BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83512_g1_i1 len=701 path=[739:0-700]

Length=701
                                                                      Score     E

ref|XP_006360048.1|  PREDICTED: anther-specific protein LAT52-like      166   1e-47   
ref|XP_009604804.1|  PREDICTED: anther-specific protein LAT52           165   3e-47   
ref|XP_004248244.1|  PREDICTED: anther-specific protein LAT52           163   1e-46   
gb|AFB73932.1|  LAT52-like protein                                      162   2e-46   
gb|AFB73931.1|  LAT52-like protein                                      162   3e-46   
ref|XP_009794171.1|  PREDICTED: anther-specific protein LAT52           160   3e-45   
ref|XP_009602640.1|  PREDICTED: anther-specific protein LAT52-like      157   3e-44   
ref|XP_009778120.1|  PREDICTED: anther-specific protein LAT52-like      156   1e-43   
ref|XP_004251892.1|  PREDICTED: anther-specific protein LAT52-like      149   4e-41   
ref|XP_002523378.1|  Anther-specific protein LAT52 precursor, put...    145   1e-39   Ricinus communis
ref|XP_011070069.1|  PREDICTED: anther-specific protein LAT52-like      144   3e-39   
ref|XP_009761932.1|  PREDICTED: anther-specific protein LAT52-like      144   4e-39   
ref|XP_006358942.1|  PREDICTED: anther-specific protein LAT52-like      142   1e-38   
ref|XP_009598969.1|  PREDICTED: anther-specific protein LAT52-like      141   5e-38   
ref|XP_011029563.1|  PREDICTED: olee1-like protein                      140   1e-37   
ref|XP_011098227.1|  PREDICTED: anther-specific protein LAT52-like      139   2e-37   
gb|EYU26327.1|  hypothetical protein MIMGU_mgv1a015422mg                137   1e-36   
ref|XP_002316866.1|  pollen Ole e 1 allergen and extensin family ...    136   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_004244268.1|  PREDICTED: anther-specific protein LAT52-like      137   3e-36   
ref|XP_006348395.1|  PREDICTED: anther-specific protein LAT52-like      135   9e-36   
ref|XP_010277041.1|  PREDICTED: anther-specific protein LAT52           135   1e-35   
gb|KDP32532.1|  hypothetical protein JCGZ_14735                         135   1e-35   
gb|EYU45018.1|  hypothetical protein MIMGU_mgv1a015317mg                134   3e-35   
gb|EPS72638.1|  hypothetical protein M569_02120                         132   1e-34   
ref|XP_007021723.1|  Pollen Ole e 1 allergen and extensin family ...    129   3e-33   
gb|KHG25858.1|  Olee1-like protein                                      126   3e-32   
ref|XP_011006522.1|  PREDICTED: olee1-like protein                      126   3e-32   
gb|KHG10520.1|  Olee1-like protein                                      125   7e-32   
ref|XP_006370166.1|  pollen Ole e 1 allergen and extensin family ...    124   1e-31   
ref|XP_009617824.1|  PREDICTED: olee1-like protein                      124   1e-31   
ref|XP_009352776.1|  PREDICTED: olee1-like protein                      122   1e-30   
ref|XP_009334049.1|  PREDICTED: olee1-like protein                      122   1e-30   
ref|XP_008359333.1|  PREDICTED: olee1-like protein                      122   2e-30   
ref|XP_007212169.1|  hypothetical protein PRUPE_ppa012463mg             122   2e-30   
ref|XP_006857531.1|  hypothetical protein AMTR_s00061p00032820          121   2e-30   
ref|XP_003541705.1|  PREDICTED: olee1-like protein-like                 121   2e-30   
emb|CDP16230.1|  unnamed protein product                                121   2e-30   
ref|XP_009340070.1|  PREDICTED: olee1-like protein                      121   3e-30   
ref|XP_009396935.1|  PREDICTED: pollen-specific protein C13-like        120   5e-30   
ref|XP_008371469.1|  PREDICTED: olee1-like protein                      120   6e-30   
emb|CDP06002.1|  unnamed protein product                                120   6e-30   
ref|XP_009348994.1|  PREDICTED: olee1-like protein                      120   6e-30   
ref|XP_009773994.1|  PREDICTED: olee1-like protein                      120   8e-30   
emb|CDP16229.1|  unnamed protein product                                118   2e-29   
ref|XP_008383629.1|  PREDICTED: olee1-like protein                      119   3e-29   
ref|XP_009342278.1|  PREDICTED: olee1-like protein                      118   3e-29   
ref|XP_004485892.1|  PREDICTED: olee1-like protein-like                 118   3e-29   
ref|XP_004143635.1|  PREDICTED: olee1-like protein-like                 117   6e-29   
ref|XP_007148052.1|  hypothetical protein PHAVU_006G176500g             117   7e-29   
ref|XP_003546028.1|  PREDICTED: olee1-like protein-like                 117   1e-28   
gb|ACJ83911.1|  unknown                                                 116   1e-28   Medicago truncatula
gb|ACU23617.1|  unknown                                                 116   3e-28   Glycine max [soybeans]
ref|XP_008226528.1|  PREDICTED: olee1-like protein                      115   3e-28   
ref|XP_008467237.1|  PREDICTED: olee1-like protein                      115   3e-28   
sp|O49813.1|OLEE1_BETPN  RecName: Full=Olee1-like protein; Flags:...    115   3e-28   Betula pendula [white birch]
gb|AAN76546.1|AF393475_1  LLP-B3 protein                                115   3e-28   Lilium longiflorum [Easter lily]
ref|XP_011085997.1|  PREDICTED: olee1-like protein                      115   4e-28   
ref|XP_010057097.1|  PREDICTED: olee1-like protein                      115   5e-28   
ref|XP_002447728.1|  hypothetical protein SORBIDRAFT_06g014740          115   5e-28   Sorghum bicolor [broomcorn]
gb|ADI55168.1|  AS1                                                     115   5e-28   
ref|XP_007213539.1|  hypothetical protein PRUPE_ppa019680mg             114   8e-28   
gb|EYU43331.1|  hypothetical protein MIMGU_mgv1a014984mg                114   8e-28   
ref|XP_006652233.1|  PREDICTED: pollen-specific protein C13-like        114   8e-28   
ref|XP_007025385.1|  Olee1-like protein                                 114   1e-27   
sp|O82015.2|LIGV1_LIGVU  RecName: Full=Major pollen allergen Lig ...    113   1e-27   Ligustrum vulgare [prim]
gb|AFK47865.1|  unknown                                                 114   1e-27   
gb|ACG33223.1|  pollen-specific protein C13 precursor                   114   1e-27   Zea mays [maize]
ref|XP_008450951.1|  PREDICTED: olee1-like protein                      114   2e-27   
gb|ACF82695.1|  unknown                                                 113   2e-27   Zea mays [maize]
ref|XP_008348540.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          113   2e-27   
ref|XP_002522577.1|  Pollen allergen Che a 1 precursor, putative        113   3e-27   Ricinus communis
gb|ABP58635.1|  major pollen allergen Ole e 1                           112   3e-27   Olea europaea
ref|XP_008363638.1|  PREDICTED: olee1-like protein                      113   3e-27   
emb|CAA54819.1|  major allergen                                         112   3e-27   Ligustrum vulgare [prim]
ref|NP_001105351.1|  pollen-specific protein C13 precursor              113   3e-27   Zea mays [maize]
pir||B53806  major allergen OLE5c - common olive                        112   4e-27
ref|XP_004144129.1|  PREDICTED: olee1-like protein-like                 112   6e-27   
ref|NP_001148343.1|  LOC100281953 precursor                             112   7e-27   Zea mays [maize]
pir||C53806  major allergen OLE1c - common olive (fragment)             111   7e-27
ref|NP_001052674.1|  Os04g0398700                                       112   8e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66537.1|  H0209H04.4                                             112   9e-27   Oryza sativa [red rice]
ref|XP_011079002.1|  PREDICTED: olee1-like protein                      112   1e-26   
ref|XP_009408781.1|  PREDICTED: pollen-specific protein C13-like        111   1e-26   
ref|NP_001146979.1|  LOC100280588 precursor                             112   1e-26   Zea mays [maize]
dbj|BAK06698.1|  predicted protein                                      112   1e-26   
ref|XP_004293940.1|  PREDICTED: olee1-like protein-like                 112   1e-26   
emb|CAA73038.1|  Ole e 1.0102 protein                                   110   1e-26   Olea europaea
gb|ABP58632.1|  major pollen allergen Ole e 1                           110   1e-26   Olea europaea
emb|CAA73036.1|  Ole e 1 protein                                        110   2e-26   Olea europaea
ref|XP_004975466.1|  PREDICTED: pollen-specific protein C13-like        111   2e-26   
sp|P19963.2|ALL1_OLEEU  RecName: Full=Major pollen allergen Ole e...    110   2e-26   Olea europaea
ref|XP_010261236.1|  PREDICTED: pollen-specific protein C13-like        110   2e-26   
gb|ABP58634.1|  major pollen allergen Ole e 1                           110   2e-26   Olea europaea
gb|AEW90946.1|  pollen-specific protein F8-4                            110   2e-26   
gb|AAQ83588.1|  allergen Fra e 1                                        110   2e-26   Fraxinus excelsior
ref|XP_009366359.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          110   3e-26   
ref|XP_002489221.1|  hypothetical protein SORBIDRAFT_0012s014630        110   3e-26   Sorghum bicolor [broomcorn]
ref|XP_002513885.1|  Pollen-specific protein C13 precursor, putative    110   3e-26   Ricinus communis
ref|XP_003573867.1|  PREDICTED: pollen-specific protein C13             110   3e-26   
ref|XP_010103032.1|  hypothetical protein L484_005787                   110   3e-26   
gb|AFK46977.1|  unknown                                                 110   4e-26   
ref|XP_009764546.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          110   4e-26   
gb|ACG32277.1|  pollen-specific protein C13 precursor                   110   4e-26   Zea mays [maize]
ref|XP_004983223.1|  PREDICTED: pollen-specific protein C13-like        110   6e-26   
gb|EAY93952.1|  hypothetical protein OsI_15725                          109   6e-26   Oryza sativa Indica Group [Indian rice]
emb|CAA73037.1|  Ole e 1.0103 protein                                   109   6e-26   Olea europaea
ref|XP_011080816.1|  PREDICTED: major pollen allergen Ole e 1-like      109   7e-26   
pir||S43242  allergen-like protein Syr v I isoform 1 - Syringa vu...    108   8e-26
sp|Q8LGR0.1|CHE1_CHEAL  RecName: Full=Pollen allergen Che a 1; Al...    109   8e-26   Chenopodium album [lamb's-quarters]
dbj|BAJ86956.1|  predicted protein                                      109   8e-26   
gb|ABP58633.1|  major pollen allergen Ole e 1                           108   9e-26   Olea europaea
gb|AEK85661.1|  major pollen allergen Ole e1                            108   1e-25   
gb|ABP58636.1|  major pollen allergen Ole e 1                           108   1e-25   Olea europaea
gb|KHN36879.1|  Olee1-like protein                                      108   1e-25   
ref|XP_008225283.1|  PREDICTED: olee1-like protein                      108   1e-25   
gb|KHG13789.1|  Anther-specific LAT52                                   109   1e-25   
gb|KHG12773.1|  Olee1-like protein                                      109   1e-25   
ref|XP_009759546.1|  PREDICTED: olee1-like protein                      108   2e-25   
ref|XP_009403224.1|  PREDICTED: pollen-specific protein C13-like        108   2e-25   
ref|XP_008234009.1|  PREDICTED: pollen-specific protein C13             108   2e-25   
ref|XP_002307393.1|  pollen Ole e 1 allergen and extensin family ...    108   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008376286.1|  PREDICTED: pollen-specific protein C13-like        108   2e-25   
ref|XP_008378536.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          109   2e-25   
ref|XP_006366520.1|  PREDICTED: olee1-like protein-like                 108   2e-25   
gb|KGN49303.1|  hypothetical protein Csa_6G519560                       108   2e-25   
ref|XP_006472638.1|  PREDICTED: pollen-specific protein C13-like        108   2e-25   
gb|AEK85659.1|  major pollen allergen Ole e1                            107   2e-25   
ref|NP_001235303.1|  uncharacterized protein LOC100306199 precursor     108   2e-25   
gb|KDO80906.1|  hypothetical protein CISIN_1g031458mg                   108   2e-25   
gb|ABC86745.1|  pollen-specific protein                                 107   3e-25   Vitis pseudoreticulata
ref|XP_009402012.1|  PREDICTED: pollen-specific protein C13-like        107   3e-25   
ref|XP_006434027.1|  hypothetical protein CICLE_v10002743mg             107   3e-25   
ref|XP_008782123.1|  PREDICTED: pollen-specific protein C13-like        107   4e-25   
pir||S43244  allergen-like protein Syr v I isoform 3 - Syringa vu...    107   4e-25
ref|XP_004134662.1|  PREDICTED: olee1-like protein-like                 107   5e-25   
gb|AEW90948.1|  pollen-specific protein F8-6                            107   5e-25   
ref|XP_007206364.1|  hypothetical protein PRUPE_ppa017800mg             107   5e-25   
emb|CAA78897.1|  pollen specific gene                                   107   5e-25   Oryza sativa [red rice]
gb|EPS70684.1|  hypothetical protein M569_04073                         107   6e-25   
gb|AAV74343.1|  Fra e 1.0102 major allergen                             106   6e-25   Fraxinus excelsior
pir||S43243  allergen-like protein Syr v I isoform 2 - Syringa vu...    106   6e-25
pir||E53806  major allergen OLE17 - common olive (fragment)             106   6e-25
ref|XP_009760524.1|  PREDICTED: pollen-specific protein C13-like        107   6e-25   
gb|AAX93750.1|  pollen allergen Cro s 1                                 107   8e-25   Crocus sativus [saffron crocus]
gb|AEK85660.1|  major pollen allergen Ole e1                            106   8e-25   
gb|AAM08621.1|AC107314_12  Putative Pollen specific protein C13 p...    107   9e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004134927.1|  PREDICTED: olee1-like protein-like                 106   9e-25   
ref|XP_010911793.1|  PREDICTED: pollen-specific protein C13-like        107   1e-24   
gb|KDP32694.1|  hypothetical protein JCGZ_11986                         106   1e-24   
ref|XP_011075627.1|  PREDICTED: olee1-like protein                      106   1e-24   
ref|XP_011097595.1|  PREDICTED: major pollen allergen Lol p 11-like     106   1e-24   
