BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83639_g1_i1 len=1017 path=[1:0-1016]

Length=1017
                                                                      Score     E

ref|XP_009789719.1|  PREDICTED: uncharacterized protein LOC104237298    298   1e-96   
ref|XP_009620242.1|  PREDICTED: uncharacterized protein LOC104112106    286   7e-92   
ref|XP_010252831.1|  PREDICTED: uncharacterized protein LOC104594291    244   2e-75   
ref|XP_006357683.1|  PREDICTED: uncharacterized protein LOC102581463    243   3e-75   
ref|XP_004243603.1|  PREDICTED: uncharacterized protein LOC101268776    243   3e-75   
emb|CDP20454.1|  unnamed protein product                                231   1e-70   
ref|XP_004303907.1|  PREDICTED: uncharacterized protein LOC101294866    226   2e-68   
ref|XP_008353619.1|  PREDICTED: uncharacterized protein LOC103417206    223   3e-67   
gb|AFK40533.1|  unknown                                                 220   4e-66   
ref|XP_002263850.1|  PREDICTED: uncharacterized protein LOC100259755    218   1e-65   Vitis vinifera
gb|EYU42790.1|  hypothetical protein MIMGU_mgv1a012733mg                218   2e-65   
ref|XP_011100549.1|  PREDICTED: uncharacterized protein LOC105178717    218   2e-65   
ref|XP_007215903.1|  hypothetical protein PRUPE_ppa010763mg             218   2e-65   
ref|XP_008362323.1|  PREDICTED: uncharacterized protein LOC103426009    216   9e-65   
gb|KCW47642.1|  hypothetical protein EUGRSUZ_K01386                     219   1e-64   
ref|XP_010038754.1|  PREDICTED: uncharacterized protein LOC104427349    219   2e-64   
ref|XP_008229761.1|  PREDICTED: uncharacterized protein LOC103329111    215   2e-64   
ref|NP_001241187.1|  uncharacterized protein LOC100781998               215   4e-64   
ref|XP_004488290.1|  PREDICTED: uncharacterized protein LOC101511...    214   7e-64   
ref|XP_002524596.1|  conserved hypothetical protein                     211   7e-63   Ricinus communis
ref|XP_006447851.1|  hypothetical protein CICLE_v10016450mg             209   6e-62   
ref|XP_010107359.1|  hypothetical protein L484_006874                   209   1e-61   
ref|XP_006469409.1|  PREDICTED: uncharacterized protein LOC102629811    205   2e-60   
ref|XP_003546571.1|  PREDICTED: uncharacterized protein LOC100798748    204   6e-60   
gb|KFK38226.1|  hypothetical protein AALP_AA3G085000                    202   4e-59   
ref|XP_003595548.1|  hypothetical protein MTR_2g049140                  200   2e-58   
ref|XP_008462021.1|  PREDICTED: uncharacterized protein LOC103500492    197   2e-57   
gb|KDP23000.1|  hypothetical protein JCGZ_01722                         197   3e-57   
ref|XP_010547190.1|  PREDICTED: uncharacterized protein LOC104819026    196   7e-57   
ref|XP_008803175.1|  PREDICTED: uncharacterized protein LOC103716790    195   1e-56   
ref|XP_002882540.1|  hypothetical protein ARALYDRAFT_478093             194   3e-56   
emb|CDX74035.1|  BnaA03g30120D                                          194   3e-56   
ref|XP_007138506.1|  hypothetical protein PHAVU_009G214800g             194   4e-56   
ref|XP_004144560.1|  PREDICTED: uncharacterized protein LOC101217042    194   5e-56   
ref|XP_010456375.1|  PREDICTED: uncharacterized protein LOC104737782    194   5e-56   
ref|XP_010486333.1|  PREDICTED: uncharacterized protein LOC104764490    192   1e-55   
ref|XP_009134987.1|  PREDICTED: uncharacterized protein LOC103859236    192   2e-55   
ref|XP_010464400.1|  PREDICTED: uncharacterized protein LOC104744958    192   3e-55   
ref|XP_006298429.1|  hypothetical protein CARUB_v10014498mg             189   2e-54   
emb|CDY07983.1|  BnaC03g35400D                                          188   5e-54   
ref|XP_010942899.1|  PREDICTED: uncharacterized protein LOC105060...    189   5e-54   
ref|XP_006407813.1|  hypothetical protein EUTSA_v10021420mg             187   2e-53   
ref|XP_010942898.1|  PREDICTED: uncharacterized protein LOC105060...    184   2e-52   
ref|XP_006857702.1|  hypothetical protein AMTR_s00061p00169900          183   4e-52   
ref|NP_566314.1|  uncharacterized protein                               183   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447852.1|  hypothetical protein CICLE_v10016450mg             181   3e-51   
ref|XP_009391786.1|  PREDICTED: uncharacterized protein LOC103977865    175   5e-49   
ref|XP_010551973.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    168   4e-46   
ref|XP_007138509.1|  hypothetical protein PHAVU_009G215100g             164   9e-45   
gb|ACU17201.1|  unknown                                                 163   2e-44   Glycine max [soybeans]
ref|XP_006648791.1|  PREDICTED: uncharacterized protein LOC102716101    143   1e-36   
gb|KDO51010.1|  hypothetical protein CISIN_1g030004mg                   140   3e-36   
ref|NP_001047253.1|  Os02g0582400                                       140   7e-36   Oryza sativa Japonica Group [Japonica rice]
gb|ACG38142.1|  hypothetical protein                                    139   2e-35   Zea mays [maize]
ref|XP_004952916.1|  PREDICTED: uncharacterized protein LOC101784075    139   3e-35   
ref|NP_001140846.1|  uncharacterized protein LOC100272922               138   7e-35   Zea mays [maize]
ref|XP_002454074.1|  hypothetical protein SORBIDRAFT_04g024210          137   2e-34   Sorghum bicolor [broomcorn]
ref|XP_003575243.1|  PREDICTED: uncharacterized protein LOC100845108    133   5e-33   
dbj|BAJ95320.1|  predicted protein                                      132   7e-33   
gb|EMS68197.1|  hypothetical protein TRIUR3_33755                       128   1e-30   
ref|XP_007049424.1|  Period circadian protein, putative isoform 1       127   1e-30   
gb|EMT19523.1|  hypothetical protein F775_28661                         127   2e-30   
gb|KHG19441.1|  elongation factor tu, mitochondrial                     122   1e-28   
gb|ABK24038.1|  unknown                                                 105   9e-23   Picea sitchensis
gb|AAF13082.1|AC009176_9  hypothetical protein                        99.8    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006586666.1|  PREDICTED: uncharacterized protein LOC100781...  96.3    1e-20   
ref|XP_007049425.1|  Period circadian protein, putative isoform 2     98.6    2e-20   
gb|EEC73491.1|  hypothetical protein OsI_07824                        67.8    3e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAD73827.1|  unknown protein                                      67.4    4e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86443.1|  hypothetical protein OsI_07825                        61.2    5e-08   Oryza sativa Indica Group [Indian rice]



>ref|XP_009789719.1| PREDICTED: uncharacterized protein LOC104237298 [Nicotiana sylvestris]
Length=241

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 193/241 (80%), Gaps = 1/241 (0%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP+VI+LF+D  GFG AIF AL+PNPNS+ Q R+ES +LSLE+YGIKD K S E+VH
Sbjct  1    MKVAPKVILLFRDSSGFGTAIFEALQPNPNSNFQKRQESLDLSLERYGIKDQKVSVEIVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            FQ  + LYEVSVLLLENYEPP LACAL+EVLS+L    SS +PT+V PF+V  TKLK+++
Sbjct  61   FQDGSNLYEVSVLLLENYEPPTLACALNEVLSLLVGDGSSNMPTIVAPFLVADTKLKMEN  120

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
            ++S  +D+   Y LQ G S+ +T+ALV+ L++PPPSLQIFHEQLACLLQLVRVL LPTVV
Sbjct  121  RTSVGVDNISVYALQVGASSGLTKALVTNLQSPPPSLQIFHEQLACLLQLVRVLNLPTVV  180

Query  382  LI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            +I +K + +H +TS++ LE I+EIG +LASFSSL  S E+I  D TK  RET+EPWRALY
Sbjct  181  IIGKKGQKLHRKTSEEDLEVIHEIGRHLASFSSLNFSAEKIAWDATKSSRETQEPWRALY  240

Query  205  G  203
            G
Sbjct  241  G  241



>ref|XP_009620242.1| PREDICTED: uncharacterized protein LOC104112106 [Nicotiana tomentosiformis]
Length=241

 Score =   286 bits (732),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 148/241 (61%), Positives = 191/241 (79%), Gaps = 1/241 (0%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAPRVI+LF+D  GFG AIF AL+PN NS+L+ REES +LSLE+YGIKD K S E+VH
Sbjct  1    MKVAPRVILLFRDTSGFGTAIFEALQPNANSNLRRREESLDLSLERYGIKDQKVSVEIVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F   + LYEVSVLLLENY+PP LACAL+EVLS+L    SS +PT+V PF V  TKLK+++
Sbjct  61   FLDGSNLYEVSVLLLENYKPPTLACALNEVLSLLVGDGSSNMPTIVAPFFVADTKLKMEN  120

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
            ++S  +D+   YGLQ G S+ +T+AL++ L+ PPPSLQIFHE+LACLLQL RVL +PT+V
Sbjct  121  RTSFGVDNISVYGLQVGVSSGLTKALITNLQGPPPSLQIFHEELACLLQLARVLKMPTLV  180

Query  382  LI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            +I +K + +H +TS+ +L+ I+EIG++LASFSSL  S E+I  D TK  RET+EPWRALY
Sbjct  181  IIGKKGQKLHCKTSEDELQVIHEIGQHLASFSSLNFSAEKIAWDATKSLRETQEPWRALY  240

Query  205  G  203
            G
Sbjct  241  G  241



>ref|XP_010252831.1| PREDICTED: uncharacterized protein LOC104594291 [Nelumbo nucifera]
Length=242

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 181/242 (75%), Gaps = 2/242 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MK AP++I+LF+D  G G+AI  AL+PN NS LQ  + SF LSL++YGIKD+KASG+ +H
Sbjct  1    MKTAPKIILLFRDADGVGSAIADALQPNHNSTLQRTKTSFELSLDRYGIKDVKASGDAIH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F  H GLY+VS+LLL+ Y+PPI+ACA++E+L+ +    SS++ T+++PF+V A+KL+ + 
Sbjct  61   FIDHEGLYQVSLLLLQYYDPPIIACAVNELLASIMGENSSSMLTLILPFLVAASKLEKEM  120

Query  562  KSSAIMDHALTY-GLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KSS   +H +   G+Q GP TD T+A++++++  PPSLQI +E LACLLQLVRVL LP+ 
Sbjct  121  KSSIPGNHKVALSGVQIGPETDFTRAMIARIQKAPPSLQIHYEPLACLLQLVRVLKLPSF  180

Query  385  VLIRKTESIHSQ-TSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            +LI  T    S+ T D+ +EA+YE+GE+LAS  +LC  R+RI  +PTK  R+  EPWRAL
Sbjct  181  LLIGPTAQHQSKRTPDEDIEALYELGEFLASSVNLCFLRDRIHWNPTKKQRDNLEPWRAL  240

Query  208  YG  203
            YG
Sbjct  241  YG  242



>ref|XP_006357683.1| PREDICTED: uncharacterized protein LOC102581463 [Solanum tuberosum]
Length=240

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 190/241 (79%), Gaps = 2/241 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP+VI+LF+D  GFG AIF AL+PNP S+LQ R+ES +LSL++YGIKD K + EVVH
Sbjct  1    MKVAPKVILLFRDPTGFGIAIFEALQPNPKSNLQKRQESLDLSLQRYGIKDQKVTVEVVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F     L EVS+LLLENYEPP LACAL+EVL++L     S +PT++ PF+V A+KLK+++
Sbjct  61   FLNGANL-EVSLLLLENYEPPTLACALNEVLALLVGDGLSNMPTIIAPFVVAASKLKMEN  119

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
            ++S  +D+   YGLQ G S+D+T+AL + L+ PPPSLQ+F+EQLACLLQLV+VL +PT V
Sbjct  120  RTSVSVDNISVYGLQVGASSDLTKALCTNLQIPPPSLQLFNEQLACLLQLVQVLKMPTFV  179

Query  382  LI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            +I +K +++H +TS+++ E I+EIG++LAS SSL  S E+I  D TK  +ET+EPWRALY
Sbjct  180  IIGKKGQNLHRKTSEEEHEVIHEIGQHLASLSSLSFSGEKIAWDATKSSKETQEPWRALY  239

Query  205  G  203
            G
Sbjct  240  G  240



>ref|XP_004243603.1| PREDICTED: uncharacterized protein LOC101268776 [Solanum lycopersicum]
Length=240

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 144/241 (60%), Positives = 190/241 (79%), Gaps = 2/241 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP+VI+LF+D  GFG AIF AL+PNP S+LQ R+ES +LSL+ YGIKD K S EVVH
Sbjct  1    MKVAPKVILLFRDPTGFGTAIFEALQPNPKSNLQKRQESLDLSLQHYGIKDQKVSVEVVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F     L EVS+LLLENYEPP LACAL+EVL++L     S +PT+V PF+V A+KLK+++
Sbjct  61   FLNGANL-EVSLLLLENYEPPTLACALNEVLALLVGDGLSNMPTIVAPFVVAASKLKMEN  119

