BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83672_g1_i1 len=847 path=[1:0-846]

Length=847
                                                                      Score     E

ref|XP_006341722.1|  PREDICTED: actin-depolymerizing factor 10-like     238   3e-75   
ref|XP_009787751.1|  PREDICTED: actin-depolymerizing factor 10-like     238   3e-75   
ref|XP_010327379.1|  PREDICTED: actin-depolymerizing factor 10-like     237   5e-75   
ref|XP_009615468.1|  PREDICTED: actin-depolymerizing factor 10-like     236   9e-75   
ref|XP_009595762.1|  PREDICTED: actin-depolymerizing factor 10-like     236   1e-74   
ref|XP_011093147.1|  PREDICTED: actin-depolymerizing factor 10-like     234   8e-74   
ref|XP_009771651.1|  PREDICTED: actin-depolymerizing factor 12-like     233   1e-73   
ref|XP_009793423.1|  PREDICTED: actin-depolymerizing factor 10-like     233   2e-73   
ref|XP_009630108.1|  PREDICTED: actin-depolymerizing factor 10-like     232   5e-73   
ref|XP_006339546.1|  PREDICTED: actin-depolymerizing factor 12-like     231   9e-73   
ref|XP_002271495.1|  PREDICTED: actin-depolymerizing factor 10          231   2e-72   Vitis vinifera
ref|XP_011091992.1|  PREDICTED: actin-depolymerizing factor 10-like     229   5e-72   
ref|XP_010544380.1|  PREDICTED: actin-depolymerizing factor 8 iso...    229   5e-72   
emb|CBI40336.3|  unnamed protein product                                233   1e-71   
ref|XP_010662752.1|  PREDICTED: actin-depolymerizing factor 1           228   1e-71   
gb|EYU32098.1|  hypothetical protein MIMGU_mgv1a026462mg                228   2e-71   
gb|KCW71635.1|  hypothetical protein EUGRSUZ_E00162                     228   3e-71   
ref|NP_171680.1|  actin depolymerizing factor 11                        227   5e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDP08835.1|  unnamed protein product                                228   6e-71   
ref|XP_010249803.1|  PREDICTED: actin-depolymerizing factor             226   7e-71   
ref|XP_010479839.1|  PREDICTED: actin-depolymerizing factor 10          226   1e-70   
ref|XP_010053689.1|  PREDICTED: actin-depolymerizing factor             226   2e-70   
ref|XP_002865909.1|  hypothetical protein ARALYDRAFT_495305             226   2e-70   
ref|XP_006304638.1|  hypothetical protein CARUB_v10011760mg             226   2e-70   
ref|XP_007051847.1|  Actin depolymerizing factor 11                     225   2e-70   
ref|XP_002892045.1|  hypothetical protein ARALYDRAFT_887267             224   5e-70   
ref|XP_010544379.1|  PREDICTED: actin-depolymerizing factor 8 iso...    226   6e-70   
ref|XP_007218574.1|  hypothetical protein PRUPE_ppa013108mg             224   7e-70   
ref|XP_008393892.1|  PREDICTED: actin-depolymerizing factor 1           224   8e-70   
ref|XP_008244913.1|  PREDICTED: actin-depolymerizing factor 10          224   9e-70   
gb|KGN57376.1|  hypothetical protein Csa_3G182120                       223   1e-69   
ref|XP_006418454.1|  hypothetical protein EUTSA_v10009057mg             223   1e-69   
ref|XP_010910598.1|  PREDICTED: actin-depolymerizing factor             225   1e-69   
ref|XP_002318237.1|  actin-depolymerizing factor family protein         223   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006396264.1|  hypothetical protein EUTSA_v10029050mg             223   1e-69   
ref|XP_008794195.1|  PREDICTED: actin-depolymerizing factor-like        223   2e-69   
emb|CDY07204.1|  BnaCnng02190D                                          228   2e-69   
gb|KFK26837.1|  hypothetical protein AALP_AA8G300400                    223   2e-69   
gb|EYU35082.1|  hypothetical protein MIMGU_mgv1a015967mg                223   2e-69   
ref|XP_008804935.1|  PREDICTED: actin-depolymerizing factor isofo...    222   3e-69   
ref|XP_007040194.1|  Actin depolymerizing factor 8                      222   3e-69   
emb|CDY38025.1|  BnaCnng08860D                                          223   4e-69   
ref|XP_009132530.1|  PREDICTED: actin-depolymerizing factor 12-like     222   4e-69   
ref|XP_009119731.1|  PREDICTED: actin-depolymerizing factor 10-like     222   4e-69   
ref|XP_010555668.1|  PREDICTED: actin-depolymerizing factor 7           222   5e-69   
ref|XP_002872934.1|  hypothetical protein ARALYDRAFT_490501             222   5e-69   
ref|XP_009111466.1|  PREDICTED: actin-depolymerizing factor 8           222   6e-69   
ref|XP_006476590.1|  PREDICTED: actin-depolymerizing factor 1-like      221   6e-69   
ref|XP_010317604.1|  PREDICTED: actin-depolymerizing factor 12          221   6e-69   
ref|XP_009386059.1|  PREDICTED: actin-depolymerizing factor             221   8e-69   
ref|XP_009384093.1|  PREDICTED: actin-depolymerizing factor 1           221   9e-69   
ref|XP_011080987.1|  PREDICTED: actin-depolymerizing factor-like        221   1e-68   
ref|XP_010672167.1|  PREDICTED: actin-depolymerizing factor 10          221   1e-68   
ref|XP_006401834.1|  hypothetical protein EUTSA_v10014982mg             221   1e-68   
ref|XP_009127248.1|  PREDICTED: actin-depolymerizing factor 12          221   1e-68   
gb|EPS69954.1|  hypothetical protein M569_04811                         222   2e-68   
ref|XP_009106793.1|  PREDICTED: actin-depolymerizing factor 7           221   2e-68   
ref|XP_006439576.1|  hypothetical protein CICLE_v10023304mg             221   2e-68   
ref|XP_002322471.2|  hypothetical protein POPTR_0015s13080g             220   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_009793756.1|  PREDICTED: actin-depolymerizing factor 7-like      220   2e-68   
ref|NP_567182.1|  actin depolymerizing factor 8                         220   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118832.1|  PREDICTED: actin-depolymerizing factor 10 is...    220   2e-68   
ref|XP_010427310.1|  PREDICTED: actin-depolymerizing factor 8           220   3e-68   
gb|KHN26651.1|  Actin-depolymerizing factor 7                           219   5e-68   
gb|KDP22276.1|  hypothetical protein JCGZ_26107                         219   5e-68   
gb|AAL91666.1|  pollen specific actin-depolymerizing factor 1           219   5e-68   Nicotiana tabacum [American tobacco]
emb|CDY15154.1|  BnaC05g00330D                                          219   6e-68   
ref|XP_009414703.1|  PREDICTED: actin-depolymerizing factor-like        219   6e-68   
gb|ABD66503.1|  actin depolymerizing factor 7                           219   8e-68   Gossypium hirsutum [American cotton]
ref|XP_009118831.1|  PREDICTED: actin-depolymerizing factor 10 is...    219   1e-67   
ref|XP_010419619.1|  PREDICTED: actin-depolymerizing factor 8-like      218   1e-67   
ref|XP_006843593.1|  hypothetical protein AMTR_s00007p00126220          218   1e-67   
ref|XP_002509779.1|  actin depolymerizing factor, putative              218   2e-67   Ricinus communis
ref|XP_011029243.1|  PREDICTED: actin-depolymerizing factor isofo...    218   2e-67   
ref|XP_007143417.1|  hypothetical protein PHAVU_007G070500g             218   2e-67   
ref|XP_002867603.1|  actin binding protein                              218   2e-67   
sp|P30175.1|ADF_LILLO  RecName: Full=Actin-depolymerizing factor;...    218   2e-67   Lilium longiflorum [Easter lily]
ref|XP_010444761.1|  PREDICTED: actin-depolymerizing factor 12-like     218   2e-67   
ref|XP_010456252.1|  PREDICTED: actin-depolymerizing factor 8-like      218   2e-67   
ref|NP_568769.1|  actin depolymerizing factor 10                        218   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KDO76170.1|  hypothetical protein CISIN_1g046281mg                   217   2e-67   
ref|XP_009411533.1|  PREDICTED: actin-depolymerizing factor 1-like      218   3e-67   
ref|NP_194289.2|  actin depolymerizing factor 7                         217   4e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAL91667.1|  pollen specific actin-depolymerizing factor 2           217   4e-67   Nicotiana tabacum [American tobacco]
ref|XP_006363318.1|  PREDICTED: actin-depolymerizing factor 7-like      216   5e-67   
gb|KCW46430.1|  hypothetical protein EUGRSUZ_K00262                     216   5e-67   
ref|XP_007038697.1|  Actin depolymerizing factor 7                      216   6e-67   
gb|KHN05922.1|  Actin-depolymerizing factor 2                           216   8e-67   
ref|XP_006353297.1|  PREDICTED: actin-depolymerizing factor 12-like     216   1e-66   
ref|XP_006424770.1|  hypothetical protein CICLE_v10029538mg             216   1e-66   
gb|AAM61402.1|  actin depolymerizing factor-like                        216   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009770352.1|  PREDICTED: actin-depolymerizing factor 7           216   1e-66   
ref|XP_006285474.1|  hypothetical protein CARUB_v10006893mg             216   1e-66   
ref|XP_009599636.1|  PREDICTED: actin-depolymerizing factor 7           216   1e-66   
ref|XP_002298043.1|  actin-depolymerizing factor family protein         216   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010482597.1|  PREDICTED: actin-depolymerizing factor 12          216   1e-66   
emb|CDY51146.1|  BnaA09g51810D                                          223   1e-66   
ref|XP_010521323.1|  PREDICTED: actin-depolymerizing factor 7-like      215   1e-66   
gb|AFN53632.1|  actin-depolymerizing factor 12                          223   1e-66   
ref|XP_010433613.1|  PREDICTED: actin-depolymerizing factor 7-like      215   2e-66   
ref|XP_008438059.1|  PREDICTED: actin-depolymerizing factor 7-like      215   2e-66   
ref|NP_001053519.1|  Os04g0555700                                       215   2e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010908104.1|  PREDICTED: zinc finger CCHC domain-containin...    223   2e-66   
ref|XP_009421345.1|  PREDICTED: actin-depolymerizing factor 7-like      215   2e-66   
gb|AFN53688.1|  putative actin-depolymerizing factor 12                 223   2e-66   
ref|XP_010537182.1|  PREDICTED: actin-depolymerizing factor 7-lik...    215   2e-66   
ref|XP_002448300.1|  hypothetical protein SORBIDRAFT_06g024870          215   2e-66   Sorghum bicolor [broomcorn]
ref|XP_006846080.1|  hypothetical protein AMTR_s00012p00089320          215   3e-66   
gb|KGN50293.1|  hypothetical protein Csa_5G165880                       214   3e-66   
ref|XP_009342975.1|  PREDICTED: actin-depolymerizing factor 7           214   3e-66   
gb|KDP25456.1|  hypothetical protein JCGZ_20612                         214   3e-66   
ref|XP_006843087.1|  hypothetical protein AMTR_s00140p00036970          214   3e-66   
gb|ADI78873.1|  actin-depolymerizing factor                             214   4e-66   
ref|XP_008437023.1|  PREDICTED: actin-depolymerizing factor 7           214   4e-66   
gb|KDP28647.1|  hypothetical protein JCGZ_14418                         214   5e-66   
ref|XP_010448409.1|  PREDICTED: actin-depolymerizing factor 7           214   5e-66   
ref|XP_010442763.1|  PREDICTED: actin-depolymerizing factor 12-like     214   6e-66   
ref|XP_004240732.1|  PREDICTED: actin-depolymerizing factor 7           214   7e-66   
ref|XP_006424771.1|  hypothetical protein CICLE_v10029538mg             214   7e-66   
gb|KGN56524.1|  hypothetical protein Csa_3G122480                       214   8e-66   
ref|XP_010055150.1|  PREDICTED: actin-depolymerizing factor 8           213   8e-66   
ref|XP_004496563.1|  PREDICTED: actin-depolymerizing factor 7-like      213   8e-66   
emb|CBI22738.3|  unnamed protein product                                213   9e-66   
ref|XP_009131962.1|  PREDICTED: actin-depolymerizing factor 3           213   9e-66   
gb|AEJ88268.1|  putative actin-depolymerizing factor                    213   1e-65   
ref|XP_011030201.1|  PREDICTED: uncharacterized protein LOC105129717    219   1e-65   
ref|XP_008376578.1|  PREDICTED: actin-depolymerizing factor 7 iso...    213   1e-65   
ref|XP_011084418.1|  PREDICTED: actin-depolymerizing factor 7           213   1e-65   
emb|CDY27075.1|  BnaA02g10950D                                          221   2e-65   
ref|XP_010669849.1|  PREDICTED: actin-depolymerizing factor 4-like      213   2e-65   
ref|XP_009397611.1|  PREDICTED: actin-depolymerizing factor 1-like      213   2e-65   
gb|AEW90956.1|  actin depolymerizing factor 4-2                         213   2e-65   
ref|XP_006400899.1|  hypothetical protein EUTSA_v10014975mg             212   3e-65   
gb|AEP25120.1|  actin depolymerising factor                             212   3e-65   
gb|KFK27528.1|  hypothetical protein AALP_AA8G395200                    212   3e-65   
ref|XP_004953378.1|  PREDICTED: actin-depolymerizing factor 1-like      212   3e-65   
ref|XP_004140838.1|  PREDICTED: uncharacterized protein LOC101212555    221   3e-65   
ref|XP_004157224.1|  PREDICTED: uncharacterized LOC101212555            221   3e-65   
ref|NP_001047657.1|  Os02g0663800                                       212   3e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010669850.1|  PREDICTED: actin-depolymerizing factor 4           212   3e-65   
ref|XP_002303579.1|  actin-depolymerizing factor family protein         212   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010537181.1|  PREDICTED: actin-depolymerizing factor 7-lik...    212   3e-65   
gb|KHG18554.1|  Actin-depolymerizing factor                             212   3e-65   
gb|AGW22223.1|  actin-depolymerizing factor 4                           212   3e-65   
gb|ABD66504.1|  actin depolymerizing factor 8                           212   4e-65   Gossypium hirsutum [American cotton]
ref|XP_009404611.1|  PREDICTED: actin-depolymerizing factor 7-like      212   4e-65   
ref|XP_008776502.1|  PREDICTED: actin-depolymerizing factor 7           212   4e-65   
ref|XP_006413292.1|  hypothetical protein EUTSA_v10026532mg             212   4e-65   
ref|XP_009388628.1|  PREDICTED: actin-depolymerizing factor 7           212   4e-65   
gb|KHG23104.1|  Actin-depolymerizing factor 1                           211   6e-65   
emb|CDY38916.1|  BnaA03g12630D                                          220   7e-65   
ref|XP_004503768.1|  PREDICTED: actin-depolymerizing factor 7-like      211   8e-65   
gb|AEW90955.1|  actin depolymerizing factor 4-1                         211   8e-65   
gb|ABX79380.1|  actin-depolymerizing factor                             211   9e-65   Gossypium barbadense [Egyptian cotton]
ref|XP_008804936.1|  PREDICTED: zinc finger CCHC domain-containin...    218   9e-65   
ref|XP_009420088.1|  PREDICTED: actin-depolymerizing factor 7-like      211   1e-64   
emb|CDX71068.1|  BnaC03g11520D                                          212   1e-64   
ref|XP_007144457.1|  hypothetical protein PHAVU_007G157800g             211   1e-64   
ref|NP_001238519.1|  uncharacterized protein LOC100499953               211   1e-64   
ref|XP_010535543.1|  PREDICTED: actin-depolymerizing factor 4           211   1e-64   
ref|XP_006436042.1|  hypothetical protein CICLE_v10033029mg             211   1e-64   
ref|XP_004142080.1|  PREDICTED: actin-depolymerizing factor 1-like      210   1e-64   
ref|XP_010553292.1|  PREDICTED: actin-depolymerizing factor 1           210   2e-64   
ref|XP_009593022.1|  PREDICTED: actin-depolymerizing factor 2-like      210   2e-64   
ref|XP_002511837.1|  actin depolymerizing factor, putative              210   2e-64   Ricinus communis
emb|CDX88730.1|  BnaA03g09190D                                          211   2e-64   
ref|XP_006490391.1|  PREDICTED: actin-depolymerizing factor 7-like      210   2e-64   
gb|AEZ00870.1|  putative actin depolymerizing factor protein            211   2e-64   
ref|NP_001151716.1|  LOC100285352                                       210   2e-64   Zea mays [maize]
gb|EYU25097.1|  hypothetical protein MIMGU_mgv11b015928mg               210   2e-64   
gb|ACR38016.1|  unknown                                                 210   2e-64   Zea mays [maize]
ref|XP_010253266.1|  PREDICTED: actin-depolymerizing factor 2           210   2e-64   
ref|XP_007206123.1|  hypothetical protein PRUPE_ppa013110mg             210   2e-64   
dbj|BAK04382.1|  predicted protein                                      210   3e-64   
ref|NP_001148898.1|  actin-depolymerizing factor                        209   3e-64   Zea mays [maize]
ref|XP_008447631.1|  PREDICTED: actin-depolymerizing factor 1-like      209   3e-64   
gb|KHG06644.1|  Actin-depolymerizing factor 1                           209   3e-64   
ref|XP_009389157.1|  PREDICTED: actin-depolymerizing factor 1-like      209   3e-64   
gb|EYU26572.1|  hypothetical protein MIMGU_mgv1a015955mg                209   3e-64   
ref|XP_007016496.1|  Actin depolymerizing factor 4                      209   3e-64   
ref|XP_007158489.1|  hypothetical protein PHAVU_002G156700g             209   4e-64   
ref|XP_006365713.1|  PREDICTED: actin-depolymerizing factor 2-like      209   4e-64   
ref|XP_008357628.1|  PREDICTED: actin-depolymerizing factor 1-like      209   4e-64   
ref|XP_008439227.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    217   4e-64   
ref|XP_008377508.1|  PREDICTED: actin-depolymerizing factor 7-lik...    209   5e-64   
ref|XP_009346958.1|  PREDICTED: actin-depolymerizing factor 1 iso...    209   5e-64   
ref|XP_006445079.1|  hypothetical protein CICLE_v10023747mg             209   5e-64   
gb|ABK94603.1|  unknown                                                 209   5e-64   Populus trichocarpa [western balsam poplar]
ref|XP_002284292.1|  PREDICTED: actin-depolymerizing factor 2           209   5e-64   Vitis vinifera
emb|CAJ38388.1|  actin-depolymerizing factor                            209   6e-64   Plantago major [cart-track plant]
ref|XP_010529845.1|  PREDICTED: actin-depolymerizing factor 2-like      209   6e-64   
ref|XP_004236758.1|  PREDICTED: actin-depolymerizing factor 2           209   6e-64   
ref|XP_010260094.1|  PREDICTED: actin-depolymerizing factor 2-like      209   7e-64   
ref|XP_003524462.1|  PREDICTED: actin-depolymerizing factor 7-like      209   8e-64   
gb|EYU18949.1|  hypothetical protein MIMGU_mgv1a015984mg                208   8e-64   
ref|XP_009767736.1|  PREDICTED: actin-depolymerizing factor 7-lik...    208   8e-64   
ref|XP_009358343.1|  PREDICTED: actin-depolymerizing factor 1-like      208   8e-64   
ref|XP_009586917.1|  PREDICTED: actin-depolymerizing factor 1           208   8e-64   
ref|NP_001148445.1|  actin-depolymerizing factor                        208   9e-64   Zea mays [maize]
ref|XP_010047513.1|  PREDICTED: actin-depolymerizing factor 2           208   1e-63   
ref|XP_009357677.1|  PREDICTED: actin-depolymerizing factor 1           208   1e-63   
ref|XP_009387944.1|  PREDICTED: zinc finger CCHC domain-containin...    216   1e-63   
ref|XP_002533101.1|  actin depolymerizing factor, putative              208   1e-63   Ricinus communis
ref|XP_006647644.1|  PREDICTED: actin-depolymerizing factor 1-like      208   1e-63   
gb|KHN48988.1|  Actin-depolymerizing factor 2                           209   1e-63   
ref|XP_009400269.1|  PREDICTED: actin-depolymerizing factor-like        208   1e-63   
ref|XP_002311154.2|  hypothetical protein POPTR_0008s05210g             211   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_004306801.1|  PREDICTED: actin-depolymerizing factor 10-like     208   1e-63   
gb|KHN16833.1|  Actin-depolymerizing factor 7                           209   1e-63   
ref|XP_009353719.1|  PREDICTED: actin-depolymerizing factor 1-like      208   1e-63   
ref|XP_008376580.1|  PREDICTED: uncharacterized protein LOC103439...    216   1e-63   
gb|KHN21743.1|  Actin-depolymerizing factor 7                           207   1e-63   
ref|XP_009416252.1|  PREDICTED: actin-depolymerizing factor 7-like      208   1e-63   
ref|XP_010920670.1|  PREDICTED: actin-depolymerizing factor 7           208   1e-63   
ref|XP_008343560.1|  PREDICTED: actin-depolymerizing factor 1           208   1e-63   
gb|KDP35600.1|  hypothetical protein JCGZ_09038                         207   1e-63   
ref|XP_008788089.1|  PREDICTED: actin-depolymerizing factor 7-like      207   2e-63   
ref|XP_002273958.2|  PREDICTED: actin-depolymerizing factor 1-like      209   2e-63   Vitis vinifera
ref|XP_004495011.1|  PREDICTED: actin-depolymerizing factor 2-like      207   2e-63   
ref|XP_010910431.1|  PREDICTED: actin-depolymerizing factor-like        207   2e-63   
ref|XP_010096647.1|  Actin-depolymerizing factor 2                      208   2e-63   
ref|XP_003532683.1|  PREDICTED: actin-depolymerizing factor 7-like      207   2e-63   
ref|XP_009601830.1|  PREDICTED: uncharacterized protein LOC104097027    218   2e-63   
ref|XP_004249528.1|  PREDICTED: actin-depolymerizing factor 1-like      207   2e-63   
emb|CDX91636.1|  BnaC02g15240D                                          207   2e-63   
ref|XP_008377514.1|  PREDICTED: uncharacterized protein LOC103440...    215   2e-63   
gb|EYU36258.1|  hypothetical protein MIMGU_mgv1a015971mg                207   2e-63   
ref|XP_009120511.1|  PREDICTED: actin-depolymerizing factor 3-like      207   2e-63   
ref|XP_010937681.1|  PREDICTED: actin-depolymerizing factor 7-like      207   2e-63   
dbj|BAK05349.1|  predicted protein                                      207   2e-63   
emb|CDX80216.1|  BnaC09g35260D                                          211   3e-63   
emb|CDY00526.1|  BnaA10g07470D                                          207   3e-63   
emb|CDX90057.1|  BnaA10g00250D                                          207   3e-63   
gb|ADV04049.1|  actin depolymerizing factor 4                           207   3e-63   
dbj|BAK06235.1|  predicted protein                                      207   3e-63   
ref|XP_006590210.1|  PREDICTED: uncharacterized protein LOC100804471    216   3e-63   
ref|XP_010922979.1|  PREDICTED: actin-depolymerizing factor 7-like      211   3e-63   
ref|XP_007027090.1|  Actin depolymerizing factor 4 isoform 2            208   3e-63   
ref|XP_007160047.1|  hypothetical protein PHAVU_002G288100g             208   3e-63   
ref|XP_010038440.1|  PREDICTED: uncharacterized protein LOC104426974    216   4e-63   
ref|XP_006606908.1|  PREDICTED: uncharacterized protein LOC100783153    215   4e-63   
gb|AET05009.2|  cofilin/actin-depolymerizing factor-like protein        206   4e-63   
ref|XP_007218573.1|  hypothetical protein PRUPE_ppa013105mg             206   4e-63   
ref|XP_002299887.1|  hypothetical protein POPTR_0001s24330g             206   5e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010909358.1|  PREDICTED: actin-depolymerizing factor 7-like      206   5e-63   