ref|XP_010269200.1|  PREDICTED: pollen-specific protein C13-like        106   1e-24   
ref|NP_001064462.2|  Os10g0371000                                       107   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011075462.1|  PREDICTED: olee1-like protein                      106   1e-24   
ref|XP_011006159.1|  PREDICTED: pollen-specific protein C13-like        105   1e-24   
ref|XP_004489034.1|  PREDICTED: olee1-like protein-like                 106   1e-24   
gb|EMS52933.1|  hypothetical protein TRIUR3_31283                       106   1e-24   
ref|XP_007153183.1|  hypothetical protein PHAVU_003G013900g             106   1e-24   
gb|ADK22842.1|  Sal k 5                                                 105   1e-24   
gb|AAQ08947.1|  allergen Fra e 1.0101                                   105   2e-24   Fraxinus excelsior
ref|XP_009622218.1|  PREDICTED: pollen-specific protein C13-like        105   2e-24   
pir||G53806  major allergen OLE26 - common olive (fragment)             105   2e-24
ref|XP_010942360.1|  PREDICTED: pollen allergen Phl p 11-like           106   2e-24   
ref|XP_009600627.1|  PREDICTED: major pollen allergen Lol p 11-like     105   2e-24   
ref|XP_004289324.1|  PREDICTED: pollen-specific protein C13-like        105   2e-24   
ref|XP_002268073.1|  PREDICTED: pollen-specific protein C13             105   2e-24   Vitis vinifera
ref|XP_010321468.1|  PREDICTED: LOW QUALITY PROTEIN: major pollen...    105   2e-24   
ref|XP_007225977.1|  hypothetical protein PRUPE_ppa012675mg             105   2e-24   
ref|XP_011016068.1|  PREDICTED: pollen-specific protein C13-like        105   2e-24   
ref|XP_009608960.1|  PREDICTED: olee1-like protein                      105   2e-24   
pir||H53806  major allergen OLE6 - common olive (fragment)              104   3e-24
ref|XP_002273294.1|  PREDICTED: olee1-like protein                      105   3e-24   Vitis vinifera
gb|AAN18042.1|  major pollen allergen Ole e 1                           104   3e-24   Olea europaea
pir||I53806  major allergen OLE16 - common olive (fragment)             104   3e-24
ref|XP_003634471.1|  PREDICTED: pollen-specific protein C13             105   3e-24   
ref|XP_006661725.1|  PREDICTED: pollen-specific protein C13-like        105   4e-24   
pir||F53806  major allergen OLE19 - common olive (fragment)             104   4e-24
ref|XP_008775180.1|  PREDICTED: pollen-specific protein C13-like        105   4e-24   
ref|XP_004237415.1|  PREDICTED: pollen-specific protein C13             104   4e-24   
ref|XP_009421183.1|  PREDICTED: pollen-specific protein C13-like        104   5e-24   
gb|AEK85663.1|  major pollen allergen Ole e1                            103   5e-24   
ref|XP_010538956.1|  PREDICTED: major pollen allergen Lol p 11          104   5e-24   
ref|XP_006355373.1|  PREDICTED: pollen-specific protein C13-like        104   6e-24   
emb|CDX99789.1|  BnaC05g22110D                                          104   7e-24   
ref|XP_002301038.1|  pollen Ole e 1 allergen and extensin family ...    103   8e-24   Populus trichocarpa [western balsam poplar]
gb|ABK92993.1|  unknown                                                 103   9e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006442530.1|  hypothetical protein CICLE_v10024378mg             103   9e-24   
gb|ABK94215.1|  unknown                                                 103   9e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008245042.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          103   9e-24   
ref|XP_009797814.1|  PREDICTED: major pollen allergen Lol p 11-like     103   1e-23   
ref|XP_010540511.1|  PREDICTED: pollen-specific protein-like At4g...    103   2e-23   
ref|XP_009109686.1|  PREDICTED: pollen-specific protein-like At4g...    103   2e-23   
ref|XP_009115274.1|  PREDICTED: pollen-specific protein-like At4g...    103   2e-23   
ref|XP_010686203.1|  PREDICTED: pollen allergen Che a 1                 103   2e-23   
ref|XP_008439742.1|  PREDICTED: olee1-like protein isoform X1           103   2e-23   
ref|XP_008234688.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          102   2e-23   
ref|XP_007153182.1|  hypothetical protein PHAVU_003G013800g             102   3e-23   
gb|AAQ07442.1|  major pollen allergen Ole e 1                           101   4e-23   Olea europaea
ref|XP_006464247.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          102   4e-23   
gb|KHN19737.1|  Pollen-specific protein C13                             102   4e-23   
ref|NP_001238723.1|  uncharacterized protein LOC100499710 precursor     102   4e-23   
pir||A38968  major allergen OLE20 - common olive (fragment)             101   4e-23
ref|XP_010529196.1|  PREDICTED: pollen-specific protein-like At4g...    102   4e-23   
ref|XP_010538209.1|  PREDICTED: pollen-specific protein-like At4g...    102   4e-23   
gb|AAQ10269.1|  major pollen allergen Ole e 1                           101   4e-23   Olea europaea
gb|EPS62385.1|  hypothetical protein M569_12405                         101   5e-23   
gb|AAQ10267.1|  major pollen allergen Ole e 1                           101   5e-23   Olea europaea
ref|XP_008439743.1|  PREDICTED: olee1-like protein isoform X2           102   6e-23   
gb|AAF16869.1|AF109693_1  allergen-like protein BRSn20                  101   6e-23   Sambucus nigra
emb|CDY43319.1|  BnaC03g58910D                                          101   7e-23   
gb|AEK85662.1|  major pollen allergen Ole e1                            100   8e-23   
ref|XP_002392460.1|  hypothetical protein MPER_07958                    101   8e-23   Moniliophthora perniciosa FA553
ref|XP_003581152.1|  PREDICTED: pollen-specific protein C13-like        101   8e-23   
gb|AAQ10277.1|  major pollen allergen Ole e 1                           100   9e-23   Olea europaea
gb|KFK44745.1|  hypothetical protein AALP_AA1G297400                    101   9e-23   
ref|XP_006428158.1|  hypothetical protein CICLE_v10027141mg             103   9e-23   
gb|ABP58637.1|  major pollen allergen Ole e 1                           100   9e-23   Olea europaea
ref|XP_004146873.1|  PREDICTED: pollen allergen Che a 1-like            101   1e-22   
ref|NP_001150330.1|  pollen allergen Phl p 11 precursor                 100   1e-22   Zea mays [maize]
gb|AEK85658.1|  major pollen allergen Ole e1                          99.8    1e-22   
ref|XP_002533139.1|  Pollen-specific protein C13 precursor, putative    100   1e-22   Ricinus communis
ref|NP_001131377.1|  uncharacterized protein LOC100192702 precursor     100   1e-22   Zea mays [maize]
gb|AAB32652.2|  main olive allergen                                   99.8    2e-22   Olea europaea
ref|XP_010060161.1|  PREDICTED: protein DOWNSTREAM OF FLC               100   2e-22   
ref|XP_007149397.1|  hypothetical protein PHAVU_005G066800g             100   2e-22   
ref|NP_174209.1|  pollen Ole e 1 allergen and extensin family pro...    100   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008453801.1|  PREDICTED: major pollen allergen Lol p 11-like     100   2e-22   
ref|XP_010942359.1|  PREDICTED: major pollen allergen Lol p 11-like     100   2e-22   
gb|AAQ08188.1|  major pollen allergen Ole e 1                         99.4    2e-22   Olea europaea
ref|XP_003566418.1|  PREDICTED: major pollen allergen Lol p 11-like     100   2e-22   
gb|AFK42345.1|  unknown                                               99.8    3e-22   
ref|XP_009386950.1|  PREDICTED: pollen-specific protein C13-like        100   3e-22   
ref|XP_007149396.1|  hypothetical protein PHAVU_005G066700g           99.8    3e-22   
ref|XP_011090511.1|  PREDICTED: major pollen allergen Lol p 11-like   99.8    3e-22   
sp|Q7M1X5.1|LOLB_LOLPR  RecName: Full=Major pollen allergen Lol p...  99.0    4e-22   Lolium perenne [perennial ryegrass]
ref|XP_008797140.1|  PREDICTED: major pollen allergen Lol p 11-like     100   4e-22   
ref|XP_010460686.1|  PREDICTED: pollen-specific protein-like At4g...  99.8    4e-22   
gb|AAQ10272.1|  major pollen allergen Ole e 1                         98.6    4e-22   Olea europaea
gb|AAO22132.1|  major pollen allergen Ole e 1                         98.6    4e-22   Olea europaea
ref|XP_009409254.1|  PREDICTED: major pollen allergen Lol p 11-like   99.8    4e-22   
ref|XP_010499433.1|  PREDICTED: pollen-specific protein-like At4g...  99.8    5e-22   
gb|AFW77548.1|  pollen allergen Phl p 11                              99.4    5e-22   
ref|XP_010478273.1|  PREDICTED: pollen-specific protein-like At4g...  99.4    6e-22   
emb|CDY69202.1|  BnaCnng62360D                                        99.4    6e-22   
gb|EYU31033.1|  hypothetical protein MIMGU_mgv1a015328mg              99.0    6e-22   
ref|XP_009102877.1|  PREDICTED: pollen-specific protein-like At4g...  99.4    6e-22   
ref|NP_001237189.1|  uncharacterized protein LOC100305566 precursor   99.0    6e-22   
gb|AAQ10274.1|  major pollen allergen Ole e 1                         97.8    8e-22   Olea europaea
ref|XP_006289520.1|  hypothetical protein CARUB_v10003061mg           98.6    9e-22   
emb|CDP01424.1|  unnamed protein product                              98.2    1e-21   
ref|XP_010916905.1|  PREDICTED: pollen-specific protein C13-like      98.2    2e-21   
gb|KCW69946.1|  hypothetical protein EUGRSUZ_F03264                   97.8    2e-21   
ref|XP_006304746.1|  hypothetical protein CARUB_v10012122mg           97.8    2e-21   
ref|XP_010676978.1|  PREDICTED: major pollen allergen Lol p 11-like   97.8    2e-21   
ref|XP_011030966.1|  PREDICTED: protein DOWNSTREAM OF FLC             97.4    2e-21   
ref|XP_010481521.1|  PREDICTED: pollen-specific protein-like At4g...  97.8    3e-21   
ref|XP_006415610.1|  hypothetical protein EUTSA_v10008921mg           97.4    3e-21   
gb|EPS69662.1|  hypothetical protein M569_05103                       97.1    3e-21   
ref|XP_010062811.1|  PREDICTED: olee1-like protein                    97.8    3e-21   
ref|XP_010441660.1|  PREDICTED: pollen-specific protein-like At4g...  97.4    4e-21   
ref|XP_004960638.1|  PREDICTED: pollen allergen Phl p 11-like         97.1    4e-21   
ref|XP_004233077.1|  PREDICTED: major pollen allergen Lig v 1-like    97.1    5e-21   
ref|XP_010434511.1|  PREDICTED: pollen-specific protein-like At4g...  96.7    6e-21   
ref|XP_010496255.1|  PREDICTED: pollen-specific protein-like At4g...  96.7    6e-21   
ref|XP_006664913.1|  PREDICTED: pollen allergen Phl p 11-like         96.7    7e-21   
ref|XP_010941451.1|  PREDICTED: pollen-specific protein C13-like      96.3    7e-21   
ref|XP_008803750.1|  PREDICTED: pollen-specific protein C13           96.7    7e-21   
ref|XP_010439832.1|  PREDICTED: pollen-specific protein-like At4g...  96.3    7e-21   
ref|XP_006284941.1|  hypothetical protein CARUB_v10006240mg           96.3    7e-21   
ref|XP_011101449.1|  PREDICTED: olee1-like protein                    96.3    8e-21   
ref|XP_009134109.1|  PREDICTED: pollen-specific protein C13           95.9    8e-21   
emb|CDY12288.1|  BnaA09g24880D                                        95.9    9e-21   
ref|XP_008445353.1|  PREDICTED: protein DOWNSTREAM OF FLC             95.9    9e-21   
ref|XP_007141147.1|  hypothetical protein PHAVU_008G171500g           95.9    9e-21   
ref|XP_010436385.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        95.5    1e-20   
ref|NP_567338.1|  protein SAH7                                        95.5    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518802.1|  PREDICTED: pollen-specific protein-like At4g...  95.9    1e-20   
gb|AAT08700.1|  pollen-specific protein                               95.9    1e-20   Hyacinthus orientalis [common hyacinth]
ref|XP_004150698.1|  PREDICTED: pollen-specific protein C13-like      95.5    1e-20   
gb|AFK37732.1|  unknown                                               95.5    1e-20   
ref|XP_010549400.1|  PREDICTED: pollen-specific protein-like At4g...  95.5    1e-20   
gb|AAQ10273.1|  major pollen allergen Ole e 1                         94.4    2e-20   
ref|XP_010455288.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        95.1    2e-20   
emb|CDY05022.1|  BnaC03g28200D                                        95.1    2e-20   
ref|XP_006344595.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        95.1    2e-20   
ref|XP_010494740.1|  PREDICTED: pollen-specific protein-like At4g...  95.5    2e-20   
emb|CDX99452.1|  BnaC01g11000D                                        95.1    2e-20   
ref|XP_002307104.1|  hypothetical protein POPTR_0005s08000g           94.7    2e-20   
ref|XP_007136225.1|  hypothetical protein PHAVU_009G028900g           94.7    2e-20   
ref|NP_567562.1|  pollen Ole e 1 allergen and extensin family pro...  95.1    2e-20   
ref|XP_004502439.1|  PREDICTED: pollen-specific protein C13-like      94.7    2e-20   
ref|XP_002870034.1|  pollen ole e 1 allergen and extensin family ...  95.1    2e-20   
dbj|BAB09316.1|  Ole e I (main olive allergen)-like protein           94.7    3e-20   
emb|CDY01556.1|  BnaC07g35460D                                        94.7    3e-20   
ref|XP_009132011.1|  PREDICTED: pollen-specific protein-like At4g...  94.7    3e-20   
gb|AAQ10280.1|  major pollen allergen Ole e 1                         93.6    3e-20   
ref|XP_007018845.1|  Pollen-specific protein C13, putative            94.4    3e-20   
ref|NP_568650.1|  pollen_Ole_e_I-domain containing protein            94.7    3e-20   
gb|AAM65838.1|  Ole e I (main olive allergen)-like protein            94.4    4e-20   
ref|XP_006414083.1|  hypothetical protein EUTSA_v10026398mg           94.4    4e-20   
gb|KHG30321.1|  Anther-specific LAT52                                 94.0    5e-20   
ref|NP_001148443.1|  pollen allergen Phl p 11 precursor               94.4    5e-20   
ref|XP_009136942.1|  PREDICTED: pollen-specific protein-like At4g...  94.0    5e-20   
dbj|BAK07321.1|  predicted protein                                    93.6    6e-20   
gb|AAQ10281.1|  major pollen allergen Ole e 1                         92.8    7e-20   
gb|KFK31513.1|  hypothetical protein AALP_AA6G122400                  93.6    7e-20   
gb|KFK28529.1|  hypothetical protein AALP_AA7G008600                  93.6    8e-20   