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
            ++S  +D+   YGLQ G S+D+T+AL + L++PPPSLQI +EQLACLLQLVRVL +PT V
Sbjct  120  RTSVSIDNRSVYGLQVGASSDLTKALCTNLQSPPPSLQICNEQLACLLQLVRVLKMPTYV  179

Query  382  LI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            +I +K +++H +TS+++ E I+EIG++LASFSSL  S E+I  D TK  +ET+EPWRALY
Sbjct  180  IIGKKGQNLHRKTSEEEHEVIHEIGQHLASFSSLSFSGEKIAWDATKSSKETQEPWRALY  239

Query  205  G  203
            G
Sbjct  240  G  240



>emb|CDP20454.1| unnamed protein product [Coffea canephora]
Length=244

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 172/244 (70%), Gaps = 4/244 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDL---HGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGE  752
            MK A RVI+L KD     GF ++I +AL+PNPNS+L+  EESF LSLEKYGIKD KASG 
Sbjct  1    MKAATRVILLLKDGADDGGFASSISNALQPNPNSNLRRLEESFELSLEKYGIKDHKASGN  60

Query  751  VVHFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLK  572
            ++HF    G+ EVSVLLLE+ EPP+LACAL+EVL     G SS IP +VVPF+V A+KLK
Sbjct  61   MIHFLNSNGVSEVSVLLLEHTEPPLLACALNEVLVSFLGGTSSDIPNLVVPFLVEASKLK  120

Query  571  VDSKSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLP  392
            +++K++        YGL+FG   ++T AL SK++  P SLQI+HEQLACLL LVRVL +P
Sbjct  121  LENKNAISSYEVSLYGLEFGQLHNLTHALASKIQKAPQSLQIYHEQLACLLHLVRVLDIP  180

Query  391  TVVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWR  215
             +VL+ + T   +S   ++  E IY IGE LA +SSLC  RER+  +P K  + ++EPW 
Sbjct  181  ALVLVGQHTRHSYSNNLEQYPEVIYGIGELLAEYSSLCFLRERVVWNPPKSSKASKEPWH  240

Query  214  ALYG  203
            ALYG
Sbjct  241  ALYG  244



>ref|XP_004303907.1| PREDICTED: uncharacterized protein LOC101294866 [Fragaria vesca 
subsp. vesca]
Length=237

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 172/242 (71%), Gaps = 7/242 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MK+ P+V++L KD  GFG AI  A  PNP   +   EESF LSLE+YGI++ KASG+V H
Sbjct  1    MKLGPKVVLLLKDPEGFGEAISDAFHPNPTGSVS--EESFELSLERYGIRNCKASGKVRH  58

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G +EVSVLL+E YE PILACA +EVL+ +A  +SS+IPT+V PF V ++KLK DS
Sbjct  59   FLDQQGQFEVSVLLMEYYESPILACAFNEVLAQIAGLKSSSIPTIVAPFFVASSKLKWDS  118

Query  562  KSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS+  +D   + YG+Q G  TD+++A++++ +  PP+LQI +E LACLLQLVRVL LPT 
Sbjct  119  KSATKVDSKGSLYGIQIGAETDISKAIIARTQKAPPTLQIHYEPLACLLQLVRVLNLPTF  178

Query  385  VLIRKTESIHSQTSDK-QLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            +LI + +    + SDK +LE +YEIGE LA+   +  SR +IT  PTK  ++ +EPWRAL
Sbjct  179  ILIGQRD---QRISDKEELEILYEIGELLANTCQVNFSRGKITWKPTKKSKDEQEPWRAL  235

Query  208  YG  203
            YG
Sbjct  236  YG  237



>ref|XP_008353619.1| PREDICTED: uncharacterized protein LOC103417206 [Malus domestica]
Length=237

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 170/242 (70%), Gaps = 7/242 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKV  +V+ L +D  GFG AI  A RPNP++   + EESF LSLE+YGI++ KASG + H
Sbjct  1    MKVGSKVVFLLRDSEGFGEAISAAFRPNPSNS--TIEESFELSLERYGIQNCKASGILRH  58

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F  H GLYEVSVLL+E  EPPILACA++EVL  LA   SS++PTVV PF + ++KLK +S
Sbjct  59   FLDHQGLYEVSVLLMEYSEPPILACAINEVLGELAGRNSSSVPTVVAPFFLESSKLKGES  118

Query  562  KSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS+   +   + YG++ G  T +++A+ ++ + PPPSL+I HE LAC LQLVRVL LPT 
Sbjct  119  KSATKFEXKYSLYGIEIGSETSISKAMATETQKPPPSLRIHHEPLACFLQLVRVLKLPTY  178

Query  385  VLIRKTESIHSQTSDK-QLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            VLI +      + SDK + + +YEIGE LAS  +L  SR++IT +PT+  ++  EPWRAL
Sbjct  179  VLIGQR---GQRISDKEEFQILYEIGELLASTLNLSFSRDKITWNPTRKSKDDREPWRAL  235

Query  208  YG  203
            YG
Sbjct  236  YG  237



>gb|AFK40533.1| unknown [Lotus japonicus]
Length=242

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 166/242 (69%), Gaps = 2/242 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHG-FGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVV  746
            MKVAP V+ LF+D  G F +AI  AL PNP+S     E+SF LSLE YGIKDLKASG V+
Sbjct  1    MKVAPTVVFLFRDTQGGFVSAISEALHPNPSSSFTRLEDSFELSLEGYGIKDLKASGNVI  60

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVD  566
            H   + G+Y+VSV+++++YEPP+LAC L+EVL+ +A  +SS++P+++VPF+V ++K+K  
Sbjct  61   HHVDNHGIYQVSVVVMQHYEPPVLACTLNEVLNEIAGDKSSSVPSLLVPFLVESSKVKGQ  120

Query  565  SKS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            SKS  +     L  G+Q G STDV QAL+ K +  P SLQI HE L  LL  VRV+ LPT
Sbjct  121  SKSLRSDEGKPLILGIQVGQSTDVMQALLKKTQEIPSSLQIQHETLTFLLHFVRVMKLPT  180

Query  388  VVLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
              LI +T       S KQ E I+EIGE LAS + L  S +R+  +P K  RET+EPWRAL
Sbjct  181  FFLIGQTSQHLDNKSTKQREIIHEIGEVLASSTGLQFSEDRVIWNPEKTSRETKEPWRAL  240

Query  208  YG  203
            YG
Sbjct  241  YG  242



>ref|XP_002263850.1| PREDICTED: uncharacterized protein LOC100259755 [Vitis vinifera]
 emb|CBI28478.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 161/240 (67%), Gaps = 14/240 (6%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP+++ LF D   F    F ALRPNPNS L + E++F+LSLE+YGI+D  ASG ++H
Sbjct  1    MKVAPKIVFLFNDCQPF----FDALRPNPNSSLTTLEDAFHLSLERYGIRDRNASGTLLH  56

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F  + G Y++S++LL+NYEPPILACA++EVL+ +   +SS     +  F+VP++KLK + 
Sbjct  57   FVDNKGSYQLSMVLLQNYEPPILACAVNEVLASITGEQSS----PLPTFLVPSSKLKWEI  112

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
            K+SA       YG+Q GP T+ TQAL ++ + PP  LQI HE LA  +QL RVL LPT V
Sbjct  113  KNSAPNHKNALYGMQIGPETETTQALATRTKKPPSLLQIHHEPLAIFIQLARVLKLPTFV  172

Query  382  LIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALYG  203
            LI +          ++LE ++++GE LAS S LC  RERI  +PT   ++  EPWRALYG
Sbjct  173  LIGQ------NGKGEELEMLHKVGEVLASTSGLCFLRERIKWNPTMTSKDVGEPWRALYG  226



>gb|EYU42790.1| hypothetical protein MIMGU_mgv1a012733mg [Erythranthe guttata]
Length=241

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 167/241 (69%), Gaps = 1/241 (0%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA +VI+L        AA+   L PNPNS+ Q+ ++SF   LE YGI+D KASGE++H
Sbjct  1    MKVAEKVILLLNGGDALAAAVSGGLNPNPNSNFQTLKDSFGFPLESYGIEDRKASGEIIH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G YEVS+LLL++YEPP+LACAL+EVL  LA  + ST+PT++ PFIVP +KLK +S
Sbjct  61   FIDSDGHYEVSILLLQSYEPPLLACALNEVLLKLAGNDLSTMPTLIAPFIVPESKLKQES  120

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
              S   D    YG++ G +TD+T+AL S+L   PP  QI HE LA LL LV V+ +PTVV
Sbjct  121  NYSRKNDKGSVYGIKLGHTTDITEALSSRLPKSPPFSQINHEGLAMLLHLVNVIKIPTVV  180

Query  382  LIR-KTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            LI    +S+ ++ S ++LE I EIG++LAS  SL  S+E++  +PTK+ R+ +E WRALY
Sbjct  181  LIGLSDQSVSNKNSKEELEVICEIGDHLASVFSLTFSKEKMVQNPTKISRDDKEAWRALY  240

Query  205  G  203
            G
Sbjct  241  G  241



>ref|XP_011100549.1| PREDICTED: uncharacterized protein LOC105178717 [Sesamum indicum]
Length=241

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 168/241 (70%), Gaps = 1/241 (0%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA +VI+L     GF AAI   L P P S+ Q+  +SF L LE YG+KD K SGE+ H
Sbjct  1    MKVAEKVILLLNGGEGFSAAIAGGLHPKPESNFQTLNDSFELPLECYGVKDQKVSGEITH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G YEVS+L L+NYEPPILACAL+EVL  LA  + ST+PTV+VPF+VP +KLK+ +
Sbjct  61   FVGSNGHYEVSILHLQNYEPPILACALNEVLLKLAGEDLSTVPTVIVPFLVPESKLKLQN  120

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
            + +   +    YG++ GP+TDV+QAL S+L+  PP  QI+HE LA LL LV V+ LPTV+
Sbjct  121  RYTEKSEKVSVYGIKLGPTTDVSQALSSRLQKSPPLFQIYHEGLAMLLHLVNVMKLPTVM  180

Query  382  LIR-KTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            L+    + + ++ S ++LE   +IG++LAS SSL  S+E++  +P K+ R+++E WRALY
Sbjct  181  LVGLSGQHVSNKNSTEELEVTCQIGDHLASISSLSFSKEKVVQNPPKISRDSKEAWRALY  240

Query  205  G  203
            G
Sbjct  241  G  241



>ref|XP_007215903.1| hypothetical protein PRUPE_ppa010763mg [Prunus persica]
 gb|EMJ17102.1| hypothetical protein PRUPE_ppa010763mg [Prunus persica]
Length=237

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 172/242 (71%), Gaps = 7/242 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKV  +V+ L +D  GFG AI  A  P P++   + EESF LSLE YGIK+ KASG + H
Sbjct  1    MKVGSKVVFLLRDSDGFGDAISGAFHPKPSN--TTIEESFELSLEHYGIKNCKASGSIRH  58

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F  H G YEVSVLL++ +EPPILACA++EVL+ +A  +SS+IPT+V PF+V ++KLK++S
Sbjct  59   FLDHQGQYEVSVLLMQYHEPPILACAVNEVLAQIAGKKSSSIPTIVAPFVVASSKLKLES  118

Query  562  KSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS+   +  ++ YG + G  T +++A+ ++ + PPP++QI HE LAC LQL RVL LPT 
Sbjct  119  KSATKFEGKVSLYGTEIGSETAISKAMATRTQKPPPTMQIHHEPLACFLQLARVLKLPTY  178

Query  385  VLIRKTESIHSQTSDK-QLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            VLI +      + SDK +LE +YEIGE LAS  +L  SR++IT +PT+  ++ +EPWRAL
Sbjct  179  VLIGER---GLRISDKEELEILYEIGELLASTLNLYFSRDKITWNPTRKTKDNKEPWRAL  235

Query  208  YG  203
            YG
Sbjct  236  YG  237



>ref|XP_008362323.1| PREDICTED: uncharacterized protein LOC103426009 [Malus domestica]
Length=237

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 170/242 (70%), Gaps = 7/242 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKV  +V+ L +D  GFG AI  A RPNP++   + EESF LSLE+YGI++ KASG + H
Sbjct  1    MKVGSKVVFLLRDSEGFGEAISAAFRPNPSNS--TVEESFELSLERYGIQNCKASGXLRH  58

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G YEVSVLL+E +EPPILACA+SEVL+ LA   SS++PTVV PF + ++KLK +S
Sbjct  59   FLDPQGQYEVSVLLMEYHEPPILACAISEVLAQLAGQNSSSVPTVVAPFFLESSKLKGES  118

Query  562  KSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS+   +   + YG++ G  T +++A+ +K + P PSLQI HE LAC LQLVRVL LP  
Sbjct  119  KSATKFESKCSLYGIEIGSETAISKAMATKTQKPQPSLQIHHEPLACFLQLVRVLKLPVY  178

Query  385  VLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            VLI ++ + ++ +   ++ + +YEIGE LAS  +L  SR++IT +PT+  ++  EPWRAL
Sbjct  179  VLIGQRGQHVYDK---EEFQILYEIGELLASTLNLSFSRDKITWNPTRKSKDDREPWRAL  235

Query  208  YG  203
            YG
Sbjct  236  YG  237



>gb|KCW47642.1| hypothetical protein EUGRSUZ_K01386 [Eucalyptus grandis]
Length=330