ref|XP_007218580.1|  hypothetical protein PRUPE_ppa013189mg             206   5e-63   
gb|AFK48761.1|  unknown                                                 206   5e-63   
ref|XP_008463478.1|  PREDICTED: actin-depolymerizing factor 2 iso...    206   6e-63   
ref|XP_007211217.1|  hypothetical protein PRUPE_ppa013153mg             206   6e-63   
ref|XP_008385227.1|  PREDICTED: actin-depolymerizing factor 1-like      206   6e-63   
ref|XP_004142738.1|  PREDICTED: actin-depolymerizing factor 2-like      206   6e-63   
emb|CDY31909.1|  BnaC09g28350D                                          206   6e-63   
ref|XP_003611106.1|  Actin depolymerizing factor                        206   7e-63   
ref|XP_011048781.1|  PREDICTED: uncharacterized protein LOC105142716    217   7e-63   
gb|AFK48601.1|  unknown                                                 206   7e-63   
ref|XP_009406977.1|  PREDICTED: actin-depolymerizing factor 2 iso...    206   7e-63   
ref|XP_010238336.1|  PREDICTED: actin-depolymerizing factor 9           206   9e-63   
ref|XP_011016059.1|  PREDICTED: actin-depolymerizing factor 2-like      206   1e-62   
ref|XP_009150048.1|  PREDICTED: actin-depolymerizing factor 2           205   1e-62   
sp|Q9FVI1.1|ADF2_PETHY  RecName: Full=Actin-depolymerizing factor...    206   1e-62   Petunia x hybrida [garden petunia]
ref|XP_004294586.1|  PREDICTED: actin-depolymerizing factor 2-lik...    205   1e-62   
ref|XP_006418975.1|  hypothetical protein EUTSA_v10002704mg             205   1e-62   
emb|CDP05195.1|  unnamed protein product                                205   1e-62   
ref|XP_002314195.1|  actin-depolymerizing factor family protein         205   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_003538360.1|  PREDICTED: actin-depolymerizing factor 7-lik...    205   2e-62   
ref|NP_190187.1|  actin depolymerizing factor 1                         205   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094831.1|  PREDICTED: actin-depolymerizing factor 1 iso...    205   2e-62   
ref|XP_006292022.1|  hypothetical protein CARUB_v10018211mg             205   2e-62   
gb|AAC13618.1|  Similar to actin binding protein; F6N23.12              204   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63340.1|  hypothetical protein M569_11446                         205   2e-62   
gb|ADV02778.1|  actin depolymerizing factor 1                           205   2e-62   
ref|XP_011077447.1|  PREDICTED: actin-depolymerizing factor 1-like      206   2e-62   
ref|XP_002510785.1|  actin depolymerizing factor, putative              216   2e-62   Ricinus communis
ref|XP_009126640.1|  PREDICTED: actin-depolymerizing factor 4 iso...    204   2e-62   
gb|KGN58886.1|  hypothetical protein Csa_3G734880                       204   2e-62   
ref|XP_006281290.1|  hypothetical protein CARUB_v10027340mg             204   3e-62   
sp|Q9FVI2.1|ADF1_PETHY  RecName: Full=Actin-depolymerizing factor...    204   3e-62   Petunia x hybrida [garden petunia]
gb|ACU23570.1|  unknown                                                 204   3e-62   Glycine max [soybeans]
ref|XP_009340028.1|  PREDICTED: uncharacterized protein LOC103932...    212   3e-62   
ref|XP_010245480.1|  PREDICTED: actin-depolymerizing factor 1-like      204   3e-62   
ref|XP_009419950.1|  PREDICTED: actin-depolymerizing factor 4           204   3e-62   
ref|XP_009109200.1|  PREDICTED: actin-depolymerizing factor-like        204   3e-62   
ref|XP_009137539.1|  PREDICTED: actin-depolymerizing factor-like        204   4e-62   
gb|KHG04895.1|  Actin-depolymerizing factor 10 -like protein            204   4e-62   
ref|XP_003637508.1|  Actin-depolymerizing factor                        204   4e-62   
ref|XP_009600590.1|  PREDICTED: actin-depolymerizing factor 2           204   4e-62   
dbj|BAB10533.1|  actin depolymerizing factor-like                       204   4e-62   
ref|XP_003630533.1|  Actin depolymerizing factor                        204   4e-62   
ref|XP_011027144.1|  PREDICTED: actin-depolymerizing factor 1-like      204   4e-62   
emb|CAL25339.1|  actin-depolymerizing factor                            204   5e-62   
gb|ACB32233.1|  actin-depolymerizing factor 1                           204   5e-62   
gb|AFK35836.1|  unknown                                                 204   5e-62   
ref|XP_009382377.1|  PREDICTED: actin-depolymerizing factor 1-like      204   5e-62   
ref|XP_004984753.1|  PREDICTED: actin-depolymerizing factor 7-lik...    204   5e-62   
ref|XP_009406976.1|  PREDICTED: actin-depolymerizing factor 7 iso...    204   5e-62   
ref|XP_008442569.1|  PREDICTED: actin-depolymerizing factor 2-like      204   5e-62   
ref|XP_004294585.1|  PREDICTED: actin-depolymerizing factor 2-lik...    204   5e-62   
gb|AFK45315.1|  unknown                                                 204   5e-62   
ref|XP_006339034.1|  PREDICTED: actin-depolymerizing factor 1-like      204   6e-62   
gb|ABD66505.1|  actin depolymerizing factor 3                           204   6e-62   
ref|XP_008392560.1|  PREDICTED: actin-depolymerizing factor 7-like      204   6e-62   
gb|ABD63906.1|  actin depolymerizing factor 2                           203   7e-62   
ref|XP_006418977.1|  hypothetical protein EUTSA_v10002714mg             203   7e-62   
ref|XP_002284029.1|  PREDICTED: actin-depolymerizing factor 2-lik...    203   8e-62   
ref|XP_009775372.1|  PREDICTED: actin-depolymerizing factor 2-like      203   9e-62   
ref|XP_002316301.1|  actin-depolymerizing factor family protein         203   9e-62   
emb|CAA18167.1|  actin depolymerizing factor-like protein               203   9e-62   
ref|XP_002528457.1|  actin depolymerizing factor, putative              203   1e-61   
ref|XP_004511586.1|  PREDICTED: actin-depolymerizing factor 7-lik...    203   1e-61   
ref|XP_010040886.1|  PREDICTED: actin-depolymerizing factor 7-like      202   1e-61   
emb|CDX99133.1|  BnaA06g18240D                                          204   1e-61   
emb|CDP06641.1|  unnamed protein product                                204   1e-61   
ref|XP_006590525.1|  PREDICTED: actin-depolymerizing factor 7-lik...    203   1e-61   
gb|EPS73519.1|  actin-depolymerizing factor                             203   1e-61   
ref|XP_010514926.1|  PREDICTED: actin-depolymerizing factor 1           203   1e-61   
gb|AAT42170.1|  putative actin depolymerizing factor                    213   1e-61   
ref|XP_002468086.1|  hypothetical protein SORBIDRAFT_01g039300          202   1e-61   
ref|XP_009767730.1|  PREDICTED: uncharacterized protein LOC104218...    207   1e-61   
ref|XP_009612959.1|  PREDICTED: actin-depolymerizing factor 2-like      202   2e-61   
ref|NP_001078247.1|  actin depolymerizing factor 1                      203   2e-61   
ref|XP_006418976.1|  hypothetical protein EUTSA_v10002704mg             203   2e-61   
ref|XP_011000294.1|  PREDICTED: actin-depolymerizing factor 2-like      202   2e-61   
ref|XP_006341057.1|  PREDICTED: actin-depolymerizing factor 1-like      202   2e-61   
ref|XP_006281292.1|  hypothetical protein CARUB_v10027342mg             202   2e-61   
ref|XP_009337572.1|  PREDICTED: actin-depolymerizing factor 1-like      202   2e-61   
ref|XP_010031001.1|  PREDICTED: actin-depolymerizing factor 2-like      202   2e-61   
gb|ACJ84058.1|  unknown                                                 202   2e-61   
ref|XP_010503215.1|  PREDICTED: actin-depolymerizing factor 1-like      202   2e-61   
ref|XP_002299888.1|  actin-depolymerizing factor family protein         202   2e-61   
emb|CBI31711.3|  unnamed protein product                                204   2e-61   
ref|XP_010455704.1|  PREDICTED: actin-depolymerizing factor 3           202   2e-61   
ref|XP_004172071.1|  PREDICTED: actin-depolymerizing factor 1-like      202   3e-61   
gb|EEE61469.1|  hypothetical protein OsJ_15732                          210   3e-61   
gb|EAY95118.1|  hypothetical protein OsI_16935                          210   3e-61   
ref|XP_010543331.1|  PREDICTED: actin-depolymerizing factor 1-like      202   3e-61   
ref|XP_010671964.1|  PREDICTED: actin-depolymerizing factor 7           201   3e-61   
ref|NP_001059648.1|  Os07g0484200                                       202   3e-61   
gb|EEC82036.1|  hypothetical protein OsI_26009                          202   3e-61   
ref|XP_011094830.1|  PREDICTED: actin-depolymerizing factor 1 iso...    202   4e-61   
ref|XP_009131961.1|  PREDICTED: actin-depolymerizing factor 4-like      202   4e-61   
ref|XP_002314194.1|  actin-depolymerizing factor 3 family protein       202   4e-61   
ref|NP_001240195.1|  uncharacterized protein LOC100795241               201   4e-61   
emb|CDX86048.1|  BnaC03g55630D                                          202   4e-61   
ref|NP_851228.1|  actin depolymerizing factor 4                         201   4e-61   
ref|XP_004246462.1|  PREDICTED: actin-depolymerizing factor 1           201   5e-61   
gb|EPS60626.1|  hypothetical protein M569_14175                         202   5e-61   
ref|XP_010503214.1|  PREDICTED: actin-depolymerizing factor 2           201   6e-61   
emb|CDX92721.1|  BnaC07g39790D                                          202   6e-61   
emb|CDX88731.1|  BnaA03g09180D                                          203   6e-61   
ref|XP_002864656.1|  hypothetical protein ARALYDRAFT_496124             201   6e-61   
gb|KFK33962.1|  hypothetical protein AALP_AA5G084200                    201   6e-61   
ref|XP_010426028.1|  PREDICTED: actin-depolymerizing factor 1-like      201   7e-61   
ref|XP_004511585.1|  PREDICTED: actin-depolymerizing factor 7-lik...    201   7e-61   
ref|XP_010455715.1|  PREDICTED: actin-depolymerizing factor 4           201   7e-61   
ref|XP_011042674.1|  PREDICTED: actin-depolymerizing factor 2-lik...    201   8e-61   
ref|XP_004984752.1|  PREDICTED: actin-depolymerizing factor 7-lik...    201   8e-61   
ref|XP_010426027.1|  PREDICTED: actin-depolymerizing factor 2-like      201   8e-61   
ref|XP_004152385.1|  PREDICTED: actin-depolymerizing factor 7-like      200   8e-61   
gb|KDP29838.1|  hypothetical protein JCGZ_18413                         201   8e-61   
gb|ABD66508.1|  actin depolymerizing factor 6                           201   8e-61   
ref|XP_006292028.1|  hypothetical protein CARUB_v10018217mg             201   9e-61   
ref|XP_004133872.1|  PREDICTED: actin-depolymerizing factor 10-like     200   1e-60   
emb|CDY09242.1|  BnaA02g06680D                                          201   1e-60   
ref|XP_006657701.1|  PREDICTED: actin-depolymerizing factor 9-like      200   1e-60   
ref|XP_009371344.1|  PREDICTED: uncharacterized protein LOC103960584    210   2e-60   
ref|XP_002877448.1|  hypothetical protein ARALYDRAFT_484979             200   2e-60   
ref|XP_010514925.1|  PREDICTED: actin-depolymerizing factor 2-like      199   2e-60   
ref|XP_006491074.1|  PREDICTED: actin-depolymerizing factor 10-like     199   2e-60   
ref|XP_007206122.1|  hypothetical protein PRUPE_ppa013109mg             199   3e-60   
ref|XP_007147534.1|  hypothetical protein PHAVU_006G132700g             199   3e-60   
ref|XP_004149045.1|  PREDICTED: actin-depolymerizing factor 2-lik...    199   3e-60   
ref|XP_002969368.1|  hypothetical protein SELMODRAFT_146459             199   4e-60   
ref|XP_008371032.1|  PREDICTED: actin-depolymerizing factor 1           199   4e-60   
ref|XP_007027089.1|  Actin depolymerizing factor 4 isoform 1            201   4e-60   
ref|XP_006572866.1|  PREDICTED: uncharacterized protein LOC100795...    199   4e-60   
gb|EMT04440.1|  Actin-depolymerizing factor 1                           199   4e-60   
ref|XP_008369858.1|  PREDICTED: actin-depolymerizing factor 2-like      199   5e-60   
gb|AAD09110.1|  actin depolymerizing factor 4                           199   5e-60   
ref|XP_010105396.1|  Actin-depolymerizing factor 7                      198   5e-60   
gb|EAY86979.1|  hypothetical protein OsI_08373                          198   6e-60   
ref|NP_566882.1|  actin depolymerizing factor 2                         198   6e-60   
ref|XP_009374667.1|  PREDICTED: actin-depolymerizing factor 2-lik...    199   6e-60   
ref|XP_010534301.1|  PREDICTED: actin-depolymerizing factor 1-like      198   8e-60   
ref|XP_002452789.1|  hypothetical protein SORBIDRAFT_04g032550          198   8e-60   
ref|XP_002439159.1|  hypothetical protein SORBIDRAFT_09g001500          198   8e-60   
ref|XP_006367965.1|  PREDICTED: actin-depolymerizing factor 2-like      198   8e-60   
ref|XP_007009413.1|  Actin depolymerizing factor 4 isoform 1            208   9e-60   
ref|XP_008233662.1|  PREDICTED: uncharacterized protein LOC103332693    209   9e-60   
emb|CDY50194.1|  BnaA03g47540D                                          201   1e-59   
ref|XP_010558792.1|  PREDICTED: actin-depolymerizing factor 2-lik...    197   1e-59   
gb|ABC49719.1|  actin depolymerizing factor-like protein                197   1e-59   
gb|ACR34799.1|  unknown                                                 197   2e-59   
emb|CDY31586.1|  BnaA10g12850D                                          197   2e-59   
ref|XP_010031003.1|  PREDICTED: actin-depolymerizing factor 2-like      197   2e-59   
ref|NP_851227.1|  actin depolymerizing factor 3                         197   2e-59   
ref|XP_011076485.1|  PREDICTED: uncharacterized protein C683.02c        205   2e-59   
ref|XP_004486422.1|  PREDICTED: actin-depolymerizing factor 2-like      197   2e-59   
ref|NP_001105463.1|  actin-depolymerizing factor 1                      197   2e-59   
gb|ABK21557.1|  unknown                                                 198   2e-59   
ref|XP_006436041.1|  hypothetical protein CICLE_v10033029mg             197   3e-59   
ref|XP_006586815.1|  PREDICTED: actin-depolymerizing factor 2-like      197   3e-59   
ref|NP_001236448.1|  uncharacterized protein LOC100305514               197   3e-59   
gb|KCW50259.1|  hypothetical protein EUGRSUZ_J00048                     196   3e-59   
ref|XP_006421922.1|  hypothetical protein CICLE_v10007087mg             196   4e-59   
ref|XP_006653969.1|  PREDICTED: actin-depolymerizing factor 7-like      196   4e-59   
ref|XP_008457551.1|  PREDICTED: actin-depolymerizing factor 2           196   4e-59   
sp|Q0DLA3.2|ADF7_ORYSJ  RecName: Full=Actin-depolymerizing factor...    196   5e-59   
ref|XP_010533658.1|  PREDICTED: actin-depolymerizing factor 8-like      196   5e-59   
ref|XP_010089132.1|  Actin-depolymerizing factor 7                      195   8e-59   
ref|XP_008647356.1|  PREDICTED: hypothetical protein isoform X1         196   8e-59   
emb|CDP09013.1|  unnamed protein product                                195   8e-59   
gb|ABK22764.1|  unknown                                                 196   8e-59   
gb|EMS51874.1|  Actin-depolymerizing factor 6                           201   9e-59   
gb|ACN27286.1|  unknown                                                 195   1e-58   
ref|XP_010111772.1|  Actin-depolymerizing factor 1                      195   1e-58   
emb|CAJ38384.1|  actin-depolymerizing factor                            195   1e-58   
emb|CBI16177.3|  unnamed protein product                                195   1e-58   
ref|XP_004957704.1|  PREDICTED: actin-depolymerizing factor 2-like      195   2e-58   
gb|KFK27529.1|  hypothetical protein AALP_AA8G395300                    195   2e-58   
ref|XP_002460700.1|  hypothetical protein SORBIDRAFT_02g033380          195   2e-58   
ref|XP_009767744.1|  PREDICTED: actin-depolymerizing factor 7-lik...    194   2e-58   
ref|XP_008651860.1|  PREDICTED: actin-depolymerizing factor 1 iso...    195   2e-58   
gb|KDP44204.1|  hypothetical protein JCGZ_05671                         194   2e-58   
gb|AAR23800.1|  putative actin-depolymerizing factor 2                  194   2e-58   
ref|XP_004240356.1|  PREDICTED: actin-depolymerizing factor 2-like      194   3e-58   
ref|XP_010528350.1|  PREDICTED: actin-depolymerizing factor 1-like      194   3e-58   
ref|XP_008234462.1|  PREDICTED: uncharacterized protein LOC103333411    204   4e-58   
ref|NP_001105590.1|  actin-depolymerizing factor 2                      194   4e-58   
gb|KFK30636.1|  hypothetical protein AALP_AA6G007700                    197   4e-58   
gb|ABK26220.1|  unknown                                                 194   4e-58   
ref|XP_008387742.1|  PREDICTED: actin-depolymerizing factor 2-like      194   4e-58   
ref|NP_001054456.1|  Os05g0113400                                       193   5e-58   
gb|AES62539.2|  cofilin/actin-depolymerizing factor-like protein        206   5e-58   
gb|EMT14364.1|  Actin-depolymerizing factor 6                           193   7e-58   
ref|XP_003592288.1|  Actin depolymerizing factor                        206   7e-58   
gb|AFS49701.1|  actin-depolymerizing factor 7                           193   7e-58   
ref|XP_010227222.1|  PREDICTED: uncharacterized protein LOC100826202    204   8e-58   
gb|ACG37280.1|  actin-depolymerizing factor 1                           193   9e-58   
ref|XP_003594440.1|  Actin depolymerizing factor                        192   1e-57   
ref|XP_003569002.1|  PREDICTED: actin-depolymerizing factor 7           192   1e-57   
dbj|BAJ93061.1|  predicted protein                                      192   2e-57   
gb|KHN35014.1|  Actin-depolymerizing factor 7                           191   4e-57   
ref|XP_008668647.1|  PREDICTED: actin-depolymerizing factor 2 iso...    191   4e-57   
emb|CDX94438.1|  BnaC01g17460D                                          191   4e-57   
ref|XP_003629907.1|  Actin depolymerizing factor-like protein           191   4e-57   
ref|XP_003570044.1|  PREDICTED: actin-depolymerizing factor 1           191   5e-57   
ref|XP_009628017.1|  PREDICTED: actin-depolymerizing factor 7-like      191   6e-57   
emb|CDY52365.1|  BnaA08g31000D                                          190   6e-57   
gb|AAD51856.1|AF179295_1  putative actin depolymerizing factor          190   6e-57   
gb|ABF60823.1|  actin depolymerizing factor                             190   9e-57   
ref|XP_008793579.1|  PREDICTED: actin-depolymerizing factor 11 is...    191   1e-56   
ref|XP_008385142.1|  PREDICTED: actin-depolymerizing factor 1-like      190   1e-56   
gb|EPS71217.1|  hypothetical protein M569_03542                         190   1e-56   
ref|XP_004300779.1|  PREDICTED: actin-depolymerizing factor 7-like      189   1e-56   
ref|XP_004302775.1|  PREDICTED: actin-depolymerizing factor 3-lik...    190   2e-56   
ref|XP_008787346.1|  PREDICTED: actin-depolymerizing factor-like ...    190   2e-56   
gb|ACJ84098.1|  unknown                                                 189   2e-56   
ref|XP_006418978.1|  hypothetical protein EUTSA_v10002714mg             189   2e-56   
ref|XP_008787347.1|  PREDICTED: actin-depolymerizing factor 11-li...    189   2e-56   
ref|XP_009408567.1|  PREDICTED: actin-depolymerizing factor 11-like     189   3e-56   
gb|EMT12807.1|  Actin-depolymerizing factor 7                           191   3e-56   
gb|AFK42408.1|  unknown                                                 189   4e-56   
gb|KCW50261.1|  hypothetical protein EUGRSUZ_J00048                     188   4e-56   
ref|XP_010906274.1|  PREDICTED: actin-depolymerizing factor-like ...    189   4e-56   
ref|XP_004960504.1|  PREDICTED: actin-depolymerizing factor 7-like      188   5e-56   
gb|AFK39900.1|  unknown                                                 188   6e-56   
emb|CDX71067.1|  BnaC03g11510D                                          188   7e-56   
ref|XP_009388955.1|  PREDICTED: actin-depolymerizing factor 11-like     188   7e-56   
ref|XP_008343556.1|  PREDICTED: actin-depolymerizing factor 1-like      187   1e-55   
ref|NP_568916.2|  actin depolymerizing factor 4                         187   1e-55   
ref|XP_002877449.1|  hypothetical protein ARALYDRAFT_484981             187   2e-55   
ref|XP_004307557.1|  PREDICTED: actin-depolymerizing factor 2-like      187   2e-55   
ref|XP_002864657.1|  hypothetical protein ARALYDRAFT_332260             187   2e-55   
emb|CDP00056.1|  unnamed protein product                                186   2e-55   
gb|AEJ90198.1|  actin depolymerizing factor 1                           187   3e-55   
ref|XP_004309205.1|  PREDICTED: uncharacterized protein LOC101314811    195   3e-55   
ref|XP_008241374.1|  PREDICTED: actin-depolymerizing factor 2-like      186   5e-55   
ref|NP_001067327.1|  Os12g0628100                                       186   7e-55   
emb|CAB82824.1|  actin depolymerizing factor 2 (ADF2)                   185   1e-54   
ref|NP_001239657.1|  uncharacterized protein LOC100819975               185   1e-54   
ref|NP_001236003.1|  uncharacterized protein LOC100527688               184   2e-54   
gb|EEC69719.1|  hypothetical protein OsI_39206                          184   2e-54   
gb|AFK34162.1|  unknown                                                 184   2e-54   
ref|XP_009139339.1|  PREDICTED: actin-depolymerizing factor             184   2e-54   
gb|KCW50264.1|  hypothetical protein EUGRSUZ_J00048                     184   3e-54   
ref|XP_009388500.1|  PREDICTED: actin-depolymerizing factor 11          184   3e-54   
ref|XP_007162541.1|  hypothetical protein PHAVU_001G160700g             184   5e-54   
ref|XP_007050307.1|  Actin depolymerizing factor 6 isoform 1            183   7e-54   
ref|XP_006656880.1|  PREDICTED: actin-depolymerizing factor 6-like      183   8e-54   
ref|XP_010923770.1|  PREDICTED: actin-depolymerizing factor-like ...    183   8e-54   
emb|CDO99231.1|  unnamed protein product                                183   9e-54   
ref|XP_006664223.1|  PREDICTED: actin-depolymerizing factor 11-like     182   1e-53   
gb|AFK34925.1|  unknown                                                 182   1e-53   
ref|XP_004504229.1|  PREDICTED: actin-depolymerizing factor 2-like      182   1e-53   
gb|ADE75680.1|  unknown                                                 182   2e-53   
ref|XP_010111917.1|  Actin-depolymerizing factor 6                      182   2e-53   
ref|XP_007035112.1|  Actin depolymerizing factor 6                      182   2e-53   
ref|XP_008787348.1|  PREDICTED: actin-depolymerizing factor-like ...    181   3e-53   
ref|XP_010555867.1|  PREDICTED: actin-depolymerizing factor 6-like      181   3e-53   
gb|ABK23520.1|  unknown                                                 181   4e-53   