ref|XP_002863445.1|  hypothetical protein ARALYDRAFT_494394           93.6    8e-20   
gb|AEW90943.1|  group 11 grass pollen allergen F8-6                   93.2    8e-20   
ref|XP_008343344.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  92.0    1e-19   
gb|KDP46869.1|  hypothetical protein JCGZ_24078                       92.8    1e-19   
ref|XP_011078225.1|  PREDICTED: pollen allergen Che a 1-like          93.2    1e-19   
sp|Q8H6L7.1|PHLB_PHLPR  RecName: Full=Pollen allergen Phl p 11; A...  92.4    1e-19   
ref|XP_006281481.1|  hypothetical protein CARUB_v10027565mg           92.8    1e-19   
ref|XP_003638771.1|  Pollen allergen Phl p                            92.8    1e-19   
ref|XP_006601773.1|  PREDICTED: uncharacterized protein LOC100527...  92.4    1e-19   
ref|XP_009108374.1|  PREDICTED: pollen-specific protein-like At4g...  92.8    1e-19   
gb|AEW90941.1|  group 11 grass pollen allergen F7-4                   92.4    2e-19   
ref|XP_004500607.1|  PREDICTED: pollen-specific protein C13-like      92.4    2e-19   
emb|CDX77620.1|  BnaC07g18740D                                        92.4    2e-19   
ref|XP_002890794.1|  hypothetical protein ARALYDRAFT_336019           97.1    2e-19   
ref|XP_002310579.1|  hypothetical protein POPTR_0007s05750g           92.0    2e-19   
gb|AAQ10279.1|  major pollen allergen Ole e 1                         91.3    2e-19   
ref|XP_010527375.1|  PREDICTED: major pollen allergen Lol p 11-like   92.0    2e-19   
gb|AFK47744.1|  unknown                                               92.0    2e-19   
ref|XP_006398273.1|  hypothetical protein EUTSA_v10001051mg           92.0    2e-19   
ref|XP_002454899.1|  hypothetical protein SORBIDRAFT_03g001020        92.0    3e-19   
ref|XP_006397273.1|  hypothetical protein EUTSA_v10029031mg           91.7    3e-19   
emb|CDX87759.1|  BnaC02g31900D                                        92.0    3e-19   
ref|XP_009128814.1|  PREDICTED: pollen-specific protein-like At4g...  92.0    3e-19   
ref|XP_011101379.1|  PREDICTED: olee1-like protein                    92.0    3e-19   
gb|AEW90942.1|  group 11 grass pollen allergen F7-6                   91.7    3e-19   
emb|CDY52214.1|  BnaAnng11370D                                        91.7    4e-19   
gb|EAZ45758.1|  hypothetical protein OsJ_30442                        91.3    4e-19   
ref|XP_009101556.1|  PREDICTED: pollen-specific protein-like At4g...  91.7    4e-19   
ref|XP_009114385.1|  PREDICTED: pollen-specific protein-like At4g...  91.7    4e-19   
gb|EMT13715.1|  Pollen allergen Phl p 11                              91.7    4e-19   
ref|XP_004959259.1|  PREDICTED: pollen-specific protein C13-like      91.3    5e-19   
ref|XP_006661014.1|  PREDICTED: pollen-specific protein C13-like      91.3    5e-19   
dbj|BAD46623.1|  putative Pollen specific protein C13 precursor       90.9    5e-19   
ref|XP_002872410.1|  hypothetical protein ARALYDRAFT_489767           90.9    6e-19   
gb|EEC85106.1|  hypothetical protein OsI_32490                        90.9    6e-19   
ref|NP_001064001.1|  Os09g0572800                                     90.9    6e-19   
emb|CDY65576.1|  BnaC09g52000D                                        90.9    7e-19   
gb|AAM78185.1|  putative SAH7 protein                                 89.4    7e-19   
gb|AAO22133.1|  major pollen allergen Ole e 1                         89.7    8e-19   
gb|KFK32118.1|  hypothetical protein AALP_AA6G200700                  90.5    9e-19   
emb|CAA16739.1|  pollen-specific protein - like                       95.9    9e-19   
gb|EYU24008.1|  hypothetical protein MIMGU_mgv1a015363mg              90.5    9e-19   
ref|XP_009383585.1|  PREDICTED: pollen-specific protein C13-like      90.1    1e-18   
gb|AAM78187.1|  putative SAH7 protein                                 89.0    1e-18   
gb|AEW90940.1|  group 11 grass pollen allergen F7-1                   90.1    1e-18   
gb|KEH38612.1|  pollen Ole e I family allergen                        90.1    1e-18   
ref|XP_010535648.1|  PREDICTED: major pollen allergen Lol p 11-like   89.7    1e-18   
ref|XP_010424432.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        91.7    2e-18   
gb|KEH38613.1|  pollen Ole e I family allergen                        89.7    2e-18   
ref|XP_002440811.1|  hypothetical protein SORBIDRAFT_09g007260        89.7    2e-18   
gb|ACJ86286.1|  unknown                                               89.0    3e-18   
ref|XP_003565925.1|  PREDICTED: pollen allergen Phl p 11              89.0    3e-18   
ref|XP_010025486.1|  PREDICTED: protein DOWNSTREAM OF FLC             88.6    4e-18   
ref|XP_002459879.1|  hypothetical protein SORBIDRAFT_02g012930        88.6    5e-18   
ref|XP_007048005.1|  Pollen-specific protein C13, putative            87.8    6e-18   
ref|NP_001057857.1|  Os06g0556600                                     87.8    9e-18   
gb|KHG18492.1|  Anther-specific LAT52                                 87.4    1e-17   
ref|XP_004971474.1|  PREDICTED: pollen allergen Phl p 11-like         87.4    1e-17   
gb|AEW90945.1|  group 11 grass pollen allergen R1-2                   87.0    1e-17   
ref|XP_010521200.1|  PREDICTED: major pollen allergen Lol p 11        87.0    1e-17   
gb|AFO38383.1|  putative pollen-specific protein C13                  87.4    2e-17   
ref|XP_003543768.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        86.3    2e-17   
ref|XP_010317514.1|  PREDICTED: olee1-like protein                    85.1    3e-17   
ref|XP_006645671.1|  PREDICTED: pollen allergen Phl p 11-like         85.9    3e-17   
gb|AAM78189.1|  putative SAH7 protein                                 84.7    4e-17   
gb|ACJ86288.1|  unknown                                               85.9    5e-17   
gb|KFK42186.1|  hypothetical protein AALP_AA2G222600                  85.5    5e-17   
gb|AAM78186.1|  putative SAH7 protein                                 84.3    6e-17   
gb|EMS61378.1|  Pollen-specific protein C13                           84.7    7e-17   
gb|KDP21093.1|  hypothetical protein JCGZ_21564                       85.9    9e-17   
gb|EAZ04544.1|  hypothetical protein OsI_26693                        83.6    2e-16   
ref|XP_011101376.1|  PREDICTED: pollen allergen Che a 1-like isof...  83.2    4e-16   
ref|XP_008381078.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        82.4    6e-16   
gb|AAM78188.1|  putative SAH7 protein                                 81.3    7e-16   
gb|EAZ40496.1|  hypothetical protein OsJ_24951                        81.3    1e-15   
ref|NP_001175282.1|  Os07g0590500                                     81.6    2e-15   
ref|XP_003601984.1|  Pollen-specific protein C13                      80.9    2e-15   
ref|XP_006302909.1|  hypothetical protein CARUB_v10021044mg           80.9    3e-15   
ref|XP_004299638.1|  PREDICTED: pollen allergen Phl p 11-like         79.3    3e-15   
ref|NP_196575.1|  pollen_Ole_e_I-domain containing protein            80.1    4e-15   
gb|KHN44330.1|  Pollen-specific protein C13                           79.3    5e-15   
ref|XP_011102257.1|  PREDICTED: olee1-like protein                    80.1    5e-15   
ref|XP_010906302.1|  PREDICTED: pollen-specific protein C13-like      78.6    6e-15   
emb|CAC41634.1|  plantain pollen major allergen, Pla l 1.0102         78.6    7e-15   
ref|XP_010090546.1|  hypothetical protein L484_016596                 79.7    9e-15   
gb|ACK44512.1|  AT5G10130-like protein                                79.7    9e-15   
emb|CAC41635.1|  plantain pollen major allergen, Pla l 1.0103         78.2    1e-14   
ref|XP_010491667.1|  PREDICTED: protein DOWNSTREAM OF FLC             79.0    1e-14   
ref|XP_006399503.1|  hypothetical protein EUTSA_v10014875mg           78.6    1e-14   
ref|XP_011101377.1|  PREDICTED: olee1-like protein isoform X2         78.6    2e-14   
gb|ADM76637.1|  extensin-like protein                                 78.2    2e-14   
ref|XP_010422886.1|  PREDICTED: protein DOWNSTREAM OF FLC             77.8    3e-14   
ref|XP_010453035.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        77.8    3e-14   
ref|XP_006288804.1|  hypothetical protein CARUB_v10002136mg           77.8    3e-14   
ref|XP_010547621.1|  PREDICTED: protein DOWNSTREAM OF FLC             77.4    3e-14   
ref|XP_002889170.1|  pollen ole e 1 allergen and extensin family ...  77.4    4e-14   
ref|NP_177927.1|  pollen Ole e 1 allergen and extensin family pro...  77.4    4e-14   
ref|XP_010416770.1|  PREDICTED: major pollen allergen Lol p 11-like   77.4    4e-14   
ref|XP_010105888.1|  hypothetical protein L484_021545                 77.4    5e-14   
gb|ADM76665.1|  extensin-like protein                                 77.0    5e-14   
gb|ABK21930.1|  unknown                                               77.0    5e-14   
gb|ADM76653.1|  extensin-like protein                                 77.0    5e-14   
gb|ABK22573.1|  unknown                                               77.0    5e-14   
ref|XP_002887714.1|  pollen ole e 1 allergen and extensin family ...  76.6    6e-14   
sp|P82242.2|PLAL1_PLALA  RecName: Full=Major pollen allergen Pla ...  75.9    7e-14   
ref|XP_010472003.1|  PREDICTED: major pollen allergen Lol p 11-like   76.6    8e-14   
ref|XP_010428908.1|  PREDICTED: major pollen allergen Lol p 11-like   75.9    1e-13   
emb|CDY21640.1|  BnaC09g46520D                                        75.5    1e-13   
ref|XP_006468202.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  74.7    2e-13   
gb|AFK44177.1|  unknown                                               75.1    2e-13   
gb|AAN60344.1|  unknown                                               74.7    2e-13   
ref|XP_002873440.1|  pollen ole e 1 allergen and extensin family ...  75.1    2e-13   
emb|CDX87484.1|  BnaA07g33890D                                        75.1    3e-13   
emb|CDX88408.1|  BnaC06g38520D                                        75.1    3e-13   
ref|XP_009106450.1|  PREDICTED: protein DOWNSTREAM OF FLC             75.1    3e-13   
ref|XP_006390031.1|  hypothetical protein EUTSA_v10019236mg           74.3    4e-13   
ref|XP_008343324.1|  PREDICTED: olee1-like protein                    73.2    5e-13   
ref|XP_009794836.1|  PREDICTED: pollen-specific protein C13-like      72.8    5e-13   
gb|AAZ67595.1|  80A08_10                                              73.9    5e-13   
ref|XP_009122085.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        73.9    6e-13   
gb|ACQ44229.1|  putative pollen Ole e 1 allergen and extensin fam...  73.6    9e-13   
gb|EMT21854.1|  hypothetical protein F775_27590                       72.8    9e-13   
emb|CDO96791.1|  unnamed protein product                              72.4    9e-13   
ref|XP_010680579.1|  PREDICTED: major pollen allergen Lol p 11-like   73.2    1e-12   
emb|CDY40079.1|  BnaC02g00510D                                        72.8    1e-12   
emb|CDX85777.1|  BnaA02g00360D                                        72.4    2e-12   
ref|XP_009125327.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        72.4    2e-12   
ref|XP_008357485.1|  PREDICTED: uncharacterized protein LOC103421237  72.8    5e-12   
ref|XP_006838264.1|  hypothetical protein AMTR_s00103p00069180        70.1    7e-12   
gb|KDO56621.1|  hypothetical protein CISIN_1g041753mg                 69.3    1e-11   
ref|XP_003596434.1|  Major pollen allergen Lol p                      70.1    1e-11   
gb|AAF17689.1|AC009243_16  F28K19.26                                  73.6    1e-11   
ref|XP_009789881.1|  PREDICTED: olee1-like protein                    70.1    1e-11   
ref|XP_003596438.1|  Major pollen allergen Lol p                      69.7    2e-11   
ref|XP_003596443.1|  Major pollen allergen Lol p                      70.5    2e-11   
gb|KDO44647.1|  hypothetical protein CISIN_1g045131mg                 68.2    2e-11   
emb|CDY21637.1|  BnaC09g46550D                                        69.3    2e-11   
gb|AFW82075.1|  hypothetical protein ZEAMMB73_949741                  66.2    1e-10   
ref|XP_008238496.1|  PREDICTED: olee1-like protein                    67.0    2e-10   
ref|XP_003596420.1|  Pollen allergen Che a                            65.1    6e-10   
ref|XP_003596436.1|  Major pollen allergen Lol p                      63.9    2e-09   
ref|XP_009413179.1|  PREDICTED: pollen-specific protein C13-like      62.4    3e-09   
ref|XP_008391140.1|  PREDICTED: olee1-like protein                    62.0    3e-09   
ref|XP_007210061.1|  hypothetical protein PRUPE_ppa018487mg           61.2    2e-08   
gb|AAO41983.1|  unknown protein                                       60.5    2e-08   
gb|KEH15235.1|  pollen protein Ole E I-like protein                   60.8    2e-08   
ref|NP_001237949.1|  uncharacterized protein LOC100527053             59.3    3e-08   
ref|XP_007208803.1|  hypothetical protein PRUPE_ppa024703mg           60.5    4e-08   
ref|XP_007208811.1|  hypothetical protein PRUPE_ppa024778mg           60.5    4e-08   
gb|EMS67079.1|  hypothetical protein TRIUR3_25214                     57.8    1e-07   
emb|CDY14639.1|  BnaC02g24740D                                        56.6    5e-07   
ref|XP_008225290.1|  PREDICTED: olee1-like protein                    57.4    6e-07   
gb|ABN50034.1|  putative Ole e 1-like protein                         51.6    1e-05   
ref|XP_009147847.1|  PREDICTED: pollen-specific protein-like At4g...  52.8    1e-05   
ref|XP_010029417.1|  PREDICTED: proline-rich protein 4-like           53.9    4e-05   
ref|XP_009111550.1|  PREDICTED: pollen allergen Che a 1-like          51.6    6e-05   
ref|XP_008240860.1|  PREDICTED: olee1-like protein                    51.6    1e-04   
ref|NP_001147157.1|  pollen proteins Ole e I family protein precu...  50.4    2e-04   
ref|XP_010425434.1|  PREDICTED: uncharacterized protein LOC104710515  49.3    4e-04   
ref|XP_009627730.1|  PREDICTED: pollen-specific protein C13-like      47.0    6e-04   
ref|XP_010502657.1|  PREDICTED: uncharacterized protein LOC104779923  48.9    6e-04   
ref|XP_003595687.1|  Olee1-like protein                               48.9    9e-04   