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 168/246 (68%), Gaps = 3/246 (1%)
 Frame = -3

Query  931  SLKMKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGE  752
            S  MKVAP+V+ LFKD  G G A   ALRP+P+SDL+  EESF L LE+YGI D  A GE
Sbjct  85   SRDMKVAPKVVFLFKDQDGLGPAFAAALRPDPSSDLRRLEESFELPLERYGIGDGGARGE  144

Query  751  VVHFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLK  572
            VVHF    G+Y+VSVL +E+Y+PP+LACAL+EVL+ L    S T+PT++VPFI  +T LK
Sbjct  145  VVHFVDGHGVYQVSVLQMESYKPPLLACALNEVLAQLMDETSETMPTLLVPFISSSTNLK  204

Query  571  VDSKSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLML  395
             + +S       ++ YGL  G  TDVT A++++ + PP SL+I +E LAC LQLVRVL L
Sbjct  205  SEKRSLPTDSRRVSLYGLHIGRETDVTCAIMAETQKPPSSLEIHYEPLACFLQLVRVLKL  264

Query  394  PTVVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITL-DPTKMCRETEEP  221
            PTV+L+ R  E    + S   LE ++ +GE LA+   LC SR+++   +P+K  R+ EEP
Sbjct  265  PTVILVGRVGERFSEKGSTDALETLHAMGELLANNVGLCFSRDKVVWSNPSKTSRDEEEP  324

Query  220  WRALYG  203
            WRALYG
Sbjct  325  WRALYG  330



>ref|XP_010038754.1| PREDICTED: uncharacterized protein LOC104427349 [Eucalyptus grandis]
Length=355

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 168/246 (68%), Gaps = 3/246 (1%)
 Frame = -3

Query  931  SLKMKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGE  752
            S  MKVAP+V+ LFKD  G G A   ALRP+P+SDL+  EESF L LE+YGI D  A GE
Sbjct  110  SRDMKVAPKVVFLFKDQDGLGPAFAAALRPDPSSDLRRLEESFELPLERYGIGDGGARGE  169

Query  751  VVHFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLK  572
            VVHF    G+Y+VSVL +E+Y+PP+LACAL+EVL+ L    S T+PT++VPFI  +T LK
Sbjct  170  VVHFVDGHGVYQVSVLQMESYKPPLLACALNEVLAQLMDETSETMPTLLVPFISSSTNLK  229

Query  571  VDSKSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLML  395
             + +S       ++ YGL  G  TDVT A++++ + PP SL+I +E LAC LQLVRVL L
Sbjct  230  SEKRSLPTDSRRVSLYGLHIGRETDVTCAIMAETQKPPSSLEIHYEPLACFLQLVRVLKL  289

Query  394  PTVVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITL-DPTKMCRETEEP  221
            PTV+L+ R  E    + S   LE ++ +GE LA+   LC SR+++   +P+K  R+ EEP
Sbjct  290  PTVILVGRVGERFSEKGSTDALETLHAMGELLANNVGLCFSRDKVVWSNPSKTSRDEEEP  349

Query  220  WRALYG  203
            WRALYG
Sbjct  350  WRALYG  355



>ref|XP_008229761.1| PREDICTED: uncharacterized protein LOC103329111 [Prunus mume]
Length=237

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 171/242 (71%), Gaps = 7/242 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKV  +V+ L +D  GFG AI  A  P P++   + EESF LSLE YGIK+ KASG + H
Sbjct  1    MKVGSKVVFLLRDSDGFGDAISGAFHPKPSN--TTIEESFELSLEHYGIKNCKASGSIRH  58

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F  H G YEVS+LL++ YEPPILACA++EVL+ +A  +SS+IPT+V PF+V ++KLK++S
Sbjct  59   FLDHQGQYEVSLLLMQYYEPPILACAVNEVLAQIAGQKSSSIPTLVAPFVVASSKLKLES  118

Query  562  KSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS+      ++ YG + G  T +++A+ ++ + PP ++QI HE LAC LQLVRVL LPT 
Sbjct  119  KSATKFKGKVSLYGTEIGSETAISKAMATRTQKPPSTMQIHHEPLACFLQLVRVLKLPTY  178

Query  385  VLIRKTESIHSQTSDK-QLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            VLI +      + SDK +LE +YEIGE LAS  +L  SR++IT +PT+  ++ +EPWRAL
Sbjct  179  VLIGER---GLRISDKEELEILYEIGELLASTLNLYFSRDKITWNPTRKTKDDKEPWRAL  235

Query  208  YG  203
            YG
Sbjct  236  YG  237



>ref|NP_001241187.1| uncharacterized protein LOC100781998 [Glycine max]
 gb|ACU23389.1| unknown [Glycine max]
 gb|KHN41433.1| hypothetical protein glysoja_031066 [Glycine soja]
Length=241

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 162/241 (67%), Gaps = 1/241 (0%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP V+ LF+D  GF + I  A RP P+S    +E+SF LSLE YGIK LKASG V H
Sbjct  1    MKVAPIVVFLFRDTEGFASTISQAFRPKPSSSFTRQEDSFELSLEAYGIKHLKASGSVSH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G Y+V+++ +E+YEPP+L+CAL+EVL+ + A +SS +PT++VPF+V ++K+K  S
Sbjct  61   FVDDHGAYKVTIVAMEHYEPPVLSCALNEVLNKITADKSSFVPTLLVPFLVESSKVKGHS  120

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS  +     L +G++ G +TD+ QAL++K++ PP SL+I HE  AC L  VRV+ LPT 
Sbjct  121  KSLRSDEIKPLIFGIKIGQNTDIMQALLNKIQEPPSSLRIQHETFACFLHFVRVMQLPTF  180

Query  385  VLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
             LI +        S KQ E ++ IGE LAS + L  S +R+  +P K   E++EPWRALY
Sbjct  181  FLIGQASQYLDNKSTKQQEILHAIGEILASTTDLQFSEDRVVWNPKKASGESKEPWRALY  240

Query  205  G  203
            G
Sbjct  241  G  241



>ref|XP_004488290.1| PREDICTED: uncharacterized protein LOC101511378 isoform X1 [Cicer 
arietinum]
Length=234

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 165/241 (68%), Gaps = 8/241 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MK++P  + +F+D  GF + I  AL PNP+S     EESF LSLE YGIKD KASG V+H
Sbjct  1    MKLSPITLFMFRDSDGFASIISQALHPNPSSSFTPIEESFELSLEDYGIKDHKASGIVLH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            +  + G+Y+VS++L+++YEPP+LACAL+EVL+ +A G+ S+IPT++VPF+V ++K+K  S
Sbjct  61   YVDNHGIYKVSIVLMQHYEPPVLACALNEVLNKIAGGDPSSIPTLLVPFLVESSKVKGYS  120

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS  +    ALT+G+Q G +TD+ Q L+ K +  P SLQI  E  AC L  VRV+ LPT 
Sbjct  121  KSLRSDESRALTFGIQIGHTTDIMQTLLKKTQETPSSLQIQQENFACFLHFVRVMKLPTF  180

Query  385  VLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
             LI        Q+S KQ EAI EIG+ LAS + L  S E++  +P K  RE++EPWR LY
Sbjct  181  FLI-------GQSSTKQHEAICEIGDILASSTGLQFSEEKVIWNPKKTSRESKEPWRDLY  233

Query  205  G  203
            G
Sbjct  234  G  234



>ref|XP_002524596.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37804.1| conserved hypothetical protein [Ricinus communis]
Length=241

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 163/246 (66%), Gaps = 11/246 (4%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA  ++ LFKD  GF +A+ +AL P+PN+     EE+F LSL KYGIKDLKA G ++H
Sbjct  1    MKVAQNIVFLFKDSDGFASAVANALCPSPNTSFHRLEETFELSLGKYGIKDLKAIGNLIH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStip-tvvvpfivPATKLKVD  566
            F    G Y+VSVLLLE YEPP L CA+SEVL+ +   ESS     ++VPF+  A+KLK +
Sbjct  61   FVDSGGNYQVSVLLLEKYEPPTLVCAVSEVLTQMV--ESSLSIPALIVPFVGMASKLKHE  118

Query  565  SKSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            + +++    A  YG+Q GP TD+T A+V + + PP SLQI  E LAC LQ+VR+L LPT 
Sbjct  119  TSATSNDGRASFYGVQIGPETDITSAIVRRTKKPPSSLQIHFEPLACFLQVVRILKLPTT  178

Query  385  VLIRKTESIHSQTSDKQLEAIY----EIGEYLASFSSLCLSRERITLDP-TKMCRETEEP  221
            +L  +   +  + + K+LE I+    E+GE LAS  SL  SRE+IT +P     ++ +EP
Sbjct  179  LLFGR---LSDKAAGKELELIFQILSEMGELLASTMSLSFSREKITWNPAANTSKDIKEP  235

Query  220  WRALYG  203
            WRALYG
Sbjct  236  WRALYG  241



>ref|XP_006447851.1| hypothetical protein CICLE_v10016450mg [Citrus clementina]
 gb|ESR61091.1| hypothetical protein CICLE_v10016450mg [Citrus clementina]
Length=242

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 167/243 (69%), Gaps = 4/243 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLE-KYGIKDLKASGEVV  746
            MKVAP++I L +D  G  AAI  AL  NP+S  +  EESF LSLE +YGIK+ KA G++V
Sbjct  1    MKVAPKLIFLLRDPEGLVAAIADALHSNPSSSYRRLEESFELSLEQRYGIKEQKARGQLV  60

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVD  566
            HF    G Y+VSVLLL+NYEPP L CA+SEVL+ L   E+ST+P ++ PF+V ++KLK  
Sbjct  61   HFIDDKGNYQVSVLLLQNYEPPALVCAISEVLAQLNC-ETSTLPLLLAPFVVESSKLKGQ  119

Query  565  SKSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
             KS A  +  ++ YGLQ G  TD+TQA+ ++ +  P SLQI  E LAC LQLVR+L LPT
Sbjct  120  EKSLAASESKVSLYGLQIGLETDITQAMAARTQKAPSSLQIHCEPLACFLQLVRILKLPT  179

Query  388  VVLIRKTESIHS-QTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
             +LI +  + HS +TS  +L+ ++E+G+ LA  + L   RE+I  +P K  ++ +EPWRA
Sbjct  180  FILIGQRTTSHSNKTSGGELQILHEMGDLLAKNTGLSFRREKIIWNPAKESKDAQEPWRA  239

Query  211  LYG  203
            LYG
Sbjct  240  LYG  242



>ref|XP_010107359.1| hypothetical protein L484_006874 [Morus notabilis]
 gb|EXC15610.1| hypothetical protein L484_006874 [Morus notabilis]
Length=242

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 163/243 (67%), Gaps = 4/243 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPN--SDLQSREESFNLSLEKYGIKDLKASGEV  749
            MKVAP  + LF+D  GFG AI  A   NPN  S L+S EE F LSLE+YGIKD + SG +
Sbjct  1    MKVAPITVFLFRDSEGFGTAISEAFHLNPNNPSSLRSLEEPFELSLERYGIKD-RVSGNI  59

Query  748  VHFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKV  569
            +HF  H GL++VS LL+++YEPPILACA++EVL  +   +SS +PT++ PFIVP++KLK 
Sbjct  60   LHFVDHQGLHQVSFLLIQHYEPPILACAVAEVLEQITREKSSPLPTIIAPFIVPSSKLKQ  119

Query  568  DSKSSAIMDHAL-TYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLP  392
            + K+    ++ +  YGLQ GP TD T+AL +++  P  S Q+ HE LACLLQL R+  LP
Sbjct  120  NGKTLTKSENKIPVYGLQVGPVTDTTKALAARVEEPSCSFQVHHEPLACLLQLARISNLP  179

Query  391  TVVLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
            T +LI +     S  + ++LE I EIGE L+S  +LC S+E I  +P    +   EPWRA
Sbjct  180  TFLLIWEKGRRFSDKNAEELEIISEIGEILSSTLNLCFSKEGIEWNPKGTSKNIVEPWRA  239

Query  211  LYG  203
            LYG
Sbjct  240  LYG  242



>ref|XP_006469409.1| PREDICTED: uncharacterized protein LOC102629811 [Citrus sinensis]
Length=242

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 166/243 (68%), Gaps = 4/243 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLE-KYGIKDLKASGEVV  746
            MKVAP++I L +D  G   AI  AL  NP+S  +  EESF LSLE +YGIK+ KA G++V
Sbjct  1    MKVAPKLIFLLRDPEGLVTAIADALHSNPSSSYRRLEESFELSLEQRYGIKEQKARGQLV  60

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVD  566
            HF    G Y+VSVLLL+NYEPP L CA+SEVL+ L   E+ST+P ++ PF+V ++KLK  
Sbjct  61   HFIDDKGNYQVSVLLLQNYEPPALVCAISEVLAQLNC-ETSTLPLLLAPFVVESSKLKGQ  119

Query  565  SKSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
             KS A  +  ++ YGLQ G  TD+TQA+ ++ +  P SLQI  E LAC LQLVR+L  PT
Sbjct  120  EKSLAASESKVSLYGLQIGLETDITQAMAARTQKAPSSLQIHCEPLACFLQLVRILKSPT  179

Query  388  VVLIRKTESIHS-QTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
             +LI +  + HS +TS  +L+ ++E+G+ LAS + L   RE+I  +P +  ++ +EPWRA
Sbjct  180  FILIGQRTTSHSNKTSGGELQILHEMGDLLASNTGLSFRREKIIWNPAQESKDAQEPWRA  239