>ref|XP_006341722.1| PREDICTED: actin-depolymerizing factor 10-like [Solanum tuberosum]
Length=139

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKL+FLELK+KRN+R++VFKIDE+ Q VVVEK+G   ETH  F+NSM
Sbjct  1    MANSASGIAVSDECKLRFLELKAKRNHRFLVFKIDESVQQVVVEKVGGQAETHDDFANSM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PP+ECRYAV+DYD+TTDEN QKS+IFFVAW+PETA +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PPSECRYAVFDYDWTTDENVQKSRIFFVAWSPETARVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLDTF GR +
Sbjct  121  LQATDPSEMSLDTFIGRIH  139



>ref|XP_009787751.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana sylvestris]
Length=139

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KR++RYIVFKID++   VVVEK+G ++ETH  F+N++
Sbjct  1    MANSASGIAVSDECKLKFLELKAKRDHRYIVFKIDDSGHQVVVEKVGRNDETHEDFANNL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAV+DYDFTT+EN QKSKIFFVAWAPETA +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PPNECRYAVFDYDFTTNENVQKSKIFFVAWAPETARVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATD SEMSLDTF GRA
Sbjct  121  LQATDASEMSLDTFIGRA  138



>ref|XP_010327379.1| PREDICTED: actin-depolymerizing factor 10-like [Solanum lycopersicum]
Length=146

 Score =   237 bits (605),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKL+FLELK+KRN+RY+VFKIDE+ Q VVVEK+G   ETH  F+NSMP
Sbjct  9    ANSASGIAVSDECKLRFLELKAKRNHRYLVFKIDESVQQVVVEKVGGQTETHDDFANSMP  68

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
            P+ECRYAV+DYD+TTDEN QKS+IFFVAW+PETA +RSKM+YASSKDRFRRELDGVQVEL
Sbjct  69   PSECRYAVFDYDWTTDENVQKSRIFFVAWSPETARVRSKMLYASSKDRFRRELDGVQVEL  128

Query  289  QATDPSEMSLDTFKGRAY  236
            QATDPSEMSLDTF GR +
Sbjct  129  QATDPSEMSLDTFVGRIH  146



>ref|XP_009615468.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana tomentosiformis]
Length=140

 Score =   236 bits (603),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKFLELK+KRN+RYIVFKI+E+ Q VVVEK+G   ETH  F+NS+
Sbjct  1    MANSASGIAVSDDCKLKFLELKAKRNHRYIVFKIEESVQQVVVEKVGGQAETHEDFANSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAV+DYD+TT+EN QKS+IFFVAW+PETA +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PPNECRYAVFDYDWTTNENVQKSRIFFVAWSPETARVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDPSEMSLDTF GR
Sbjct  121  LQATDPSEMSLDTFIGR  137



>ref|XP_009595762.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana tomentosiformis]
Length=139

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLK+LELK+KR++RYIVFKID++   VVVEK+G ++ETH  F+N++
Sbjct  1    MANSASGIAVSDECKLKYLELKAKRDHRYIVFKIDDSGHQVVVEKVGRNDETHEDFANNL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAV+DYDFTT+EN QKSKIFFVAWAPETA +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PPNECRYAVFDYDFTTNENVQKSKIFFVAWAPETARVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATD SEMSLDTF GRA
Sbjct  121  LQATDASEMSLDTFIGRA  138



>ref|XP_011093147.1| PREDICTED: actin-depolymerizing factor 10-like [Sesamum indicum]
Length=139

 Score =   234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRN+RYIVFKID+  Q V+VEK G+H E +  F+NS+
Sbjct  1    MANSASGIAVNDECKLKFLELKAKRNFRYIVFKIDDTVQEVMVEKAGNHGENYEDFTNSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+DYDFTTDENC KSKIFF+AW+P+TA +R+KM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVFDYDFTTDENCHKSKIFFIAWSPDTARVRTKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLD FK RAY
Sbjct  121  LQATDPSEMSLDIFKERAY  139



>ref|XP_009771651.1| PREDICTED: actin-depolymerizing factor 12-like [Nicotiana sylvestris]
Length=137

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKF+ELK+KRNYRYIVFKI+   Q VVVEK+G   ETH  F+NS+
Sbjct  1    MANSASGIAVSDECKLKFMELKAKRNYRYIVFKIE--GQQVVVEKVGEQGETHEDFANSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+DYDFTTDEN QKSKIFFVAW+PETA +RSKM+YASSKDRFRRE DGVQVE
Sbjct  59   PSNECRYAVFDYDFTTDENVQKSKIFFVAWSPETARVRSKMLYASSKDRFRREFDGVQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLDTF GRA
Sbjct  119  LQATDPSEMSLDTFIGRA  136



>ref|XP_009793423.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana sylvestris]
Length=140

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKFLELK+KRN+RY+VFKI+E+ Q VVVEK+G   ETH  F++S+
Sbjct  1    MANSASGIAVSDDCKLKFLELKAKRNHRYLVFKIEESVQQVVVEKVGGQAETHDDFASSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAV+DYD+TT+EN QKS+IFFVAW+PETA +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PPNECRYAVFDYDWTTNENVQKSRIFFVAWSPETARVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDPSEMSLDTF GR
Sbjct  121  LQATDPSEMSLDTFIGR  137



>ref|XP_009630108.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana tomentosiformis]
Length=137

 Score =   232 bits (591),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKF+ELK+KRNYRYIVFKI+   Q VVV+K+G   ETH  FSNS+
Sbjct  1    MANSASGIAVSDECKLKFMELKAKRNYRYIVFKIE--GQQVVVDKVGEQGETHQDFSNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+DYD+TTDEN QKSKIFFVAW+PETA +RSKM+YASSKDRFRRE DGVQVE
Sbjct  59   PSNECRYAVFDYDYTTDENVQKSKIFFVAWSPETARVRSKMLYASSKDRFRREFDGVQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLDTF GRA
Sbjct  119  LQATDPSEMSLDTFIGRA  136



>ref|XP_006339546.1| PREDICTED: actin-depolymerizing factor 12-like [Solanum tuberosum]
Length=137

 Score =   231 bits (590),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKF+ELK+KRN+RYIVFKID   Q VVVEK+G   ETH  F+NS+
Sbjct  1    MANSASGIAVSDECKLKFMELKAKRNHRYIVFKID--GQQVVVEKVGGQAETHDDFANSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAV+DYDFTT+EN QKSKIFFVAW+PETA +RSKM+YASSKDRFRRE DGVQVE
Sbjct  59   PPNECRYAVFDYDFTTNENVQKSKIFFVAWSPETARVRSKMLYASSKDRFRREFDGVQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLDTF  RA
Sbjct  119  LQATDPSEMSLDTFVCRA  136



>ref|XP_002271495.1| PREDICTED: actin-depolymerizing factor 10 [Vitis vinifera]
 emb|CAN73839.1| hypothetical protein VITISV_012391 [Vitis vinifera]
Length=139

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRN+R+IVFKIDE  Q V+VEKLGS +ET+  F+NS+
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSPDETYEDFTNSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTTDENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  KGRA
Sbjct  121  LQATDPSEMSMDIIKGRA  138



>ref|XP_011091992.1| PREDICTED: actin-depolymerizing factor 10-like [Sesamum indicum]
Length=139

 Score =   229 bits (585),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYRYI+FKID+  Q V+VEK G H ET+  F++S+
Sbjct  1    MANSASGIAVSDECKLKFLELKAKRNYRYIIFKIDDNVQQVMVEKAGDHAETYEHFTSSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P N+CRYAV+DYDFTTDENC KSKIFF+AW+P+TA +R+KM+YASSKDRF+RELDG+Q E
Sbjct  61   PDNDCRYAVFDYDFTTDENCHKSKIFFIAWSPDTARVRTKMLYASSKDRFKRELDGIQAE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS DT K RA+
Sbjct  121  LQATDPSEMSWDTLKARAF  139



>ref|XP_010544380.1| PREDICTED: actin-depolymerizing factor 8 isoform X2 [Tarenaya 
hassleriana]
Length=139

 Score =   229 bits (585),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KR+YR+IVFKIDE  Q VVV+K+G+ EET+  F++SM
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRSYRFIVFKIDEKVQKVVVDKIGNPEETYDDFTSSM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT +NCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PENECRYAVYDFDFTTKDNCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLD  KGRA+
Sbjct  121  LQATDPSEMSLDIIKGRAF  139



>emb|CBI40336.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -1

Query  658  HKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSN  479
            H MANSASG+ V DECKLKFLELK+KRN+R+IVFKIDE  Q V+VEKLGS +ET+  F+N
Sbjct  116  HNMANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSPDETYEDFTN  175

Query  478  SMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQ  299
            S+P +ECRYAV+D+DFTTDENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+Q
Sbjct  176  SLPADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQ  235

Query  298  VELQATDPSEMSLDTFKGRA  239
            VELQATDPSEMS+D  KGRA
Sbjct  236  VELQATDPSEMSMDIIKGRA  255



>ref|XP_010662752.1| PREDICTED: actin-depolymerizing factor 1 [Vitis vinifera]
Length=139

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRN+R+IVFKI+E  Q VVVEKLGS +E++  F++S+
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIEEKIQQVVVEKLGSPDESYDAFTSSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DFTTDENCQKSKIFF+AWAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVFDFDFTTDENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  121  LQATDPSEMSLDIVKSRA  138



>gb|EYU32098.1| hypothetical protein MIMGU_mgv1a026462mg, partial [Erythranthe 
guttata]
Length=138

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKLKFLELK+KRN+RYIVFKID+  Q V+VEK+G+  ET+  F+NS+P
Sbjct  1    ANSASGIAVSDECKLKFLELKAKRNHRYIVFKIDDTVQQVMVEKVGTQAETYEDFANSLP  60

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             N+CRYAV+DYDFTTDENC+KSKIFF+AW+P+ A +R+KM+YASSKDRF+RELDG+QVEL
Sbjct  61   DNDCRYAVFDYDFTTDENCRKSKIFFIAWSPDIAKVRTKMLYASSKDRFKRELDGIQVEL  120

Query  289  QATDPSEMSLDTFKGRAY  236
            QATDPSEMS DT K RAY
Sbjct  121  QATDPSEMSWDTLKARAY  138



>gb|KCW71635.1| hypothetical protein EUGRSUZ_E00162 [Eucalyptus grandis]
Length=139

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANS+SG+ V DECKLKFLELK+KR YR+IVFKI+E  Q V +EKLGS EET+  FS+S+
Sbjct  1    MANSSSGMAVDDECKLKFLELKTKRIYRFIVFKIEEKIQQVTIEKLGSPEETYDDFSSSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTTDENCQKSKIFF+AWAPET+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFTTDENCQKSKIFFIAWAPETSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  +GRA
Sbjct  121  LQATDPSEMSIDIIRGRA  138



>ref|NP_171680.1| actin depolymerizing factor 11 [Arabidopsis thaliana]
 sp|Q9LQ81.1|ADF10_ARATH RecName: Full=Actin-depolymerizing factor 10; Short=ADF-10; Short=AtADF10 
[Arabidopsis thaliana]
 gb|AAF78408.1|AC009273_14 Contains similarity to actin depolymerizing factor 4 from Arabidopsis 
thaliana gb|AF102822. It contains cofilin/tropomyosin-type 
actin-binding proteins PF|00241. EST gb|AA720247 comes 
from this gene [Arabidopsis thaliana]
 gb|AAL62402.1| actin depolymerizing factor, putative [Arabidopsis thaliana]
 gb|AAM65844.1| Actin-depolymerizing factor like At1g01750 (ADF-like) [Arabidopsis 
thaliana]
 gb|AAN65137.1| actin depolymerizing factor, putative [Arabidopsis thaliana]
 gb|AEE27331.1| actin depolymerizing factor 11 [Arabidopsis thaliana]
Length=140

 Score =   227 bits (578),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+IVFKIDE +Q V+++KLG+ EET+  F+ S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYEDFTRSI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYDYDFTT ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PEDECRYAVYDYDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGR 
Sbjct  121  LQATDPSEMSLDIIKGRV  138



>emb|CDP08835.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   228 bits (580),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANS SG+ V DECKLKFLELK+KRNYRYIVFKID+ S+ V +EKLGSH+ET+  F+NS+P
Sbjct  23   ANSVSGIAVHDECKLKFLELKAKRNYRYIVFKIDDISKQVAIEKLGSHDETYEDFTNSLP  82

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             ++CRYAV+DYDFTT+ENC KSKI+F+AW+P+T+ IR+KMVYASSKDRF+RELDG+QVEL
Sbjct  83   ADQCRYAVFDYDFTTEENCHKSKIYFIAWSPDTSKIRAKMVYASSKDRFKRELDGIQVEL  142

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMSLD  + RA
Sbjct  143  QATDPSEMSLDVIRSRA  159



>ref|XP_010249803.1| PREDICTED: actin-depolymerizing factor [Nelumbo nucifera]
Length=139

 Score =   226 bits (577),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKFLELK+KRNYR+IVFKIDE  Q V+VE+LG+ EE++  F+  +
Sbjct  1    MANSASGMAVNDDCKLKFLELKAKRNYRFIVFKIDEKIQQVMVERLGNPEESYEDFTACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DFTTDENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  KGRA
Sbjct  121  LQATDPSEMSMDIIKGRA  138



>ref|XP_010479839.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
 ref|XP_010457085.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
 ref|XP_010474795.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
Length=140

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYRYI+FKIDE +Q V+++KLG+ EET+  F+ S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRYIIFKIDEKAQQVMIDKLGNPEETYDDFTGSI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RE+DG+QVE
Sbjct  61   PEDECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGR 
Sbjct  121  LQATDPSEMSLDIIKGRV  138



>ref|XP_010053689.1| PREDICTED: actin-depolymerizing factor [Eucalyptus grandis]
 gb|KCW78051.1| hypothetical protein EUGRSUZ_D02275 [Eucalyptus grandis]
Length=139

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRN+R+IVFKIDE  Q V VEK+GS EET+  F+  M
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIDEKIQQVSVEKVGSPEETYDDFTACM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DF TDENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVFDFDFITDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  KGRA
Sbjct  121  LQATDPSEMSIDIIKGRA  138



>ref|XP_002865909.1| hypothetical protein ARALYDRAFT_495305 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006281622.1| hypothetical protein CARUB_v10027750mg [Capsella rubella]
 gb|EFH42168.1| hypothetical protein ARALYDRAFT_495305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA14520.1| hypothetical protein CARUB_v10027750mg [Capsella rubella]
Length=137

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS EE +  FSNS+
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAVYD+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PPNECRYAVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  119  LQATDPSEMSLDIIKSRA  136



>ref|XP_006304638.1| hypothetical protein CARUB_v10011760mg [Capsella rubella]
 gb|EOA37536.1| hypothetical protein CARUB_v10011760mg [Capsella rubella]
Length=140

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+IVFKIDE +Q V+++KLG+ EET+  F+ S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYDDFTRSI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PEDECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGR 
Sbjct  121  LQATDPSEMSLDIIKGRV  138



>ref|XP_007051847.1| Actin depolymerizing factor 11 [Theobroma cacao]
 gb|EOX96004.1| Actin depolymerizing factor 11 [Theobroma cacao]
Length=139

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANS+SG+ + DECKLKFLELK+KRN+RYIVFKIDE +Q V+VEKLGS   T+  F+NS+
Sbjct  1    MANSSSGMAMNDECKLKFLELKAKRNHRYIVFKIDEKTQQVIVEKLGSPGATYDDFTNSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+DY+FTT+ENCQKSKIFF AW+P+T+ +RSKM+YASSKD+F+R+LDG+QVE
Sbjct  61   PANECRYAVFDYNFTTNENCQKSKIFFFAWSPDTSRVRSKMLYASSKDKFKRQLDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGRA
Sbjct  121  LQATDPSEMSLDIVKGRA  138



>ref|XP_002892045.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68304.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   224 bits (572),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKFLELK+KRNYR+IVFKIDE +Q V+++KLG+ EET+  F+ S+
Sbjct  1    MANSASGMHVSDDCKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYDDFTRSI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PEDECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGR 
Sbjct  121  LQATDPSEMSLDIIKGRV  138



>ref|XP_010544379.1| PREDICTED: actin-depolymerizing factor 8 isoform X1 [Tarenaya 
hassleriana]
Length=177

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKLKFLELK+KR+YR+IVFKIDE  Q VVV+K+G+ EET+  F++SMP
Sbjct  40   ANSASGMHVNDECKLKFLELKAKRSYRFIVFKIDEKVQKVVVDKIGNPEETYDDFTSSMP  99

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAVYD+DFTT +NCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVEL
Sbjct  100  ENECRYAVYDFDFTTKDNCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVEL  159

Query  289  QATDPSEMSLDTFKGRAY  236
            QATDPSEMSLD  KGRA+
Sbjct  160  QATDPSEMSLDIIKGRAF  177



>ref|XP_007218574.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
 gb|EMJ19773.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
Length=139

 Score =   224 bits (570),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKFLELK+KRN+R+IVFKI+E  Q V+VEK+G  +E++  F+ SM
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFAASM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT+ENCQKSKIFF+AWAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGRA
Sbjct  121  LQATDPSEMSLDIIKGRA  138



>ref|XP_008393892.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
 ref|XP_008353979.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   224 bits (570),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KRN+R+IVFKI+E  Q V+VEKLG  +E++  FS SM
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRNFRFIVFKIEEKIQQVIVEKLGGPDESYDDFSASM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT+ENCQKSKIFF+AWAP+T+ +RSKM+YASSKDRF+REL+G+QVE
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELEGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGRA
Sbjct  121  LQATDPSEMSLDIIKGRA  138



>ref|XP_008244913.1| PREDICTED: actin-depolymerizing factor 10 [Prunus mume]
Length=139

 Score =   224 bits (570),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKFLELK+KRN+R+IVFKI+E  Q V+VEK+G  +E++  F++SM
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFASSM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT+ENCQKSKIFF+AWAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  +GRA
Sbjct  121  LQATDPSEMSLDIIRGRA  138



>gb|KGN57376.1| hypothetical protein Csa_3G182120 [Cucumis sativus]
Length=137

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 124/139 (89%), Gaps = 2/139 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+FKI+  +Q VVVEKLGS EET+  FS ++
Sbjct  1    MANAASGMAVRDECKLKFLELKTKRNYRFIIFKIE--NQEVVVEKLGSPEETYDDFSAAI  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DFTTDENCQKSKIFF+AW+P+T+ +R+KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRNKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS D  K RA+
Sbjct  119  LQATDPSEMSFDIIKARAF  137



>ref|XP_006418454.1| hypothetical protein EUTSA_v10009057mg [Eutrema salsugineum]
 gb|ESQ36807.1| hypothetical protein EUTSA_v10009057mg [Eutrema salsugineum]
Length=140

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+IVFKIDE +Q V+++ +G+ EET+  F+  M
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDMVGNPEETYDDFTKCM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PENECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGR 
Sbjct  121  LQATDPSEMSLDIIKGRV  138



>ref|XP_010910598.1| PREDICTED: actin-depolymerizing factor [Elaeis guineensis]
Length=178

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -1

Query  661  QHKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFS  482
            +  MANS SG+ V DECKLKFLELK+KRN+R+IVFKIDE  Q V VE+LG  +E++  F+
Sbjct  37   EANMANSPSGIAVDDECKLKFLELKAKRNFRFIVFKIDEKIQQVTVERLGQPDESYDDFT  96

Query  481  NSMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGV  302
              +PPNECRYAV+D+DF TDENCQKSKIFF+AW+P+T+ +RSKMVYASSKDRF+RELDG+
Sbjct  97   ACLPPNECRYAVFDFDFVTDENCQKSKIFFIAWSPDTSKVRSKMVYASSKDRFKRELDGI  156

Query  301  QVELQATDPSEMSLDTFKGRA  239
            QVELQATDPSEMS+D  KGRA
Sbjct  157  QVELQATDPSEMSMDVVKGRA  177



>ref|XP_002318237.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|EEE96457.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=137

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+FKI+  SQ VVVEKLGS EET+ +F+ S+
Sbjct  1    MANAASGMAVDDECKLKFLELKAKRNYRFIIFKIE--SQQVVVEKLGSPEETYEEFAASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+DYDFTT+ENCQKSKIFF+AW+P+T+ IRSKMVYAS+KDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDYDFTTNENCQKSKIFFIAWSPDTSRIRSKMVYASTKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_006396264.1| hypothetical protein EUTSA_v10029050mg [Eutrema salsugineum]
 gb|ESQ37717.1| hypothetical protein EUTSA_v10029050mg [Eutrema salsugineum]
Length=141

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            +ANSASG+ V DECKLKFLELK+KR YR+IVFKIDE +Q V +EKLG+ EET+  F+NS+
Sbjct  3    LANSASGMNVSDECKLKFLELKAKRTYRFIVFKIDENAQQVQIEKLGNPEETYDDFTNSI  62

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT++NCQKSKIFF++W+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  63   PENECRYAVYDFDFTTEDNCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  122

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD    RA
Sbjct  123  LQATDPSEMSLDIINERA  140



>ref|XP_008794195.1| PREDICTED: actin-depolymerizing factor-like [Phoenix dactylifera]
Length=139

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRN+R+I+FKIDE  Q V VEKLG  +E++  F+ S+
Sbjct  1    MANSASGMAVNDECKLKFLELKTKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++W+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLD  KGRA+
Sbjct  121  LQATDPSEMSLDIVKGRAF  139