>ref|XP_006360048.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            +E F V GKVYCDTCRVQF+T++SE + G  V+L C+N   E  T+S EG T  DGKY L
Sbjct  24   SEVFDVEGKVYCDTCRVQFETKLSENLDGATVKLQCRNISTEAETFSVEGVTDKDGKYKL  83

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
            +VD +HEND CEVTVVKSP+EDCKE+++G EKA + C+ NVG++ ++RYANPLFFMK ++
Sbjct  84   TVDGDHENDICEVTVVKSPREDCKESVSGYEKARIECSNNVGIHNAVRYANPLFFMKAES  143

Query  527  DERCHKVLEEINF  565
             + C + L+E+  
Sbjct  144  VQGCKEALDELGL  156



>ref|XP_009604804.1| PREDICTED: anther-specific protein LAT52 [Nicotiana tomentosiformis]
Length=161

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +2

Query  155  HGAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADG  334
            H  P + F V GKVYCDTCRVQF+T++SE + G  VRL C+N   ET T+S EG T  DG
Sbjct  21   HCRP-QVFDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTETETFSVEGVTDKDG  79

Query  335  KYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
            KY L+V+ +H++D CEVTVVKSP+EDCKE++ G EKA + C++NVG++ ++RYANPLFFM
Sbjct  80   KYKLTVEGDHQDDICEVTVVKSPREDCKESVTGYEKARIECSDNVGIHNAVRYANPLFFM  139

Query  515  KNKADERCHKVLEEINF  565
            K +A   C +VL+E+  
Sbjct  140  KTEAVSGCKEVLDELGL  156



>ref|XP_004248244.1| PREDICTED: anther-specific protein LAT52 [Solanum lycopersicum]
 sp|P13447.1|LAT52_SOLLC RecName: Full=Anther-specific protein LAT52; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA33854.1| LAT52 [Solanum lycopersicum]
Length=161

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +2

Query  155  HGAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADG  334
            H  P E F V GKVYCDTCRVQF+T++SE + G  V+L C+N   E  T+S EG T  DG
Sbjct  21   HCRP-EVFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDG  79

Query  335  KYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
            KY L+V+ +HEND CEVTVVKSP+EDCKE+++G EKA + C++NVG++ ++R+ANPLFFM
Sbjct  80   KYKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKARIECSDNVGIHNAVRFANPLFFM  139

Query  515  KNKADERCHKVLEEINF  565
            K ++ + C + L+E+  
Sbjct  140  KAESVQGCKEALDELGL  156



>gb|AFB73932.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +2

Query  155  HGAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADG  334
            H  P E F V GKVYCDTCRVQF+T++S+ + G  V+L C+N   ET T+S EG T  DG
Sbjct  21   HCHP-EVFDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCRNITTETETFSVEGVTDKDG  79

Query  335  KYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
            KY L+V+ +H++D CEVTVVKSP+EDCKE ++G EKA + C++NVG++ ++RYANPLFFM
Sbjct  80   KYKLTVEGDHQDDICEVTVVKSPREDCKEAVSGYEKARIECSDNVGMHNAVRYANPLFFM  139

Query  515  KNKADERCHKVLEEINF  565
            K +A E C + L+E+  
Sbjct  140  KAEAVEGCKEALDELGL  156



>gb|AFB73931.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +2

Query  155  HGAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADG  334
            H  P E F V GKVYCDTCRVQF+T++S+ + G  V+L C+N   ET T+S EG T  DG
Sbjct  21   HCHP-EVFDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCRNITTETETFSVEGVTDKDG  79

Query  335  KYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
            KY L+V+ +H++D CEVTVVKSP+EDCKE ++G EKA + C++NVG++ ++RYANPLFFM
Sbjct  80   KYKLTVEGDHQDDICEVTVVKSPREDCKEAVSGYEKARIECSDNVGMHNAVRYANPLFFM  139

Query  515  KNKADERCHKVLEEINF  565
            K +A E C + L+E+  
Sbjct  140  KAEAVEGCKEALDELGL  156



>ref|XP_009794171.1| PREDICTED: anther-specific protein LAT52 [Nicotiana sylvestris]
Length=161

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  155  HGAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADG  334
            H  P + F V GKVYCDTCRVQF+T++SE + G  VRL C+N   E  T+S EG T  DG
Sbjct  21   HCHP-QVFDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTEIETFSVEGVTDKDG  79

Query  335  KYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
            KY L+V+ +H++D CEVTVVKSP+EDCKE + G EKA + C++NVG++ ++RYAN LFFM
Sbjct  80   KYKLTVEGDHQDDICEVTVVKSPREDCKEAVTGYEKARIECSDNVGIHNAVRYANALFFM  139

Query  515  KNKADERCHKVLEEINF  565
            K++A   C +VL+E+  
Sbjct  140  KSEAVSGCKEVLDELGL  156



>ref|XP_009602640.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=163

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            ++   V G VYCDTCRVQFQT++SEY+ G  VRL CK+ + E  TYS EG T  +GKY +
Sbjct  25   SQAINVEGSVYCDTCRVQFQTKLSEYIEGATVRLACKDIETEKETYSVEGVTDKNGKYII  84

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V+ +HEN+ CEV++VKSP+EDCKE+  G E + VVC+ NVG++   RYANPLFFMK +A
Sbjct  85   KVEGDHENELCEVSIVKSPREDCKESAIGFENSRVVCSANVGIHNPTRYANPLFFMKTEA  144

Query  527  DERCHKVLEEINF  565
               C  VL+E+  
Sbjct  145  VSGCKDVLDELGL  157



>ref|XP_009778120.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=163

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            ++   V G VYCDTCRVQFQT++SEY+ G  VRL CK+ + E  TYS EG T  +GKY +
Sbjct  25   SQAINVEGSVYCDTCRVQFQTKLSEYIEGATVRLACKDIETEKETYSVEGVTDKNGKYII  84

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V+ +HEN+ CEV++VKSP+EDCKE   G E + VVC+ NVG++   RYANPLFFMK +A
Sbjct  85   KVEGDHENELCEVSIVKSPREDCKEPAIGFENSRVVCSGNVGIHNPTRYANPLFFMKTEA  144

Query  527  DERCHKVLEEINF  565
               C  VL+E+  
Sbjct  145  VSGCKDVLDELGL  157



>ref|XP_004251892.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=161

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            E F V G VYCDTCRVQFQTRISEY+ G  V+L C++ + E VTY+AE  T  +GKY + 
Sbjct  25   EAFKVEGTVYCDTCRVQFQTRISEYIEGAKVKLTCRDMETEKVTYTAEALTDKNGKYTIE  84

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
               +HE + C+V VV+SP+EDCK+   G E + VVC+ NVG++   RYANPLFFMK +  
Sbjct  85   ASGDHEKELCDVGVVQSPREDCKDPAIGFENSRVVCSNNVGMHNPTRYANPLFFMKKETL  144

Query  530  ERCHKVLEEINF  565
              C  VL+E+  
Sbjct  145  PDCKDVLDELGL  156



>ref|XP_002523378.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
 gb|EEF38957.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
Length=166

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = +2

Query  182  VRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDRE  361
            V GKVYCDTCRV+F+T++SE + G  V+L+CKN +N T+TY+ EG T A G Y L V+ E
Sbjct  32   VEGKVYCDTCRVEFETKLSEVIPGTRVKLECKNRENNTLTYAVEGVTDASGIYRLPVEGE  91

Query  362  HENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCH  541
            HE D CEV ++KS K DC E    ++ A V+ T NVGV    RY NPL FMK KA   C 
Sbjct  92   HEEDLCEVKLIKSGKPDCAEAFKSVDHARVLLTHNVGVVQPTRYTNPLGFMKQKASPECG  151

Query  542  KVLEEINFSSNENMM  586
            KVL+++ F   +N++
Sbjct  152  KVLQDMGFVPLDNLV  166



>ref|XP_011070069.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=161

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 88/130 (68%), Gaps = 0/130 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            EKF V G VYCD CRVQF+T +S  +AG  VRL+C++ + +TVTYS EG TG+DG Y+L+
Sbjct  24   EKFHVEGDVYCDPCRVQFETELSYNLAGATVRLECRDIETKTVTYSMEGVTGSDGHYSLT  83