Query  211  LYG  203
            LYG
Sbjct  240  LYG  242



>ref|XP_003546571.1| PREDICTED: uncharacterized protein LOC100798748 [Glycine max]
 gb|KHN35587.1| hypothetical protein glysoja_042202 [Glycine soja]
Length=241

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 156/241 (65%), Gaps = 1/241 (0%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP V+ LF+D  GF +AI  AL  NP+S    +E+ F LSLE YGIK LK SG V H
Sbjct  1    MKVAPIVVFLFRDTEGFASAISQALHANPSSSFTRQEDFFELSLEAYGIKHLKTSGSVSH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G Y+V+++ +E+YEPP+LACAL+EVL+ +   +SS IPT++VPF+V ++K+K  S
Sbjct  61   FVDDHGAYKVTIVAMEHYEPPVLACALNEVLNKITEDKSSLIPTLLVPFLVESSKVKGHS  120

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS  +     L +G + G +TD+ QAL++K + PP SL + HE  AC L  V V+ LPT 
Sbjct  121  KSLRSDESKPLIFGTKIGQNTDIMQALLNKTQEPPSSLGVQHETFACFLHFVHVMQLPTF  180

Query  385  VLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
             LI +        S KQ E ++ IGE LAS + L  S +R+  +P K   E++EPWRALY
Sbjct  181  FLIGQASQYLDNKSTKQHEILHAIGEILASTTGLQFSEDRVVWNPKKASGESKEPWRALY  240

Query  205  G  203
            G
Sbjct  241  G  241



>gb|KFK38226.1| hypothetical protein AALP_AA3G085000 [Arabis alpina]
Length=241

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 162/242 (67%), Gaps = 3/242 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA +++ L  D  GF A I  AL PNP+S L+  EE   L L+KYG+KD+   G +VH
Sbjct  1    MKVAEKIVFLLNDSDGFAATIADALNPNPSSSLRKLEERIQLPLDKYGVKDVGTGGSIVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G+Y+VSV LL +YEPP L CA++E+L ++   E+ST+PT+V PF V A+KLK ++
Sbjct  61   FVDDNGVYQVSVFLLRSYEPPALVCAMNELLDLITR-EASTLPTIVAPFFVAASKLKFNN  119

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            ++  A    A  + +Q GP T+ ++   S++  PPPS+QI +E L+CLL L RV  LPT 
Sbjct  120  RALEASTRKASLHYVQVGPETETSRLFASRIEKPPPSMQIKYEPLSCLLHLARVKGLPTS  179

Query  385  VLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            +LI +++ SI ++  D++L+ I+E GE +AS++ L  SR+RI  + +K  +E E PWRAL
Sbjct  180  ILIGQRSSSISNKALDEELQVIHETGELVASYAGLSFSRDRIKWNVSKTSKEEESPWRAL  239

Query  208  YG  203
            YG
Sbjct  240  YG  241



>ref|XP_003595548.1| hypothetical protein MTR_2g049140 [Medicago truncatula]
 gb|AES65799.1| MLP3.9 protein [Medicago truncatula]
 gb|AFK46905.1| unknown [Medicago truncatula]
Length=238

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 159/241 (66%), Gaps = 4/241 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MK+AP  + +F+D  GF +AI  AL    +S     E+SF LSLE YGIKD KASG V+H
Sbjct  1    MKLAPITVFMFRDSEGFASAISQALS---SSSFTRLEDSFELSLEGYGIKDHKASGNVLH  57

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            +  +   Y+VS++++++YEPP+LACAL+EVL+ +  G+ S++PT++VPF+V ++K+K +S
Sbjct  58   YLDNHRSYKVSIVIMQHYEPPVLACALNEVLNKIVGGDPSSMPTLLVPFLVESSKVKGNS  117

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS  +    ALTYG+Q G  T+  Q L+ K + PP SL+I  E  AC L  VRV+ LPT 
Sbjct  118  KSLRSDESRALTYGIQIGQITETMQTLLKKTQEPPSSLRIQQENFACFLHFVRVMKLPTF  177

Query  385  VLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
             LI +T       S KQ EAI EIGE LAS + L  S +R+  +P K  +E +EPWR LY
Sbjct  178  FLIGQTSQYLDNKSPKQHEAICEIGEILASSTGLEFSEDRVIWNPKKTLKEIKEPWRDLY  237

Query  205  G  203
            G
Sbjct  238  G  238



>ref|XP_008462021.1| PREDICTED: uncharacterized protein LOC103500492 [Cucumis melo]
Length=246

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/246 (45%), Positives = 161/246 (65%), Gaps = 6/246 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MK+AP+VI L +D  GF +A+  ALR NP S + + +E F  SLE Y IKD KASG +VH
Sbjct  1    MKLAPKVIFLLRDSEGFASALSGALRLNPPSTVTTLDEIFEFSLEDYAIKDQKASGNIVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAA----GESStiptvvvpfivPATKL  575
            +    G+Y+VSVL+L+NYEPP+LACAL  VLS +A       S   PT+VVP I+ ++KL
Sbjct  61   YLDDKGIYQVSVLILQNYEPPVLACALDVVLSHIAGERSPSSSKAKPTLVVPSIITSSKL  120

Query  574  KVDSKSSAIMDHA-LTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLM  398
            K +SK+    D   L YG Q GP TD++Q + +K++  P + QI++EQLACL  L+ +L 
Sbjct  121  KWESKTLTKNDRTVLLYGTQVGPETDISQTMGAKVKKLPSASQIYYEQLACLYHLIHILK  180

Query  397  LPTVVLIRKT-ESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEP  221
            +P   ++  T  S+ +Q + ++++ + E+GE LA+   L  SRE I  +P +  ++ +EP
Sbjct  181  IPAFFVVGLTGRSLSNQAAGEEIQILNEMGELLANSLPLSFSREGIVWNPKETSKDVKEP  240

Query  220  WRALYG  203
            WRALYG
Sbjct  241  WRALYG  246



>gb|KDP23000.1| hypothetical protein JCGZ_01722 [Jatropha curcas]
Length=242

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 167/242 (69%), Gaps = 2/242 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA ++I LF D  GF  AI  AL PNPNS ++  EESF LSL ++G++DLKA G +++
Sbjct  1    MKVASKIIFLFNDTDGFATAISTALYPNPNSFVRRLEESFELSLARFGVQDLKAKGHLIN  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G  +VSVLLLE YEPP L CA+SEVL+ +    SS + T+++P I  ++KLK +S
Sbjct  61   FIDSGGDPQVSVLLLEKYEPPTLVCAVSEVLTQIIGEGSSGLLTLIIPLIGTSSKLKWES  120

Query  562  KSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            +S    D  ++ YG+Q GP TD+TQA+ S+ + P  ++++ +E LAC LQLVRVL LPT 
Sbjct  121  RSLTANDGKVSLYGVQIGPETDITQAIASRTQKPQSNVKVHYEPLACFLQLVRVLKLPTS  180

Query  385  VLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            VLI ++  ++  + ++++LE +YE+GE LA+   LC  RE+I  +P  + ++ +EPWRAL
Sbjct  181  VLIGQRNRTLSDKAAEEELEILYELGELLANTVGLCFLREKIMWNPGNISKDIKEPWRAL  240

Query  208  YG  203
            YG
Sbjct  241  YG  242



>ref|XP_010547190.1| PREDICTED: uncharacterized protein LOC104819026 [Tarenaya hassleriana]
Length=243

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 167/245 (68%), Gaps = 7/245 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA +++ L+ D HGF  AI  AL PN NS L+  EE F L L+KYGI D+ ASG+++H
Sbjct  1    MKVAEKIVFLWNDPHGFATAIIGALNPNLNSSLRILEEPFELPLDKYGIGDVSASGKIIH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G+++VSVLLL++YEPP  ACA++E+L  +  G S+ +PTVV PF+V A+KLK  +
Sbjct  61   FVDENGVFQVSVLLLQSYEPPTTACAINELLDQITRGLST-LPTVVAPFLVAASKLKFQN  119

Query  562  KS--SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            +S  S   +  L Y +Q GP T +++   S+++ PPP LQI +E L+C LQL RVL +PT
Sbjct  120  RSLASRSENANLCY-VQLGPETGISKLCASRIQRPPPLLQIHYEPLSCFLQLARVLRMPT  178

Query  388  VVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRET--EEPW  218
             VLI +++ +I ++  +++L+ I+EIGE +AS + LC SR+ I  +  K  +E   E+PW
Sbjct  179  TVLIGQRSTAISNKALEEELQVIHEIGELVASSTGLCFSRDGIKWNVPKTSKEGGEEKPW  238

Query  217  RALYG  203
             +LYG
Sbjct  239  LSLYG  243



>ref|XP_008803175.1| PREDICTED: uncharacterized protein LOC103716790 [Phoenix dactylifera]
Length=241

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 157/241 (65%), Gaps = 1/241 (0%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M++AP+VI L +D  GFG AI  ALRPNP+S+      SF LSLEKYGI D KASG+++ 
Sbjct  1    MRLAPKVIFLVRDPDGFGPAIADALRPNPDSNFMRETSSFELSLEKYGIGDRKASGDLIE  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G  +VS+LLL NY PPI ACA+ EVL+++++ ES   P +++P+++ A K+  + 
Sbjct  61   FVDPHGSPQVSILLLPNYGPPIAACAVKEVLALISSEESPNQPIIILPYVMKALKVNQEL  120

Query  562  KSSAIMDH-ALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
             + A  +   +  G +   +TD+ Q+++++  T P SLQI  E LACLLQ+VRVL LPTV
Sbjct  121  ANPASSEQKVMLCGAEIQGTTDIFQSMIAETATAPSSLQIHCESLACLLQMVRVLNLPTV  180

Query  385  VLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            ++         +++D++LEA+YE+G +LA+   LC S E +     +  R  +EPWRALY
Sbjct  181  LIASCARDQSKRSADQELEALYEVGRFLANHMGLCFSIEGLQQKEIEKPRSVQEPWRALY  240

Query  205  G  203
            G
Sbjct  241  G  241



>ref|XP_002882540.1| hypothetical protein ARALYDRAFT_478093 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58799.1| hypothetical protein ARALYDRAFT_478093 [Arabidopsis lyrata subsp. 
lyrata]
Length=241

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 162/242 (67%), Gaps = 3/242 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA ++++L+ D  GF A I  AL PNP+S L+  EE  +L L+KYG++  +  G +VH
Sbjct  1    MKVAEKIVILWNDSDGFAATIADALSPNPSSPLRKLEEQIHLPLDKYGVEGAETGGSIVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G+Y+VS+ LL +YEPP+L CA++E+L ++   E ST+PT+V PF+V A+KLK ++
Sbjct  61   FVDENGVYQVSIFLLPSYEPPVLVCAMNELLDLITR-EVSTLPTIVAPFLVAASKLKFNN  119

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            +S  A    A  + +Q GP T++++   S++  PPP +QI +E L+CLL L RV  LPT 
Sbjct  120  RSYEANRRTASLHYVQVGPETEISRLFASRIEKPPPLMQIHYEPLSCLLHLARVKRLPTS  179

Query  385  VLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            +LI +++ S+  +  D+ L+ I+E GE +AS++ L  SR+RI    +K  +E E PWRAL
Sbjct  180  ILIGQRSSSLSHKALDQDLQVIHETGELVASWTGLSFSRDRIKWSASKTSKEEESPWRAL  239

Query  208  YG  203
            YG
Sbjct  240  YG  241



>emb|CDX74035.1| BnaA03g30120D [Brassica napus]
Length=241

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 158/243 (65%), Gaps = 5/243 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA ++++L+ +  GF A I  AL  NP S L+  EE  +L L  YGI+D  + G VVH
Sbjct  1    MKVAEKIVILWNESDGFAATIADALSTNPTSSLRKLEEQIHLPLANYGIEDGGSGGSVVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G Y+VSV LL +YEPP L CA++E+L ++   ESS +PT+V PF V A+KLK ++
Sbjct  61   FVDEDGAYQVSVFLLRSYEPPALVCAMNELLDMITR-ESSALPTIVAPFFVAASKLKFNN  119

Query  562  KS--SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            KS  ++    +L Y +Q GP T+ T+   +++  PPP +QI HE L+CLL L RV  LPT
Sbjct  120  KSLEASSRKASLRY-VQVGPETEATRLFATRVEKPPPLMQILHEPLSCLLHLARVKCLPT  178

Query  388  VVLIRKTESIHSQTS-DKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
             +LI +  S  S T+ +++L+ I+E GE +AS++ LC +R+RI    +K  +E E PWRA
Sbjct  179  SILIGQRSSSVSHTALNEELQVIHETGELVASWTGLCFARDRIKWSASKTSKEEESPWRA  238

Query  211  LYG  203
            LYG
Sbjct  239  LYG  241



>ref|XP_007138506.1| hypothetical protein PHAVU_009G214800g [Phaseolus vulgaris]
 gb|ESW10500.1| hypothetical protein PHAVU_009G214800g [Phaseolus vulgaris]
Length=240

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 155/241 (64%), Gaps = 2/241 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP V+ LF+D  GF AAI  AL PN +S    RE++F+ SLE YGIK LKASG V H
Sbjct  1    MKVAPVVVFLFRDSEGFAAAILQALHPNTSSSFTRREDTFDHSLEPYGIKHLKASGSVSH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G Y VS++ +E+YEPP+LACAL+EVL+ + A +SS +PT++VPF+V ++K+K   
Sbjct  61   FVDEHGAYMVSIVAMEHYEPPVLACALNEVLNKITADKSS-LPTLLVPFLVESSKVKGKI  119