>emb|CDY07204.1| BnaCnng02190D [Brassica napus]
Length=271

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECK+KF+ELK+KR YRYIVFKIDE +Q V +EKLG+ EET+  F+NS+P
Sbjct  9    ANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEKLGNPEETYDDFANSIP  68

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYA+YD+DFTT++NCQKSKI+F+AW+P+T+ +RSKM+YASSKDRF+RE+DG+QVEL
Sbjct  69   ENECRYAIYDFDFTTEDNCQKSKIYFIAWSPDTSRVRSKMLYASSKDRFKREMDGIQVEL  128

Query  289  QATDPSEMSLDTFKGRAY*KLISIAFL  209
            QATDPSEMSLD  K RA  KL S + +
Sbjct  129  QATDPSEMSLDIIKERALSKLFSFSRM  155



>gb|KFK26837.1| hypothetical protein AALP_AA8G300400 [Arabis alpina]
Length=137

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS EE +  FSNS+
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  119  LQATDPSEMSLDIIKSRA  136



>gb|EYU35082.1| hypothetical protein MIMGU_mgv1a015967mg [Erythranthe guttata]
Length=139

 Score =   223 bits (567),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANS SG+ V DECKLKFLELK+KRN+RYIVFKID   Q VVVEK+G   E++  F++S+
Sbjct  1    MANSVSGIAVNDECKLKFLELKAKRNHRYIVFKIDNNVQQVVVEKVGPQGESYQDFADSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYDYDFTTDENC KSKI+F+AW+PE A +R+KM+YASSKDR +RELDG+QVE
Sbjct  61   PANECRYAVYDYDFTTDENCHKSKIYFIAWSPEGATVRTKMLYASSKDRIKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLD  K RAY
Sbjct  121  LQATDPSEMSLDIIKERAY  139



>ref|XP_008804935.1| PREDICTED: actin-depolymerizing factor isoform X2 [Phoenix dactylifera]
Length=139

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRN+R+I+FKIDE  Q V VEKLG  +E++  F+ S+
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DF TDENCQKSKI F++W+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVFDFDFVTDENCQKSKIIFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLD  KGRA+
Sbjct  121  LQATDPSEMSLDIVKGRAF  139



>ref|XP_007040194.1| Actin depolymerizing factor 8 [Theobroma cacao]
 gb|EOY24695.1| Actin depolymerizing factor 8 [Theobroma cacao]
Length=139

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECK KFLELK+KR+YR+IVFKI+E  Q VVVEKLG   +++   S S+
Sbjct  1    MANSASGMAVNDECKRKFLELKAKRSYRFIVFKIEEKIQQVVVEKLGGPSDSYDDLSASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTTDENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PANECRYAVYDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  KGRA
Sbjct  121  LQATDPSEMSFDIVKGRA  138



>emb|CDY38025.1| BnaCnng08860D [Brassica napus]
Length=176

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+IVFKIDE +Q V++E +G+ E+T+  F+  M
Sbjct  37   MANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIEMVGNPEKTYDDFTKCM  96

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  97   PENECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  156

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGR 
Sbjct  157  LQATDPSEMSLDIIKGRV  174



>ref|XP_009132530.1| PREDICTED: actin-depolymerizing factor 12-like [Brassica rapa]
Length=137

 Score =   222 bits (565),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS EE +  FSNS+
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT+ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVYDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_009119731.1| PREDICTED: actin-depolymerizing factor 10-like [Brassica rapa]
Length=140

 Score =   222 bits (565),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+IVFKIDE +Q V ++ +G+ EET+  F+  M
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVTIDMVGNPEETYDSFTKCM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PENECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EMSLD  KGR 
Sbjct  121  LQATDPTEMSLDIIKGRV  138



>ref|XP_010555668.1| PREDICTED: actin-depolymerizing factor 7 [Tarenaya hassleriana]
Length=137

 Score =   222 bits (565),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS EET+  F+ S+
Sbjct  1    MANSASGMAVDDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEETYDDFAESL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT+ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVYDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  119  LQATDPSEMSIDIIKSRA  136



>ref|XP_002872934.1| hypothetical protein ARALYDRAFT_490501 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49193.1| hypothetical protein ARALYDRAFT_490501 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   222 bits (565),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KR YR+IVFKIDE +Q V +EKLG+ EET+  F++++
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSAI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT++NCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RE+DG+QVE
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMDGIQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDPSEMSLD  KGR
Sbjct  121  LQATDPSEMSLDIIKGR  137



>ref|XP_009111466.1| PREDICTED: actin-depolymerizing factor 8 [Brassica rapa]
Length=139

 Score =   222 bits (565),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECK+KF+ELK+KR YRYIVFKIDE +Q V +EKLG+ +ET+  F+NS+
Sbjct  1    MANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEKLGNPQETYDDFTNSI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYA+YD+DFTT++NCQKSKI+F+AW+P+T+ +RSKM+YASSKDRF+RE+DG+QVE
Sbjct  61   PENECRYAIYDFDFTTEDNCQKSKIYFIAWSPDTSRVRSKMLYASSKDRFKREMDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  121  LQATDPSEMSLDIIKERA  138



>ref|XP_006476590.1| PREDICTED: actin-depolymerizing factor 1-like [Citrus sinensis]
Length=139

 Score =   221 bits (564),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANS+SG+ V D+CKLKFLELK+KR+YR+IVFKI+E  Q V VEKLG   E++  F+ S+
Sbjct  1    MANSSSGMAVHDDCKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTTDENCQKSKIFFVAW+P+T+ IRSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  121  LQATDPSEMSLDIVKSRA  138



>ref|XP_010317604.1| PREDICTED: actin-depolymerizing factor 12 [Solanum lycopersicum]
Length=137

 Score =   221 bits (564),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 122/139 (88%), Gaps = 2/139 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ SG  V DECKLKFLELK+KRNYR+I+FKID   Q VVVEKLGS EE++  F+NS+
Sbjct  1    MANAVSGTAVQDECKLKFLELKAKRNYRFIIFKID--GQEVVVEKLGSPEESYDNFTNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PP+ECRYAV+D+DFTT+EN QKSKIFF+AW+PE++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PPDECRYAVFDFDFTTNENIQKSKIFFIAWSPESSTVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQAT+PSEMSLD  K RAY
Sbjct  119  LQATEPSEMSLDLIKSRAY  137



>ref|XP_009386059.1| PREDICTED: actin-depolymerizing factor [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   221 bits (564),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRN+R+IVFKIDE  Q V+VEKLG  +E++  F+   
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNFRFIVFKIDEKIQQVMVEKLGRPDESYDDFTACF  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAV+D+DF TDENCQKSKIFF+AW+P+++ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFIAWSPDSSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  121  LQATDPSEMSIDIVKARA  138



>ref|XP_009384093.1| PREDICTED: actin-depolymerizing factor 1 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   221 bits (563),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRN+R+IVFKIDE  Q V+VEKLG   ET+  F+ SM
Sbjct  1    MANSASGMAVSDECKLKFLELKAKRNFRFIVFKIDERIQQVMVEKLGQPGETYDDFAASM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDE+CQKSKIFF++W+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDEHCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  KGRA
Sbjct  121  LQATDPSEMSIDIVKGRA  138



>ref|XP_011080987.1| PREDICTED: actin-depolymerizing factor-like [Sesamum indicum]
Length=139

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKL+FL+LK+KRNYR+I+FKI+E  Q VVVEKLG  EE +  FS+S+
Sbjct  1    MANSASGMSVHDECKLRFLDLKAKRNYRFIIFKIEEKIQQVVVEKLGQPEEGYEDFSSSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DF TDENCQKSKIFF+AW+P+T+ +RSKMVYASSKDRF+RELDG QVE
Sbjct  61   PDNECRYAVYDFDFITDENCQKSKIFFIAWSPDTSRVRSKMVYASSKDRFKRELDGTQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQAT+PSEMS+D  K RA
Sbjct  121  LQATEPSEMSIDIVKSRA  138



>ref|XP_010672167.1| PREDICTED: actin-depolymerizing factor 10 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKF+ELK+KRN+R+IVFKI+E  Q V+VEK+G+ +ET+  F+N++
Sbjct  1    MANAASGMAVNDECKLKFMELKAKRNHRFIVFKIEEKQQQVMVEKIGNPDETYEDFANAL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYDYDFTT +NCQKSKIFF AW+P+ + +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDYDFTTKDNCQKSKIFFFAWSPDASRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS D  KGR Y
Sbjct  121  LQATDPSEMSFDIVKGRVY  139



>ref|XP_006401834.1| hypothetical protein EUTSA_v10014982mg [Eutrema salsugineum]
 gb|ESQ43287.1| hypothetical protein EUTSA_v10014982mg [Eutrema salsugineum]
Length=137

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS EE +  FSNS+
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  119  LQATDPSEMSLDIIKSRA  136



>ref|XP_009127248.1| PREDICTED: actin-depolymerizing factor 12 [Brassica rapa]
Length=137

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS EE +  FSNS+
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>gb|EPS69954.1| hypothetical protein M569_04811 [Genlisea aurea]
Length=184

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKL FLELK++R YRY+VFKID+  Q V VEK G H E +  F+NS+P
Sbjct  47   ANSASGIAVSDECKLTFLELKARRTYRYVVFKIDDNVQQVTVEKAGEHSENYDDFTNSLP  106

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             N+CRYAVYDYDFTTDENC+KSKIFF+AW+P+ A +R+KM+YASSKDRF+RELDG+QVEL
Sbjct  107  DNDCRYAVYDYDFTTDENCRKSKIFFIAWSPDVAKVRTKMLYASSKDRFKRELDGIQVEL  166

Query  289  QATDPSEMSLDTFKGRAY  236
            QATDPSEMS D  K RAY
Sbjct  167  QATDPSEMSWDIIKARAY  184



>ref|XP_009106793.1| PREDICTED: actin-depolymerizing factor 7 [Brassica rapa]
Length=137

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELKSKRNYR+I+F+ID   Q VVVEKLGS EE +  FSNS+
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVFDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_006439576.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
 gb|ESR52816.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
Length=140

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANS+SG+ V DECKLKFLELK+KR+YR+IVFKI+E  Q V VEKLG   E++  F+ S+P
Sbjct  3    ANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASLP  62

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             +ECRYAVYD+DFTTDENCQKSKIFFVAW+P+T+ IRSKM+YASSKDRFRRELDGVQVEL
Sbjct  63   ADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYASSKDRFRRELDGVQVEL  122

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMSLD  K RA
Sbjct  123  QATDPSEMSLDIVKSRA  139



>ref|XP_002322471.2| hypothetical protein POPTR_0015s13080g [Populus trichocarpa]
 gb|EEF06598.2| hypothetical protein POPTR_0015s13080g [Populus trichocarpa]
Length=137

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+FKI+  SQ VVVEKLGS EET+ +F+ S+
Sbjct  1    MANAASGMAVDDECKLKFLELKAKRNYRFIIFKIE--SQQVVVEKLGSPEETYEEFAASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+DYDF T+ENCQKSKIFF+AW+P+T+ +RSKMVYASS+DRF+RELDG+QVE
Sbjct  59   PADECRYAVFDYDFITNENCQKSKIFFIAWSPDTSRVRSKMVYASSRDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_009793756.1| PREDICTED: actin-depolymerizing factor 7-like [Nicotiana sylvestris]
Length=137

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ SG+ V DECKLKFLELK+KRNYR+I+FKID   Q VVVEKLGS EE++  FSNS+
Sbjct  1    MANAVSGMAVQDECKLKFLELKAKRNYRFIIFKID--GQEVVVEKLGSPEESYEDFSNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D DF T+ENCQKSKIFF+AW+PET+ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDLDFITNENCQKSKIFFIAWSPETSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS D  K RAY
Sbjct  119  LQATDPSEMSFDIVKARAY  137



>ref|NP_567182.1| actin depolymerizing factor 8 [Arabidopsis thaliana]
 sp|Q570Y6.2|ADF8_ARATH RecName: Full=Actin-depolymerizing factor 8; Short=ADF-8; Short=AtADF8 
[Arabidopsis thaliana]
 gb|AAM63658.1| putative actin-depolymerizing factor [Arabidopsis thaliana]
 gb|ABD60702.1| At4g00680 [Arabidopsis thaliana]
 gb|AEE81918.1| actin depolymerizing factor 8 [Arabidopsis thaliana]
Length=140

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECK+KFLELK+KR YR+IVFKIDE +Q V +EKLG+ EET+  F++S+
Sbjct  1    MANSASGMHVNDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSSI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT++NCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RE++G+QVE
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDPSEMSLD  KGR
Sbjct  121  LQATDPSEMSLDIIKGR  137



>ref|XP_009118832.1| PREDICTED: actin-depolymerizing factor 10 isoform X2 [Brassica 
rapa]
Length=140

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+IVFKIDE +Q V++E +G+ E+T+  F+  M
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIEMVGNPEKTYDDFTKCM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFT  ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PENECRYAVYDFDFTPPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGR 
Sbjct  121  LQATDPSEMSLDIIKGRV  138



>ref|XP_010427310.1| PREDICTED: actin-depolymerizing factor 8 [Camelina sativa]
Length=141

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECK+KFLELK+KR YR+IVFKIDE +Q V +EKLG+ EET+  F++S+
Sbjct  1    MANSASGMNVSDECKIKFLELKAKRTYRFIVFKIDEKAQQVEIEKLGNPEETYDDFTSSI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT++NCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RE++G+QVE
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDPSEMSLD  +GR
Sbjct  121  LQATDPSEMSLDIIQGR  137



>gb|KHN26651.1| Actin-depolymerizing factor 7, partial [Glycine soja]
Length=136

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ASG+ V+DECKLKFLELK+KRNYR+IVFKI+  +  VVVEKLGS EET+  FS S+P
Sbjct  1    ANAASGMAVIDECKLKFLELKAKRNYRFIVFKIE--NYEVVVEKLGSPEETYDDFSASLP  58

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAV+D+DFTT+ENCQKSKIFF+AWAP+T+ +R KMVYASSKD+F+RELDG+QVEL
Sbjct  59   ANECRYAVFDFDFTTNENCQKSKIFFIAWAPDTSKVREKMVYASSKDKFKRELDGIQVEL  118

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMS D  K RA
Sbjct  119  QATDPSEMSFDIIKARA  135



>gb|KDP22276.1| hypothetical protein JCGZ_26107 [Jatropha curcas]
Length=137

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKFLELK+KRNYR+I FKI++  Q V+++KLG+ ++T+  F+ S+
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNYRFITFKIED--QQVIIDKLGTPQQTYDDFTASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DFTTDENCQKSKIFF+AW+P+T+ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGRA
Sbjct  119  LQATDPSEMSLDIIKGRA  136



>gb|AAL91666.1| pollen specific actin-depolymerizing factor 1 [Nicotiana tabacum]
Length=137

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ SG+ V DECKLKFLELK+KRNYR+I+FKID   Q VVVEKLGS EE++  F+NS+
Sbjct  1    MANAVSGMAVQDECKLKFLELKTKRNYRFIIFKID--GQEVVVEKLGSPEESYEDFANSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D DF T+ENCQKSKIFF+AW+PET+ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDLDFITNENCQKSKIFFIAWSPETSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS D  K RAY
Sbjct  119  LQATDPSEMSFDIVKARAY  137



>emb|CDY15154.1| BnaC05g00330D [Brassica napus]
Length=150

 Score =   219 bits (559),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKLKFLELK+KRNYR+IVFKIDE +Q V ++ +G+ EET+  F+  MP
Sbjct  12   ANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVTIDMVGNPEETYDSFTKCMP  71

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAVYD+DFTT ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVEL
Sbjct  72   ENECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVEL  131

Query  289  QATDPSEMSLDTFKGRA  239
            QATDP+EMSLD  KGR 
Sbjct  132  QATDPTEMSLDIIKGRV  148



>ref|XP_009414703.1| PREDICTED: actin-depolymerizing factor-like [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   219 bits (558),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRN+R+IVFKI+E  Q V VEKLG  ++++   + S+
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNFRFIVFKINEKLQQVTVEKLGQPDDSYDDLTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAV+D+DF TDENCQKSKIFF++WAP+ + +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFISWAPDASKVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQAT+PSEMS+D  KGRA
Sbjct  121  LQATEPSEMSIDIVKGRA  138



>gb|ABD66503.1| actin depolymerizing factor 7 [Gossypium hirsutum]
Length=139

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECK KFLELK+KRNYR+IVFKI+E  Q +VVEK+G+ ++++ +  +S+
Sbjct  1    MANSASGMAVNDECKTKFLELKAKRNYRFIVFKIEENLQQIVVEKVGAPKDSYEKLCSSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTTDENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PSDECRYAVYDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS D  K RA+
Sbjct  121  LQATDPSEMSFDIVKERAF  139



>ref|XP_009118831.1| PREDICTED: actin-depolymerizing factor 10 isoform X1 [Brassica 
rapa]
Length=145

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKLKFLELK+KRNYR+IVFKIDE +Q V++E +G+ E+T+  F+  MP
Sbjct  7    ANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIEMVGNPEKTYDDFTKCMP  66

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAVYD+DFT  ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVEL
Sbjct  67   ENECRYAVYDFDFTPPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVEL  126

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMSLD  KGR 
Sbjct  127  QATDPSEMSLDIIKGRV  143



>ref|XP_010419619.1| PREDICTED: actin-depolymerizing factor 8-like [Camelina sativa]
Length=141

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KR YR+IVFKIDE +Q V +EKLG+ EET+  F++ +
Sbjct  1    MANSASGMKVSDECKLKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSCI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT++NCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RE++G+QVE
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  +GR 
Sbjct  121  LQATDPSEMSLDVIQGRV  138



>ref|XP_006843593.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
 gb|ERN05268.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
Length=139

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D CKL+FLELK+KR++R+IVFKIDE  Q V+VEKLG   +T+  F+ S+
Sbjct  1    MANSASGMAVHDNCKLRFLELKTKRSHRFIVFKIDEKIQQVMVEKLGQPNDTYDDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PP+ECRYAV+D+DF TDENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+Q+E
Sbjct  61   PPDECRYAVFDFDFVTDENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQLE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSE+S+D  KGRA
Sbjct  121  LQATDPSELSMDIIKGRA  138



>ref|XP_002509779.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF51166.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANS+SG+ V DECKLKFLELK+KR+YR+IVFKI+E  Q V VEKLG  +E++  F+ S+
Sbjct  1    MANSSSGMAVNDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGQPQESYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD DFTT+EN QKSKIFFVAW+P+T+ +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PANECRYAVYDLDFTTNENVQKSKIFFVAWSPDTSKVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  121  LQATDPSEMSFDIVKARA  138



>ref|XP_011029243.1| PREDICTED: actin-depolymerizing factor isoform X2 [Populus euphratica]
Length=139

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKL+F+ELK+KR++R+IVFKI+E  Q VVVE LG  ++++  F+ S+
Sbjct  1    MANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTTDEN QKSKIFFVAW+P+T+ IRSKM+YASS+DRFRRELDGVQVE
Sbjct  61   PANECRYAVYDFDFTTDENVQKSKIFFVAWSPDTSKIRSKMLYASSRDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLD  K RA+
Sbjct  121  LQATDPSEMSLDIVKERAF  139



>ref|XP_007143417.1| hypothetical protein PHAVU_007G070500g [Phaseolus vulgaris]
 gb|ESW15411.1| hypothetical protein PHAVU_007G070500g [Phaseolus vulgaris]
Length=138

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V+DECKLKFLELK+KRN+R+IVFKI+  +  VVVEKLGS  ET+  F+ S+
Sbjct  1    MANAASGMAVLDECKLKFLELKAKRNFRFIVFKIE--NYEVVVEKLGSPTETYEDFTASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DFTT+ENCQKSKIFF+AWAP+T+ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVFDFDFTTNENCQKSKIFFIAWAPDTSKVREKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKARA  136



>ref|XP_002867603.1| actin binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43862.1| actin binding protein [Arabidopsis lyrata subsp. lyrata]
Length=137

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELKSKRNYR+I+F+ID   Q VVVEKLG+ EET+  F+ S+
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPEETYGDFTASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DF TDENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVFDFDFITDENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>sp|P30175.1|ADF_LILLO RecName: Full=Actin-depolymerizing factor; Short=ADF [Lilium 
longiflorum]
 emb|CAA78483.1| actin depolymerizing factor [Lilium longiflorum]
Length=139

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANS+SG+ V DECKLKF+ELK+KRN+R+IVFKI+E  Q V VE+LG   E++  F+  +
Sbjct  1    MANSSSGMAVDDECKLKFMELKAKRNFRFIVFKIEEKVQQVTVERLGQPNESYDDFTECL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAV+D+DF TDENCQKSKIFF++W+P+T+ +RSKM+YAS+KDRF+RELDG+QVE
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYASTKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS+D  K RA+
Sbjct  121  LQATDPSEMSMDIIKARAF  139



>ref|XP_010444761.1| PREDICTED: actin-depolymerizing factor 12-like [Camelina sativa]
Length=137

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS  ET+  F+N++
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPAETYDDFTNAL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAVYD+DFTT EN QKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PPNECRYAVYDFDFTTTENIQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD    RA
Sbjct  119  LQATDPSEMSLDIIISRA  136



>ref|XP_010456252.1| PREDICTED: actin-depolymerizing factor 8-like [Camelina sativa]
Length=141

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECK+KFLELK+KR YR+IVFKIDE +Q V +EKLG+ EET+  F++ +
Sbjct  1    MANSASGMNVSDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSCI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT++NCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RE++G+QVE
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  +GR 
Sbjct  121  LQATDPSEMSLDVIQGRV  138



>ref|NP_568769.1| actin depolymerizing factor 10 [Arabidopsis thaliana]
 sp|Q8LFH6.2|ADF12_ARATH RecName: Full=Actin-depolymerizing factor 12; Short=ADF-12; Short=AtADF12 
[Arabidopsis thaliana]
 gb|ABR46233.1| At5g52360 [Arabidopsis thaliana]
 gb|AED96205.1| actin depolymerizing factor 10 [Arabidopsis thaliana]
Length=137

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS +E +  F+N +
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPQENYDDFTNYL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAVYD+DFTT EN QKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PPNECRYAVYDFDFTTAENIQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  119  LQATDPSEMSLDIIKSRA  136



>gb|KDO76170.1| hypothetical protein CISIN_1g046281mg, partial [Citrus sinensis]
Length=133

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANS+SG+ V DECKLKFLELK+KR+YR+IVFKI+E  Q V VEKLG   E++  F+ S+
Sbjct  1    MANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTTDENCQKSKIFFVAW+P+T+ IRSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLD  257
            LQATDPSEMSLD
Sbjct  121  LQATDPSEMSLD  132



>ref|XP_009411533.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=169

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ASG+ V DECKLKFLELK+KRN+R+IVFKIDE  Q V+V+KLG  +E++  F+ S+P
Sbjct  32   ANAASGMAVSDECKLKFLELKAKRNFRFIVFKIDERIQQVMVDKLGQPDESYDDFTASLP  91