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +HE D CEV  VKSPK +C E M   E+A + CTEN G++  IRYANP+ FM  +  
Sbjct  84   VKGDHEKDICEVIPVKSPKAECSEPMGDYERAKIECTENSGLHNPIRYANPIGFMTPEIL  143

Query  530  ERCHKVLEEI  559
              C  +L  +
Sbjct  144  PACGPILANL  153



>ref|XP_009761932.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=164

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A  E F V G+V+CDTCR+ F T +SE + G  VRL C++ +    TYS EG+T   GKY
Sbjct  22   AEPEVFDVEGRVFCDTCRLGFATSLSEAIQGATVRLTCRDIETHNETYSTEGKTDMIGKY  81

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
             L+V+ +HEND CEVTVV SP+EDCKE ++ L K  VVC++NVG++ ++R+ NPLFF K+
Sbjct  82   TLTVEGDHENDICEVTVVNSPREDCKEIVSELVKGRVVCSKNVGMHNAVRFTNPLFFQKD  141

Query  521  KADERCHKVLEEI  559
            K    C +++EE+
Sbjct  142  KPVPGCKELVEEM  154



>ref|XP_006358942.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            E F V G VYCDTCRVQFQT+ISE + G  V+L C++ + E VTY+ E  T  DGKY + 
Sbjct  25   EVFKVEGTVYCDTCRVQFQTKISENIEGAKVQLTCRDMETEKVTYTTEALTDKDGKYTIE  84

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
               +HE + C+V V+ SP+EDCKE   G E   VVC+ NVG++   RYANPLFFMK ++ 
Sbjct  85   ATGDHEKELCDVGVIHSPREDCKEPAIGFENTRVVCSNNVGMHNPTRYANPLFFMKKESL  144

Query  530  ERCHKVLEEINF  565
              C  VL+E+  
Sbjct  145  PGCKDVLDELGL  156



>ref|XP_009598969.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=164

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A  E F V G+V+CDTCR+ F T +SE + G  V L C++ +    TYS EG+T   GKY
Sbjct  22   AEPEVFDVEGRVFCDTCRLGFATSLSEVIQGATVGLTCRDIETHNETYSTEGKTDMIGKY  81

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
             L+V+ +HEND CEVTVV SP+EDCKE ++ L K  VVC++NVG++ ++R+ NPLFF K+
Sbjct  82   TLTVEGDHENDICEVTVVNSPREDCKEIVSELVKGRVVCSKNVGMHNAVRFTNPLFFQKD  141

Query  521  KADERCHKVLEEI  559
            K    C +++EE+
Sbjct  142  KPVPGCKELVEEM  154



>ref|XP_011029563.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=166

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A+   V GKVYCDTCRV+FQT+IS+ + G  V+L C N +N T+TY+ EG T + G Y L
Sbjct  27   ADYLDVEGKVYCDTCRVEFQTKISDALPGAKVKLACNNRENGTLTYTVEGSTDSRGTYRL  86

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V  +HE D CEV +V+SP+ DC E    ++ A ++ T+NVGV  S+RYAN L +MK  A
Sbjct  87   PVAGDHEEDICEVRLVESPRADCNEPFKSVDSARILLTKNVGVVNSLRYANALGYMKKVA  146

Query  527  DERCHKVLEEINF  565
               C KVLEE+ F
Sbjct  147  QPECAKVLEEMGF  159



>ref|XP_011098227.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=163

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            EKF V G VYCD CRVQF+T +S ++AG +VR++C++ + + +T+S EG TG+DG Y++ 
Sbjct  26   EKFYVEGDVYCDPCRVQFETELSYHIAGAMVRVECRDIETKKITFSMEGVTGSDGHYSIM  85

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +HE D CEV   +SPK +C E M   E+A V CTEN G++ +IRYANP+ FM  K  
Sbjct  86   VTGDHEKDICEVIPTRSPKNECSEPMGDYERAKVECTENSGLHNTIRYANPVGFMTPKVL  145

Query  530  ERCHKVLEEI-NFSSNEN  580
              C  +L ++  F+ + N
Sbjct  146  PECAPILADLATFNEDSN  163



>gb|EYU26327.1| hypothetical protein MIMGU_mgv1a015422mg [Erythranthe guttata]
Length=158

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +2

Query  155  HGAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADG  334
            HG   E F V G VYCD CRVQF+T +++ + G  VRL+C++   + VTYS EG TG +G
Sbjct  19   HGHQTEHFNVEGDVYCDPCRVQFETVLAQRLIGATVRLECRDLVKKAVTYSVEGVTGFNG  78

Query  335  KYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             Y+L V  +H+N+ CEV VVKSP+ DC E M    K+ + CT N G + ++R+ANP+ FM
Sbjct  79   HYSLPVVGDHQNEICEVAVVKSPRPDCIEPMGDFAKSRISCTTNDGTHAAVRFANPIGFM  138

Query  515  KNKADERCHKVLEEINFSSN  574
               A  +C  VL ++    N
Sbjct  139  TGAAVPQCTPVLFDLGVLVN  158



>ref|XP_002316866.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|EEE97478.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=164

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 89/133 (67%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A+   V GKVYCDTCRV+FQT+IS+ + G  V+L C N +N T+TY+ EG T + G Y L
Sbjct  27   ADYLDVEGKVYCDTCRVEFQTKISDAIPGAKVKLVCNNRENGTLTYTVEGTTDSSGTYRL  86

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V  +HE D CEV +V+SP+ DC E    ++ A ++ T+NVGV  ++RYAN L +MK  A
Sbjct  87   PVVGDHEEDICEVRLVESPRADCNEPFKSVDSARILLTKNVGVVDNLRYANALGYMKKVA  146

Query  527  DERCHKVLEEINF  565
               C KVLEE+ F
Sbjct  147  QPECAKVLEEMGF  159



>ref|XP_004244268.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=169

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 91/135 (67%), Gaps = 0/135 (0%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A  E F V GKV+CDTCR+ F T +S  + G  VR+ CK+ +    T++ EG+T   GKY
Sbjct  22   ADVETFNVEGKVFCDTCRLGFVTSLSNTLEGATVRMTCKDMETHNETFTTEGKTDGIGKY  81

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
             L V+ +HEND CEVT+V SPK+DCKE +  +    V+C++NVG++ ++R+ NPLF+ K+
Sbjct  82   TLKVEGDHENDICEVTLVNSPKDDCKEVVPDMVNNRVICSKNVGMHNAVRFVNPLFYQKD  141

Query  521  KADERCHKVLEEINF  565
            K  + C K++EE+  
Sbjct  142  KPIDGCAKLVEEMEL  156



>ref|XP_006348395.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=169

 Score =   135 bits (341),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A  E F V GKV+CDTCR+ F T +S  + G  VRL CK+ +    T++ EG+T   GKY
Sbjct  22   ADFEIFDVEGKVFCDTCRLGFVTSLSNTLEGATVRLTCKDMETHNETFTTEGKTDYIGKY  81

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
             L+V+ +HEND CEVT+V SPK+DCKE +  +    V+C++NVG++ ++R+ NPLFF K+
Sbjct  82   TLTVEGDHENDICEVTLVNSPKDDCKEIVPDMVNNRVICSKNVGMHNAVRFVNPLFFQKD  141

Query  521  KADERCHKVLEEI  559
            K    C +++EE+
Sbjct  142  KPINGCRELVEEM  154



>ref|XP_010277041.1| PREDICTED: anther-specific protein LAT52 [Nelumbo nucifera]
Length=165

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            E+F V+GKVYCDTCR QF+T++SE ++G  VRL+C++ +N+ V YS EGET   G Y L 
Sbjct  28   EQFFVQGKVYCDTCRTQFETKLSEPISGAKVRLECRSRENDDVAYSVEGETDTTGIYKLP  87

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V+  HE D CEV ++ SP++DC E   GL+ A V+ + N G++ + R+AN L FM  K  
Sbjct  88   VEGSHEEDICEVKLLSSPRKDCSEPAPGLDHARVLLSSNNGISSASRFANSLGFMVLKPI  147

Query  530  ERCHKVLEEINF  565
            E C  VL+E+  
Sbjct  148  EGCSDVLKELGL  159



>gb|KDP32532.1| hypothetical protein JCGZ_14735 [Jatropha curcas]
Length=165

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = +2

Query  182  VRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDRE  361
            V GKVYCD CRV+F+T++SE + G VV+L+CK  +N T+TY+ EGET   G Y L V+ E
Sbjct  32   VEGKVYCDVCRVEFETKLSEPIKGAVVKLECKIRENNTLTYAVEGETDPQGIYRLPVEGE  91

Query  362  HENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCH  541
            HE D CEV +VKS   DC E     ++A ++ ++NVGV  + RYANPL +MK +A+  C 
Sbjct  92   HEEDICEVRLVKSGMTDCIEPFKSTDRARILLSQNVGVVQASRYANPLGYMKKEANPNCG  151

Query  542  KVLEEINFSSN  574
            +VL ++ F  N
Sbjct  152  QVLLDMGFLPN  162



>gb|EYU45018.1| hypothetical protein MIMGU_mgv1a015317mg [Erythranthe guttata]
Length=161

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 84/128 (66%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F + G VYCD CRVQF T +S+ + G  VRL+C+N + + VTYS EG T ADG Y+L VD
Sbjct  30   FNIEGDVYCDPCRVQFHTELSKRIPGATVRLECQNEETKAVTYSVEGLTNADGHYSLRVD  89

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE D C V  +KSP  +C E M  + ++ +VCT N+G++ ++R+ANP+ FM      +
Sbjct  90   GDHEKDVCVVKAIKSPIAECSEPMTDVRESRIVCTNNIGMHSAVRFANPIGFMTKVGSPQ  149

Query  536  CHKVLEEI  559
            C  VL++ 
Sbjct  150  CIPVLQDF  157



>gb|EPS72638.1| hypothetical protein M569_02120, partial [Genlisea aurea]
Length=161

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDC-KNTDNETVTYSAEGETGADGKYNLSV  352
            F V G+VYCD CRVQF T +S  + G  VRL C +  D   +TYS EG+TG DG+Y L V
Sbjct  35   FDVVGEVYCDPCRVQFMTELSRRLVGATVRLQCHRYNDTGCITYSVEGKTGFDGRYRLQV  94

Query  353  DREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADE  532
              +HE+D C V V+ SP+ DC   M  + ++ +VCT+NVG++  +RYANPL FM   A  
Sbjct  95   KGDHESDLCFVKVIGSPRADCAVPMTDVVESRIVCTKNVGISSPVRYANPLGFMTRAAAP  154

Query  533  RCHKVLE  553
            RC  VL+
Sbjct  155  RCLPVLK  161



>ref|XP_007021723.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY13248.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=162

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKN-TDNETVTYSAEGETGADGKYNLSV  352
            F V GKVYCDTCRV+F+TR+S+ + G  V L+C++ T   ++TYS E  T   GKY + V
Sbjct  28   FFVEGKVYCDTCRVEFETRLSQPIKGATVILECRDRTVGGSITYSQESVTDESGKYRIPV  87

Query  353  DREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADE  532
              +HE + CEV VVKSP+EDC E M   ++A V+ T+  GV+  IRYAN L F+K +A  
Sbjct  88   QGDHEEEICEVRVVKSPREDCNEFMEAWQRARVLLTKKNGVSDPIRYANNLGFLKKEAVP  147

Query  533  RCHKVLEEINF  565
             C +VLEE+ F
Sbjct  148  GCAEVLEELGF  158



>gb|KHG25858.1| Olee1-like protein [Gossypium arboreum]
Length=166

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 87/140 (62%), Gaps = 0/140 (0%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
            G+ + KF V GKVYCDTCRV+F+T++SE + G  V+L+C+   +ETVTYS E ET A+G 
Sbjct  27   GSLSNKFVVLGKVYCDTCRVEFETKLSEPIPGAKVKLECRKEGDETVTYSHEAETDANGV  86

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            Y + V+ +HE   C V+ V SP+ DC E M   EKA V  T + G+    R AN L F K
Sbjct  87   YKIPVEGDHEEQICAVSTVSSPRADCNEKMEAFEKAQVELTSDDGLAEPSRKANNLGFKK  146

Query  518  NKADERCHKVLEEINFSSNE  577
              A   C +VL+E+ F   E
Sbjct  147  KVAVPGCAQVLKEMGFPLTE  166



>ref|XP_011006522.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=161

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 83/133 (62%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A+   V GKVYCD CRV+FQT+ISE +    V+L C N DN T TY+ EG T + G Y L
Sbjct  24   ADYLNVEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDSSGTYRL  83

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
            SV  +HE+D CE+ +V+S + DC E    ++ A ++ T+N GV    RY N L +MK +A
Sbjct  84   SVAGDHEDDICEIRLVESSRPDCNEPFRSIDSAKILLTKNAGVVDKTRYPNALGYMKKEA  143

Query  527  DERCHKVLEEINF  565
               C  VL+E+ F
Sbjct  144  QPECANVLKEMGF  156



>gb|KHG10520.1| Olee1-like protein [Gossypium arboreum]
Length=180

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = +2

Query  164  PAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNE-TVTYSAEGETGADGKY  340
            P EKF V G+VYCDTCRV+F+T+IS+ + G  V+L+C+N  NE  V++S +  T   G Y
Sbjct  28   PEEKFIVEGRVYCDTCRVEFETKISQPIKGASVKLECRNITNEKIVSHSQDVVTDEAGGY  87