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            K   +     L +G+  G +TD+ QAL++K +  P S  I HE  A  L  VRV+ LPT 
Sbjct  120  KHLGSDESKPLIFGIPIGQNTDIMQALLNKTQELPSSSWIQHEIFASFLHFVRVMQLPTF  179

Query  385  VLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
             LI +T       S KQ E I+ IGE LAS + L  S +R+  +P K   +++EPW+ALY
Sbjct  180  FLIGQTSQYLDDQSTKQHEIIHAIGEILASTTGLQFSEDRVVWNPKKKSVQSKEPWQALY  239

Query  205  G  203
            G
Sbjct  240  G  240



>ref|XP_004144560.1| PREDICTED: uncharacterized protein LOC101217042 [Cucumis sativus]
 ref|XP_004161009.1| PREDICTED: uncharacterized protein LOC101225303 [Cucumis sativus]
 gb|KGN43390.1| hypothetical protein Csa_7G031020 [Cucumis sativus]
Length=246

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/246 (44%), Positives = 161/246 (65%), Gaps = 6/246 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MK+AP+VI L +D  GF +A+  ALR +P S + + +E F  SLE Y IKD KASG +VH
Sbjct  1    MKLAPKVIFLLRDSEGFASALSGALRLSPPSTVTTLDECFEFSLEDYAIKDQKASGNIVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAA----GESStiptvvvpfivPATKL  575
            +    G+Y+VSVL+L+NYEPP+LACAL  VLS +A       S   PTVVVP ++ ++KL
Sbjct  61   YLDDKGIYQVSVLILQNYEPPVLACALDVVLSHIAGERSPSSSKAKPTVVVPSVITSSKL  120

Query  574  KVDSKSSAIMDHA-LTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLM  398
            K +SK+    D   L YG + GP TD+++ + +K++  P + QI++EQLACL  L+ +L 
Sbjct  121  KWESKTLTKNDRTVLLYGTEVGPETDISRTMGAKVKKLPSTSQIYYEQLACLYHLIHILN  180

Query  397  LPTVVLIRKT-ESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEP  221
            +P   ++  T  S+ +Q + ++++ + E+GE LA+   L  SRE I  +P +  +E +EP
Sbjct  181  IPAFFVVGLTGRSLSNQAAGEEIQILNEMGELLANSLPLSFSREGIVWNPKETSKEVKEP  240

Query  220  WRALYG  203
            WRALYG
Sbjct  241  WRALYG  246



>ref|XP_010456375.1| PREDICTED: uncharacterized protein LOC104737782 [Camelina sativa]
 ref|XP_010456429.1| PREDICTED: uncharacterized protein LOC104737782 [Camelina sativa]
Length=242

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 161/243 (66%), Gaps = 4/243 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKD-LKASGEVV  746
            MKVA +++ L++D  GF   I  AL P+P S L+  EE   L L+KYG++D ++  G +V
Sbjct  1    MKVAEKIVFLWEDSDGFATTIADALNPSPGSPLRKLEEQIQLPLDKYGVRDDVETGGSIV  60

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVD  566
            HF    G Y+VS+ LL NYEPP+L CA++E+L ++   E+ST+ T+V PF+V A+KLK +
Sbjct  61   HFVDENGAYQVSIFLLRNYEPPLLVCAMNELLDLITR-EASTLSTIVTPFLVAASKLKFN  119

Query  565  SKS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            ++S  A    A  + +Q G  TD ++   S++  PPP +QI +E L+CLL L RV  LPT
Sbjct  120  NRSLEANNRKASLHYVQVGTETDTSRLFASRIEKPPPLMQIHYEPLSCLLHLARVKRLPT  179

Query  388  VVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
             +LI +++ S++S+  D++L+ I+E GE +AS++ L  SR+RI    +K  +E E PWRA
Sbjct  180  SILIGQRSSSLYSKALDEELQVIHETGELVASWTGLSFSRDRIKWSASKTSKEEESPWRA  239

Query  211  LYG  203
            LYG
Sbjct  240  LYG  242



>ref|XP_010486333.1| PREDICTED: uncharacterized protein LOC104764490 [Camelina sativa]
Length=241

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/243 (42%), Positives = 154/243 (63%), Gaps = 5/243 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASG-EVV  746
            MKVA +++ L++D  GF A I  AL P+P+S L+  EE   L L+KYG++D   +G  +V
Sbjct  1    MKVAEKIVFLWEDSDGFAATIADALNPSPSSPLRKLEEQIQLPLDKYGVRDDAGTGGSIV  60

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVD  566
            HF    G+Y+VS+ LL +YEPP+L CA++E+L ++    S+            A+KLK +
Sbjct  61   HFVDENGVYQVSIFLLRSYEPPVLVCAMNELLDLITRETSTLTIVAPFLVA--ASKLKFN  118

Query  565  SKS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            ++S  A    A  + +Q G  TD ++   S++  PPP +QI +E L+CLL L RV  LPT
Sbjct  119  NRSLEANNSKASLHYVQVGTETDTSRLFASRIEKPPPLMQIHYEPLSCLLHLARVKRLPT  178

Query  388  VVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
             +LI +++ S++S+T D++L+ I+E GE +AS++ L  SRERI    +K  +E E PWRA
Sbjct  179  CILIGQRSSSLYSKTLDEELQVIHETGELVASWAGLSFSRERIKWIASKTSKEEESPWRA  238

Query  211  LYG  203
            LYG
Sbjct  239  LYG  241



>ref|XP_009134987.1| PREDICTED: uncharacterized protein LOC103859236 [Brassica rapa]
Length=241

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 157/243 (65%), Gaps = 5/243 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA ++++L+ +  GF A I  AL  NP S L+  EE  +L L  YGI+D  + G VVH
Sbjct  1    MKVAEKIVILWNESDGFAATIADALSTNPTSSLRKLEEQIHLPLANYGIEDGGSGGSVVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G Y+VSV LL +YEPP L CA++E+L ++   ESS +PT+V PF V A+KLK ++
Sbjct  61   FVDEDGAYQVSVFLLRSYEPPALVCAMNELLDLITR-ESSALPTIVAPFFVAASKLKFNN  119

Query  562  KS--SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            KS  ++    +L Y +Q GP T+ T+   +++  PPP +QI HE L+CLL L RV  LPT
Sbjct  120  KSLEASSRKASLRY-VQVGPETEATRLFATRVEKPPPLMQILHEPLSCLLHLARVKCLPT  178

Query  388  VVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
             +LI +++ S   +  ++ L+ I+E GE +AS++ LC +R+RI    +K  +E E PWRA
Sbjct  179  SILIGQRSSSTSHKALNEGLQVIHETGELVASWTGLCFARDRIKWSASKTSKEEESPWRA  238

Query  211  LYG  203
            LYG
Sbjct  239  LYG  241



>ref|XP_010464400.1| PREDICTED: uncharacterized protein LOC104744958 [Camelina sativa]
Length=242

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 164/243 (67%), Gaps = 4/243 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKD-LKASGEVV  746
            MKVA +++ L++D  GF A I  AL P+P+S L+  EE   L L+KYG++D +   G +V
Sbjct  1    MKVAEKIVFLWEDSDGFAATIADALNPSPSSPLRKLEEQIQLPLDKYGVRDDVGTGGSIV  60

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVD  566
            HF    G+Y+VS+ LL +YEPP+L CA++E+L +++  E+ST+PT+V PF+V A+KLK +
Sbjct  61   HFVDQNGVYQVSIFLLRSYEPPLLVCAMNELLDLISR-EASTLPTIVAPFLVAASKLKFN  119

Query  565  SKS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            ++S  A    A  + +Q G  TD ++   S++  PPP +QI +E L+CLL L RV  LPT
Sbjct  120  NRSLEANNSKASLHYVQVGTETDTSRLFASRIEKPPPLMQIHYEPLSCLLHLARVKRLPT  179

Query  388  VVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
             +LI +++ S++ +  D++L+ I+E GE +AS++ L  SR+RI    +K  +E E PWRA
Sbjct  180  SILIGQRSSSLYRKALDEELQVIHETGELVASWTGLSFSRDRIKWSASKTSKEEESPWRA  239

Query  211  LYG  203
            LYG
Sbjct  240  LYG  242



>ref|XP_006298429.1| hypothetical protein CARUB_v10014498mg [Capsella rubella]
 gb|EOA31327.1| hypothetical protein CARUB_v10014498mg [Capsella rubella]
Length=243

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/244 (45%), Positives = 160/244 (66%), Gaps = 5/244 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGI-KDLKASGEVV  746
            MKVA +++ L+KD  GF A I  AL P+P+S L+  EE   L L+KYG+  D+   G +V
Sbjct  1    MKVAEKIVFLWKDSDGFAATIADALNPSPSSPLRKLEEQIQLPLDKYGVHDDVGTGGSIV  60

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVD  566
            HF    G+Y+VS+ LL +YEPP+L CA++E+L  +   E+ST+PT+V PF+V A+KLK +
Sbjct  61   HFVDENGVYQVSIFLLRSYEPPVLVCAMNELLDQITR-EASTLPTIVAPFLVAASKLKFN  119

Query  565  SKS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            ++S  A       Y +Q G  T+ ++   S++  PPP +QI  E L+CLL L RV  LPT
Sbjct  120  NRSLEANNKKTSLYYVQVGTETETSRLFASRIEKPPPLMQINCEPLSCLLHLARVKCLPT  179

Query  388  VVLI-RKTESIHSQT-SDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWR  215
             +LI +++ SI+ +   +++L+ I+E GE +AS+S LC+SRERI     K  +E E PWR
Sbjct  180  CILIGQRSSSIYRKALEEEELQVIHETGELVASWSGLCMSRERIKWSAAKTSKEEESPWR  239

Query  214  ALYG  203
            ALYG
Sbjct  240  ALYG  243



>emb|CDY07983.1| BnaC03g35400D [Brassica napus]
Length=238

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 155/243 (64%), Gaps = 8/243 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA +++ L+ D  GF A I  AL PNP S L+  EE   L L  YGI+D    G V H
Sbjct  1    MKVAEKIVFLWNDSDGFAATIADALNPNPTSSLRKLEEQIQLPLVNYGIED---GGSVAH  57

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G Y+VSV LL +YEPP L CA++E+L ++   E+S +PT+  PF+V A+KLK ++
Sbjct  58   FVDEDGAYQVSVFLLRSYEPPALVCAMNELLDMITR-EASILPTIAAPFLVAASKLKFNN  116

Query  562  KS--SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            KS  ++    +L Y +Q GP T+ T+   +++  PPP +QI HE L+CLL L RV  LPT
Sbjct  117  KSLEASSRKASLRY-VQVGPETEATRLFATRVEKPPPLMQILHEPLSCLLHLARVKCLPT  175

Query  388  VVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
             +LI +++ S+  +  +++L+ I+E GE +AS++ LC  R+ I  + +K  +E E PWRA
Sbjct  176  SILIGQRSSSVSHKALNEELQVIHETGELVASWTGLCFERDGIKWNASKTSKEEESPWRA  235

Query  211  LYG  203
            LYG
Sbjct  236  LYG  238



>ref|XP_010942899.1| PREDICTED: uncharacterized protein LOC105060759 isoform X2 [Elaeis 
guineensis]
Length=240

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 154/241 (64%), Gaps = 2/241 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MK+AP+VI L +D  GFG AI  AL P+  S       SF LSLEKYGI D KASG+++ 
Sbjct  1    MKLAPKVIFLVRDPDGFGPAIADALLPSSESKFTRETSSFELSLEKYGIGDRKASGDLIE  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G  +VS+LLL NY PPI ACA+ EVL+++++ ESS   T+++P+++ A  +  + 
Sbjct  61   FVDPHGSPQVSILLLPNYGPPIAACAVKEVLALISSEESSNHTTIILPYVMKALMVNQEL  120

Query  562  KSSAIMDH-ALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
             + A  +   + YG + G +TD+ Q+++++  T PP LQI  E LACLLQ+VRVL LPTV
Sbjct  121  ANPASSERKVMLYGAEIGGTTDIIQSMIAETAT-PPLLQIHCESLACLLQMVRVLNLPTV  179

Query  385  VLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            ++         +++ ++ EA YE+G +LA+   LC S+ER+     +  R  +EPWRALY
Sbjct  180  LIASHAPDQSKRSAGQEFEAWYEVGHFLANHMGLCFSKERLQQKGIEKPRSVQEPWRALY  239

Query  205  G  203
            G
Sbjct  240  G  240



>ref|XP_006407813.1| hypothetical protein EUTSA_v10021420mg [Eutrema salsugineum]
 gb|ESQ49266.1| hypothetical protein EUTSA_v10021420mg [Eutrema salsugineum]
Length=240

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 157/242 (65%), Gaps = 4/242 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MK+A ++++L+ D  GF A +  AL PNP S L+  EE   L L+KYG++     G +VH
Sbjct  1    MKLAEKIVLLWNDPDGFAATVADALNPNPASPLRKLEEQIELPLDKYGVEG-GTGGSIVH  59