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             +ECRYAV+D+DF TDENCQKSKIFF+AW+P+ A +RSKM+YASSKDRF+RELDG+QVEL
Sbjct  92   ADECRYAVFDFDFVTDENCQKSKIFFIAWSPDAARVRSKMLYASSKDRFKRELDGIQVEL  151

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMS+D  KGRA
Sbjct  152  QATDPSEMSIDIVKGRA  168



>ref|NP_194289.2| actin depolymerizing factor 7 [Arabidopsis thaliana]
 sp|Q67ZM4.1|ADF7_ARATH RecName: Full=Actin-depolymerizing factor 7; Short=ADF-7; Short=AtADF7 
[Arabidopsis thaliana]
 dbj|BAD43856.1| actin depolymerizing factor - like protein [Arabidopsis thaliana]
 gb|AEE85080.1| actin depolymerizing factor 7 [Arabidopsis thaliana]
Length=137

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELKSKRNYR+I+F+ID   Q VVVEKLG+ +ET+  F+ S+
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPDETYDDFTASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DF TDENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PANECRYAVFDFDFITDENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>gb|AAL91667.1| pollen specific actin-depolymerizing factor 2 [Nicotiana tabacum]
Length=137

 Score =   217 bits (552),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V+DECKLKFLELK+KRNYR+IVFKI+   Q VVVEKLG+ EE +  F+NS+
Sbjct  1    MANAASGMAVLDECKLKFLELKAKRNYRFIVFKIE--GQQVVVEKLGNPEENYDDFTNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF T ENCQKSKIFF+AW+P+T+ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDFDFITTENCQKSKIFFIAWSPDTSKVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_006363318.1| PREDICTED: actin-depolymerizing factor 7-like [Solanum tuberosum]
Length=137

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KR YR+I+FKID  +Q VVVEKLG+ EET+  F+N++
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRIYRFIIFKID--AQQVVVEKLGNPEETYEDFTNAL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF T+ENCQKSKIFF+AW+P+T+ +R KMVYASSKDRF+RE+DG+QVE
Sbjct  59   PADECRYAVFDFDFVTNENCQKSKIFFIAWSPDTSKVRMKMVYASSKDRFKREIDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  119  LQATDPSEMSLDIIKARA  136



>gb|KCW46430.1| hypothetical protein EUGRSUZ_K00262 [Eucalyptus grandis]
Length=137

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKL+F+ELK+KR YR+I+FKI+  +Q VVVEK+G+ EET+  FS S 
Sbjct  1    MANAASGMAVSDECKLRFMELKAKRIYRFIIFKIE--NQQVVVEKVGNPEETYEDFSASF  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRY+V+D+DF T+ENCQKSKIFF+AWAP+TA IRSKMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYSVFDFDFITNENCQKSKIFFIAWAPDTAKIRSKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGRA
Sbjct  119  LQATDPSEMSLDIIKGRA  136



>ref|XP_007038697.1| Actin depolymerizing factor 7 [Theobroma cacao]
 gb|EOY23198.1| Actin depolymerizing factor 7 [Theobroma cacao]
Length=137

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+IVFKI +  Q VVV+K+GS +ET+  F  S+
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNYRFIVFKIQD--QQVVVDKVGSPQETYDDFQASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF T ENCQKSKIFF+AW+P+T+ +RSKMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDFDFITSENCQKSKIFFIAWSPDTSKVRSKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  KGRA
Sbjct  119  LQATDPSEMSFDIIKGRA  136



>gb|KHN05922.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=139

 Score =   216 bits (550),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KR YRYIVFKI+E S+ V+VEKLG     + +F+ S+
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRYIVFKIEEKSKQVIVEKLGDPANGYDEFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+Q+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD FK RA
Sbjct  121  LQATDPTEMGLDVFKSRA  138



>ref|XP_006353297.1| PREDICTED: actin-depolymerizing factor 12-like [Solanum tuberosum]
Length=137

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ SG  V DECKLKFLELK+KRNYR+I+FKID   Q VVVEKLGS EE +  F+NS+
Sbjct  1    MANAVSGTAVQDECKLKFLELKAKRNYRFIIFKID--GQEVVVEKLGSPEENYDDFANSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PP+ECRYAV+D+DF T+EN QKSKIFF+AW+PE++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PPDECRYAVFDFDFITNENIQKSKIFFIAWSPESSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQAT+PSEMS D  K RAY
Sbjct  119  LQATEPSEMSFDLIKSRAY  137



>ref|XP_006424770.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488280.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Citrus 
sinensis]
 gb|ESR38010.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 gb|KDO72932.1| hypothetical protein CISIN_1g032504mg [Citrus sinensis]
Length=139

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + V+VEKLG   +T+  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P  ECRYAVYDYDF T ENCQKS+IFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEM LD FK RA
Sbjct  121  LQATDPSEMGLDVFKDRA  138



>gb|AAM61402.1| actin depolymerizing factor-like [Arabidopsis thaliana]
Length=137

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 119/137 (87%), Gaps = 2/137 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS +E +  F+N +
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPQENYDDFTNYL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAVYD+DFTT EN QKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PPNECRYAVYDFDFTTAENIQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDPSEMSLD  K R
Sbjct  119  LQATDPSEMSLDIIKSR  135



>ref|XP_009770352.1| PREDICTED: actin-depolymerizing factor 7 [Nicotiana sylvestris]
Length=137

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V+DECKLKFLELK+KRNYR+IVFKI+   Q VVVEKLG+ EE +  F+NS+
Sbjct  1    MANAASGMAVLDECKLKFLELKAKRNYRFIVFKIE--GQQVVVEKLGNPEENYDDFTNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF T ENCQKSKIFF+AW+P+T+ +R KM+YASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDFDFITTENCQKSKIFFIAWSPDTSKVRMKMLYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_006285474.1| hypothetical protein CARUB_v10006893mg [Capsella rubella]
 gb|EOA18372.1| hypothetical protein CARUB_v10006893mg [Capsella rubella]
Length=137

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELKSKRNYR+IVF+ID   Q VVVEKLG+ EET+  F+ S+
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIVFRID--GQQVVVEKLGNPEETYDDFTASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_009599636.1| PREDICTED: actin-depolymerizing factor 7 [Nicotiana tomentosiformis]
Length=137

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V+DECKLKFLELK+KRNYR+IVFKI+   Q VVVEKLG+ EE +  F+NS+
Sbjct  1    MANAASGMAVLDECKLKFLELKTKRNYRFIVFKIE--GQQVVVEKLGNPEENYDDFTNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D DF T ENCQKSKIFF+AW+P+T+ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDLDFITTENCQKSKIFFIAWSPDTSKVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_002298043.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011029242.1| PREDICTED: actin-depolymerizing factor isoform X1 [Populus euphratica]
 gb|EEE82848.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=141

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKL+F+ELK+KR++R+IVFKI+E  Q VVVE LG  ++++  F+ S+P
Sbjct  4    ANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASLP  63

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAVYD+DFTTDEN QKSKIFFVAW+P+T+ IRSKM+YASS+DRFRRELDGVQVEL
Sbjct  64   ANECRYAVYDFDFTTDENVQKSKIFFVAWSPDTSKIRSKMLYASSRDRFRRELDGVQVEL  123

Query  289  QATDPSEMSLDTFKGRAY  236
            QATDPSEMSLD  K RA+
Sbjct  124  QATDPSEMSLDIVKERAF  141



>ref|XP_010482597.1| PREDICTED: actin-depolymerizing factor 12 [Camelina sativa]
Length=137

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS  E +  F+N++
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPAENYDDFTNAL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAVYD+DFTT EN QKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PPNECRYAVYDFDFTTTENIQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD    RA
Sbjct  119  LQATDPSEMSLDIIISRA  136



>emb|CDY51146.1| BnaA09g51810D [Brassica napus]
Length=352

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -1

Query  658  HKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSN  479
            H  ANSASG+ V DECK+KF+ELK+KR YRYIVFKIDE +Q V +EKLG+ +ET+  F+N
Sbjct  69   HHKANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEKLGNPQETYDDFTN  128

Query  478  SMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQ  299
            S+P NECRYA+YD+DFTT++NCQKSKI+F+AW+P+T+ +RSKM+YASSKDRF+RE+DG+Q
Sbjct  129  SIPENECRYAIYDFDFTTEDNCQKSKIYFIAWSPDTSRVRSKMLYASSKDRFKREMDGIQ  188

Query  298  VELQATDPSEMSLDTFKGRA  239
            VELQATDPSEMSLD  K RA
Sbjct  189  VELQATDPSEMSLDIIKERA  208



>ref|XP_010521323.1| PREDICTED: actin-depolymerizing factor 7-like [Tarenaya hassleriana]
Length=137

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKF ELK+KRNYRYI+F+ID   Q VVVEKLGS ++T+  F++S+
Sbjct  1    MANAASGMAVEDECKLKFQELKAKRNYRYIIFRID--GQQVVVEKLGSPDDTYDDFADSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PVNECRYAVYDFDFTTPENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  119  LQATDPSEMSIDIIKSRA  136



>gb|AFN53632.1| actin-depolymerizing factor 12 [Linum usitatissimum]
Length=359

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 2/137 (1%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V D+CKLKFLELK+KRNYR+IVFKI   +Q V VEKLGS EET+  F++S+P
Sbjct  224  ANSASGMAVHDDCKLKFLELKAKRNYRFIVFKI--LNQQVSVEKLGSPEETYEDFTSSLP  281

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
            PNECRYAVYD+DFTTDENCQKSKIFF+AWAP+ + +R KMVYASSKDRF+RELDG+QVEL
Sbjct  282  PNECRYAVYDFDFTTDENCQKSKIFFIAWAPDISKVREKMVYASSKDRFKRELDGIQVEL  341

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMSLD  KGRA
Sbjct  342  QATDPSEMSLDIVKGRA  358



>ref|XP_010433613.1| PREDICTED: actin-depolymerizing factor 7-like [Camelina sativa]
 ref|XP_010438859.1| PREDICTED: actin-depolymerizing factor 7-like [Camelina sativa]
Length=137

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELKSKRNYR+IVF+ID   Q VVVEKLG  EET+  F+ S+
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIVFRID--GQQVVVEKLGKPEETYDDFTASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_008438059.1| PREDICTED: actin-depolymerizing factor 7-like [Cucumis melo]
Length=139

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANS+SG+ V DECKLKFL+LK+KR YR+IVFKI+E  Q V VEK+G  +ET+  F+ S+
Sbjct  1    MANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVEKVGGPDETYDDFTASI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT+ENCQKSKI+F+AW+P+++ IRSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDFDFTTEENCQKSKIYFIAWSPDSSRIRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  121  LQATDPSEMSFDIIKSRA  138



>ref|NP_001053519.1| Os04g0555700 [Oryza sativa Japonica Group]
 sp|Q7XSN9.2|ADF6_ORYSJ RecName: Full=Actin-depolymerizing factor 6; Short=ADF-6; Short=OsADF6 
[Oryza sativa Japonica Group]
 emb|CAE01864.2| OSJNBb0012E24.5 [Oryza sativa Japonica Group]
 dbj|BAF15433.1| Os04g0555700 [Oryza sativa Japonica Group]
 dbj|BAG91382.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKF ELKSKR++R+I FKIDE +Q VVV++LG   +T+  F+ SM
Sbjct  1    MANSASGMAVGDECKLKFQELKSKRSFRFITFKIDERTQQVVVDRLGQPGDTYDDFTASM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++W+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PASECRYAVFDFDFVTDENCQKSKIFFISWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  121  LQATDPSEMSMDIVKARA  138



>ref|XP_010908104.1| PREDICTED: zinc finger CCHC domain-containing protein 9-like 
[Elaeis guineensis]
Length=355

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            +ANSASG+ V DECKLKFLELK+KRN+R+I+FKIDE  Q V VEKLG  +E++  F+ S+
Sbjct  217  LANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVTVEKLGQPDESYDDFTASL  276

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DF TDENCQKSKIFF++W+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  277  PANECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  336

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLD  KGRA+
Sbjct  337  LQATDPSEMSLDIVKGRAF  355



>ref|XP_009421345.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKIDE  + V+VE LG    T+  F+ S+
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVETLGEPNLTYDDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYA+YD+DF T+ENCQKSKIFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PTNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTARVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>gb|AFN53688.1| putative actin-depolymerizing factor 12 [Linum usitatissimum]
Length=388

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 122/137 (89%), Gaps = 2/137 (1%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V D+CKLKFLELK+KRNYR+IVFKI   +Q V VEKLGS EET+  F++S+P
Sbjct  253  ANSASGMAVHDDCKLKFLELKAKRNYRFIVFKI--MNQQVSVEKLGSPEETYEDFTSSLP  310

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
            PNECRYAVYD+DFTTDENCQKSKIFF+AWAP+ + +R KMVYASSKDRF+RELDG+QVEL
Sbjct  311  PNECRYAVYDFDFTTDENCQKSKIFFIAWAPDISKVREKMVYASSKDRFKRELDGIQVEL  370

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMSLD  KGRA
Sbjct  371  QATDPSEMSLDIVKGRA  387



>ref|XP_010537182.1| PREDICTED: actin-depolymerizing factor 7-like isoform X2 [Tarenaya 
hassleriana]
Length=137

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VV+EKLG  ++T+  F+ S+
Sbjct  1    MANSASGMAVDDECKLKFLELKAKRNYRFIIFRID--GQQVVIEKLGFPDQTYDDFAQSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT+ENCQKSKIFF+AW+P+++ +R KM+YASSKDRF+RELDG+QVE
Sbjct  59   PVNECRYAVYDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMLYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  119  LQATDPSEMSIDIIKSRA  136



>ref|XP_002448300.1| hypothetical protein SORBIDRAFT_06g024870 [Sorghum bicolor]
 gb|EES12628.1| hypothetical protein SORBIDRAFT_06g024870 [Sorghum bicolor]
Length=139

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKF ELKSKR++R+I FKI+E +Q VVV++LG   +++  F+ SM
Sbjct  1    MANSASGMAVSDECKLKFQELKSKRSFRFITFKINEQTQQVVVDRLGQPGDSYDDFTGSM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTTDENCQKSKIFF++W+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PDSECRYAVFDFDFTTDENCQKSKIFFISWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  121  LQATDPSEMSMDIVKARA  138



>ref|XP_006846080.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
 gb|ERN07755.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
Length=139

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KR YRY+VFKI+E  + V+VEKLG   + +  F+ S+
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYVVFKIEEKLKQVIVEKLGEPTDGYEAFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DF T+ENCQKSKIFF+AW+P+ A +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSKIFFIAWSPDIAKVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>gb|KGN50293.1| hypothetical protein Csa_5G165880 [Cucumis sativus]
Length=137

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+FKI++  Q VVVEKLG  +ET+  F+ S+
Sbjct  1    MANAASGMAVRDECKLKFLELKAKRNYRFIIFKIEQ--QEVVVEKLGQPDETYEDFTGSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF+AW+P+ + +RSKMVYASSKDRF+RELDG+Q E
Sbjct  59   PADECRYAVFDFDFITDENCQKSKIFFIAWSPDISKVRSKMVYASSKDRFKRELDGIQFE  118

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS D  K RA+
Sbjct  119  LQATDPSEMSFDIVKARAF  137



>ref|XP_009342975.1| PREDICTED: actin-depolymerizing factor 7 [Pyrus x bretschneideri]
 ref|XP_009349340.1| PREDICTED: actin-depolymerizing factor 7 [Pyrus x bretschneideri]
Length=138

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 123/139 (88%), Gaps = 3/139 (2%)
 Frame = -1

Query  652  MANS-ASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            M+N+ ASG+ V DECKLKF+ELK+KRNYR+IVFKID+  Q VVVEK+GS +ET+  F+ S
Sbjct  1    MSNAKASGMAVNDECKLKFVELKAKRNYRFIVFKIDK--QEVVVEKVGSPDETYEDFAAS  58

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
            +P +ECRYAV+D+DFTT ENCQKSKIFF+AW+PET+ +R KMVYASSKDRF+RELDG+QV
Sbjct  59   LPADECRYAVFDFDFTTAENCQKSKIFFIAWSPETSKVRMKMVYASSKDRFKRELDGIQV  118

Query  295  ELQATDPSEMSLDTFKGRA  239
            ELQATDPSEMSLD  KGRA
Sbjct  119  ELQATDPSEMSLDIIKGRA  137



>gb|KDP25456.1| hypothetical protein JCGZ_20612 [Jatropha curcas]
Length=139

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKF ELK+KR+YR+IVFKI+E  Q V VEKLG  ++++  F+ S+
Sbjct  1    MANSASGMAVHDDCKLKFQELKAKRSYRFIVFKIEEGIQQVTVEKLGKPQQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DFTT+EN QKSKIFF+AW+P+T+ +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PANECRYAVFDFDFTTNENVQKSKIFFIAWSPDTSRVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS D  +GRA+
Sbjct  121  LQATDPSEMSFDIVQGRAH  139



>ref|XP_006843087.1| hypothetical protein AMTR_s00140p00036970 [Amborella trichopoda]
 gb|ERN04762.1| hypothetical protein AMTR_s00140p00036970 [Amborella trichopoda]
Length=139

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+C+ +FLELK+KR+YR+IVFKI+E  Q V VEK+G   +T+  F+ S+
Sbjct  1    MANSASGMAVNDDCQQRFLELKAKRSYRFIVFKIEEKIQQVTVEKIGMPNDTYDDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAV+D+DF TDENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG QVE
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGFQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSE+S+D  KGRA
Sbjct  121  LQATDPSELSMDIIKGRA  138



>gb|ADI78873.1| actin-depolymerizing factor [Hevea brasiliensis]
Length=139

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL+FLELK+KR YRYIVFKI+E ++ V+VEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRYIVFKIEEKAKQVIVEKLGEPTQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD FK RA
Sbjct  121  LQATDPTEMGLDVFKSRA  138



>ref|XP_008437023.1| PREDICTED: actin-depolymerizing factor 7 [Cucumis melo]
Length=137

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+FKI++  Q VVVEKLG  +ET+  F+ S+
Sbjct  1    MANAASGMAVRDECKLKFLELKAKRNYRFIIFKIEQ--QEVVVEKLGRPDETYEDFTGSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF+AW+P+ + +RSKMVYASSKDRF+RELDG+Q E
Sbjct  59   PADECRYAVFDFDFITDENCQKSKIFFIAWSPDISKVRSKMVYASSKDRFKRELDGIQFE  118

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMS D  K RA+
Sbjct  119  LQATDPSEMSFDIVKARAF  137



>gb|KDP28647.1| hypothetical protein JCGZ_14418 [Jatropha curcas]
Length=132

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V DECKLKFLELK+KRNYR+IVFKIDE +Q V+VEK+G   +++  F+NS+PP ECRY
Sbjct  1    MAVNDECKLKFLELKAKRNYRFIVFKIDENNQQVMVEKVGGPNQSYEDFTNSLPPAECRY  60

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AV+D+DFTTDENCQKSKIFF+AWAP+T+ +RSKM+YASSKDRF+RELDG+Q+ELQATDPS
Sbjct  61   AVFDFDFTTDENCQKSKIFFIAWAPDTSKVRSKMLYASSKDRFKRELDGIQLELQATDPS  120

Query  271  EMSLDTFKGRA  239
            EMSLD  K RA
Sbjct  121  EMSLDIVKARA  131



>ref|XP_010448409.1| PREDICTED: actin-depolymerizing factor 7 [Camelina sativa]
Length=137

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELKSKRNYR+IVF+ID   Q VVVEKLG  +ET+  F+ S+
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIVFRID--GQQVVVEKLGKPDETYDDFTASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_010442763.1| PREDICTED: actin-depolymerizing factor 12-like [Camelina sativa]
 ref|XP_010442764.1| PREDICTED: actin-depolymerizing factor 12-like [Camelina sativa]
Length=137

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS  E +  F+N++
Sbjct  1    MANAASGMAVEDKCKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPAENYDDFTNAL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PPNECRYAVYD+DFTT EN QKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PPNECRYAVYDFDFTTTENIQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD    RA
Sbjct  119  LQATDPSEMSLDIIISRA  136



>ref|XP_004240732.1| PREDICTED: actin-depolymerizing factor 7 [Solanum lycopersicum]
Length=137

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I+FKID  +Q VVVEKLG+ EE++  F+N++
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRIYRFIIFKID--AQQVVVEKLGNPEESYEDFTNAL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF T+ENCQKSKIFF+AW+PET+ +R KMVYASSKDRF+RE+DG+QVE
Sbjct  59   PADECRYAVFDFDFVTNENCQKSKIFFIAWSPETSKVRMKMVYASSKDRFKREIDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EMSLD  K RA
Sbjct  119  LQATDPTEMSLDIIKSRA  136



>ref|XP_006424771.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488279.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Citrus 
sinensis]
 gb|ESR38011.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
Length=141

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + V+VEKLG   +T+  F+ S+P
Sbjct  4    ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLP  63

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
              ECRYAVYDYDF T ENCQKS+IFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVEL
Sbjct  64   AEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVEL  123

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEM LD FK RA
Sbjct  124  QATDPSEMGLDVFKDRA  140



>gb|KGN56524.1| hypothetical protein Csa_3G122480 [Cucumis sativus]
Length=139

 Score =   214 bits (544),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANS+SG+ V DECKLKFL+LK+KR YR+IVFKI+E  Q V V+K+G  +ET+  F+ S+
Sbjct  1    MANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVDKVGGPDETYDDFTASI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYDY+FTT+ENCQKSKI+F+AW+P+++ IRSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDYNFTTNENCQKSKIYFIAWSPDSSRIRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  121  LQATDPSEMSFDIIKSRA  138



>ref|XP_010055150.1| PREDICTED: actin-depolymerizing factor 8 [Eucalyptus grandis]
Length=132

 Score =   213 bits (543),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V DECKLKFLELK+KR YR+IVFKI+E  Q V +EKLGS EET+  FS+S+P +ECRY
Sbjct  1    MAVDDECKLKFLELKTKRIYRFIVFKIEEKIQQVTIEKLGSPEETYDDFSSSLPADECRY  60

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AV+D+DFTTDENCQKSKIFF+AWAPET+ +RSKM+YASSKDRF+RELDG+QVELQATDPS
Sbjct  61   AVFDFDFTTDENCQKSKIFFIAWAPETSRVRSKMLYASSKDRFKRELDGIQVELQATDPS  120

Query  271  EMSLDTFKGRA  239
            EMS+D  +GRA
Sbjct  121  EMSIDIIRGRA  131



>ref|XP_004496563.1| PREDICTED: actin-depolymerizing factor 7-like [Cicer arietinum]
Length=137

 Score =   213 bits (543),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+IVFKI+  +Q VVVEKLG  EET+  F+ S+
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRNYRFIVFKIE--NQEVVVEKLGGPEETYEDFNASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTT+ENCQKSKIFF+AW+P+ + +R KMVYAS+KDRF+RELDG+QVE
Sbjct  59   PSDECRYAVFDFDFTTNENCQKSKIFFIAWSPDISKVRHKMVYASTKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKARA  136



>emb|CBI22738.3| unnamed protein product [Vitis vinifera]
Length=132

 Score =   213 bits (543),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V DECKLKFLELK+KRN+R+IVFKI+E  Q VVVEKLGS +E++  F++S+P NECRY
Sbjct  1    MAVNDECKLKFLELKAKRNHRFIVFKIEEKIQQVVVEKLGSPDESYDAFTSSLPANECRY  60