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
             + V  +HE++ CEV++VKSP+ DC E      KA VV T+  GV+G+ R+AN L +MK 
Sbjct  88   KIEVKGDHEDEICEVSLVKSPRADCNEPTEVWRKARVVLTKADGVSGTYRFANNLGYMKK  147

Query  521  KADERCHKVLEEINF  565
            +A   C KVL E+ +
Sbjct  148  EALPECKKVLTEMGY  162



>ref|XP_006370166.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ERP66735.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=161

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A+   V GKVYCD CRV+FQT+ISE +    V+L C N DN T TY+ EG T   G Y L
Sbjct  24   ADYLDVEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDNSGTYRL  83

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V  +HE+D CEV +V+S + DC E    ++ A ++ T+NVGV    RY N L +MK +A
Sbjct  84   PVAGDHEDDICEVRLVESSRPDCNEPFRSIDSARILLTKNVGVVDKTRYPNALGYMKKEA  143

Query  527  DERCHKVLEEINF  565
               C  VL+E+ F
Sbjct  144  QPECADVLKEMGF  156



>ref|XP_009617824.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=171

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 89/138 (64%), Gaps = 3/138 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F V GKVYCD CR  F+ R+S+ M G  VRL C+N+ +++VT + EG+T  +G Y+L V
Sbjct  30   QFHVEGKVYCDFCRALFENRLSKPMPGAEVRLQCRNSTDDSVTLTVEGQTDKNGVYSLLV  89

Query  353  DREHENDTCEVTVVKSPKEDCKETM---AGLEKATVVCTENVGVNGSIRYANPLFFMKNK  523
            +R+HE++ CE+ ++KS KEDC E        E A +  T N G+  +IR+ANPLFF+K +
Sbjct  90   ERDHEDEICEMILMKSSKEDCSEIPNEGHAKESARITITSNNGMAETIRHANPLFFVKKE  149

Query  524  ADERCHKVLEEINFSSNE  577
            A   C +V +E+     E
Sbjct  150  AAPECAEVFKELELLPEE  167



>ref|XP_009352776.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=180

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 87/143 (61%), Gaps = 3/143 (2%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            AE   V G VYCD CR QF TRISE + G  VRL+C+ ++   VT + E +T   G Y++
Sbjct  25   AETLNVHGIVYCDNCRTQFFTRISEPLTGAKVRLECRESEGGKVTLTKEADTEELGTYSI  84

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLE---KATVVCTENVGVNGSIRYANPLFFMK  517
             V+ +HE + CEV +VKSPKEDC E    L     A +  T + G+ G  R ANPL FMK
Sbjct  85   PVEGDHEEEVCEVILVKSPKEDCSEISNELHAKLSARISLTNHNGITGPHRMANPLGFMK  144

Query  518  NKADERCHKVLEEINFSSNENMM  586
             + D RC +VL+E+  + + +++
Sbjct  145  KEVDPRCAEVLKELGLTPDGDLV  167



>ref|XP_009334049.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 1/134 (1%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
            GA      V GKVYCD CRVQF+TR+S  + G  V L+C++ +N T+ Y  EG+T  +G 
Sbjct  26   GAATRTLFVEGKVYCDPCRVQFETRLSTPIDGATVALECRSRENGTIVYVVEGKTDKNGI  85

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            Y+L+  +E E   CEV  V+SP ++C +    +E+A ++ T N GVN   RYANPL FMK
Sbjct  86   YSLATHKEFEEQICEVRTVRSPTDECADHF-DIERARILLTHNNGVNALARYANPLGFMK  144

Query  518  NKADERCHKVLEEI  559
             ++   C  VL+E+
Sbjct  145  KESTSECEAVLKEL  158



>ref|XP_008359333.1| PREDICTED: olee1-like protein [Malus domestica]
Length=166

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 1/134 (1%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
            GA  E   V GKVYCD CRVQF+TR+S  + G  V L+C++ +N T+ Y+ EG+T  +G 
Sbjct  26   GADIETLFVEGKVYCDPCRVQFETRLSTPLDGATVALECRSRENGTMVYTLEGKTDKNGI  85

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            Y+L  D+  E   CEV  V SP  DC +    +EKA ++ T N GV    RYANPL FMK
Sbjct  86   YSLPADKNFEEQICEVRTVSSPTGDCADHF-DIEKARILLTHNNGVKAMARYANPLGFMK  144

Query  518  NKADERCHKVLEEI  559
             ++   C  VL+E+
Sbjct  145  KESTTECEAVLKEL  158



>ref|XP_007212169.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
 gb|EMJ13368.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
Length=168

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 90/143 (63%), Gaps = 5/143 (3%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A+  +V G VYCD CR+QF TRISE + G  V+L+C++ +  TVT S+E +T   G+Y +
Sbjct  26   ADNLSVDGLVYCDNCRIQFMTRISEPLQGATVKLECRDREGGTVTLSSETDTDEQGRYQI  85

Query  347  SVDREHENDTCEVTVVKSPKEDCKE----TMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             V+ +HE + CEV +VKSP++DC E    + A L  A +  T N G+ G  R  NPL F+
Sbjct  86   PVEGDHEEEVCEVLLVKSPRDDCSEVSTDSHAKL-SARISLTNNNGIAGPHRIPNPLGFL  144

Query  515  KNKADERCHKVLEEINFSSNENM  583
            K + D +C +VL+E+  +   ++
Sbjct  145  KTEPDAKCAEVLKELGLTPEGDL  167



>ref|XP_006857531.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
 gb|ERN18998.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
Length=159

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 81/132 (61%), Gaps = 0/132 (0%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
            G P   F V G+VYCDTCR  F+T  + Y+ G  VRL+CK+     +TYS EG T A G 
Sbjct  21   GTPTPNFEVEGRVYCDTCRAGFETSATTYIKGSTVRLECKDRATHQLTYSIEGVTDATGT  80

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            Y L V  + +++ CEV VV SP+  C + M G E+A V+ T N G+  + RYAN L F+K
Sbjct  81   YRLPVSDDRQHEICEVVVVSSPEAGCGKAMLGRERARVLLTHNNGIVSNTRYANALAFLK  140

Query  518  NKADERCHKVLE  553
            ++   RC ++L+
Sbjct  141  DEPLPRCAELLK  152



>ref|XP_003541705.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN08444.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 90/143 (63%), Gaps = 4/143 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDN-ETVTYSAEGETGADGKYNL  346
            ++F V G VYCDTCRVQF T++SE++ G  VR+ C   DN + VT+S E  T A G Y +
Sbjct  26   DRFMVEGTVYCDTCRVQFLTKLSEFLEGATVRVVCSQVDNAKNVTFSKEAVTDASGSYKV  85

Query  347  SVDREHENDTCEVTVVKSPKEDCKET--MAGLEKAT-VVCTENVGVNGSIRYANPLFFMK  517
             VD +HE DTCEVT++KSP+ DC E    + L++A  +  T+N G+   IR ANPL F+K
Sbjct  86   EVDGDHEEDTCEVTLLKSPRADCSEVDQESHLQQAARISITKNNGIVSPIRQANPLGFLK  145

Query  518  NKADERCHKVLEEINFSSNENMM  586
                  C  +L+E+  + +  ++
Sbjct  146  KDRLPGCLDLLKELGINEDGTLI  168



>emb|CDP16230.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 88/139 (63%), Gaps = 1/139 (1%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            E FTV+G+VYCD CRV+FQT +S+ + G  V L C+  +NETVT S + +T A G Y LS
Sbjct  24   EAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVELQCRVRENETVTVSQKAKTDAIGNYELS  83

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +HE + CEV  V SP ++C     G  KA V+ T+N GV G+ RYAN L +   +A+
Sbjct  84   VQGDHEEEICEVVSVSSPSQECNVPF-GENKARVLLTQNNGVQGTDRYANALGYKTAEAN  142

Query  530  ERCHKVLEEINFSSNENMM  586
              C  VL+E+ +  +E+ +
Sbjct  143  PDCKAVLQEMGYIPDEDQI  161



>ref|XP_009340070.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
            GA  E   V GKVYCD CRVQF+TR+S  + G  V L+C++ +N T+ Y  EG+T  +G 
Sbjct  26   GADIETLFVEGKVYCDPCRVQFETRLSTPLDGATVALECRSRENGTMVYRLEGKTDKNGI  85

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            Y+L  D+  E   CEV  V SP  DC +    +EKA ++ T N GV    RYANPL FMK
Sbjct  86   YSLPADKNFEEQICEVRTVSSPTGDCADHF-DIEKARILLTHNNGVKAMARYANPLGFMK  144

Query  518  NKADERCHKVLEEI  559
             ++   C  VL+E+
Sbjct  145  KESTPECEAVLKEL  158



>ref|XP_009396935.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +2

Query  182  VRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDRE  361
            V G+VYCDTCR  F+T  +EY+AG  V+L+CKN     + ++ +  T A GKY ++V  +
Sbjct  32   VEGRVYCDTCRAGFETTATEYIAGAKVKLECKNYTTGEIIHTNQATTDATGKYQITVVDD  91

Query  362  HENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCH  541
            H+ +TC+VT++ SP+ DC E   G   A VV T NVG+   +RYAN L F+K K  E C 
Sbjct  92   HQEETCQVTLISSPRSDCSEISEGRNSALVVVTHNVGITSGVRYANSLGFLKEKPLETCG  151

Query  542  KVL  550
            ++L
Sbjct  152  QLL  154



>ref|XP_008371469.1| PREDICTED: olee1-like protein [Malus domestica]
Length=172

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (60%), Gaps = 3/142 (2%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
             E   V G VYCD CR+QF TRISE + G  VRL+C+  +   +T S E +T   G Y++
Sbjct  25   GETLNVHGIVYCDNCRIQFVTRISETLKGAKVRLECRENEGGKITLSKEADTDDLGTYSI  84

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLE---KATVVCTENVGVNGSIRYANPLFFMK  517
             V+ +HE + CEV +VKSPKEDC E    L     A +  T + G+ G  R ANPL FMK
Sbjct  85   PVEGDHEEEVCEVILVKSPKEDCSEISNELHVKLSARISLTNHNGITGPHRMANPLGFMK  144

Query  518  NKADERCHKVLEEINFSSNENM  583
             + D +C +VL+E+  + + ++
Sbjct  145  KEVDPKCAEVLKELGLTPDGDI  166



>emb|CDP06002.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 87/139 (63%), Gaps = 1/139 (1%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            E FTV+G+VYCD CRV+FQT +S+ + G  V L C+  +N TVT S +  T A+G Y LS
Sbjct  24   EAFTVKGRVYCDPCRVEFQTSLSKNIEGAEVELQCRVRENGTVTVSQKATTDANGNYELS  83

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +HE + CEV  V SP  +C     G  KA ++ T+N GV G+ R+ANPL +   +A+
Sbjct  84   VQGDHEEEICEVASVSSPSLECNVPF-GENKARILLTQNNGVQGTDRFANPLGYKTTEAN  142

Query  530  ERCHKVLEEINFSSNENMM  586
              C  +L+E+ +  +EN +
Sbjct  143  PDCKPILQEMGYIPDENGL  161



>ref|XP_009348994.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=172

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (60%), Gaps = 3/142 (2%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
             E   V G VYCD CR+QF TRISE + G  VRL+C+  +   +T S E +T   G Y++
Sbjct  25   GETLNVHGIVYCDNCRIQFVTRISETLKGAKVRLECRENEGGKITLSKEADTDDLGTYSI  84

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLE---KATVVCTENVGVNGSIRYANPLFFMK  517
             V+ +HE + CEV +VKSPKEDC E    L     A +  T + G+ G  R ANPL FMK
Sbjct  85   PVEGDHEEEVCEVILVKSPKEDCSEISNELHVKLSARISLTNHNGITGPHRMANPLGFMK  144

Query  518  NKADERCHKVLEEINFSSNENM  583
             + D +C +VL+E+  + + ++
Sbjct  145  KEVDPKCAEVLKELGLTPDGDI  166



>ref|XP_009773994.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=173

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V GKVYCD CR  F+ R+S+ MAG  VRL C+N  +++VT + EG+T  +G Y+L V+
Sbjct  33   FHVEGKVYCDFCRALFENRLSKPMAGAEVRLQCRNNTDDSVTLTVEGQTDKNGVYSLLVE  92

Query  356  REHENDTCEVTVVKSPKEDCKETM---AGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
            R+HE++ CE+ ++KS  EDC E        E A +  T N G+  + R+ANPLFF+K +A
Sbjct  93   RDHEDEICEMILMKSSMEDCSEIPNEGHAKESARITITSNNGMAETTRHANPLFFVKKQA  152

Query  527  DERCHKVLEEINFSSNE  577
               C +V +E+     E
Sbjct  153  APECAEVFKELELLPEE  169



>emb|CDP16229.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 85/139 (61%), Gaps = 1/139 (1%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            E FTV+G+VYCD CRV+FQT +S+ + G  V L C+  +N TVT S +  T A+G Y LS
Sbjct  24   EAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVELQCRVRENGTVTVSQKATTDANGNYELS  83

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
               +HE + CEV  V SP ++C    A   KA V+ T+N GV G+ RYAN L +   K +
Sbjct  84   AQGDHEEEICEVVSVSSPSQECNVPFAE-NKARVLLTQNNGVQGTDRYANALGYKTTKTN  142