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G+Y+VS+ LL NYEPP+L CA++E+L ++   E+ T PT+V PF+V A+KLK ++
Sbjct  60   FVDGNGVYQVSIFLLRNYEPPVLVCAMNELLDLITR-EAPTPPTIVAPFLVAASKLKFNN  118

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            +S  A    A  + +Q GP T+  +   S++  PPP +QI HE L+CLL L RV  L T 
Sbjct  119  RSLEASSRKASLHYVQVGPETETARLFASRIEKPPPLMQILHEPLSCLLHLARVKRLSTS  178

Query  385  VLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            +LI +++ SI  +  D++L+ I+E GE +AS++ L  SR++I  + +K  +E E PWRAL
Sbjct  179  ILIGQRSSSISHKALDEELQVIHETGELVASWTGLSFSRDKIKWNASKTSKEEESPWRAL  238

Query  208  YG  203
            YG
Sbjct  239  YG  240



>ref|XP_010942898.1| PREDICTED: uncharacterized protein LOC105060759 isoform X1 [Elaeis 
guineensis]
Length=248

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/249 (43%), Positives = 155/249 (62%), Gaps = 10/249 (4%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MK+AP+VI L +D  GFG AI  AL P+  S       SF LSLEKYGI D KASG+++ 
Sbjct  1    MKLAPKVIFLVRDPDGFGPAIADALLPSSESKFTRETSSFELSLEKYGIGDRKASGDLIE  60

Query  742  FQAHTG--------LYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivP  587
            F    G        +Y VS+LLL NY PPI ACA+ EVL+++++ ESS   T+++P+++ 
Sbjct  61   FVDPHGSPQARQFSVYLVSILLLPNYGPPIAACAVKEVLALISSEESSNHTTIILPYVMK  120

Query  586  ATKLKVDSKSSAIMDH-ALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLV  410
            A  +  +  + A  +   + YG + G +TD+ Q+++++  TPP  LQI  E LACLLQ+V
Sbjct  121  ALMVNQELANPASSERKVMLYGAEIGGTTDIIQSMIAETATPP-LLQIHCESLACLLQMV  179

Query  409  RVLMLPTVVLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRET  230
            RVL LPTV++         +++ ++ EA YE+G +LA+   LC S+ER+     +  R  
Sbjct  180  RVLNLPTVLIASHAPDQSKRSAGQEFEAWYEVGHFLANHMGLCFSKERLQQKGIEKPRSV  239

Query  229  EEPWRALYG  203
            +EPWRALYG
Sbjct  240  QEPWRALYG  248



>ref|XP_006857702.1| hypothetical protein AMTR_s00061p00169900 [Amborella trichopoda]
 gb|ERN19169.1| hypothetical protein AMTR_s00061p00169900 [Amborella trichopoda]
Length=240

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 153/242 (63%), Gaps = 4/242 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M+VA +VI L++D +GFG AI ++L+PNPNS  +  + SF+LSLE+YGI D KASG ++ 
Sbjct  1    MRVASKVIFLYRDANGFGTAIANSLKPNPNSGSKRIKSSFDLSLERYGIHDTKASGNIID  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G  +V++LL++NYEPPI  CA++EVL  +     +  P +++P+IV ++KL+   
Sbjct  61   FVDAQGATQVTILLMQNYEPPIAGCAVNEVLKSITQESGTNRPLLMLPYIVSSSKLEQKV  120

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            ++   I  +   YG++ GP TD   ++V  L  PP +L I  E LACLLQ VRVL L TV
Sbjct  121  RNLGKISRNFPLYGIKIGPDTDSIASMVDGLPKPPSTLPIHDEILACLLQFVRVLRLETV  180

Query  385  VLIRKTESIHSQTSDKQ-LEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
             L+  T    S T+ KQ  E + E+GE+LAS   L  S+E +  D  +    ++E WRAL
Sbjct  181  FLVAPTSG--SNTAAKQEREVLSELGEFLASRVGLSFSKECVEDDRVEKANASKEDWRAL  238

Query  208  YG  203
            YG
Sbjct  239  YG  240



>ref|NP_566314.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM67099.1| unknown [Arabidopsis thaliana]
 gb|ABF83678.1| At3g07640 [Arabidopsis thaliana]
 dbj|BAF01412.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74579.1| uncharacterized protein AT3G07640 [Arabidopsis thaliana]
Length=241

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 101/242 (42%), Positives = 157/242 (65%), Gaps = 3/242 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVA +++ L+ D  GF A I   L P+P+S L+  EE   L L+KYG++ ++  G +VH
Sbjct  1    MKVAEKIVFLWNDSDGFAATISDTLNPSPSSPLRKLEEQIQLPLDKYGVEGVETGGSIVH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F     +Y+VS+ LL +YEPP+L CA++E+L ++  G SST+PT++ PF V A+KLK ++
Sbjct  61   FVDENEVYQVSIFLLRSYEPPVLVCAMNELLDLITRG-SSTLPTIIAPFFVAASKLKFNN  119

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            +S  A    A  + +Q    T+ ++   S++  PP S+QI +E L+CLL L RV  LPT 
Sbjct  120  RSLEANNRKASLHYVQVATETETSRLFASRIEKPPLSMQIHYEPLSCLLHLARVKRLPTA  179

Query  385  VLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            +LI +++ S+  +  D++L+ I+E GE +AS++ L  SR+RI    +K  +E E PWRAL
Sbjct  180  ILIGQRSNSLTHKALDEELQVIHETGELVASWTGLSFSRDRIKWSASKTSKEEESPWRAL  239

Query  208  YG  203
            YG
Sbjct  240  YG  241



>ref|XP_006447852.1| hypothetical protein CICLE_v10016450mg [Citrus clementina]
 gb|ESR61092.1| hypothetical protein CICLE_v10016450mg [Citrus clementina]
Length=218

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 146/209 (70%), Gaps = 4/209 (2%)
 Frame = -3

Query  820  SREESFNLSLE-KYGIKDLKASGEVVHFQAHTGLYEVSVLLLENYEPPILACALSEVLSV  644
             REESF LSLE +YGIK+ KA G++VHF    G Y+VSVLLL+NYEPP L CA+SEVL+ 
Sbjct  11   GREESFELSLEQRYGIKEQKARGQLVHFIDDKGNYQVSVLLLQNYEPPALVCAISEVLAQ  70

Query  643  LAAGESStiptvvvpfivPATKLKVDSKSSAIMDHALT-YGLQFGPSTDVTQALVSKLRT  467
            L   E+ST+P ++ PF+V ++KLK   KS A  +  ++ YGLQ G  TD+TQA+ ++ + 
Sbjct  71   LNC-ETSTLPLLLAPFVVESSKLKGQEKSLAASESKVSLYGLQIGLETDITQAMAARTQK  129

Query  466  PPPSLQIFHEQLACLLQLVRVLMLPTVVLIRKTESIHS-QTSDKQLEAIYEIGEYLASFS  290
             P SLQI  E LAC LQLVR+L LPT +LI +  + HS +TS  +L+ ++E+G+ LA  +
Sbjct  130  APSSLQIHCEPLACFLQLVRILKLPTFILIGQRTTSHSNKTSGGELQILHEMGDLLAKNT  189

Query  289  SLCLSRERITLDPTKMCRETEEPWRALYG  203
             L   RE+I  +P K  ++ +EPWRALYG
Sbjct  190  GLSFRREKIIWNPAKESKDAQEPWRALYG  218



>ref|XP_009391786.1| PREDICTED: uncharacterized protein LOC103977865 [Musa acuminata 
subsp. malaccensis]
Length=234

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 153/240 (64%), Gaps = 8/240 (3%)
 Frame = -3

Query  916  VAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVHFQ  737
            +AP VIVL +D  GFG  I  AL P PNS+L     SF LSLEKY +KD KASG+++ F 
Sbjct  1    MAPTVIVLVRDADGFGPTIAEALLPIPNSNLTREISSFELSLEKYDVKDSKASGDLIQFL  60

Query  736  AHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDSKS  557
              +G  +VS+ +L+NYEPP+ AC  +E+L+       S   T+V+PF++ A K+  +  S
Sbjct  61   DPSGSPQVSIFILQNYEPPLAACVTNELLASF-----SNETTIVLPFVMKALKINREEMS  115

Query  556  SAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVVL  380
               +D  +T Y  + G  +++T+A++S   + PPSLQI  E LACLL + R+L LPTV++
Sbjct  116  GHSVDQEVTLYAAKIGGISELTKAMISGAISAPPSLQIHCELLACLLLMARILSLPTVLI  175

Query  379  IRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLD-PTKMCRETEEPWRALYG  203
                +  + ++S+ +LEA+YE+G+ +AS   LC S+++I    PTK     +EPWRALYG
Sbjct  176  AAGGQRSNRKSSNPELEALYELGQLVASNLGLCFSKDKIQQKHPTK-STSVQEPWRALYG  234



>ref|XP_010551973.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104822442 
[Tarenaya hassleriana]
Length=245

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/245 (40%), Positives = 150/245 (61%), Gaps = 5/245 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M VA +++ L+ D  G  AAI  AL PNPNS L+  E  F L L+KYGI+ ++ASG+++H
Sbjct  1    MNVAGKIVFLWDDPDGVAAAIAGALNPNPNSSLRKLEVPFELPLDKYGIEGVRASGKIIH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G+++V   LL++ E P + CA++E+L  +  G S+     V  F+V A+KLK   
Sbjct  61   FVDGNGVFQVPAWLLQSREAPTIVCAMNELLDQITGGVSTASXRWVATFLVAASKLKFQI  120

Query  562  KSSAIMD-HALTYGLQFGPSTDVTQALVSKL-RTPPPSLQIFHEQLACLLQLVRVLMLPT  389
            +S A  + H+  Y +Q GP T  +    +++ R PPP LQI +  L+C LQL   L LPT
Sbjct  121  ESLASSNKHSGLYHVQIGPKTGASVLYAARIPRKPPPLLQIHYGPLSCFLQLTNALGLPT  180

Query  388  VVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFS-SLCLS-RERITLDPTKMCRETEEPW  218
             VLI +++  I S+  +++L+ ++E G+ +AS +   C+S R  I  + +K  +E E+PW
Sbjct  181  SVLIGQRSIGISSKALEEELQVLHETGDAVASSTVQGCVSLRNEIKWNTSKTWKEEEKPW  240

Query  217  RALYG  203
            RALYG
Sbjct  241  RALYG  245



>ref|XP_007138509.1| hypothetical protein PHAVU_009G215100g [Phaseolus vulgaris]
 gb|ESW10503.1| hypothetical protein PHAVU_009G215100g [Phaseolus vulgaris]
Length=214

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 143/241 (59%), Gaps = 28/241 (12%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP V+ LF+D  GF AAI  AL PN +S    RE++F+ SLE YGIK LKASG V H
Sbjct  1    MKVAPVVVFLFRDSEGFAAAILQALHPNTSSSFTRREDTFDHSLEPYGIKHLKASGSVSH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G Y VS++ +E+Y+PP+LACAL+EVL+ + A +SS +PT++VPF+V ++K+K   
Sbjct  61   FVDEHGAYMVSIVAMEHYKPPVLACALNEVLNKITADKSS-LPTLLVPFLVESSKVKGKI  119

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            K   +     L +G+  G +TD+ QAL++K +  P S  I HE  A  L  VR+      
Sbjct  120  KHLGSDESKPLIFGIPIGQNTDIMQALLNKTQELPSSSWIQHEIFASFLHFVRI------  173

Query  385  VLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
                                I+ IGE LAS + L  S +R+  +P K   +++EPW+ALY
Sbjct  174  --------------------IHAIGEILASTTGLQFSEDRVVWNPKKKSVQSKEPWQALY  213

Query  205  G  203
            G
Sbjct  214  G  214



>gb|ACU17201.1| unknown [Glycine max]
Length=241

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 142/238 (60%), Gaps = 3/238 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP V+ LF+D  GF +AI  AL  NP+S    +E+ F LSLE YGIK LK SG V H
Sbjct  1    MKVAPIVVFLFRDTEGFASAISQALHANPSSSFTRQEDFFELSLEAYGIKHLKTSGSVSH  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G Y+V+++ +E+YEPP+LACAL+EVL+ +   +SS IPT++VPF+V ++K+   S
Sbjct  61   FVDDHGAYKVTIVAMEHYEPPVLACALNEVLNKITEDKSSLIPTLLVPFLVESSKVNGHS  120

Query  562  KS-SAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            KS  +     L +G + G +TD+ QAL++K + PP SL + HE  AC L  V V+ LPT 
Sbjct  121  KSLRSDESKPLIFGTKIGQNTDIMQALLNKTQEPPSSLGVQHETFACFLHFVHVMQLPTF  180

Query  385  VLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRA  212
             LI +        S KQ E ++ I  +  +   +C S ++I     +        WRA
Sbjct  181  FLIGQASQYLDNKSTKQHEILHAIVRFWLAL-HVC-SFQKIEWSGIRKASGKARAWRA  236



>ref|XP_006648791.1| PREDICTED: uncharacterized protein LOC102716101 [Oryza brachyantha]
Length=236

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/240 (37%), Positives = 142/240 (59%), Gaps = 6/240 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M+VAP+V+V+ +D  G+GAA+  ALRP P   L     +  L L KYG+   KASGE+V+
Sbjct  1    MRVAPKVLVIVRDAAGYGAALADALRPTPG--LTRESATLELPLAKYGLDGEKASGELVN  58

