIKESTDPSLGLPVNTTLALQMPSACNIDAKVSDCPTLLSLPPDSADAKI  164



>gb|AFK38594.1| unknown [Lotus japonicus]
Length=195

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 82/119 (69%), Gaps = 3/119 (3%)
 Frame = -3

Query  640  ILCFLL--CLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            +L F+L   ++VG   +D + DK+ C +QL GL+ CL ++ G++K P   CC  +++ LK
Sbjct  9    LLHFMLLASMIVGIAMADSSTDKQECTEQLTGLATCLPYIQGESKAPPPDCCSGLKQVLK  68

Query  466  KTRLCLCVLVKDRNEPGL-GLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            + + CLC+++KDR +P L GL IN T ALSLP++C AP N+S+C  LLH+ P S +A++
Sbjct  69   QNKKCLCLIIKDRKDPDLGGLMINVTSALSLPTVCNAPANISKCPELLHMDPKSKEAQV  127



>emb|CDP03376.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            L ++C  +  +     +   +D+K C DQL  L+ C+ +VSGD K PT  CC++ +K   
Sbjct  8    LSMICICIATVAIVAVATIQEDEKDCADQLTNLAACIPYVSGDEKIPTPECCEDTKKVKS  67

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
                CLCVL+K+  +P +GL IN TLAL +PS C+    VS+C ++L+L P+SPDAKI
Sbjct  68   AKPKCLCVLIKESTDPSMGLPINTTLALKMPSACKIDAKVSDCPSILNLAPDSPDAKI  125



>ref|XP_010518027.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=187

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 96/168 (57%), Gaps = 13/168 (8%)
 Frame = -3

Query  616  MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLV  437
            +VGG   D A+++++C+++ + +  CL ++ G AK PT  CC  +++ L   + C+CV++
Sbjct  21   VVGG-GEDKAKNEEQCREERLSMGTCLPYMKGQAKSPTPGCCSGLKQILDSEKKCICVII  79

Query  436  KDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDA-----------KIf  290
            +DRN+P LGL+IN +L+ +LPS+C    +V++C   LHL P SP+A           KI 
Sbjct  80   QDRNDPALGLQINISLSYTLPSVCHVTADVAKCPAFLHLDPKSPEAQVFYLIDQALHKIG  139

Query  289  eefssssvsgnntstGDLNASS-STALFRKRWIDLLQAHAGFSLLLLI  149
                  S S   T+  D N S  +T LF KRW+ +      F + +L+
Sbjct  140  LASDPPSPSVPPTAGSDNNNSGRTTQLFGKRWLVVAHFFVIFCIFILV  187



>ref|XP_010506349.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=186

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 94/167 (56%), Gaps = 12/167 (7%)
 Frame = -3

Query  616  MVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLV  437
            +VGG   D A+++++C+++ + +  CL ++ G AK PT  CC  +++ L   + C+CV++
Sbjct  21   VVGG-GEDKAKNEEQCREERLSMGTCLPYMKGQAKSPTPVCCSGLKQILDSEKNCICVII  79

Query  436  KDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDA-----------KIf  290
            +DRN+P LGL+IN +L+ +LPS+C    +V++C   LHL P SP+A           KI 
Sbjct  80   QDRNDPALGLQINISLSYTLPSVCHVTADVAKCPAFLHLDPKSPEAQVFYLIDQVLHKIG  139

Query  289  eefssssvsgnntstGDLNASSSTALFRKRWIDLLQAHAGFSLLLLI  149
                  SV        + N+  +T LF KRW+ +      F + +L+
Sbjct  140  LASDPPSVPPTAGPDNNNNSGRTTHLFGKRWLVVAHFFVIFCIFILV  186



>gb|EPS62245.1| non-specific lipid-transfer protein, partial [Genlisea aurea]
Length=133

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            D + D+ +C D L G+  CL +VS  AK PT  CC   +  L+++  C+C+L+KDRN+PG
Sbjct  1    DISVDRAKCADTLGGVITCLPYVSDQAKSPTKDCCSGFQTVLQESPQCICLLIKDRNDPG  60

Query  415  LGLKINGTLALSLPSLCRAPTN--VSECLTLLHLPPNSPDAKI  293
            LGL+I+   A+SLP +C+  TN  V +C  +LHLPPNSPDA++
Sbjct  61   LGLQIDVPRAMSLPQICKIHTNQTVGDCPAILHLPPNSPDAQV  103



>ref|XP_004511135.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Cicer arietinum]
Length=196