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AV+D+DFTTDENCQKSKIFF+AWAP+T+ +RSKM+YASSKDRF+RELDG+QVELQATDPS
Sbjct  61   AVFDFDFTTDENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELDGIQVELQATDPS  120

Query  271  EMSLDTFKGRA  239
            EMSLD  K RA
Sbjct  121  EMSLDIVKSRA  131



>ref|XP_009131962.1| PREDICTED: actin-depolymerizing factor 3 [Brassica rapa]
Length=139

 Score =   213 bits (543),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IV+KI+E  + VVVEKLG   ++H  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYA++D+DF T ENCQKSKIFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD FK RA
Sbjct  121  LQATDPTEMDLDIFKSRA  138



>gb|AEJ88268.1| putative actin-depolymerizing factor [Wolffia arrhiza]
Length=139

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR +R+IVFKIDE  + V+VEK+G    T+  F+ S+
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTHRFIVFKIDEKQKQVIVEKIGEPALTYEDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYA+YD+DF T ENCQKSKIFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PDNECRYAIYDFDFVTSENCQKSKIFFIAWSPDTARVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>ref|XP_011030201.1| PREDICTED: uncharacterized protein LOC105129717 [Populus euphratica]
Length=296

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            +AN+ASG+ V DECKLKFLELK+KRNYR+I+FKI+  SQ VVVEKLGS EET+ +F+ S+
Sbjct  160  IANAASGMAVDDECKLKFLELKAKRNYRFIIFKIE--SQQVVVEKLGSPEETYEEFAASL  217

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+DYDFTT+ENCQKSKIFF+AW+P+T+ IRSKMVYASSKDRF+RELDG+QVE
Sbjct  218  PADECRYAVFDYDFTTNENCQKSKIFFIAWSPDTSRIRSKMVYASSKDRFKRELDGIQVE  277

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  278  LQATDPSEMSFDIIKSRA  295



>ref|XP_008376578.1| PREDICTED: actin-depolymerizing factor 7 isoform X1 [Malus domestica]
Length=134

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 119/134 (89%), Gaps = 2/134 (1%)
 Frame = -1

Query  640  ASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNE  461
            ASG+ V DECKLKF+ELK+KRNYR+IVFKID+  Q VVVEK+GS +ET+  F+ S+P +E
Sbjct  2    ASGMAVNDECKLKFVELKAKRNYRFIVFKIDK--QEVVVEKVGSPDETYEDFAASLPADE  59

Query  460  CRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQAT  281
            CRYAV+D+DFTT ENCQKSKIFF+AW+PET+ +R KMVYASSKDRF+RELDG+QVELQAT
Sbjct  60   CRYAVFDFDFTTAENCQKSKIFFIAWSPETSKVRMKMVYASSKDRFKRELDGIQVELQAT  119

Query  280  DPSEMSLDTFKGRA  239
            DPSEMSLD  KGRA
Sbjct  120  DPSEMSLDIIKGRA  133



>ref|XP_011084418.1| PREDICTED: actin-depolymerizing factor 7 [Sesamum indicum]
Length=137

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KRNYR+I+FKI+   Q VVVEKLGS +E++  F+ S+
Sbjct  1    MANSASGMAVDDECKLKFLELKAKRNYRFIIFKIE--GQQVVVEKLGSPDESYEDFTASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTT+ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PSDECRYAVFDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKERA  136



>emb|CDY27075.1| BnaA02g10950D [Brassica napus]
Length=401

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 7/147 (5%)
 Frame = -1

Query  664  PQHK-----MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEE  500
            PQ+K     MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS EE
Sbjct  256  PQNKNGVYPMANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEE  313

Query  499  THIQFSNSMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFR  320
             +  FSNS+P NECRYAVYD+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+
Sbjct  314  NYDDFSNSLPANECRYAVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFK  373

Query  319  RELDGVQVELQATDPSEMSLDTFKGRA  239
            RELDG+QVELQATDPSEMS D  K RA
Sbjct  374  RELDGIQVELQATDPSEMSFDIIKSRA  400



>ref|XP_010669849.1| PREDICTED: actin-depolymerizing factor 4-like [Beta vulgaris 
subsp. vulgaris]
Length=139

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I+FKI+E  + V+VEK+G   E++  F+ S+
Sbjct  1    MANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFTASI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKS+IFF+AWAP+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWAPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  K RA
Sbjct  121  LQATDPTEMDLDVIKSRA  138



>ref|XP_009397611.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKFLELK+KR++R+IVF+I+E  Q V+VEKLG  E+++   + S+
Sbjct  1    MANSASGMAVSDECKLKFLELKAKRSFRFIVFRIEEKIQRVMVEKLGQPEQSYDDLAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            PP++CRYAV+D DF TDENCQKSKIFF++W+P+T+ +R+KM+YASSKDRF+RELDG+QV+
Sbjct  61   PPDDCRYAVFDLDFITDENCQKSKIFFISWSPDTSRVRNKMLYASSKDRFKRELDGIQVD  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  KGRA
Sbjct  121  LQATDPSEMSFDIIKGRA  138



>gb|AEW90956.1| actin depolymerizing factor 4-2 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=139

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V D+CKLKF ELK+KR++R+IVFKIDE  Q VVV+++G   E++  F+  +
Sbjct  1    MSNSASGMAVCDDCKLKFQELKAKRSFRFIVFKIDEKVQQVVVDRVGEKTESYDDFTACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  KGRA
Sbjct  121  LQATDPSEMSMDIVKGRA  138



>ref|XP_006400899.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
 gb|ESQ42352.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
Length=139

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IV+KI+E  + V+VEK+G   ++H  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPGQSHDDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYA++D+DF T ENCQKSKIFFVAW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAIFDFDFVTAENCQKSKIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD FK RA
Sbjct  121  LQATDPTEMDLDVFKSRA  138



>gb|AEP25120.1| actin depolymerising factor [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AIT97057.1| actin-depolymerizing factor 11 [Triticum aestivum]
Length=139

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V DECKLKF ELK+KR++R+IVFKI+E  Q VVV+++G   E++  F+  +
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKTESYDDFTACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  KGRA
Sbjct  121  LQATDPSEMSMDIIKGRA  138



>gb|KFK27528.1| hypothetical protein AALP_AA8G395200 [Arabis alpina]
Length=139

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IV+KI+E  + VVVEK+G   ++H  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKVGEPGQSHDDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYA++D+DF T ENCQKSKIFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDP+EM LD FK R
Sbjct  121  LQATDPTEMDLDVFKSR  137



>ref|XP_004953378.1| PREDICTED: actin-depolymerizing factor 1-like [Setaria italica]
Length=139

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V DECKLKFLELK+KR++R+IVFKI+E  Q VVV++LG   E++  F+  +
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGEPGESYEDFTACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  121  LQATDPSEMSMDIIKSRA  138



>ref|XP_004140838.1| PREDICTED: uncharacterized protein LOC101212555 [Cucumis sativus]
Length=396

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 125/140 (89%), Gaps = 2/140 (1%)
 Frame = -1

Query  655  KMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            K+AN+ASG+ V DECKLKFLELK+KRNYR+I+FKI+  +Q VVVEKLGS EET+  FS +
Sbjct  259  KVANAASGMAVRDECKLKFLELKTKRNYRFIIFKIE--NQEVVVEKLGSPEETYDDFSAA  316

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
            +P NECRYAV+D+DFTTDENCQKSKIFF+AW+P+T+ +R+KMVYASSKDRF+RELDG+QV
Sbjct  317  IPANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRNKMVYASSKDRFKRELDGIQV  376

Query  295  ELQATDPSEMSLDTFKGRAY  236
            ELQATDPSEMS D  K RA+
Sbjct  377  ELQATDPSEMSFDIIKARAF  396



>ref|XP_004157224.1| PREDICTED: uncharacterized LOC101212555 [Cucumis sativus]
Length=396

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 125/140 (89%), Gaps = 2/140 (1%)
 Frame = -1

Query  655  KMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            K+AN+ASG+ V DECKLKFLELK+KRNYR+I+FKI+  +Q VVVEKLGS EET+  FS +
Sbjct  259  KVANAASGMAVRDECKLKFLELKTKRNYRFIIFKIE--NQEVVVEKLGSPEETYDDFSAA  316

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
            +P NECRYAV+D+DFTTDENCQKSKIFF+AW+P+T+ +R+KMVYASSKDRF+RELDG+QV
Sbjct  317  IPANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRNKMVYASSKDRFKRELDGIQV  376

Query  295  ELQATDPSEMSLDTFKGRAY  236
            ELQATDPSEMS D  K RA+
Sbjct  377  ELQATDPSEMSFDIIKARAF  396



>ref|NP_001047657.1| Os02g0663800 [Oryza sativa Japonica Group]
 sp|Q6EUH7.1|ADF1_ORYSJ RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1; Short=OsADF1 
[Oryza sativa Japonica Group]
 dbj|BAD27692.1| putative actin-depolymerizing factor [Oryza sativa Japonica Group]
 dbj|BAF09571.1| Os02g0663800 [Oryza sativa Japonica Group]
 dbj|BAG91513.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V DECKLKFLELK+KR++R+IVFKI+E  Q VVV++LG   E++  F+  +
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFTACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  121  LQATDPSEMSMDIVKSRA  138



>ref|XP_010669850.1| PREDICTED: actin-depolymerizing factor 4 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I+FKI+E  + V+VEK+G   E++  F+ S+
Sbjct  1    MANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFAASI  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKS+IFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEM LD  K RA
Sbjct  121  LQATDPSEMDLDVIKSRA  138



>ref|XP_002303579.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011022717.1| PREDICTED: actin-depolymerizing factor 1-like [Populus euphratica]
 gb|EEE78558.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D CKL+FLELK+KR++R+IVFKI+E +Q VVVE LG  ++++  F+ S+
Sbjct  1    MANSASGMAVNDGCKLRFLELKAKRSHRFIVFKIEEKTQQVVVETLGEPQQSYDDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTTDEN QKSKIFFVAW+P+ + IRSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PIDECRYAVYDFDFTTDENVQKSKIFFVAWSPDASKIRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSE+SLD  K RA+
Sbjct  121  LQATDPSEISLDIVKERAF  139



>ref|XP_010537181.1| PREDICTED: actin-depolymerizing factor 7-like isoform X1 [Tarenaya 
hassleriana]
Length=141

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VV+EKLG  ++T+  F+ S+P
Sbjct  6    ANSASGMAVDDECKLKFLELKAKRNYRFIIFRID--GQQVVIEKLGFPDQTYDDFAQSLP  63

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAVYD+DFTT+ENCQKSKIFF+AW+P+++ +R KM+YASSKDRF+RELDG+QVEL
Sbjct  64   VNECRYAVYDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMLYASSKDRFKRELDGIQVEL  123

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMS+D  K RA
Sbjct  124  QATDPSEMSIDIIKSRA  140



>gb|KHG18554.1| Actin-depolymerizing factor [Gossypium arboreum]
Length=139

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECK++FLELK+KR+YR+IVFKI+E  Q V+VEKLG  +E +  FS  +
Sbjct  1    MANSASGMAVNDECKMRFLELKAKRSYRFIVFKIEENIQQVMVEKLGGPKEKYDDFSACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DFTTDEN QKSKIFF+AW+P+T+ +RSKM+YASSKDRFRRELDGVQVE
Sbjct  61   PHNECRYAVFDFDFTTDENVQKSKIFFIAWSPDTSRVRSKMLYASSKDRFRRELDGVQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATD SEMS+D  K RA+
Sbjct  121  LQATDASEMSIDIVKERAF  139



>gb|AGW22223.1| actin-depolymerizing factor 4 [Triticum aestivum]
Length=139

 Score =   212 bits (539),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V DECKLKF ELK+KR++R+IVFKI+E  Q VVV+++G   E++  F+  +
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKTESYDDFTACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  KGRA
Sbjct  121  LQATDPSEMSMDIVKGRA  138



>gb|ABD66504.1| actin depolymerizing factor 8 [Gossypium hirsutum]
 gb|AAY88048.2| actin depolymerizing factor [Gossypium hirsutum]
 gb|KHG23444.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
Length=139

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + VVVEK+G   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTDSYEAFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF TDENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEM LD  + RA
Sbjct  121  LQATDPSEMDLDVIRSRA  138



>ref|XP_009404611.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I+FKIDE  + V+VEKLG    T+  F+ ++
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKQKQVIVEKLGEPNLTYDDFTATL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYA+YD+DF  +ENCQKSKI F+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PTNECRYAIYDFDFVNEENCQKSKIIFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEM LD  +GRA
Sbjct  121  LQATDPSEMGLDVIRGRA  138



>ref|XP_008776502.1| PREDICTED: actin-depolymerizing factor 7 [Phoenix dactylifera]
Length=139

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I+FKI+E  + V+VEKLG    ++  F+ ++
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIEEKLKQVIVEKLGEPTLSYEDFTAAL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DF T+ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>ref|XP_006413292.1| hypothetical protein EUTSA_v10026532mg [Eutrema salsugineum]
 gb|ESQ54745.1| hypothetical protein EUTSA_v10026532mg [Eutrema salsugineum]
Length=137

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECK KFLELKSKRNYR+I+F+ID   Q VVVEKLG+ +ET+  F+ S+
Sbjct  1    MANAASGMAVEDECKRKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPQETYDDFTASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVFDFDFTTTENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  119  LQATDPSEMSFDIIKSRA  136



>ref|XP_009388628.1| PREDICTED: actin-depolymerizing factor 7 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKIDE  + VVVEK+G     +  FS S+
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVVVEKVGEPTLGYDDFSASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DF T+ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PTNECRYAVFDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>gb|KHG23104.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   211 bits (538),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YRYIVFKI+E  + VVVEKLG   +++  F++S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVFKIEEKQKQVVVEKLGEPSQSYDDFTSSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+Q+E
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>emb|CDY38916.1| BnaA03g12630D [Brassica napus]
Length=405

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS EE +  FSNS+
Sbjct  269  MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  326

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT+ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVE
Sbjct  327  PANECRYAVYDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVE  386

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS D  K RA
Sbjct  387  LQATDPSEMSFDIIKSRA  404



>ref|XP_004503768.1| PREDICTED: actin-depolymerizing factor 7-like [Cicer arietinum]
Length=137

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL+F ELKSKR+YR+IVFKI+E  Q VVVEKLG   E++  F  S 
Sbjct  1    MANAASGMAVHDDCKLRFQELKSKRSYRFIVFKIEE--QQVVVEKLGEPSESYDDFMASF  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTTDENCQKSKIFF AW+P+T+ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVYDFDFTTDENCQKSKIFFYAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  KGRA
Sbjct  119  LQATDPSEMSLDIVKGRA  136



>gb|AEW90955.1| actin depolymerizing factor 4-1 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=139

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V D+CKLKF ELK+KR++R+IVFKI+E  Q VVV+++G   E++  F+  +
Sbjct  1    MSNSASGMAVCDQCKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKNESYDDFTACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  KGRA
Sbjct  121  LQATDPSEMSMDIVKGRA  138



>gb|ABX79380.1| actin-depolymerizing factor [Gossypium barbadense]
Length=139

 Score =   211 bits (537),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + VVVEK+G   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPIDSYEAFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF TDENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEM LD  + RA
Sbjct  121  LQATDPSEMDLDVIRSRA  138



>ref|XP_008804936.1| PREDICTED: zinc finger CCHC domain-containing protein 9 isoform 
X3 [Phoenix dactylifera]
Length=351

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKLKFLELK+KRN+R+I+FKIDE  Q V VEKLG  +E++  F+ S+P
Sbjct  214  ANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASLP  273

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAV+D+DF TDENCQKSKI F++W+P+T+ +RSKM+YASSKDRF+RELDG+QVEL
Sbjct  274  ANECRYAVFDFDFVTDENCQKSKIIFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVEL  333

Query  289  QATDPSEMSLDTFKGRAY  236
            QATDPSEMSLD  KGRA+
Sbjct  334  QATDPSEMSLDIVKGRAF  351



>ref|XP_009420088.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKIDE  + V+VEK+G     +  F+ S+
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVEKVGEPTLGYDDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYA+YD+DF T+ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PNNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>emb|CDX71068.1| BnaC03g11520D [Brassica napus]
Length=164

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ASG+ V D+CKLKFLELK+KR YR+IV+KI+E  + VVVEKLG   ++H  F+ S+P
Sbjct  27   ANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLP  86

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             +ECRYA++D+DF T ENCQKSKIFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVEL
Sbjct  87   ADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVEL  146

Query  289  QATDPSEMSLDTFKGRA  239
            QATDP+EM LD FK RA
Sbjct  147  QATDPTEMDLDIFKSRA  163



>ref|XP_007144457.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
 gb|AGV54234.1| actin-depolymerizing factor [Phaseolus vulgaris]
 gb|ESW16451.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
Length=139

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YRYIV+KI+E  + VVVEKLG     +  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVYKIEEKQKQVVVEKLGEPANGYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKSKIFF+AW+P++A +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSKIFFIAWSPDSARVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDP+EM LD FK R
Sbjct  121  LQATDPTEMGLDVFKSR  137



>ref|NP_001238519.1| uncharacterized protein LOC100499953 [Glycine max]
 gb|ACU14320.1| unknown [Glycine max]
Length=139

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + V+VEKLG     +  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+Q+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD FK RA
Sbjct  121  LQATDPTEMGLDVFKSRA  138



>ref|XP_010535543.1| PREDICTED: actin-depolymerizing factor 4 [Tarenaya hassleriana]
Length=139

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL+FLELK+KR YR+IV+KI+E  + V+VEK+G   +T+  F+ S+
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPAQTYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYA++D+DF T ENCQKSKIFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDP+EM LD FK R
Sbjct  121  LQATDPTEMGLDVFKSR  137



>ref|XP_006436042.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 ref|XP_006486066.1| PREDICTED: actin-depolymerizing factor 2-like [Citrus sinensis]
 gb|ESR49282.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 gb|KDO67706.1| hypothetical protein CISIN_1g032498mg [Citrus sinensis]
Length=139

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + VVVEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSDSYENFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF TDENCQKSKI F+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTDENCQKSKIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + R+
Sbjct  121  LQATDPTEMGLDVMRSRS  138



>ref|XP_004142080.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 ref|XP_004169676.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 gb|KGN54230.1| hypothetical protein Csa_4G294380 [Cucumis sativus]
Length=139

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELKSKR +R+IVFKI+E  + VVVEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DF T+ENCQKS+IFF+AW+P+ + +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSRIFFIAWSPDDSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>ref|XP_010553292.1| PREDICTED: actin-depolymerizing factor 1 [Tarenaya hassleriana]
Length=139

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELKSKR YR+IV+KI+E  + V+VEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKSKRTYRFIVYKIEEKQKQVIVEKLGEPSQSYEDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTSENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  K RA
Sbjct  121  LQATDPTEMGLDVIKSRA  138



>ref|XP_009593022.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009801697.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana sylvestris]
Length=139

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + V+VEKLG   E++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAESYEDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRY V+D+DF T+E CQKSKIFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYTVFDFDFVTEEGCQKSKIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDP+EM LD FK R
Sbjct  121  LQATDPTEMGLDVFKSR  137



>ref|XP_002511837.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF50506.1| actin depolymerizing factor, putative [Ricinus communis]
Length=131

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V DECKLKF ELK KRN+R+IVFKIDE  Q V VEKLG   ET+  F+NS+PPNECRY
Sbjct  1    MAVNDECKLKFQELK-KRNHRFIVFKIDEKIQQVSVEKLGGPHETYDDFANSLPPNECRY  59

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AVYD+DFTT+ENCQKSKIFF+AW+P+T+ +RSKMVYASSKDRF+RELDG+Q+ELQATDPS
Sbjct  60   AVYDFDFTTNENCQKSKIFFIAWSPDTSRVRSKMVYASSKDRFKRELDGIQLELQATDPS  119

Query  271  EMSLDTFKGRA  239
            EMSLD  KGRA
Sbjct  120  EMSLDIVKGRA  130



>emb|CDX88730.1| BnaA03g09190D [Brassica napus]
Length=154

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ASG+ V D+CKLKFLELK+KR YR+IV+KI+E  + VVVEKLG   ++H  F+ S+P
Sbjct  17   ANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLP  76

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             +ECRYA++D+DF T ENCQKSKIFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVEL
Sbjct  77   ADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVEL  136

Query  289  QATDPSEMSLDTFKGRA  239
            QATDP+EM LD FK RA
Sbjct  137  QATDPTEMDLDIFKSRA  153



>ref|XP_006490391.1| PREDICTED: actin-depolymerizing factor 7-like [Citrus sinensis]
Length=137

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKF+ELK+KRNYR+I+FKID  +Q VVVEKLGS  +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRNYRFIIFKID--NQQVVVEKLGSPGDSYDDFTTSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKSKIFF+AW+P+ + +RSKMVYASSKDRF+RELDG+Q E
Sbjct  59   PADECRYAVYDFDFITHENCQKSKIFFIAWSPDPSKVRSKMVYASSKDRFKRELDGIQFE  118

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLD  K RA+
Sbjct  119  LQATDPSEMSLDIIKERAF  137



>gb|AEZ00870.1| putative actin depolymerizing factor protein, partial [Elaeis 
guineensis]
Length=179

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -1

Query  655  KMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            +MAN+ASG+ V D+CKLKFLELK+KR +RYI+FKIDE  + V+VEK+G    ++  F+ +
Sbjct  40   EMANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVEKVGEPTLSYEDFTAA  99

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
            +P +ECRYA+YD+DF T+ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QV
Sbjct  100  LPADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQV  159

Query  295  ELQATDPSEMSLDTFKGRAY  236
            ELQATDP+EM LD  +GRAY
Sbjct  160  ELQATDPTEMGLDVIRGRAY  179



>ref|NP_001151716.1| LOC100285352 [Zea mays]
 gb|ACG44105.1| actin-depolymerizing factor [Zea mays]
 tpg|DAA36509.1| TPA: actin-depolymerizing factor [Zea mays]
Length=139

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKF ELKSKR++R+I FKI+E +Q VVV++LG   +T+  F+ SM
Sbjct  1    MANSASGMAVSDECKLKFQELKSKRSFRFITFKINEQTQQVVVDRLGQPGDTYDDFTGSM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTTDENCQKSKI F++W+P+T+ +RSKM+YASSKDRF+REL+G+Q+E
Sbjct  61   PESECRYAVFDFDFTTDENCQKSKILFISWSPDTSRVRSKMLYASSKDRFKRELEGIQLE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  + RA
Sbjct  121  LQATDPSEMSMDIVRARA  138



>gb|EYU25097.1| hypothetical protein MIMGU_mgv11b015928mg [Erythranthe guttata]
Length=138

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANS SG+ V DECKLKFL+LK+KRNYR+IVFKI+   Q VVVEKLG  +E++  F+ S+P
Sbjct  3    ANSGSGMAVDDECKLKFLDLKAKRNYRFIVFKIE--GQKVVVEKLGQPDESYENFTASLP  60

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             +ECRYAV+D+DF T+ENCQKSKI+F+AW+PE + +R KMVYASSKDRF+RELDG+QVEL
Sbjct  61   SDECRYAVFDFDFITNENCQKSKIYFIAWSPEVSTVRMKMVYASSKDRFKRELDGIQVEL  120