Query  530  ERCHKVLEEINFSSNENMM  586
              C  +L+E+ +  +EN +
Sbjct  143  PDCKAILQEMGYIPDENQI  161



>ref|XP_008383629.1| PREDICTED: olee1-like protein [Malus domestica]
Length=184

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 83/138 (60%), Gaps = 3/138 (2%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            E   V G VYCD CR QF TRISE + G  VRL+C+ ++   VT + E +T   G Y++ 
Sbjct  26   ETLNVHGIVYCDNCRTQFFTRISEPLTGAKVRLECRESEGGKVTLTKEXDTEELGTYSIP  85

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLE---KATVVCTENVGVNGSIRYANPLFFMKN  520
            V+ +HE + CEV +VKSPKEDC E    L     A +  T + G+ G  R ANPL FMK 
Sbjct  86   VEGDHEEEVCEVILVKSPKEDCSEISNELHAKLSARISLTNHNGITGPHRMANPLGFMKK  145

Query  521  KADERCHKVLEEINFSSN  574
            + D RC +VL+E+  + +
Sbjct  146  EVDPRCAEVLKELGLTPD  163



>ref|XP_009342278.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
            GA      V GKVYCD CRVQF+TR+S  + G  V L+C++ +N T+ Y  EG+T  +G 
Sbjct  26   GAATRTLFVEGKVYCDPCRVQFETRLSTPIDGATVALECRSRENGTIVYVVEGKTDKNGI  85

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            Y+L+  +E E   CEV  V+S  ++C +    +E+A ++ T N GVN   RYANPL FMK
Sbjct  86   YSLATHKEFEEQICEVRTVRSSTDECADHF-DIERARILLTHNNGVNALARYANPLGFMK  144

Query  518  NKADERCHKVLEEI  559
             ++   C  VL+E+
Sbjct  145  KESTSECEAVLKEL  158



>ref|XP_004485892.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=165

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 93/142 (65%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            ++F V G VYCDTCR QF T+++E+M G  VR++CK  DN TVT+S E  T A G Y + 
Sbjct  25   DRFFVEGVVYCDTCRTQFITKLTEFMEGATVRMECKE-DNGTVTFSKEAVTDASGTYRVE  83

Query  350  VDREHENDTCEVTVVKSPKEDCKE--TMAGLEKAT-VVCTENVGVNGSIRYANPLFFMKN  520
            VD +HE++ CE+T+ KSP++DC E  + + LE+A  +  T N G+   +R ANPL F+K 
Sbjct  84   VDGDHEDEVCEITLAKSPRKDCSEVDSDSHLEQAARISITNNNGIVSPLRTANPLGFLKK  143

Query  521  KADERCHKVLEEINFSSNENMM  586
            +    C  VL+++  + + +++
Sbjct  144  ERLPGCADVLKDLGINEDGSLI  165



>ref|XP_004143635.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004168700.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN50408.1| hypothetical protein Csa_5G172880 [Cucumis sativus]
Length=166

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 81/136 (60%), Gaps = 6/136 (4%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            ++F V GKVYCD CRVQF T+ S+++ G  V+L CK  +  +VT S E  T   G Y++ 
Sbjct  26   DRFLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIE  85

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEK----ATVVCTENVGVNGSIRYANPLFFMK  517
             D +HE D CEVT+VKS   DC E    LEK    A V  T N G+   +R+ANPL FMK
Sbjct  86   ADGDHEEDLCEVTLVKSNDPDCSEI--SLEKYEHMARVSITNNSGITNPVRHANPLAFMK  143

Query  518  NKADERCHKVLEEINF  565
             +    C +VL E+ F
Sbjct  144  KEKLPECKEVLRELGF  159



>ref|XP_007148052.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
 gb|ESW20046.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
Length=169

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 89/143 (62%), Gaps = 4/143 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDN-ETVTYSAEGETGADGKYNL  346
            ++F V G VYCDTCRVQF TR+SE++ G  VR+ C   DN + VT+  E  T A G Y +
Sbjct  26   DRFFVEGTVYCDTCRVQFLTRMSEFLEGAAVRVMCSQVDNAKNVTFDKETVTDALGSYKM  85

Query  347  SVDREHENDTCEVTVVKSPKEDCKET--MAGLEKAT-VVCTENVGVNGSIRYANPLFFMK  517
             VD +HE D C+VT+VKSP+ DC E    + L++A  +  T+N G+   IR ANPL F+K
Sbjct  86   EVDGDHEEDNCQVTLVKSPRPDCSEVDKESYLQQAARISITKNNGIVSPIRQANPLGFLK  145

Query  518  NKADERCHKVLEEINFSSNENMM  586
                  C  +L+E+  + + +++
Sbjct  146  KDRLPGCQDLLKELGINEDGSLV  168



>ref|XP_003546028.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN18912.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 88/142 (62%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDN-ETVTYSAEGETGADGKYNL  346
            ++F V G VYCDTCRVQF T++SE + G  VR+ C   DN + VT+S E  T A G Y +
Sbjct  26   DRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQVDNAKNVTFSKEAVTDASGSYKV  85

Query  347  SVDREHENDTCEVTVVKSPKEDCKET--MAGLEKAT-VVCTENVGVNGSIRYANPLFFMK  517
             V+ +HE DTCEVT++KSP+ DC E    + L++A  +  T+N G+   +R ANPL F+K
Sbjct  86   EVEGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAARISITKNNGIVSPLRQANPLGFLK  145

Query  518  NKADERCHKVLEEINFSSNENM  583
                  C  +L+E+  + +  +
Sbjct  146  KDRLPGCADLLKELGINEDGTL  167



>gb|ACJ83911.1| unknown [Medicago truncatula]
 gb|ACJ86228.1| unknown [Medicago truncatula]
 gb|AFK43996.1| unknown [Medicago truncatula]
 gb|KEH36588.1| pollen Ole e I family allergen [Medicago truncatula]
Length=168

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            +++F V G VYCDTCR QF TR++E++ G  VR++CK  DN T+T++ E  T   GKY++
Sbjct  25   SDRFFVEGVVYCDTCRTQFITRLTEFIEGATVRVECKE-DNGTLTFNKEATTDKSGKYSV  83

Query  347  SVDREHENDTCEVTVVKSPKEDCKE--TMAGLEKAT-VVCTENVGVNGSIRYANPLFFMK  517
             +D +HE++TCEV + KSP++DC E  + A L++A  +  T N G+   +R A+PL F+K
Sbjct  84   EIDGDHEDETCEVILCKSPRKDCSEVDSEAHLQQAARISVTNNNGIVSPVRAASPLGFLK  143

Query  518  NKADERCHKVLEEINFSSN  574
             +   +C +VL+E+  + +
Sbjct  144  KERLPKCGEVLKELGINED  162



>gb|ACU23617.1| unknown [Glycine max]
Length=169

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDN-ETVTYSAEGETGADGKYNL  346
            ++F V G VYCDTCRVQF T++SE + G  VR+ C   DN + VT+S E  T A G Y +
Sbjct  26   DRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQVDNAKNVTFSKEAVTDASGSYKV  85

Query  347  SVDREHENDTCEVTVVKSPKEDCKET--MAGLEKAT-VVCTENVGVNGSIRYANPLFFMK  517
             V+ +HE DTCEVT++KSP+ DC E    + L++A  +  T+N G+    R ANPL F+K
Sbjct  86   EVEGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAARISITKNNGIVSPFRQANPLGFLK  145

Query  518  NKADERCHKVLEEINFSSNENM  583
                  C  +L+E+  + +  +
Sbjct  146  KDRLPGCADLLKELGINEDGTL  167



>ref|XP_008226528.1| PREDICTED: olee1-like protein [Prunus mume]
Length=163

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 80/126 (63%), Gaps = 1/126 (1%)
 Frame = +2

Query  182  VRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDRE  361
            V G+VYCD CRVQF+TR+S  + G VV L+C+  +N T+ Y+ +G+T  +G Y+L  D +
Sbjct  31   VEGRVYCDPCRVQFETRLSVPLEGAVVALECRGRENGTLAYTLQGKTDKNGIYSLPADED  90

Query  362  HENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCH  541
             E   CEV  V SP+ +C +     E+A V+ T N GV    RYANPL FM+N +   C 
Sbjct  91   MEEQICEVRTVSSPRANCNDHF-DFERARVLLTHNNGVKSMARYANPLGFMQNASVTECE  149

Query  542  KVLEEI  559
            +VL+E+
Sbjct  150  EVLKEL  155



>ref|XP_008467237.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=166

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 81/136 (60%), Gaps = 6/136 (4%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            ++F V GKVYCD CRVQF T+ S+++ G  V+L CK  +  +VT S E  T   G Y++ 
Sbjct  26   DRFLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIE  85

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEK----ATVVCTENVGVNGSIRYANPLFFMK  517
             D +HE + CEVT+VKS   DC E    LEK    A V  T N G+   +R+ANPL FMK
Sbjct  86   ADGDHEEELCEVTLVKSNDPDCSEI--SLEKYEHMARVSITNNSGITNPVRHANPLAFMK  143

Query  518  NKADERCHKVLEEINF  565
             +    C ++L E+ F
Sbjct  144  KEKLPECKEILRELGF  159



>sp|O49813.1|OLEE1_BETPN RecName: Full=Olee1-like protein; Flags: Precursor [Betula pendula]
 emb|CAA74365.1| putative Ole e 1 protein [Betula pendula]
Length=166

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 82/138 (59%), Gaps = 3/138 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F V GKVYCD CR QF T++S YM G  V L+C+N +  T+ YS++ ET   G Y + V
Sbjct  26   RFFVEGKVYCDNCRTQFVTKLSTYMKGAKVSLECRNREGGTLIYSSDSETDKSGTYRIPV  85

Query  353  DREHENDTCEVTVVKSPKEDCKETMAG--LEK-ATVVCTENVGVNGSIRYANPLFFMKNK  523
            D +HE + CE+ + KS   DC E      L+K A +  T+N G++  +R ANPL FMK K
Sbjct  86   DGDHEEEICEIALKKSSDPDCSEVSKDPFLKKSARISLTKNNGISTPVRLANPLGFMKKK  145

Query  524  ADERCHKVLEEINFSSNE  577
                C K L E+  + ++
Sbjct  146  PLPECAKALRELGMNPDD  163



>gb|AAN76546.1|AF393475_1 LLP-B3 protein [Lilium longiflorum]
Length=160

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 83/130 (64%), Gaps = 0/130 (0%)
 Frame = +2

Query  164  PAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYN  343
            P   F V G+VYCD+CR  F+T I+ Y+ G  V+L+C++ DN+++ ++ EG T + G Y+
Sbjct  24   PNPTFIVEGRVYCDSCRAGFETNITTYIEGAKVKLECRHFDNDSIAHTVEGVTNSTGTYS  83

Query  344  LSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNK  523
            + ++ +HE++ CEV +V SP  DC E     ++A V  T N G++  IRYAN L F++ +
Sbjct  84   IQLENDHESEICEVVLVSSPIFDCNEIDYDRDRARVTLTNNNGIDSPIRYANSLGFLQEQ  143

Query  524  ADERCHKVLE  553
             D  C  +L+
Sbjct  144  PDIICGDLLK  153



>ref|XP_011085997.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=170

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A A +F V G+VYC+ CR+ F  ++SE M G  V+L+CK  +   +TY+ EGET   G+Y
Sbjct  27   ATAPEFFVVGEVYCEVCRLNFINKLSEPMPGAKVKLECKGEEAGNITYTQEGETNEGGQY  86

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKET----MAGLEKATVVCTENVGVNGSIRYANPLF  508
             L V+ +HE + C +T+VKS + DC E      A    + +  T+N G +GS RYANPL 
Sbjct  87   RLKVEGDHEEEECGITLVKSSRADCNEIPDEGWASKPSSLITLTKNNGFHGSSRYANPLG  146

Query  509  FMKNKADERCHKVLEEINFSSN  574
            F K KA+  C ++++E+  + +
Sbjct  147  FTKKKANPECAELIKELEINPD  168



>ref|XP_010057097.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
 gb|KCW74109.1| hypothetical protein EUGRSUZ_E02748 [Eucalyptus grandis]
Length=168

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 84/136 (62%), Gaps = 3/136 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F V GKVYCDTCR QF T++S+ M    VRL+CK+ +  +VTYS EG T   G Y L V
Sbjct  29   RFFVEGKVYCDTCRTQFITKVSKDMPDAKVRLECKDREGGSVTYSIEGVTDNTGMYRLPV  88

Query  353  DREHENDTCEVTVVKSPKEDCKETM--AGLEK-ATVVCTENVGVNGSIRYANPLFFMKNK  523
            D EHE + CE+ +VKS +  C+E      L K A +  T+N G+   +R ANPL +MKN+
Sbjct  89   DGEHEEEICEIVLVKSSQPGCEEVSNDPFLRKTARISLTKNNGMATPVRQANPLGYMKNE  148

Query  524  ADERCHKVLEEINFSS  571
            +   C  VL E+  +S
Sbjct  149  SLPECADVLRELGMTS  164



>ref|XP_002447728.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
 gb|EES12056.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
Length=173