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = -3

Query  631  FLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLC  452
             L  ++V    +D ++DK  C  Q+ GL+ CL +V G+ K P   CCD ++  L   + C
Sbjct  14   LLASMIVWNGMADSSKDKDECTSQITGLASCLPYVEGEGKTPAPDCCDGLKTLLNTNKKC  73

Query  451  LCVLVKDRNEPGL-GLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            LC+++KDRN+P L G++IN TLAL LP++C AP N+S+C  LLH+ P S +A++
Sbjct  74   LCLIIKDRNDPDLGGIQINVTLALGLPTVCNAPANISKCPELLHMDPKSAEAQV  127



>ref|XP_009374052.1| PREDICTED: protein YLS3-like [Pyrus x bretschneideri]
Length=198

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 74/123 (60%), Gaps = 2/123 (2%)
 Frame = -3

Query  655  MGS--LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEI  482
            MGS  L++ C ++  +     +    D+K C DQ+  L  C+ FVSG +K PT  CC+  
Sbjct  1    MGSKKLRLFCIVVASLAVATMATMEDDEKECADQMADLVACIPFVSGTSKKPTPECCENT  60

Query  481  RKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPD  302
            +K       CLCVL+K+  +P +GL +N TLAL +PS C     +S+C ++L+LPPNSPD
Sbjct  61   KKLKANKPKCLCVLIKESTDPSMGLPVNTTLALQMPSACDIDGKISDCPSILNLPPNSPD  120

Query  301  AKI  293
            AK 
Sbjct  121  AKF  123



>ref|XP_007013274.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY30893.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=199

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = -3

Query  643  KILCFLLCLMVGGVSSDFA---QDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKD  473
            K++ F + +    ++S       D+K C DQL  L+ C+ FVSG A  PT  CC + +K 
Sbjct  6    KMMVFCIVVASWAMASSMGTMQDDEKECADQLANLASCIAFVSGTATKPTLQCCQDTQKV  65

Query  472  LKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
                  CLCVL+K+  +P +GL +N TLAL +PS C     VS+C T+L+LPP+SPDAKI
Sbjct  66   KATKPKCLCVLIKESTDPSMGLPVNTTLALQMPSACSIDAKVSDCPTILNLPPDSPDAKI  125



>ref|XP_008242742.1| PREDICTED: protein YLS3-like [Prunus mume]
Length=197

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            L + C ++  +     +    D+  C +Q+  L+ C+ FVSG AK PT  CC+  +K   
Sbjct  6    LIVFCIVVASLAMASMATMEDDENECAEQMATLAACIPFVSGTAKKPTPECCENTKKVKA  65

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
                CLCVL+K+  +P +GL +N TLAL +PS C     +S+C ++L LPPNSPDAKI
Sbjct  66   NKPKCLCVLIKESTDPSMGLPVNTTLALQMPSACNIDGKISDCPSILKLPPNSPDAKI  123



>ref|XP_004172159.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like, 
partial [Cucumis sativus]
Length=125

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -3

Query  586  QDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPGLGL  407
            QD+  C DQ++GL+ CL +V G+AK PT  CC  ++  L K+R CLCVL+KDR++P LGL
Sbjct  1    QDRAECADQVVGLATCLPYVGGEAKAPTPDCCSGLKLVLDKSRKCLCVLIKDRDDPSLGL  60

Query  406  KINGTLALSLPSLCRAPTNVSECLT  332
            K+N +LAL LPS C AP N+ +C+ 
Sbjct  61   KVNLSLALGLPSACHAPANIKDCVV  85



>ref|XP_009394719.1| PREDICTED: protein YLS3-like [Musa acuminata subsp. malaccensis]
Length=192

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = -3

Query  604  VSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRN  425
             SSD A D + C  QLIGL  C+ +V G A+ PT  CC  ++  + K+  CLC+LVKD +
Sbjct  29   ASSDTASDLQECGSQLIGLQTCIPYVEGTAQAPTPDCCTGLKDVVAKSPKCLCILVKDHD  88

Query  424  EPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            +P L +KIN T AL+LP  C  P N+S C  LL+LPPNS +A+I
Sbjct  89   DPQLPIKINLTRALALPKACNTPVNISACPKLLNLPPNSKEAEI  132



>ref|XP_010508310.1| PREDICTED: protein YLS3-like [Camelina sativa]
Length=185

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 99/177 (56%), Gaps = 11/177 (6%)
 Frame = -3

Query  649  SLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDL  470
            ++ I   +   +VGG   D A+++++C+++ + +  CL ++ G AK PT  CC  +++ L
Sbjct  10   AISIALIMATTVVGG-GDDKAKNEEQCKEERLSMGTCLPYMKGQAKSPTPVCCSGLKQIL  68