Query  289  QATDPSEMSLDTFKGRAY  236
            QATDPSEMSLD  K RAY
Sbjct  121  QATDPSEMSLDIIKARAY  138



>gb|ACR38016.1| unknown [Zea mays]
 gb|AFW63299.1| actin-depolymerizing factor [Zea mays]
Length=139

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V DECKLKF ELK+KR++R+IVFKI+E  Q VVV++LG   E++  F+   
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINENVQQVVVDRLGGPGESYDAFTACF  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DF TDENCQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  121  LQATDPSEMSMDIVKSRA  138



>ref|XP_010253266.1| PREDICTED: actin-depolymerizing factor 2 [Nelumbo nucifera]
Length=139

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + VVVEK+G   E++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTESYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+Q+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>ref|XP_007206123.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
 ref|XP_008223136.1| PREDICTED: actin-depolymerizing factor 2 [Prunus mume]
 gb|EMJ07322.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
Length=139

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG  V D+CKLKFLELK+KR YR+IVFKI+E  + V+VEKLG   E++  F+ S+
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIEEEQKQVIVEKLGEPAESYENFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+E+ LD  K RA
Sbjct  121  LQATDPTEIGLDVIKSRA  138



>dbj|BAK04382.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V DECKLKF ELK+KR++R+IVFKI+E  Q VVV+++G   E++  F+  +
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKNESYDDFAACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  121  LQATDPSEMSMDIVKARA  138



>ref|NP_001148898.1| actin-depolymerizing factor [Zea mays]
 gb|ACG33344.1| actin-depolymerizing factor [Zea mays]
Length=139

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V DECKLKF ELK+KR++R+IVFKI+E  Q VVV++LG   E++  F+   
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINENVQQVVVDRLGEPGESYDAFTACF  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DF TDENCQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  121  LQATDPSEMSMDIVKSRA  138



>ref|XP_008447631.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis melo]
Length=139

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELKSKR +R+IVFKI+E  + VVVEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DF T+ENCQKS+IFF+AW P+ + +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDFDFVTEENCQKSRIFFIAWCPDDSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>gb|KHG06644.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + VVVEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSQSYDDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>ref|XP_009389157.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=143

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            ANSASG+ V DECKLKFLELK+KRN+R+IVFKI+E  Q V VE+LG   E++   + S+P
Sbjct  6    ANSASGMAVSDECKLKFLELKAKRNFRFIVFKIEEKIQQVKVERLGQPGESYDDLTASLP  65

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             ++CRYAV+D+DF TDENCQKSKIFF++W+P+T+ +R+KM+YASSKDRF+RELDG+QVEL
Sbjct  66   DDDCRYAVFDFDFITDENCQKSKIFFISWSPDTSRVRNKMLYASSKDRFKRELDGIQVEL  125

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMS+D  KGRA
Sbjct  126  QATDPSEMSIDIIKGRA  142



>gb|EYU26572.1| hypothetical protein MIMGU_mgv1a015955mg [Erythranthe guttata]
Length=139

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL+FLELK+KR++R+IVFKI+E  + V+VEK+G   E++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRSHRFIVFKIEEKQKQVIVEKVGEPNESYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRY VYD+DF T ENCQKSKIFF+AW+P+TA IR+KM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYTVYDFDFVTAENCQKSKIFFIAWSPDTARIRNKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDP+EM LD  K RAY
Sbjct  121  LQATDPTEMGLDVIKSRAY  139



>ref|XP_007016496.1| Actin depolymerizing factor 4 [Theobroma cacao]
 gb|EOY34115.1| Actin depolymerizing factor 4 [Theobroma cacao]
Length=139

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + VVVEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>ref|XP_007158489.1| hypothetical protein PHAVU_002G156700g [Phaseolus vulgaris]
 gb|ESW30483.1| hypothetical protein PHAVU_002G156700g [Phaseolus vulgaris]
Length=137

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D CKLKF ELK+KR YRYI FKI++  Q VVV+K+G   ET+  F  S+
Sbjct  1    MANAASGMAVNDSCKLKFQELKAKRIYRYITFKIEQ--QEVVVDKIGGSTETYDDFQASL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTTDENCQKSKIFFVAW+P+T+ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PGDECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  119  LQATDPSEMSLDIVKARA  136



>ref|XP_006365713.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum]
Length=143

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I++KI+E  + VVVEKLG   E++  F+  +
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVVVEKLGEPTESYEDFAAGL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+TA +RSKM+YASSKDRF+RELDG QVE
Sbjct  61   PADECRYAVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD F+ RA
Sbjct  121  LQATDPTEMGLDVFRSRA  138



>ref|XP_008357628.1| PREDICTED: actin-depolymerizing factor 1-like [Malus domestica]
Length=139

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG  V D+CKLKFLELK+KR YR+IVFKIDE    V+VEKLG   E++  F+ ++
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DF T ENCQKS+IFFV W+P+TA +R+KM+YASSKDRF+RELDG+QVE
Sbjct  61   PDNECRYAVYDFDFVTVENCQKSRIFFVGWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSE+ LD  K RA
Sbjct  121  LQATDPSEIGLDVIKSRA  138



>ref|XP_008439227.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103484078 
[Cucumis melo]
Length=386

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ASG+ V DECKLKFLELK+KRNYR+I+FKI+  +Q VVVEKLGS EET+  F+ ++P
Sbjct  251  ANAASGMAVRDECKLKFLELKAKRNYRFIIFKIE--NQEVVVEKLGSPEETYDDFTAAIP  308

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAV+D+DFTTDENCQKSKIFF+AW+P+T+ +R+KMVYASSKDRF+RELDG+QVEL
Sbjct  309  ANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRNKMVYASSKDRFKRELDGIQVEL  368

Query  289  QATDPSEMSLDTFKGRAY  236
            QATDPSEMS D  K RA+
Sbjct  369  QATDPSEMSFDIIKARAF  386



>ref|XP_008377508.1| PREDICTED: actin-depolymerizing factor 7-like isoform X1 [Malus 
domestica]
Length=135

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = -1

Query  643  SASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPN  464
            + SG+ V DECKLKF ELK+KRNYR+IVFKID+  Q VVVEKLGS +ET+  F+ S+P +
Sbjct  2    AVSGMAVSDECKLKFGELKAKRNYRFIVFKIDK--QEVVVEKLGSPDETYEDFAESLPAD  59

Query  463  ECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQA  284
            ECRYAV+D+DFTT ENCQKSKIFF+AW+PE + +R KMVYASS+DRF+RELDG+QVELQA
Sbjct  60   ECRYAVFDFDFTTSENCQKSKIFFIAWSPEISRVRMKMVYASSRDRFKRELDGIQVELQA  119

Query  283  TDPSEMSLDTFKGRA  239
            TDPSEMSLD  KGRA
Sbjct  120  TDPSEMSLDIIKGRA  134



>ref|XP_009346958.1| PREDICTED: actin-depolymerizing factor 1 isoform X2 [Pyrus x 
bretschneideri]
Length=132

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V D+CKLKFLELK+KRN+R+IVFKI+E  Q V+VEKLG  +E++  FS S+P +ECRY
Sbjct  1    MAVHDDCKLKFLELKAKRNFRFIVFKIEEKIQQVIVEKLGGPDESYDDFSASLPADECRY  60

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AVYD+DFTT+ENCQKSKIFF+AWAP+T+ +RSKM+YASSKDRF+REL+G+QVELQATDPS
Sbjct  61   AVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYASSKDRFKRELEGIQVELQATDPS  120

Query  271  EMSLDTFKGRA  239
            EMSLD  KGRA
Sbjct  121  EMSLDIIKGRA  131



>ref|XP_006445079.1| hypothetical protein CICLE_v10023747mg, partial [Citrus clementina]
 gb|ESR58319.1| hypothetical protein CICLE_v10023747mg, partial [Citrus clementina]
Length=138

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ SG+ V DECKLKFLELK+KRN+R+IVFKIDE  Q V VE++GS + ++  F+ S+P
Sbjct  1    ANAVSGMAVHDECKLKFLELKAKRNHRFIVFKIDEKIQQVTVERVGSPQASYEDFTKSLP  60

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             +ECR+AV+D+DFTT EN QKSKIFF+AWAP+ + +RSKMVYASSKDRF+RELDG+ VEL
Sbjct  61   ADECRHAVFDFDFTTSENVQKSKIFFIAWAPDASRVRSKMVYASSKDRFKRELDGIHVEL  120

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMSLD  KGRA
Sbjct  121  QATDPSEMSLDIIKGRA  137



>gb|ABK94603.1| unknown [Populus trichocarpa]
Length=139

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR +R+IVFKI+E  + V+VEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+D+ TDENCQKS+I FVAW+P+T+ +RSKM+YASSKDRF+RELDG+Q+E
Sbjct  61   PANECRYAVYDFDYVTDENCQKSRIVFVAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDP+EM LD  + R+Y
Sbjct  121  LQATDPTEMGLDVIRSRSY  139



>ref|XP_002284292.1| PREDICTED: actin-depolymerizing factor 2 [Vitis vinifera]
Length=139

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IV+KI+E  + VVVEK+G   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>emb|CAJ38388.1| actin-depolymerizing factor [Plantago major]
Length=139

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ SG+ V D+CKL+FLELK+KR +R++VFKI+E  + VVVEK+G   ET+  F+ S+
Sbjct  1    MANAVSGMAVHDDCKLRFLELKAKRTHRFVVFKIEEKQKQVVVEKVGEPAETYEDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRY VYD+DF T ENCQKS+IFF+AW+P+TA IRSKM+YASSK+RF+RELDG+QVE
Sbjct  61   PENECRYGVYDFDFVTAENCQKSRIFFIAWSPDTARIRSKMIYASSKERFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  KGRA
Sbjct  121  LQATDPTEMGLDVIKGRA  138



>ref|XP_010529845.1| PREDICTED: actin-depolymerizing factor 2-like [Tarenaya hassleriana]
Length=139

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ SG+ V DECKLKFLELK+KR YR+IVFKI+E  + V+VEKLG   +++  F+ S+
Sbjct  1    MANAVSGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPSQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>ref|XP_004236758.1| PREDICTED: actin-depolymerizing factor 2 [Solanum lycopersicum]
Length=143

 Score =   209 bits (531),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I++KI+E  + V+VEKLG   E++  F+  +
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVIVEKLGEPTESYEDFAAGL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+TA +RSKM+YASSKDRF+RELDG QVE
Sbjct  61   PADECRYAVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGFQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD F+ RA
Sbjct  121  LQATDPTEMGLDVFRSRA  138



>ref|XP_010260094.1| PREDICTED: actin-depolymerizing factor 2-like [Nelumbo nucifera]
Length=139

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + VVVEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+E+ LD  + RA
Sbjct  121  LQATDPTEVGLDVIRSRA  138



>ref|XP_003524462.1| PREDICTED: actin-depolymerizing factor 7-like [Glycine max]
 gb|KHN23656.1| Actin-depolymerizing factor 7 [Glycine soja]
Length=169

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  655  KMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            KMAN+ASG+ V D+CKL+F ELKSKR+YR+IVFKI+E  Q VVVEKLG   E++  F  S
Sbjct  32   KMANAASGMAVHDDCKLRFQELKSKRSYRFIVFKIEE--QQVVVEKLGDPTESYEDFMAS  89

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
             P NECRYAVYD+DFTT ENCQKSKIFFVAW+P+T+ +R KMVYASSKDRF+RELDG+QV
Sbjct  90   FPANECRYAVYDFDFTTAENCQKSKIFFVAWSPDTSKVRMKMVYASSKDRFKRELDGIQV  149

Query  295  ELQATDPSEMSLDTFKGRA  239
            ++QATDPSEMSLD  K RA
Sbjct  150  DMQATDPSEMSLDLVKARA  168



>gb|EYU18949.1| hypothetical protein MIMGU_mgv1a015984mg [Erythranthe guttata]
Length=139

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKF+ELK+KR +R+IV+KI+E  + V+VEKLG   ET+  F+ S+
Sbjct  1    MANSASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVMVEKLGEPIETYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF T+E+ QKSKIFF+AW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTEESVQKSKIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDP+EM LD FK RA+
Sbjct  121  LQATDPTEMGLDVFKSRAF  139



>ref|XP_009767736.1| PREDICTED: actin-depolymerizing factor 7-like isoform X2 [Nicotiana 
sylvestris]
Length=137

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELKSKRNYRYI+FKI+  SQ VVVEKLG  EE++  F+NS+
Sbjct  1    MANAASGMAVHDDCKLKFLELKSKRNYRYIIFKIE--SQQVVVEKLGGTEESYEDFTNSL  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRY V+D+DF T ENCQKSKIFF+AW P+T+ +R KMVYASSKDRF+RELD +QVE
Sbjct  59   PADECRYTVFDFDFITTENCQKSKIFFIAWFPDTSKVRMKMVYASSKDRFKRELDVIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPS+MSL+  + RA
Sbjct  119  LQATDPSKMSLEIIESRA  136



>ref|XP_009358343.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG  V D+CKLKFLELK+KR YR+IVFKIDE    V+VEKLG   E++  F+ ++
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGQPAESYEDFTANL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DF T ENCQKS+IFFV W+P+TA +R+KM+YASSKDRF+RELDG+QVE
Sbjct  61   PDNECRYAVYDFDFVTVENCQKSRIFFVGWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+E+ LD  K RA
Sbjct  121  LQATDPTEIGLDVIKSRA  138



>ref|XP_009586917.1| PREDICTED: actin-depolymerizing factor 1 [Nicotiana tomentosiformis]
 ref|XP_009774799.1| PREDICTED: actin-depolymerizing factor 1 [Nicotiana sylvestris]
Length=139

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL+FLELK+KR +R+IVFKI+E  + VVVEK+G   E++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTESYEDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DF T ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  K RA
Sbjct  121  LQATDPTEMGLDVIKSRA  138



>ref|NP_001148445.1| actin-depolymerizing factor [Zea mays]
 gb|ACG31487.1| actin-depolymerizing factor [Zea mays]
 gb|AFW72692.1| actin-depolymerizing factor [Zea mays]
Length=139

 Score =   208 bits (530),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V DECKLKFLELK+KR++R+IVFKI+E  Q VVV++LG   E++  F    
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINENVQQVVVDRLGGPGESYDAFRACF  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAV+D+DF TDENCQKSKIFF++WAP+ + +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVFDFDFVTDENCQKSKIFFISWAPDASRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQAT+PSEMS+D  K RA
Sbjct  121  LQATEPSEMSMDIIKSRA  138



>ref|XP_010047513.1| PREDICTED: actin-depolymerizing factor 2 [Eucalyptus grandis]
Length=139

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL+FLELK+KR YR+IVFKI+E  + VVVEK+G   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>ref|XP_009357677.1| PREDICTED: actin-depolymerizing factor 1 [Pyrus x bretschneideri]
Length=139

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK++R YR+IV+KI+E    VVVEKLG   +++  FS S+
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVVVEKLGEPTDSYEDFSASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+D+ T+ENCQKS+I FVAW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIVFVAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+E+ LD  + RA
Sbjct  121  LQATDPTEVGLDVIRSRA  138



>ref|XP_009387944.1| PREDICTED: zinc finger CCHC domain-containing protein 9-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ SG+ V DECKLKFL+LK+KRNYR+IVFKIDE  Q V VEKLG  +ET+  F+ S+P
Sbjct  223  ANAVSGMAVHDECKLKFLDLKAKRNYRFIVFKIDEKIQQVTVEKLGQPDETYDDFTASLP  282

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             +ECRYAV+D+DF TDE+CQKSKIFF++WAP+T+ +RSKM+YASSKDRF+RELDG+QVEL
Sbjct  283  ADECRYAVFDFDFVTDEHCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVEL  342

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMS+D  KGRA
Sbjct  343  QATDPSEMSIDIVKGRA  359



>ref|XP_002533101.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF29273.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL+FLELK+KR YR+IVFKI+E  + V+VEK+G   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+Q+E
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQIE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD F+ RA
Sbjct  121  LQATDPTEMGLDVFRSRA  138



>ref|XP_006647644.1| PREDICTED: actin-depolymerizing factor 1-like [Oryza brachyantha]
Length=139

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            M+NSASG+ V DECKLKF +LK+KR++R+IVFKI+E  Q VVV++LG   E++  FS  +
Sbjct  1    MSNSASGMAVCDECKLKFQDLKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFSACL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++W+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMS+D  K RA
Sbjct  121  LQATDPSEMSMDIIKSRA  138



>gb|KHN48988.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=154

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  655  KMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            ++AN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + V+VEKLG     +  F+ S
Sbjct  15   EVANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFAAS  74

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
            +P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+Q+
Sbjct  75   LPADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQI  134

Query  295  ELQATDPSEMSLDTFKGRA  239
            ELQATDP+EM LD FK RA
Sbjct  135  ELQATDPTEMGLDVFKSRA  153



>ref|XP_009400269.1| PREDICTED: actin-depolymerizing factor-like [Musa acuminata subsp. 
malaccensis]
Length=132

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V DECKLKFLELK+KRN+R+IVFKIDE  Q V VEKLG  E+++   + S+PPNECRY
Sbjct  1    MAVNDECKLKFLELKAKRNFRFIVFKIDEKLQQVTVEKLGQPEQSYDDLAASLPPNECRY  60

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AVYD+DF TDENCQ+SKIFF+AW+P+ + +RSKM+YASSKDRF+RELDG+QVE+QATDPS
Sbjct  61   AVYDFDFVTDENCQRSKIFFIAWSPDASRVRSKMLYASSKDRFKRELDGIQVEVQATDPS  120

Query  271  EMSLDTFKGRA  239
            EMS+D  KGRA
Sbjct  121  EMSIDIVKGRA  131



>ref|XP_002311154.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
 gb|EEE88521.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
Length=218

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  661  QHKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFS  482
            + KMAN+ASG+ V D+CKLKFLELK+KR +R+IVFKI+E  + V+VEKLG   +++  F+
Sbjct  77   REKMANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFT  136

Query  481  NSMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGV  302
             S+P NECRYAVYD+D+ TDENCQKS+I FVAW+P+T+ +RSKM+YASSKDRF+RELDG+
Sbjct  137  ASLPANECRYAVYDFDYVTDENCQKSRIVFVAWSPDTSRVRSKMIYASSKDRFKRELDGI  196

Query  301  QVELQATDPSEMSLDTFKGRAY  236
            Q+ELQATDP+EM LD  + R+Y
Sbjct  197  QIELQATDPTEMGLDVIRSRSY  218



>ref|XP_004306801.1| PREDICTED: actin-depolymerizing factor 10-like [Fragaria vesca 
subsp. vesca]
Length=132

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V D+CKLKFLELK+KRN+R+IVFKI+E  Q V+VEK+G  +ET+  F+NS+P +ECRY
Sbjct  1    MAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKIGGPDETYEDFTNSIPADECRY  60

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AVYD+DFTT+ENCQKSKIFF++W+P+T+ +RSKM+YASSKDRF+REL+G+QVELQATDPS
Sbjct  61   AVYDFDFTTEENCQKSKIFFISWSPDTSRVRSKMLYASSKDRFKRELEGIQVELQATDPS  120

Query  271  EMSLDTFKGRA  239
            EMSLD  KGRA
Sbjct  121  EMSLDVIKGRA  131



>gb|KHN16833.1| Actin-depolymerizing factor 7, partial [Glycine soja]
Length=169

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 2/139 (1%)
 Frame = -1

Query  655  KMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            KMAN ASG+ V D+CKL+F ELKSKR+YR+IVFKI+E  Q VVVEKLG   E++  F  S
Sbjct  32   KMANVASGMAVHDDCKLRFQELKSKRSYRFIVFKIEE--QQVVVEKLGDPTESYEDFMAS  89

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
             P NECRYAVYD+DFTT ENCQKSKIFFVAW+P+T+ +R KMVYASSKDRF+RELDG+QV
Sbjct  90   FPANECRYAVYDFDFTTSENCQKSKIFFVAWSPDTSKVRMKMVYASSKDRFKRELDGIQV  149

Query  295  ELQATDPSEMSLDTFKGRA  239
            ++QATDPSEMSLD  K RA
Sbjct  150  DMQATDPSEMSLDLVKARA  168



>ref|XP_009353719.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
 ref|XP_009338379.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338380.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=139

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG  V D+CKLKFLELK+KR YR+IVFKIDE    V+VEKLG   E++  F+ ++
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DF T ENCQKS+IFF+ W+P+TA +R+KM+YASSKDRF+RELDG+QVE
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIGWSPDTARVRNKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+E+ LD  K RA
Sbjct  121  LQATDPTEIGLDVIKSRA  138



>ref|XP_008376580.1| PREDICTED: uncharacterized protein LOC103439753 isoform X2 [Malus 
domestica]
Length=382

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = -1

Query  661  QHKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFS  482
            Q K A++ASG+ V DECKLKF+ELK+KRNYR+IVFKID+  Q VVVEK+GS +ET+  F+
Sbjct  243  QDKSADTASGMAVNDECKLKFVELKAKRNYRFIVFKIDK--QEVVVEKVGSPDETYEDFA  300

Query  481  NSMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGV  302
             S+P +ECRYAV+D+DFTT ENCQKSKIFF+AW+PET+ +R KMVYASSKDRF+RELDG+
Sbjct  301  ASLPADECRYAVFDFDFTTAENCQKSKIFFIAWSPETSKVRMKMVYASSKDRFKRELDGI  360

Query  301  QVELQATDPSEMSLDTFKGRA  239
            QVELQATDPSEMSLD  KGRA
Sbjct  361  QVELQATDPSEMSLDIIKGRA  381



>gb|KHN21743.1| Actin-depolymerizing factor 7 [Glycine soja]
Length=130

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V+DECKLKFLELK+KRNYR+IVFKI+  +  VVVEKLGS EET+  FS S+P NECRY
Sbjct  1    MAVIDECKLKFLELKAKRNYRFIVFKIE--NYEVVVEKLGSPEETYDDFSASLPANECRY  58

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AV+D+DFTT+ENCQKSKIFF+AWAP+T+ +R KMVYASSKD+F+RELDG+QVELQATDPS
Sbjct  59   AVFDFDFTTNENCQKSKIFFIAWAPDTSKVREKMVYASSKDKFKRELDGIQVELQATDPS  118

Query  271  EMSLDTFKGRA  239
            EMS D  K RA
Sbjct  119  EMSFDIIKARA  129



>ref|XP_009416252.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416253.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKIDE  + VVV+K+G     +  F+ ++
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKQKEVVVDKVGEPSSNYDDFAAAL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYA+YD+DF T+ENCQKSKIFF+AW+P+++ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PTDECRYAIYDFDFVTEENCQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD F+ RA
Sbjct  121  LQATDPTEMGLDVFRSRA  138



>ref|XP_010920670.1| PREDICTED: actin-depolymerizing factor 7 [Elaeis guineensis]
Length=139

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I+FKI+E  + ++VEK+G    ++  F+ S+
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIEEKLKQIIVEKVGEPTLSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYA+YD+DF T+ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>ref|XP_008343560.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK++R YR+IV+KI+E    V+VEKLG   +++  FS S+
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVIVEKLGEPTDSYEDFSASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+D+ T+ENCQKS+I FVAW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIVFVAWSPDTAKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+E+ LD  + RA
Sbjct  121  LQATDPTEVGLDVIRSRA  138