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F   +G  +VS  +L +Y+PP+ ACA++E+L+++++   ST P ++VP I  ++     +
Sbjct  59   FSDSSGTPQVSFFILPDYKPPVAACAMNEILALISSETPSTQPVLIVPSITRSSNYYHGA  118

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
            K+  +   A  +  + G +T+ T+ LV     PP SLQI  E + CLL++VRVL +PTV+
Sbjct  119  KTGQL---ATLHCTEIGATTEFTEMLVDGTTKPPQSLQIRSEPILCLLEMVRVLNIPTVL  175

Query  382  LIRKTESIHSQTS-DKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            +    E    ++S D  LE +  +G++LA   +L  S+E +     +     +EPWR LY
Sbjct  176  VGASGEQHQGKSSTDSDLEVLQCVGDHLARHINLEFSKETVLEKGIEKSPVFQEPWRELY  235



>gb|KDO51010.1| hypothetical protein CISIN_1g030004mg [Citrus sinensis]
Length=184

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 121/174 (70%), Gaps = 3/174 (2%)
 Frame = -3

Query  718  EVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDSKSSAIMDH  539
            +VSVLLL+NYEPP L CA+SEVL+ L   E+ST+P ++ PF+V ++KLK   KS A  + 
Sbjct  12   QVSVLLLQNYEPPALVCAISEVLAQLNC-ETSTLPLLLAPFVVESSKLKGQEKSLAASES  70

Query  538  ALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVVLIRKTES  362
             ++ YGLQ G  TD+TQA+ ++ +  P SLQI  E LAC LQLVR+L  PT +LI +  +
Sbjct  71   KVSLYGLQIGLETDITQAMAARTQKAPSSLQIHCEPLACFLQLVRILKSPTFILIGQRTT  130

Query  361  IHS-QTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALYG  203
             HS +TS  +L+ ++E+G+ LAS + L   RE+I  +P +  ++ +EPWRALYG
Sbjct  131  SHSNKTSGGELQILHEMGDLLASNTGLSFRREKIIWNPAQESKDAQEPWRALYG  184



>ref|NP_001047253.1| Os02g0582400 [Oryza sativa Japonica Group]
 dbj|BAD29318.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09167.1| Os02g0582400 [Oryza sativa Japonica Group]
 dbj|BAG92248.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57263.1| hypothetical protein OsJ_07285 [Oryza sativa Japonica Group]
Length=236

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 90/240 (38%), Positives = 141/240 (59%), Gaps = 6/240 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M+VAP+V+VL +D  G+GAA+  ALRP P   L        L L KYG+   KASGE+V+
Sbjct  1    MRVAPKVLVLVRDAAGYGAALADALRPTPG--LTRESTPLELPLAKYGLDGEKASGELVN  58

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F   +G  +VS  +L +Y+PP+ ACA++E+L+++++   ST PT++VPF+  +      +
Sbjct  59   FSDSSGDPQVSFFVLPDYKPPVAACAMNEILALVSSEAPSTQPTLIVPFMTRSPNYYHGA  118

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
            K+  +   A  +G + G +T+ TQ LV      P SLQ+  E + CLL++VRVL +PTV+
Sbjct  119  KTGQL---ATLHGAEIGATTEFTQMLVDGTTKLPQSLQVRSEPILCLLEMVRVLNIPTVI  175

Query  382  LIRKTESIHSQTS-DKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            L         ++S D  LE +  +G++LA   +L  S+E +     +     +EPWR LY
Sbjct  176  LFASGGQHQGKSSTDVDLEVLQCVGDHLAKHINLEFSKETVLQRGIEKSPVFQEPWRELY  235



>gb|ACG38142.1| hypothetical protein [Zea mays]
Length=238

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 141/242 (58%), Gaps = 6/242 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREES-FNLSLEKYGIKDLKASGEVV  746
            M+VAPRV+ L +D  G+GAA+  ALRP P     +RE S F L L KYG+   KA  E++
Sbjct  1    MRVAPRVLFLVRDAAGYGAALADALRPPPG---LTRESSPFELPLGKYGLDGEKACAELL  57

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVD  566
             F   +G  +V++ +L +Y+PP+ AC ++EVL ++++  +ST  T++VP+I  ++     
Sbjct  58   SFSDSSGSPQVTIFVLPDYKPPLAACVVNEVLELISSEATSTERTLIVPYITRSSSYHHG  117

Query  565  SKSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            ++ +      L +G + G +TD T  LV     PP SLQI  E + CLL++VRVL +PTV
Sbjct  118  TEHATKASTVL-HGAEIGATTDYTHLLVGGTTKPPTSLQIRSEPILCLLEMVRVLKMPTV  176

Query  385  VLIRKTESIHSQTSD-KQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            +L+        ++S    LE +  +GE+LA  ++L  S+  +     +     +EPWR L
Sbjct  177  LLVTSGGQQQGKSSTVSDLEVLQSLGEHLAKHTALEFSKGTVLKRGIEKSPIDQEPWREL  236

Query  208  YG  203
            YG
Sbjct  237  YG  238



>ref|XP_004952916.1| PREDICTED: uncharacterized protein LOC101784075 [Setaria italica]
Length=238

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/246 (37%), Positives = 145/246 (59%), Gaps = 14/246 (6%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREES-FNLSLEKYGIKDLKASGEVV  746
            M+VAP+V+VL +D  G+GAAI  ALRP P     +RE S   L L KYG+   KAS E++
Sbjct  1    MRVAPKVLVLVRDTAGYGAAIADALRPPPG---LTRESSPLELPLGKYGLDGEKASVELL  57

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATK----  578
             F   +G  +V++ ++ +Y+PP+ ACA++EVL ++++  +ST   ++VPFI  ++     
Sbjct  58   SFSDSSGSPQVTIFVVPDYKPPLAACAMNEVLELISSEATSTEQVLIVPFITRSSSYHHG  117

Query  577  LKVDSKSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLM  398
            ++  +K+S ++     +G + G +TD T   V     PP SLQI  E + CLL++VRVL 
Sbjct  118  MENATKASPVL-----HGAEIGATTDFTHLFVDGTTKPPTSLQIRTEPILCLLEMVRVLK  172

Query  397  LPTVVLIRKTESIHSQTSD-KQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEP  221
            +PTV+ +        ++S    LE +  +GE+LA  ++L  S+E I     +     +EP
Sbjct  173  MPTVLFVASGGQQQGKSSTVSDLEILQCVGEHLARHTNLEFSKESILERGIEKSPIIQEP  232

Query  220  WRALYG  203
            WR LYG
Sbjct  233  WRELYG  238



>ref|NP_001140846.1| uncharacterized protein LOC100272922 [Zea mays]
 gb|ACF84793.1| unknown [Zea mays]
 gb|AFW72052.1| hypothetical protein ZEAMMB73_875657 [Zea mays]
Length=238

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 141/242 (58%), Gaps = 6/242 (2%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREES-FNLSLEKYGIKDLKASGEVV  746
            M+VAPRV+ L +D  G+GAA+  ALRP P     +RE S F L L KYG+   KA  E++
Sbjct  1    MRVAPRVLFLVRDAAGYGAALADALRPPPG---LTRESSPFELPLGKYGLDGEKACAELL  57

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVD  566
             F   +G  +V++ +L +Y+PP+ AC ++ VL ++++  +ST  T++VP+I  ++     
Sbjct  58   SFSDSSGSPQVTIFVLPDYKPPLAACVVNGVLELISSEATSTERTLIVPYITRSSSYHHG  117

Query  565  SKSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTV  386
            ++ +      L +G + G +TD T  LV     PP SLQI  E + CLL++VRVL +PTV
Sbjct  118  TEHATKASTVL-HGAEIGATTDYTHLLVGGTTKPPTSLQIRSEPILCLLEMVRVLKVPTV  176

Query  385  VLIRKTESIHSQTSD-KQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRAL  209
            +L+        ++S    LE +  +GE+LA  ++L  S+  +     +  R  +EPWR L
Sbjct  177  LLVTSGGQQQGKSSTVSDLEVLQCLGEHLAKHTALEFSKGTVLKRGIEKSRIDQEPWREL  236

Query  208  YG  203
            YG
Sbjct  237  YG  238



>ref|XP_002454074.1| hypothetical protein SORBIDRAFT_04g024210 [Sorghum bicolor]
 gb|EES07050.1| hypothetical protein SORBIDRAFT_04g024210 [Sorghum bicolor]
Length=238

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/245 (36%), Positives = 142/245 (58%), Gaps = 12/245 (5%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M+VAP+V+ L +D  G+GAA+  +LRP   + L      F L+L+KYG+   KASGE++ 
Sbjct  1    MRVAPKVLFLVRDAAGYGAALADSLRPR--TGLTRESSPFELALDKYGLHGEKASGELLS  58

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATK----L  575
            F    G  +VS+ +L +Y+PP+ AC ++EVL ++++  +ST   ++VPFI  ++     +
Sbjct  59   FSDSNGSPQVSIFVLPDYKPPLAACVVNEVLELISSEATSTERILIVPFITRSSSYHRGM  118

Query  574  KVDSKSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLML  395
            +  +K+S ++     +G + G +TD T   V     PP  LQI  E + CLL++VRVL +
Sbjct  119  EHATKASPVL-----HGAEIGATTDYTHLFVGGTTKPPTFLQIRSEPILCLLEMVRVLRM  173

Query  394  PTVVLIRKTESIHSQTSD-KQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPW  218
            PTV+L+        ++S    LE +  +GE+LA   +L  S+E +     +     +EPW
Sbjct  174  PTVLLVTSGGQQQGKSSTVSDLEVLQCLGEHLAKHMALEFSKETVLKRGIEKSPIDQEPW  233

Query  217  RALYG  203
            R LYG
Sbjct  234  RELYG  238



>ref|XP_003575243.1| PREDICTED: uncharacterized protein LOC100845108 [Brachypodium 
distachyon]
Length=239

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 134/240 (56%), Gaps = 3/240 (1%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M+VA RV+VL +D  G+GAA+  AL P P   L        L L+KYG+K  KASGE+V 
Sbjct  1    MRVASRVVVLVRDASGYGAALADALLPPPG--LTRDSSPLELPLDKYGLKGEKASGELVS  58

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F       +VS  +L +Y+PP+ ACA++E+L+++++  S   P ++VPFI  ++      
Sbjct  59   FSDSNCSPQVSFFVLPDYKPPVAACAMNEILALISSEASPVQPIIIVPFITRSSSSYGMV  118

Query  562  KSSAIMDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVV  383
            +++     +  YG + G + + T  LV     PPPSLQI  E + CLL++V VL +P V+
Sbjct  119  RTTKTGQLSTLYGSEIGATNEFTHMLVDGTTKPPPSLQIRSEPILCLLEMVCVLKIPIVL  178

Query  382  LIRKTESIHSQ-TSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            L+        + +SD  LE +  +G++L    +L  S++ +     +     EEPWR LY
Sbjct  179  LVASGGQHQGKSSSDTDLEVLQCLGDHLGRHINLEFSKQAVLERGVEKLPTVEEPWRELY  238



>dbj|BAJ95320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 131/237 (55%), Gaps = 13/237 (5%)
 Frame = -3

Query  907  RVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVHFQAHT  728
            RV+VL +D  G+GAA+  ALRP+P   L      F L L+KYG+   KASGE+V F   +
Sbjct  1    RVVVLARDAAGYGAALADALRPSPG--LTRGSSPFELPLDKYGLNGEKASGELVSFSDSS  58

Query  727  GLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDSKSSAI  548
            G  +VS  +L +Y PP+ ACA++E+L+++++   S  P ++VPF        +   SSA 
Sbjct  59   GSPQVSFFVLPDYRPPVAACAMNEILALISSEAPSIQPVLIVPF--------ITRPSSAT  110

Query  547  MDHALT--YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVVLIR  374
                LT  +  + G S + T   V      PPSLQI  E + CLL++VRVL +PTV+L+ 
Sbjct  111  KTGQLTTLHAAEIGASNEFTHLFVDGTTKTPPSLQIRSEPIQCLLEMVRVLKIPTVLLVT  170

Query  373  KTESIHSQTSD-KQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
                   ++S    LE +  +G+++A   +L  S+E +     +     +EPWR LY
Sbjct  171  SGGQHQGKSSSGSDLEVLQCVGDHVAKHINLEFSKEIVIETGVEKSASIQEPWRELY  227



>gb|EMS68197.1| hypothetical protein TRIUR3_33755 [Triticum urartu]
Length=274

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 139/276 (50%), Gaps = 40/276 (14%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M+VA RV+VL +D  G+GAA+  ALRP+P   L      F+L L+KYG+   KASGE+V 
Sbjct  1    MRVASRVVVLVRDSAGYGAALADALRPSPG--LTRGSSPFDLPLDKYGLNGEKASGELVS  58

Query  742  FQAHTG------------LYE-----------------------VSVLLLENYEPPILAC  668
            F   +G            LY                        VS  +L +Y PP+ AC
Sbjct  59   FSDSSGSPQPFPTFLQDSLYRCARAPLLFMDVMLKISLYHLTITVSFFVLPDYRPPVAAC  118

Query  667  ALSEVLSVLAAGESStiptvvvpfivPATKLKVDSKSSAIMDHALT--YGLQFGPSTDVT  494
            A++E+L+++++   S  P ++VPFI   +        +A     LT  +  + G S + T
Sbjct  119  AMNEILALISSEAPSIQPVLIVPFITRPSGC-FHGMVNATKTGQLTTLHAAEIGASNEFT  177