Query  469  KKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKIf  290
               + C+CV+++DRN+P LGL+IN +L+ +LPS+C    +V++C   LHL P SP+A++F
Sbjct  69   DSEKNCICVIIQDRNDPALGLQINISLSYTLPSVCHVTADVAKCPAFLHLDPKSPEAQVF  128

Query  289  eefssssvsgn----------ntstGDLNASSSTALFRKRWIDLLQAHAGFSLLLLI  149
             +   +                  + + N+  +T  F K+W+ +      F + +L+
Sbjct  129  FQIDQALHKIGLASDPPSVPPTAGSDNNNSGRTTQFFGKQWLVVAHFFVIFCIFILL  185



>gb|EMT07496.1| Non-specific lipid-transfer protein-like protein [Aegilops tauschii]
Length=185

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFV--SGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
            DFA D+  C D+L+GL+ CLT+V  +  A+ PT  CC   R+ L  ++ CLCVLVKDR+E
Sbjct  27   DFAADRAECADKLMGLATCLTYVQLAATARSPTPDCCSGFRQVLAASKKCLCVLVKDRDE  86

Query  421  PGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            P LG+K N T A++LPS C  P   S+C  +L++ P+S +A+I
Sbjct  87   PTLGIKFNVTRAMNLPSACNIPATFSDCPKILNMSPDSKEAEI  129



>ref|XP_010497757.1| PREDICTED: protein YLS3-like, partial [Camelina sativa]
Length=118

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = -3

Query  637  LCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKK--  464
            LC  + +M  GV SD  QD K CQD +  L  CL +VS  AK P + CC +++ ++ K  
Sbjct  4    LCITVAVMFLGVRSDLNQDIKGCQDAMSDLYSCLPYVSNKAKAPDSTCCSKLKVNIDKGQ  63

Query  463  TRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSEC  338
            T+ CLC LVKDR++PGLG K++   A+SLPS C  P N+S+C
Sbjct  64   TKRCLCTLVKDRDDPGLGFKVDANRAMSLPSACHVPANISKC  105



>ref|XP_008337357.1| PREDICTED: protein YLS3-like [Malus domestica]
Length=199

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 73/123 (59%), Gaps = 2/123 (2%)
 Frame = -3

Query  655  MGS--LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEI  482
            MGS  L++ C ++  +     +    D+K C DQ+  L+ C+ FVSG +K P   CC+  
Sbjct  1    MGSKKLRLFCIVVASLAVATMATMEDDEKECADQMADLAACIPFVSGTSKKPMPECCENT  60

Query  481  RKDLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPD  302
            +K       CLCVL+K+  +P +GL +N TL L +PS C     +S+C ++L+LPPNSPD
Sbjct  61   KKLKANKPKCLCVLIKESTDPSMGLPVNTTLVLQMPSACDIDGKISDCPSILNLPPNSPD  120

Query  301  AKI  293
            AK 
Sbjct  121  AKF  123



>ref|XP_006476107.1| PREDICTED: protein YLS3-like [Citrus sinensis]
 gb|KDO80428.1| hypothetical protein CISIN_1g041699mg [Citrus sinensis]
Length=203

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 70/116 (60%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            I C ++  +     +    D++ C +QL  L+ C+ FVSG AK PT+ CC + +K     
Sbjct  9    IFCIVMASLAMASMATIEDDEQECAEQLTNLASCIPFVSGTAKKPTSECCQDTQKLKASK  68

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              CLCVL+K+  +P +GL IN TLAL +P+ C    +VS C  LL+L P+SPDAKI
Sbjct  69   PKCLCVLIKESTDPSMGLPINTTLALQMPAACNIDASVSSCPKLLNLAPDSPDAKI  124



>gb|EYU27162.1| hypothetical protein MIMGU_mgv1a0260443mg, partial [Erythranthe 
guttata]
Length=89

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            D A++K  C + L+GL+ CL +V G AK PT  CC  +++ LK  + CLCV++KDRN+P 
Sbjct  3    DNAKEKAECTESLVGLATCLPYVGGTAKSPTPDCCAGLKQLLKTNKKCLCVIIKDRNDPD  62

Query  415  LGLKINGTLALSLPSLCRAPTNVSEC  338
            LGL IN TLAL LP+ C AP N+SEC
Sbjct  63   LGLDINVTLALGLPTACNAPANISEC  88



>ref|XP_006451053.1| hypothetical protein CICLE_v10010697mg [Citrus clementina]
 gb|ESR64293.1| hypothetical protein CICLE_v10010697mg [Citrus clementina]
Length=203