>gb|KDP35600.1| hypothetical protein JCGZ_09038 [Jatropha curcas]
Length=139

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + V+VEK+G   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPNQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T ENCQKS+IFF+AW+P+ + +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDASRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD F+ RA
Sbjct  121  LQATDPTEMGLDVFRSRA  138



>ref|XP_008788089.1| PREDICTED: actin-depolymerizing factor 7-like [Phoenix dactylifera]
Length=139

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR +R+I+FKIDE  + V+VEK+G    ++  F+ ++
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTHRFIIFKIDEKLKQVIVEKVGEPTMSYEDFTAAL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYA+YD+DF T+ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>ref|XP_002273958.2| PREDICTED: actin-depolymerizing factor 1-like [Vitis vinifera]
 emb|CBI32606.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -1

Query  655  KMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            KMAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + VVVEK+G   +++  F+ S
Sbjct  50   KMANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPAQSYEDFTAS  109

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
            +P +ECRYAVYD+DF T+ENCQKS+IFF+AW P+++ +RSKM+YASSKDRF+RELDG+QV
Sbjct  110  LPADECRYAVYDFDFVTEENCQKSRIFFIAWCPDSSRVRSKMIYASSKDRFKRELDGIQV  169

Query  295  ELQATDPSEMSLDTFKGRA  239
            ELQATDP+EM LD  + RA
Sbjct  170  ELQATDPTEMGLDVIRSRA  188



>ref|XP_004495011.1| PREDICTED: actin-depolymerizing factor 2-like [Cicer arietinum]
Length=139

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KR YRYI++KI+E  + VVV+KLG     +  F+ ++
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKLGEPANGYDDFTANL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWCPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDP+EM LD FK R
Sbjct  121  LQATDPTEMGLDVFKSR  137



>ref|XP_010910431.1| PREDICTED: actin-depolymerizing factor-like [Elaeis guineensis]
Length=132

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V D+CKLKFLELK+KRN+R+I+FKIDE  Q V VEKLG  +E++  F+ S+P NECRY
Sbjct  1    MAVNDDCKLKFLELKAKRNFRFIIFKIDEKIQQVTVEKLGQPDESYDDFTASLPANECRY  60

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AV+D+DF TDENCQKSKIFF++W+P+ + +RSKM+YASSKDRF+RELDG+QVELQATDPS
Sbjct  61   AVFDFDFVTDENCQKSKIFFISWSPDASRVRSKMLYASSKDRFKRELDGIQVELQATDPS  120

Query  271  EMSLDTFKGRAY  236
            EMSLD  KGRA+
Sbjct  121  EMSLDIVKGRAF  132



>ref|XP_010096647.1| Actin-depolymerizing factor 2 [Morus notabilis]
 gb|EXB65315.1| Actin-depolymerizing factor 2 [Morus notabilis]
Length=159

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 124/157 (79%), Gaps = 6/157 (4%)
 Frame = -1

Query  703  FVHNSRRRVLHF*--PQHKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAV  530
            FVH S    L F   P    AN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + V
Sbjct  6    FVHES----LDFQSQPSDGSANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQV  61

Query  529  VVEKLGSHEETHIQFSNSMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKM  350
            +VEKLG   +++  F+ S+P NECRYAVYDYDF T+EN QKSKI F+AW+P+T+ +RSKM
Sbjct  62   IVEKLGEPTQSYEDFTASLPDNECRYAVYDYDFITEENVQKSKIIFIAWSPDTSRVRSKM  121

Query  349  VYASSKDRFRRELDGVQVELQATDPSEMSLDTFKGRA  239
            +YASSKDRF+RELDG+QVELQATDP+EM LD F+ R+
Sbjct  122  IYASSKDRFKRELDGIQVELQATDPTEMGLDVFRSRS  158



>ref|XP_003532683.1| PREDICTED: actin-depolymerizing factor 7-like [Glycine max]
Length=137

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN ASG+ V D+CKL+F ELKSKR+YR+IVFKI+E  Q VVVEKLG   E++  F  S 
Sbjct  1    MANVASGMAVHDDCKLRFQELKSKRSYRFIVFKIEE--QQVVVEKLGDPTESYEDFMASF  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD+DFTT ENCQKSKIFFVAW+P+T+ +R KMVYASSKDRF+RELDG+QV+
Sbjct  59   PANECRYAVYDFDFTTSENCQKSKIFFVAWSPDTSKVRMKMVYASSKDRFKRELDGIQVD  118

Query  292  LQATDPSEMSLDTFKGRA  239
            +QATDPSEMSLD  K RA
Sbjct  119  MQATDPSEMSLDLVKARA  136



>ref|XP_009601830.1| PREDICTED: uncharacterized protein LOC104097027 [Nicotiana tomentosiformis]
Length=470

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  661  QHKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFS  482
            Q  MAN+ SG+ V DECKLKFLELK+KRNYR+I+FKID   Q VVVEKLGS EE++  F+
Sbjct  331  QDTMANAVSGMAVQDECKLKFLELKTKRNYRFIIFKID--GQEVVVEKLGSPEESYEDFA  388

Query  481  NSMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGV  302
            NS+P +ECRYAV+D DF T+ENCQKSKIFF+AW+PET+ +R KMVYASSKDRF+RELDG+
Sbjct  389  NSLPADECRYAVFDLDFITNENCQKSKIFFIAWSPETSRVRMKMVYASSKDRFKRELDGI  448

Query  301  QVELQATDPSEMSLDTFKGRAY  236
            QVELQATDPSEMS D  K RAY
Sbjct  449  QVELQATDPSEMSFDIVKARAY  470



>ref|XP_004249528.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum lycopersicum]
Length=139

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL FLELK+KR +R+IVFKI+E  + VVVEK+G   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLTFLELKTKRTHRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAESL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+TA +RSKM+YASSKDRF+RELDG+Q+E
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQIE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  K RA
Sbjct  121  LQATDPTEMELDVIKSRA  138



>emb|CDX91636.1| BnaC02g15240D [Brassica napus]
Length=130

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V DECKLKFLELK+KRNYR+I+F+ID   Q VVVEKLGS EE +  FSNS+P NECRY
Sbjct  1    MAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSLPANECRY  58

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AVYD+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVELQATDPS
Sbjct  59   AVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVELQATDPS  118

Query  271  EMSLDTFKGRA  239
            EMS D  K RA
Sbjct  119  EMSFDIIKSRA  129



>ref|XP_008377514.1| PREDICTED: uncharacterized protein LOC103440585 isoform X2 [Malus 
domestica]
Length=383

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 2/141 (1%)
 Frame = -1

Query  661  QHKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFS  482
            QHK A++ SG+ V DECKLKF ELK+KRNYR+IVFKID+  Q VVVEKLGS +ET+  F+
Sbjct  244  QHKSADAVSGMAVSDECKLKFGELKAKRNYRFIVFKIDK--QEVVVEKLGSPDETYEDFA  301

Query  481  NSMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGV  302
             S+P +ECRYAV+D+DFTT ENCQKSKIFF+AW+PE + +R KMVYASS+DRF+RELDG+
Sbjct  302  ESLPADECRYAVFDFDFTTSENCQKSKIFFIAWSPEISRVRMKMVYASSRDRFKRELDGI  361

Query  301  QVELQATDPSEMSLDTFKGRA  239
            QVELQATDPSEMSLD  KGRA
Sbjct  362  QVELQATDPSEMSLDIIKGRA  382



>gb|EYU36258.1| hypothetical protein MIMGU_mgv1a015971mg [Erythranthe guttata]
Length=139

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CKLKF+ELK+KR +R+IVFKI+E  + V+VEKLG   +T+  F+ ++
Sbjct  1    MANSASGMAVHDDCKLKFMELKTKRTHRFIVFKIEEKQKQVLVEKLGEPVQTYEDFTANL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF TDEN  KS+IFF+AW+P+TA +RSKM+YASSKDRF+RELDG+Q+E
Sbjct  61   PADECRYAVYDFDFVTDENVPKSRIFFIAWSPDTAKVRSKMIYASSKDRFKRELDGIQIE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD FK RA
Sbjct  121  LQATDPTEMGLDVFKSRA  138



>ref|XP_009120511.1| PREDICTED: actin-depolymerizing factor 3-like [Brassica rapa]
Length=139

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR +R+IV+KI+E  + VVVEKLG   ++H  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF T E+CQKSKIFFVAW+P+TA +RSKM+YASSKDR +RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYASSKDRCKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD FK RA
Sbjct  121  LQATDPTEMDLDVFKSRA  138



>ref|XP_010937681.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=139

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I+FKIDE  + V+VEK+G    ++  F+ ++
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKLKQVIVEKVGEPTLSYEDFTANL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYA+YD+DF T+ENCQKSKIFF+AW+P+++ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDSSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>dbj|BAK05349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V D+CK+KF +LK++R++R+IVFKIDE +  + VE+LG     + +F+NS+
Sbjct  1    MANSASGLAVHDDCKIKFSDLKARRSFRFIVFKIDEKTMEIKVERLGETSYGYEEFTNSL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P NECRYAVYD DF TDENCQKSKIFF +W+P+TA  RSKM+YASSKDRFRRE+DG+Q E
Sbjct  61   PANECRYAVYDLDFVTDENCQKSKIFFFSWSPDTARTRSKMLYASSKDRFRREMDGIQCE  120

Query  292  LQATDPSEMSLDTFKGRAY  236
            +QATDPSEMSLD  KGRA+
Sbjct  121  IQATDPSEMSLDIIKGRAH  139



>emb|CDX80216.1| BnaC09g35260D [Brassica napus]
Length=252

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR +R+IV+KI+E  + VVVEKLG   ++H  F+ S+
Sbjct  114  MANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  173

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF T E+CQKSKIFFVAW+P+TA +RSKM+YASSKDRF+RELDG+QVE
Sbjct  174  PADECRYAVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVE  233

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD FK RA
Sbjct  234  LQATDPTEMDLDVFKSRA  251



>emb|CDY00526.1| BnaA10g07470D [Brassica napus]
Length=130

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -1

Query  631  VGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRY  452
            + V DECKLKFLELKSKRNYR+I+F+ID   Q VVVEKLGS EE +  FSNS+P NECRY
Sbjct  1    MAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSLPANECRY  58

Query  451  AVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPS  272
            AV+D+DFTT ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+QVELQATDPS
Sbjct  59   AVFDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVELQATDPS  118

Query  271  EMSLDTFKGRA  239
            EMS D  K RA
Sbjct  119  EMSFDIIKSRA  129



>emb|CDX90057.1| BnaA10g00250D [Brassica napus]
Length=133

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  625  VVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPNECRYAV  446
            V DECKLKFLELK+KRNYR+IVFKIDE +Q V ++ +G+ EET+  F+  MP NECRYAV
Sbjct  3    VNDECKLKFLELKAKRNYRFIVFKIDEKAQQVTIDMVGNPEETYDSFTKCMPENECRYAV  62

Query  445  YDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQATDPSEM  266
            YD+DFTT ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVELQATDP+EM
Sbjct  63   YDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVELQATDPTEM  122

Query  265  SLDTFKGRA  239
            SLD  KGR 
Sbjct  123  SLDIIKGRV  131



>gb|ADV04049.1| actin depolymerizing factor 4 [Hevea brasiliensis]
Length=139

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IVFKI+E  + V+VEKLG    ++  F+ S+
Sbjct  1    MANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTNSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+D+ TDENCQKS+I F+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + R+
Sbjct  121  LQATDPTEMGLDVIRSRS  138



>dbj|BAK06235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MANSASG+ V DECKLKF +LK+KR++R+I FKI+E +Q VVV+++G   +T+  F+ SM
Sbjct  1    MANSASGMAVSDECKLKFQDLKAKRSFRFITFKINENTQQVVVDRVGQPGDTYADFTASM  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DF TDENCQKSKIFF++W+P+++ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWSPDSSRVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQAT+PSEMS+D  K RA
Sbjct  121  LQATEPSEMSMDIVKARA  138



>ref|XP_006590210.1| PREDICTED: uncharacterized protein LOC100804471 [Glycine max]
Length=403

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ASG+ V+DECKLKFLELK+KRNYR+IVFKI+  +  VVVEKLGS EET+  FS S+P
Sbjct  268  ANAASGMAVIDECKLKFLELKAKRNYRFIVFKIE--NYEVVVEKLGSPEETYDDFSASLP  325

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAV+D+DFTT+ENCQKSKIFF+AWAP+T+ +R KMVYASSKD+F+RELDG+QVEL
Sbjct  326  ANECRYAVFDFDFTTNENCQKSKIFFIAWAPDTSKVREKMVYASSKDKFKRELDGIQVEL  385

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMS D  K RA
Sbjct  386  QATDPSEMSFDIIKARA  402



>ref|XP_010922979.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=256

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -1

Query  655  KMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            +MAN+ASG+ V D+CKLKFLELK+KR +RYI+FKIDE  + V+VEK+G    ++  F+ +
Sbjct  117  EMANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVEKVGEPTLSYEDFTAA  176

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
            +P +ECRYA+YD+DF T+ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QV
Sbjct  177  LPADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQV  236

Query  295  ELQATDPSEMSLDTFKGRAY  236
            ELQATDP+EM LD  +GRAY
Sbjct  237  ELQATDPTEMGLDVIRGRAY  256



>ref|XP_007027090.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
 gb|EOY07592.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
Length=173

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  661  QHKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFS  482
            + +MAN+ASG+ V DECKLKFLELK+KR YR+IVFKI+E  + V+VEKLG   +++  F+
Sbjct  32   RKEMANAASGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAQSYEDFA  91

Query  481  NSMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGV  302
             S+P +ECRYAVYD+DF T EN QKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+
Sbjct  92   KSLPADECRYAVYDFDFLTPENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGI  151

Query  301  QVELQATDPSEMSLDTFKGRA  239
            QVELQATDP+EM LD  K RA
Sbjct  152  QVELQATDPTEMGLDVIKSRA  172



>ref|XP_007160047.1| hypothetical protein PHAVU_002G288100g, partial [Phaseolus vulgaris]
 gb|ESW32041.1| hypothetical protein PHAVU_002G288100g, partial [Phaseolus vulgaris]
Length=183

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = -1

Query  655  KMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNS  476
            KMAN+ASG+ V D+CKLKF ELKSKR+YR+IVFKI+E  Q VVVEKLG    ++  F  S
Sbjct  46   KMANAASGMAVHDDCKLKFQELKSKRSYRFIVFKIEE--QQVVVEKLGDPSSSYEDFMAS  103

Query  475  MPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQV  296
             P NECRYAVYD++FTT+ENCQKSKIFFVAW+P+T+ +R KMVYASSKDRF+RELDG+QV
Sbjct  104  FPANECRYAVYDFNFTTNENCQKSKIFFVAWSPDTSKVRMKMVYASSKDRFKRELDGIQV  163

Query  295  ELQATDPSEMSLDTFKGRA  239
            ++QATDPSEMSLD  K RA
Sbjct  164  DMQATDPSEMSLDLVKARA  182



>ref|XP_010038440.1| PREDICTED: uncharacterized protein LOC104426974 [Eucalyptus grandis]
Length=427

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 124/141 (88%), Gaps = 2/141 (1%)
 Frame = -1

Query  661  QHKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFS  482
            + KMAN+ASG+ V DECKL+F+ELK+KR YR+I+FKI+  +Q VVVEK+G+ EET+  FS
Sbjct  288  EGKMANAASGMAVSDECKLRFMELKAKRIYRFIIFKIE--NQQVVVEKVGNPEETYEDFS  345

Query  481  NSMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGV  302
             S P +ECRY+V+D+DF T+ENCQKSKIFF+AWAP+TA IRSKMVYASSKDRF+RELDG+
Sbjct  346  ASFPADECRYSVFDFDFITNENCQKSKIFFIAWAPDTAKIRSKMVYASSKDRFKRELDGI  405

Query  301  QVELQATDPSEMSLDTFKGRA  239
            QVELQATDPSEMSLD  KGRA
Sbjct  406  QVELQATDPSEMSLDIIKGRA  426



>ref|XP_006606908.1| PREDICTED: uncharacterized protein LOC100783153 [Glycine max]
Length=402

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = -1

Query  649  ANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMP  470
            AN+ASG+ V+DECKLKFLELK+KRNYR+IVFKI+  +  VVVEKLGS EET+  FS S+P
Sbjct  267  ANAASGMAVIDECKLKFLELKAKRNYRFIVFKIE--NYEVVVEKLGSPEETYDDFSASLP  324

Query  469  PNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVEL  290
             NECRYAV+D+DFTT+ENCQKSKIFF+AWAP+T+ +R KMVYASSKD+F+RELDG+QVEL
Sbjct  325  ANECRYAVFDFDFTTNENCQKSKIFFIAWAPDTSKVREKMVYASSKDKFKRELDGIQVEL  384

Query  289  QATDPSEMSLDTFKGRA  239
            QATDPSEMS D  K RA
Sbjct  385  QATDPSEMSFDIIKARA  401



>gb|AET05009.2| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=137

 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL+F ELKSKR+YR+IVFKI+E  Q VVVEKLG   +++  F  S 
Sbjct  1    MANAASGMAVHDDCKLRFQELKSKRSYRFIVFKIEE--QQVVVEKLGEPSDSYDDFMASF  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DFTT+ENCQKSKI+FVAW+P+T+ +R KMVYASSKDRF+RELDG+QVE
Sbjct  59   PADECRYAVYDFDFTTNENCQKSKIYFVAWSPDTSRVRMKMVYASSKDRFKRELDGIQVE  118

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDPSEMSLD  K RA
Sbjct  119  LQATDPSEMSLDIVKARA  136



>ref|XP_007218573.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica]
 gb|EMJ19772.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica]
Length=139

 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V DECKLKFLELK+KR YR+IV+KI+E  + V+VEK+G   +++  FS S+
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKVGEPADSYEDFSASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+D+ T+ENCQKS+I F+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + RA
Sbjct  121  LQATDPTEMGLDVIRSRA  138



>ref|XP_002299887.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 ref|XP_006387927.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011000286.1| PREDICTED: actin-depolymerizing factor 2 [Populus euphratica]
 gb|ABK92579.1| unknown [Populus trichocarpa]
 gb|ABK96321.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE84692.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 gb|ERP46841.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+IV+KI+E  + V+VEKLG   +++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+EN QKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  K RA
Sbjct  121  LQATDPTEMGLDVIKSRA  138



>ref|XP_010909358.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=139

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KR YR+I++KI+E  + V+VEK+G    ++  F+ ++
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIYKIEEKLKQVIVEKVGEPTLSYEDFTAAL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYA+YD+DF T+ENCQKSKIFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSKVRSKMLYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  +GRA
Sbjct  121  LQATDPTEMGLDVIRGRA  138



>ref|XP_007218580.1| hypothetical protein PRUPE_ppa013189mg [Prunus persica]
 gb|EMJ19779.1| hypothetical protein PRUPE_ppa013189mg [Prunus persica]
Length=135

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = -1

Query  643  SASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSMPPN  464
            +ASG+ V DECKLKFLELK+KRN+RYI+FKI+   Q VVVEK+G+ EET+  F+ S+P +
Sbjct  2    AASGMAVSDECKLKFLELKAKRNHRYIIFKIE--IQQVVVEKVGTKEETYDDFAASLPAD  59

Query  463  ECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVELQA  284
            ECRYAV+D+DFTT ENCQKSKIFF+AW+P+T+ +R KMVYASSKDRF+RELDG QVELQA
Sbjct  60   ECRYAVFDFDFTTVENCQKSKIFFIAWSPDTSKVRMKMVYASSKDRFKRELDGTQVELQA  119

Query  283  TDPSEMSLDTFKGRA  239
            TDPSE+SLD  K RA
Sbjct  120  TDPSEISLDIIKSRA  134



>gb|AFK48761.1| unknown [Lotus japonicus]
Length=139

 Score =   206 bits (525),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ SG+ V D+CKLKFLELK+KR YR+IVFKI+E  + VVVEKLG     +  F+ S+
Sbjct  1    MANAVSGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPANGYDDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+IFF+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGR  242
            LQATDP+EM LD F  R
Sbjct  121  LQATDPTEMGLDVFNSR  137



>ref|XP_008463478.1| PREDICTED: actin-depolymerizing factor 2 isoform X1 [Cucumis 
melo]
 ref|XP_008463479.1| PREDICTED: actin-depolymerizing factor 2 isoform X2 [Cucumis 
melo]
Length=139

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKL+FL+LK+KR YR+IVFKI+E  + VVVEKLG   E++  F+ S+
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVVVEKLGEPSESYEDFTASL  60

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAVYD+DF T+ENCQKS+I F+AW+P+T+ +RSKM+YASSKDRF+RELDG+QVE
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIIFIAWSPDTSKVRSKMIYASSKDRFKRELDGIQVE  120

Query  292  LQATDPSEMSLDTFKGRA  239
            LQATDP+EM LD  + R+
Sbjct  121  LQATDPTEMGLDVIRSRS  138



>ref|XP_007211217.1| hypothetical protein PRUPE_ppa013153mg [Prunus persica]
 gb|EMJ12416.1| hypothetical protein PRUPE_ppa013153mg [Prunus persica]
Length=137

 Score =   206 bits (524),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 120/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  652  MANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSNSM  473
            MAN+ASG+ V D+CKLKFLELK+KRNYR+I+FKI++  Q +V++KLG   E++  F++S 
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRNYRFILFKIEQ--QQIVIDKLGEPNESYDDFTSSF  58

Query  472  PPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQVE  293
            P +ECRYAV+D+DFTT+ENCQKSKIFF+AW+P+++ +R KMVYASSKDRF+RELDG+  E
Sbjct  59   PADECRYAVFDFDFTTEENCQKSKIFFIAWSPDSSKVRMKMVYASSKDRFKRELDGISFE  118

Query  292  LQATDPSEMSLDTFKGRAY  236
            LQATDPSEMSLD  KGR +
Sbjct  119  LQATDPSEMSLDIVKGRVF  137



>ref|XP_008385227.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Malus 
domestica]
Length=147

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -1

Query  658  HKMANSASGVGVVDECKLKFLELKSKRNYRYIVFKIDEASQAVVVEKLGSHEETHIQFSN  479
            ++ AN+ASG  V D+CKLKFLELK+KR YR+IVFKIDE    V+VEKLG   E++  F+ 
Sbjct  7    YEQANAASGFXVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGXPAESYEDFTA  66

Query  478  SMPPNECRYAVYDYDFTTDENCQKSKIFFVAWAPETAPIRSKMVYASSKDRFRRELDGVQ  299
            ++P NECRYAVYD+DF T ENCQKS+IFF+ W+P+TA +R+KM+YASSKDRF+RELDG+Q
Sbjct  67   NLPDNECRYAVYDFDFVTAENCQKSRIFFIGWSPDTARVRNKMIYASSKDRFKRELDGIQ  126

Query  298  VELQATDPSEMSLDTFKGRA  239
            VELQATDP+E+ LD  K RA
Sbjct  127  VELQATDPTEIGLDVIKSRA  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1690861144275