Query  493  QALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVVLIRKTESIHSQTSDKQLEAIYEI  314
              LV     PPPSLQI  E + CLL++VRVL +PTV++    +     +SD  LE +  +
Sbjct  178  HLLVDGSIKPPPSLQIRSEPIQCLLEIVRVLKIPTVLVTPGGQHQGKSSSDSDLEVLQRV  237

Query  313  GEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            G+++A   +L  S+E +     +     +EPWR LY
Sbjct  238  GDHVAKHINLEFSKETVIETGVEKSASIQEPWRELY  273



>ref|XP_007049424.1| Period circadian protein, putative isoform 1 [Theobroma cacao]
 gb|EOX93581.1| Period circadian protein, putative isoform 1 [Theobroma cacao]
Length=270

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 146/256 (57%), Gaps = 9/256 (4%)
 Frame = -3

Query  949  ESSEAESLKMKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKD  770
            +S   E  +MKVA  V  ++ D  GF  AI   L P P        E  +L L +Y  K 
Sbjct  17   QSQSRELWRMKVASNVFFIYDDEDGFANAIAQGLCPTP-YPYNKVFELLHLGLREYDHKY  75

Query  769  LKASGEVVHFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGE--SStiptvvvpf  596
            L  +G V   +      + ++++L + EPPIL+ A++ VL+ +A  +  SST+P++V PF
Sbjct  76   LNLTGSVAQLRDEDNA-KATMVMLHHLEPPILSHAINAVLAKIADAKRISSTVPSIVAPF  134

Query  595  ivPATKLKVDSKSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLL  419
            +VPA+KLK++  +     + L  YG+Q GP TD ++ + +K + PP SLQI +E LAC L
Sbjct  135  LVPASKLKLEGGNLTTNSNKLPLYGIQVGPETDASRVIAAKTQKPPLSLQIHYEPLACFL  194

Query  418  QLVRVLMLPTVVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLD--PT  248
            Q+VR   LPT +++ ++++S  ++   +  E +YEIGE +AS +     RE++  +  PT
Sbjct  195  QIVRAANLPTSIIVGQRSQSPFNEALIEDQETLYEIGELMASTTGTYFRREQMKTNWIPT  254

Query  247  -KMCRETEEPWRALYG  203
             K      EPWRA YG
Sbjct  255  AKSGSGGREPWRAFYG  270



>gb|EMT19523.1| hypothetical protein F775_28661 [Aegilops tauschii]
Length=275

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/277 (34%), Positives = 140/277 (51%), Gaps = 41/277 (15%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M+V  RV+VL +D  G+GAA+  ALRP+P   L      F+L L+KYG+   KASGE+V 
Sbjct  1    MRVGSRVVVLVRDSAGYGAALADALRPSPG--LTRGSSPFDLPLDKYGLNGEKASGELVS  58

Query  742  FQAHTG------------LYE-----------------------VSVLLLENYEPPILAC  668
            F   +G            LY                        VS  +L +Y PP+ AC
Sbjct  59   FSDSSGSPQPFPAFLQDSLYRCARAPLLFMDVMLKISLYHLTITVSFFVLPDYRPPVAAC  118

Query  667  ALSEVLSVLAAGESStiptvvvpfivPATKLKVDSKSSAIMDHALT--YGLQFGPSTDVT  494
            A++E+L+++++   S  P ++VPFI   +        +A     LT  +  + G S + T
Sbjct  119  AMNEILALISSEAPSIQPILIVPFITRPSGC-FHGMVNATKTGQLTTLHAAEIGASNEFT  177

Query  493  QALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVVLIRKTESIHSQ-TSDKQLEAIYE  317
              LV  +  PPPSLQI  E + CLL++VRVL +PTV+L+        + +SD  LE +  
Sbjct  178  HLLVDGIIKPPPSLQIRGEPIQCLLEMVRVLKIPTVLLVTSGGQHQGKSSSDSDLEVLQC  237

Query  316  IGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
            +G++LA   +L  S+E +     +     +EPWR LY
Sbjct  238  VGDHLAKHINLEFSKETVIETGVEKSASIQEPWRELY  274



>gb|KHG19441.1| elongation factor tu, mitochondrial [Gossypium arboreum]
Length=267

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 142/250 (57%), Gaps = 16/250 (6%)
 Frame = -3

Query  925  KMKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVV  746
            ++KV+  V  ++ D  GFG AI  AL P P+   ++ E      L    + D K +  + 
Sbjct  25   RLKVSSNVFFVYHDQDGFGNAIARALNPTPHPCSKAFE------LVDLELGDAKLNASIT  78

Query  745  HFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGE--SStiptvvvpfivPATKLK  572
             F     L + ++++L++ EPP+L+ A++ VL+ +A  E   ST+PT++ PF+VPA+KL+
Sbjct  79   QFMDGENL-KATMVMLDHLEPPLLSQAINSVLTKIADAEHIPSTVPTIIAPFLVPASKLR  137

Query  571  VDSKSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLML  395
            ++ +        L  Y +Q GP TDV++A+ +K + PPPSLQI +E LAC L LVR   L
Sbjct  138  LEGRLFTTNSGKLPLYSIQVGPETDVSRAIAAKTQKPPPSLQIHYEPLACFLHLVRAANL  197

Query  394  PTVVLI-RKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETE---  227
            PT +++ ++++S  +Q   + L+ +YEIG+  AS +     RE+ + +     +      
Sbjct  198  PTSIIVGQRSQSPFNQALSEDLQTLYEIGQLAASTTGTYFQREQTSTNWIPTAKPASGGG  257

Query  226  --EPWRALYG  203
              EPW A YG
Sbjct  258  VGEPWLAFYG  267



>gb|ABK24038.1| unknown [Picea sitchensis]
Length=252

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/255 (31%), Positives = 127/255 (50%), Gaps = 18/255 (7%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M++  +VIV  KD HG G  + HALR +P++  +  E   +L L+ YG+ D+  SG++V+
Sbjct  1    MELGSKVIVSCKDRHGAGLRLAHALRQSPSTSWKRTELPLDLPLDSYGLVDVALSGQIVN  60

Query  742  FQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGESStiptvvvpfivPATKLKVDS  563
            F    G  +VS++LL+NY+ P  AC   EVL  +    S+   +  V F       K   
Sbjct  61   FVDSEGSPQVSLILLQNYKAPTSACVAYEVLKFIKTKASTQSLSFTVIFPSFTVIPKSLQ  120

Query  562  KSSAI----MDHALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLML  395
                +    M+ +L Y  +    +D ++A+   L+  PP+  I  + LA  L  V VL +
Sbjct  121  NLRCLQLEDMEQSL-YAAEINEGSDFSKAITRGLKRLPPTTHISDDLLASFLHFVHVLKV  179

Query  394  PTVVL---IRKTESIHS------QTSDKQLEAIYEIGEYLASFSSLCLSRERITLD--PT  248
            P V+L   I +   + S      Q  D Q+  + ++G+ LAS   L  S+E +     P 
Sbjct  180  PAVLLLAPITQNSRLDSKGTKMQQVEDSQM--LCKLGDLLASHMELIFSKELLENQNTPI  237

Query  247  KMCRETEEPWRALYG  203
            ++ +  E+ WR LYG
Sbjct  238  EIEKNVEDDWRRLYG  252



>gb|AAF13082.1|AC009176_9 hypothetical protein [Arabidopsis thaliana]
Length=155

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 101/156 (65%), Gaps = 3/156 (2%)
 Frame = -3

Query  664  LSEVLSVLAAGESStiptvvvpfivPATKLKVDSKS-SAIMDHALTYGLQFGPSTDVTQA  488
            ++E+L ++  G SST+PT++ PF V A+KLK +++S  A    A  + +Q    T+ ++ 
Sbjct  1    MNELLDLITRG-SSTLPTIIAPFFVAASKLKFNNRSLEANNRKASLHYVQVATETETSRL  59

Query  487  LVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVVLI-RKTESIHSQTSDKQLEAIYEIG  311
              S++  PP S+QI +E L+CLL L RV  LPT +LI +++ S+  +  D++L+ I+E G
Sbjct  60   FASRIEKPPLSMQIHYEPLSCLLHLARVKRLPTAILIGQRSNSLTHKALDEELQVIHETG  119

Query  310  EYLASFSSLCLSRERITLDPTKMCRETEEPWRALYG  203
            E +AS++ L  SR+RI    +K  +E E PWRALYG
Sbjct  120  ELVASWTGLSFSRDRIKWSASKTSKEEESPWRALYG  155



>ref|XP_006586666.1| PREDICTED: uncharacterized protein LOC100781998 isoform X1 [Glycine 
max]
Length=146

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            MKVAP V+ LF+D  GF + I  A RP P+S    +E+SF LSLE YGIK LKASG V H
Sbjct  1    MKVAPIVVFLFRDTEGFASTISQAFRPKPSSSFTRQEDSFELSLEAYGIKHLKASGSVSH  60

Query  742  FQAHTGLYEVSVLLLENYEPPI  677
            F    G Y+V+++ +E+YEPP+
Sbjct  61   FVDDHGAYKVTIVAMEHYEPPL  82


 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -3

Query  397  LPTVVLIRKTESIHSQTSDKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPW  218
            LPT  LI +        S KQ E ++ IGE LAS + L  S +R+  +P K   E++EPW
Sbjct  82   LPTFFLIGQASQYLDNKSTKQQEILHAIGEILASTTDLQFSEDRVVWNPKKASGESKEPW  141

Query  217  RALYG  203
            RALYG
Sbjct  142  RALYG  146



>ref|XP_007049425.1| Period circadian protein, putative isoform 2 [Theobroma cacao]
 gb|EOX93582.1| Period circadian protein, putative isoform 2 [Theobroma cacao]
Length=232

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 112/194 (58%), Gaps = 5/194 (3%)
 Frame = -3

Query  949  ESSEAESLKMKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKD  770
            +S   E  +MKVA  V  ++ D  GF  AI   L P P        E  +L L +Y  K 
Sbjct  17   QSQSRELWRMKVASNVFFIYDDEDGFANAIAQGLCPTPYP-YNKVFELLHLGLREYDHKY  75

Query  769  LKASGEVVHFQAHTGLYEVSVLLLENYEPPILACALSEVLSVLAAGE--SStiptvvvpf  596
            L  +G V   +      + ++++L + EPPIL+ A++ VL+ +A  +  SST+P++V PF
Sbjct  76   LNLTGSVAQLRDEDNA-KATMVMLHHLEPPILSHAINAVLAKIADAKRISSTVPSIVAPF  134

Query  595  ivPATKLKVDSKSSAIMDHALT-YGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLL  419
            +VPA+KLK++  +     + L  YG+Q GP TD ++ + +K + PP SLQI +E LAC L
Sbjct  135  LVPASKLKLEGGNLTTNSNKLPLYGIQVGPETDASRVIAAKTQKPPLSLQIHYEPLACFL  194

Query  418  QLVRVLMLPTVVLI  377
            Q+VR   LPT +++
Sbjct  195  QIVRAANLPTSIIV  208



>gb|EEC73491.1| hypothetical protein OsI_07824 [Oryza sativa Indica Group]
Length=152

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 1/112 (1%)
 Frame = -3

Query  538  ALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVVLIRKTESI  359
            A  +G + G +T+ TQ LV      P SLQ+  E + CLL++VRVL +PTV+L   +   
Sbjct  40   ATLHGAEIGATTEFTQMLVDGTTKLPQSLQVRSEPILCLLEMVRVLNIPTVILFASSGQH  99

Query  358  HSQTS-DKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
              ++S D  LE +  +G++LA   +L  S+E +     +     +EPWR LY
Sbjct  100  QGKSSTDVDLEVLQCVGDHLAKHINLEFSKETVLQRGIEKSPVFQEPWRELY  151



>dbj|BAD73827.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG87056.1| unnamed protein product [Oryza sativa Japonica Group]
Length=152

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 61/112 (54%), Gaps = 1/112 (1%)
 Frame = -3

Query  538  ALTYGLQFGPSTDVTQALVSKLRTPPPSLQIFHEQLACLLQLVRVLMLPTVVLIRKTESI  359
            A  +G + G +T+ TQ LV      P SLQ+  E + CLL++VRVL +PTV+L       
Sbjct  40   ATLHGAEIGATTEFTQMLVDGTTKLPQSLQVRSEPILCLLEMVRVLNIPTVILFASGGQH  99

Query  358  HSQTS-DKQLEAIYEIGEYLASFSSLCLSRERITLDPTKMCRETEEPWRALY  206
              ++S D  LE +  +G++LA   +L  S+E +     +     +EPWR LY
Sbjct  100  QGKSSTDVDLEVLQCVGDHLAKHINLEFSKETVLQRGIEKSPVFQEPWRELY  151



>gb|EAY86443.1| hypothetical protein OsI_07825 [Oryza sativa Indica Group]
Length=151

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = -3

Query  922  MKVAPRVIVLFKDLHGFGAAIFHALRPNPNSDLQSREESFNLSLEKYGIKDLKASGEVVH  743
            M+VAP+V+VL +D  G+GAA+  ALRP P   L        L L KYG+   KASGE+V+
Sbjct  1    MRVAPKVLVLVRDAAGYGAALADALRPTPG--LTRESAPLELPLAKYGLDGEKASGELVN  58

Query  742  FQAHTG  725
            F   +G
Sbjct  59   FSDFSG  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2302838196460