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 70/116 (60%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            I C ++  +     +    D++ C +QL  L+ C+ FVSG AK PT+ CC + +K     
Sbjct  9    IFCIVMASLAMASMATIEDDEQECAEQLTNLASCIPFVSGTAKKPTSECCQDTQKLKASK  68

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              CLCVL+K+  +P +GL IN TLAL +P+ C    +VS C  LL+L P+SPDAKI
Sbjct  69   PNCLCVLIKESTDPSMGLPINTTLALQMPAACNIDASVSSCPKLLNLAPDSPDAKI  124



>ref|XP_004241629.2| PREDICTED: protein YLS3-like [Solanum lycopersicum]
Length=183

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = -3

Query  655  MGSLKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRK  476
            M  L + C L+  +V         D K C DQL  L+ C+ +VSG AK PT  CC++ +K
Sbjct  1    MNKLSVFCMLM--LVTLAMCTIEDDVKDCADQLGDLASCIPYVSGTAKMPTPECCEDTQK  58

Query  475  DLKKTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAK  296
                   CLCVL+K+  +P LGL IN TLAL +P+ C+    VS+C +LL +P +SPDAK
Sbjct  59   LKAAKPKCLCVLIKESTDPSLGLPINTTLALQMPAACKIDAKVSDCPSLLKIPADSPDAK  118

Query  295  I  293
            I
Sbjct  119  I  119



>gb|EYU31694.1| hypothetical protein MIMGU_mgv1a0143491mg, partial [Erythranthe 
guttata]
 gb|EYU31695.1| hypothetical protein MIMGU_mgv1a0143491mg, partial [Erythranthe 
guttata]
Length=111

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
             K+   +L ++ G    D  +DK++C ++L+G+S CL +V G+AK P+  CC   ++ L+
Sbjct  6    FKLFVCILVVLFGIAKCDIEKDKEKCANELLGISTCLPYVGGEAKAPSMDCCTGFKQVLR  65

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTN  350
                C+C+L+KDR++P LGLKIN TLAL LP+ C APTN
Sbjct  66   DNIECICILIKDRDDPSLGLKINATLALGLPTRCHAPTN  104



>ref|XP_004981375.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820-like 
[Setaria italica]
Length=200

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 69/108 (64%), Gaps = 2/108 (2%)
 Frame = -3

Query  610  GGVSSDFAQDKKRCQDQLIGLSPCLTFVS--GDAKFPTTACCDEIRKDLKKTRLCLCVLV  437
            G    DFA D+  C +QL+GL+ CLTFV     A+ PT  CC  +++ +  ++ C+CVLV
Sbjct  31   GVARGDFAADRAECANQLMGLATCLTFVQDKATARAPTPDCCAGLKQVVSASKKCMCVLV  90

Query  436  KDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            KDR+EP LG KIN T A+ LP +C  P   S+C  +L +  ++P+A+I
Sbjct  91   KDRDEPALGFKINVTRAMDLPDICNYPATFSDCPKILGMSTDAPEAEI  138



>ref|XP_007203697.1| hypothetical protein PRUPE_ppa022009mg [Prunus persica]
 gb|EMJ04896.1| hypothetical protein PRUPE_ppa022009mg [Prunus persica]
Length=207

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 67/116 (58%), Gaps = 0/116 (0%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            + C ++  +     +    D+  C +Q+  L+ C+ FVSG AK PT  CC+  +K     
Sbjct  8    VFCIVVASLAMASMATMEDDENECAEQMATLAACIPFVSGTAKKPTPECCENTKKVKANK  67

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
              CLCVL+K   +P + L +N TLAL +PS C     +S+C ++L LPPNSPDAKI
Sbjct  68   PKCLCVLIKQSTDPSMSLPVNTTLALQMPSACNIDGKISDCPSILKLPPNSPDAKI  123



>ref|XP_006599593.1| PREDICTED: protein YLS3-like isoform X2 [Glycine max]
Length=157

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNEPG  416
            D AQDK+RC + L G + CL ++ GD K PT  CC  + + +K  + C+C+++KDR++P 
Sbjct  26   DSAQDKQRCAESLAGAATCLPYLGGDTKAPTADCCSRLTQAMKTNKKCVCLILKDRDDPD  85

Query  415  LGLKINGTLALSLPSLCRAPTNVSEC  338
            LGLKIN T+A+ LPSLC+ P N+S+C
Sbjct  86   LGLKINMTIAVGLPSLCKTPDNLSQC  111



>ref|XP_010541739.1| PREDICTED: protein YLS3-like [Tarenaya hassleriana]
Length=187

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 71/118 (60%), Gaps = 0/118 (0%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            +  L  L+ L+    ++   + +K C  ++  L+ C+ FVSG A  PT  CC+E +K  +
Sbjct  8    MATLMMLMALITSSKAAKMEEKEKECSTEMGNLASCIPFVSGTAVKPTAQCCEETKKVKE  67

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
                CLCV++K+  +P LGL +N TLAL +P  C     VS+C +LL+LP NSP+AKI
Sbjct  68   NKPECLCVMIKESTDPSLGLPVNTTLALQMPLACHIDAKVSDCPSLLNLPENSPEAKI  125



>ref|XP_006365420.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950-like 
[Solanum tuberosum]
Length=261

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = -3

Query  646  LKILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLK  467
            L +LC L+  +V     +   D K C DQL  L+ C+ +VSG AK PT  CC++ +K   
Sbjct  85   LSVLCMLV--LVTLAMGNIEDDVKDCADQLGDLASCIPYVSGTAKMPTPECCEDTQKLKA  142

Query  466  KTRLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
                CLCVL+K+  +P LGL IN TLAL +P+ C+    VS+C +LL +P +SPDAKI
Sbjct  143  AKPKCLCVLIKESTDPSLGLPINTTLALQMPAACKIDAKVSDCPSLLKIPADSPDAKI  200



>ref|XP_006599591.1| PREDICTED: protein YLS3-like isoform X1 [Glycine max]
Length=157

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            ++V     D AQDK+RC + L G++ CL ++  DAK PT  CC  + + +K  + C+C++
Sbjct  18   VLVSHAMEDSAQDKQRCAESLTGVATCLPYLGADAKAPTADCCGGLTQAMKTNKKCVCLI  77

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSEC  338
            +KDR+ P LGLKIN T+A+ LPSLC+ P N+S+C
Sbjct  78   LKDRDVPDLGLKINMTIAVGLPSLCKTPDNLSQC  111



>ref|XP_006599603.1| PREDICTED: protein YLS3-like isoform X2 [Glycine max]
Length=157

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -3

Query  619  LMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKTRLCLCVL  440
            ++V     D AQDK+RC + L G++ CL ++  DAK PT  CC  + + +K  + C+C++
Sbjct  18   VLVSHAMEDSAQDKQRCAESLTGVATCLPYLGADAKAPTADCCGGLTQAMKTNKKCVCLI  77

Query  439  VKDRNEPGLGLKINGTLALSLPSLCRAPTNVSEC  338
            +KDR+ P LGLKIN T+A+ LPSLC+ P N+S+C
Sbjct  78   LKDRDVPDLGLKINMTIAVGLPSLCKTPDNLSQC  111



>gb|EMT07497.1| hypothetical protein F775_15194 [Aegilops tauschii]
Length=164

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = -3

Query  595  DFAQDKKRCQDQLIGLSPCLTFV--SGDAKFPTTACCDEIRKDLKKTRLCLCVLVKDRNE  422
            DFA DK  C D+L+GL+ CLT+V  +  A+ PT  CC   R+ L  ++ C+C+LVKDR+E
Sbjct  30   DFAADKAECADKLMGLATCLTYVQLTATARAPTPDCCSGFRQVLGTSKRCMCILVKDRDE  89

Query  421  PGLGLKINGTLALSLPSLCRAPTNVSECLTLLHLPPNSPDAKI  293
            P LG+K+N T +++LPS+C      S+C  +L++ P+S + +I
Sbjct  90   PALGIKVNITRSMNLPSVCNIAATFSDCPKILNMAPDSKETEI  132



>gb|EPS60733.1| hypothetical protein M569_14069, partial [Genlisea aurea]
Length=140

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 75/118 (64%), Gaps = 2/118 (2%)
 Frame = -3

Query  640  ILCFLLCLMVGGVSSDFAQDKKRCQDQLIGLSPCLTFVSGDAKFPTTACCDEIRKDLKKT  461
            I   ++  +VG    D  +D+ +C DQL+ ++ CL +VS +A  PT  CC   ++ L  +
Sbjct  5    IPVIIILFLVGFGQCDINEDRAKCGDQLMAVATCLPYVSDEAPKPTPDCCVGFKQVLDTS  64

Query  460  RLCLCVLVKDRNEPGLGLKINGTLALSLPSLCRAPT--NVSECLTLLHLPPNSPDAKI  293
              C C+L+KDRN+P LGL+IN T +L+LP +C+  T  ++S+C   LHL PNS +A+I
Sbjct  65   PACFCLLIKDRNDPSLGLQINVTRSLTLPQVCKVTTKASISDCPAALHLAPNSTEAQI  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239096201126