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 86/135 (64%), Gaps = 0/135 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + ++G+VYCDTCR  F T ++EYMAG  VRL+CK+     V  + +G T A G Y + + 
Sbjct  38   YVIQGRVYCDTCRAGFVTNVTEYMAGAKVRLECKHFGTGEVERAIDGVTDATGTYTIELK  97

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              HE D C+V +V+SP++DC +T    ++A V+ T NVG+  S+R ANPL + K+     
Sbjct  98   DSHEEDICQVVLVQSPRKDCDQTQPLRDRAGVLLTRNVGIADSLRPANPLGYFKDVPLPV  157

Query  536  CHKVLEEINFSSNEN  580
            C  +L++++  ++++
Sbjct  158  CAALLKQLDSDNDDD  172



>gb|ADI55168.1| AS1 [Gossypium hirsutum]
Length=182

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 81/132 (61%), Gaps = 1/132 (1%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTY-SAEGETGADGKYNLS  349
            +F V G VYCDTCRV+F+T ISE + G  VRL+C+N  +E +TY S E   G  G Y + 
Sbjct  39   RFEVLGHVYCDTCRVEFETSISEPIPGATVRLECRNRTDEKITYQSPEITAGDKGNYKIQ  98

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  ++E   C+V +VKSP+ DC +      KA VV T   GV+G IR+AN L F K +A 
Sbjct  99   VTGDYEESDCDVMLVKSPRADCNDPTEEWRKARVVLTTLDGVSGEIRFANNLGFKKKEAL  158

Query  530  ERCHKVLEEINF  565
              C KVL E+ +
Sbjct  159  PECTKVLTEMGY  170



>ref|XP_007213539.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
 gb|EMJ14738.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
Length=163

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 80/126 (63%), Gaps = 1/126 (1%)
 Frame = +2

Query  182  VRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDRE  361
            V G+VYCD CRVQF+TR+S  + G VV L+C+  +N T+ Y+ +G+T  +G Y+L  D +
Sbjct  31   VEGRVYCDPCRVQFETRLSVPLEGAVVALECRGRENGTLAYTLQGKTDKNGIYSLPTDED  90

Query  362  HENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCH  541
             E   CEV  V SP+ +C E     E+A V+ T N GV    RYANPL FM+ ++   C 
Sbjct  91   MEEQICEVRTVSSPRANCNEHFE-FERARVLLTYNNGVKSMARYANPLGFMQKESVTECE  149

Query  542  KVLEEI  559
            +VL+E+
Sbjct  150  QVLKEL  155



>gb|EYU43331.1| hypothetical protein MIMGU_mgv1a014984mg [Erythranthe guttata]
Length=171

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 84/143 (59%), Gaps = 4/143 (3%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A A KF+V G VYC+ CR  F  ++S+ MAG  VRL CK      +TYS EG T   G+Y
Sbjct  28   AAATKFSVEGDVYCEVCRTNFINKLSQPMAGATVRLQCKGETEGNITYSLEGITDDKGQY  87

Query  341  NLSVDREHENDTCEVTVVKSPKEDCK----ETMAGLEKATVVCTENVGVNGSIRYANPLF  508
            +L+V+ +H  D CE+T+V+S + DC     E  A    + +  T+N G + + R ANPL 
Sbjct  88   HLTVEGDHGEDECEITLVRSSRPDCNVVPDEGWATKPTSRITLTKNSGFHDNTRKANPLG  147

Query  509  FMKNKADERCHKVLEEINFSSNE  577
            F K KAD +C ++ +E+  +  E
Sbjct  148  FTKKKADPQCAQLFKELEINPEE  170



>ref|XP_006652233.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=166

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 86/138 (62%), Gaps = 0/138 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A  + V+G+VYCDTCR  F+T ++EY+ G  VRL+CK+     +  + +G T   G Y +
Sbjct  28   APDYLVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHYGTGNIERAVDGVTDETGTYKI  87

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             +   HE D CEV +VKSP  +C E  A  ++A V+ T NVG+  ++R+ANPL ++K+  
Sbjct  88   ELKDSHEEDICEVVLVKSPLANCGEVQAERDRARVLLTRNVGICDNLRFANPLGYLKDIP  147

Query  527  DERCHKVLEEINFSSNEN  580
               C ++L++ + + ++N
Sbjct  148  LPVCGELLKQFDLTDDDN  165



>ref|XP_007025385.1| Olee1-like protein [Theobroma cacao]
 gb|EOY28007.1| Olee1-like protein [Theobroma cacao]
Length=170

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 87/141 (62%), Gaps = 4/141 (3%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            AP E+F V GKVYCD CR QF T+IS+YMAG  VRL+C++ +   +TYS +GET   G Y
Sbjct  28   AP-EQFFVEGKVYCDNCRAQFVTKISKYMAGAQVRLECRDREGGDITYSVDGETDESGTY  86

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA--GLEK-ATVVCTENVGVNGSIRYANPLFF  511
            ++ V+ +HE + CEV++V+S   +C E      L K A +  T+  G+    R ANPL F
Sbjct  87   HIKVEGDHEEEICEVSLVQSSDPECSEIDKENFLRKSARISLTKYSGITSDSRLANPLGF  146

Query  512  MKNKADERCHKVLEEINFSSN  574
            M  K    C +VL E+  +++
Sbjct  147  MVKKPLPECTEVLRELGITAD  167



>sp|O82015.2|LIGV1_LIGVU RecName: Full=Major pollen allergen Lig v 1; AltName: Allergen=Lig 
v 1 [Ligustrum vulgare]
 emb|CAA54818.1| major allergen [Ligustrum vulgare]
Length=145

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR +F T +SE++ G  VRL CK+ +N  VT++  G T A+G Y
Sbjct  6    PPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTKAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            N+ ++R+H+N+ CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F+K
Sbjct  66   NMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNT-VNGTTRTINPLGFLK  124

Query  518  NKADERCHKVLEEI  559
             +   +C +V  ++
Sbjct  125  KEVLPKCPQVFNKL  138



>gb|AFK47865.1| unknown [Lotus japonicus]
Length=168

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 86/135 (64%), Gaps = 3/135 (2%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            ++F V G VYCDTCR QF T++SE++ G  VR++CK   N +VT++ E  T A G Y + 
Sbjct  26   DRFFVEGVVYCDTCRTQFITKLSEFLEGATVRVECKEEGNGSVTFTKEVVTDAKGSYKVE  85

Query  350  VDREHENDTCEVTVVKSPKEDCKE--TMAGLEKAT-VVCTENVGVNGSIRYANPLFFMKN  520
            VD +HE + C+V +VKSP+ DC E  + + LE+A  +  T+N G+   +R ANPL F+K 
Sbjct  86   VDGDHEEELCQVVLVKSPRSDCSEIDSDSHLEQAAKISITKNNGIVSPVRAANPLGFLKK  145

Query  521  KADERCHKVLEEINF  565
            +    C  VL+E+  
Sbjct  146  ERLPGCADVLKELGI  160



>gb|ACG33223.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + ++G+VYCDTCR  F T ++EY+AG  VRL+CK+     +  S +G T A+G Y + + 
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDANGTYTIELK  91

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              HE D CEV +V+SP++DC +  A  ++A V+ T NVG++ ++R ANPL + K+     
Sbjct  92   DSHEEDICEVVLVESPRKDCDQVQADRDRAGVLLTRNVGISDNLRPANPLGYFKDVPLPI  151

Query  536  CHKVLEEI  559
            C  +L+++
Sbjct  152  CASLLKQL  159



>ref|XP_008450951.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=165

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 84/140 (60%), Gaps = 6/140 (4%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
             +  ++F V GKVYCDTCRVQF T++S+++ G  V+L+CK  +  +VT + E  T   GK
Sbjct  21   ASSKDQFFVEGKVYCDTCRVQFFTKVSKFLKGATVKLECKEIEGGSVTLNKEAVTDKSGK  80

Query  338  YNLSVDREHENDTCEVTVVKSPKEDC----KETMAGLEKATVVCTENVGVNGSIRYANPL  505
            Y++  D +HE + CEV++VKS   DC    KE      + T+  T N G+   +R ANPL
Sbjct  81   YSIEADGDHEEEVCEVSLVKSVDPDCDEISKEGYGHTSRVTI--TNNSGITNPVRLANPL  138

Query  506  FFMKNKADERCHKVLEEINF  565
             F+K +    C +VL E+ F
Sbjct  139  AFLKKEKLPECKEVLRELGF  158



>gb|ACF82695.1| unknown [Zea mays]
 tpg|DAA38042.1| TPA: pollen-specific protein C13 [Zea mays]
Length=167

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + ++G+VYCDTCR  F T ++EY+AG  VRL+CK+     +  S +G T  +G Y + + 
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDGNGTYTIELK  91

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              HE D CEV +V+SP++DC +  A  ++A V+ T NVG++ ++R ANPL ++K+     
Sbjct  92   DSHEEDICEVVLVESPRKDCDQVQADRDRAGVLLTRNVGISDNLRPANPLGYLKDVPLPI  151

Query  536  CHKVLEEI  559
            C  +L+++
Sbjct  152  CASLLKQL  159



>ref|XP_008348540.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=162

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V+G+VYCDTCR  F+T  + Y+ G  VR++CK+ +   + YS EGET + G YN+ V+
Sbjct  28   FHVQGRVYCDTCRCGFETTATNYIPGARVRIECKDRNTLQLAYSVEGETDSTGTYNILVE  87

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  CE  +V SP  DCK    G  +A VV T   GV    RYAN + F KN+    
Sbjct  88   EDHEDQICESVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGFFKNEPLAG  147

Query  536  CHKVLEE  556
            C K+LE+
Sbjct  148  CEKILEQ  154



>ref|XP_002522577.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
 gb|EEF39877.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
Length=171

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTD-NETVTYSAEGETGADGKYNLSV  352
            FTV GKVYCDTCRVQF T+ + Y+ G  VRL+CK+ +    +T+SAE ET A G Y++ V
Sbjct  31   FTVEGKVYCDTCRVQFITKATSYIKGARVRLECKDREGGGAITFSAEAETDATGTYHIPV  90

Query  353  DREHENDTCEVTVVKSPKEDCKETMAGL---EKATVVCTENVGVNGSIRYANPLFFMKNK  523
            + EHE + CE+  +KSP  DC E        + A +  T + G+    R ANP+ F+K +
Sbjct  91   NGEHEEELCEIIPLKSPDPDCNEINQDPFVKKAAQITLTNHNGIASPTRSANPIGFLKQQ  150

Query  524  ADERCHKVLEEINFSSN  574
            A   C  +L E+  + +
Sbjct  151  AVPECSGILREMGITPS  167



>gb|ABP58635.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR +F T +SE++ G  VRL C++ +N ++T++  G T A+G Y
Sbjct  1    PPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCRDGENGSITFTEVGSTRAEGLY  60

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ ++R+H+++ CE+T++ S ++DC E  + G  K ++    N  VNG+ R  NPL F K
Sbjct  61   SMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNT-VNGTTRTVNPLGFFK  119

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  120  KEALPKCPQVFNKL  133



>ref|XP_008363638.1| PREDICTED: olee1-like protein [Malus domestica]
Length=163

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = +2

Query  182  VRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDRE  361
            V GKVYCD CRVQF+TR+S  + G  V L+C++ +N T+ Y  EG+T  +G Y+L+  + 
Sbjct  31   VEGKVYCDPCRVQFETRLSTPVDGATVALECRSRENGTIVYVVEGKTDKNGIYSLASHKX  90

Query  362  HENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCH  541
             E   CEV  V+SP + C +     E+A ++ T+N GVN   RYANPL FM  ++   C 
Sbjct  91   FEEQICEVRTVRSPTDQCADHF-DFERARILLTDNNGVNALARYANPLGFMTKESTYECE  149

Query  542  KVLEEI  559
             VL+E+
Sbjct  150  AVLKEL  155



>emb|CAA54819.1| major allergen [Ligustrum vulgare]
Length=145

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR +F T +SE++ G  VRL CK+ +N  +T++  G T A+G Y
Sbjct  6    PPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ ++R+H+N+ CE+T++ S ++DC E  + G  K ++    N  VNG+ R  NPL F K
Sbjct  66   SMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNT-VNGTTRTINPLGFFK  124

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  125  KEALPKCPQVFNKL  138



>ref|NP_001105351.1| pollen-specific protein C13 precursor [Zea mays]
 sp|P33050.1|PSC13_MAIZE RecName: Full=Pollen-specific protein C13; Flags: Precursor [Zea 
mays]
 gb|AAB23277.1| pollen specific protein [Zea mays]
 gb|AFW58125.1| male-gametophyte specific1 [Zea mays]
 prf||2209273A Zm13
Length=170

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + ++G+VYCDTCR  F T ++EY+AG  VRL+CK+     +  + +G T A G Y + + 
Sbjct  35   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERAIDGVTDATGTYTIELK  94

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              HE D C+V +V SP++DC E  A  ++A V+ T NVG++ S+R ANPL + K+     
Sbjct  95   DSHEEDICQVVLVASPRKDCDEVQALRDRAGVLLTRNVGISDSLRPANPLGYFKDVPLPV  154

Query  536  CHKVLEEI  559
            C  +L+++
Sbjct  155  CAALLKQL  162



>pir||B53806 major allergen OLE5c - common olive
Length=145

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR +F T +SE++ G  VRL CK+ +N ++T++  G T A+G Y
Sbjct  6    PPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ ++R+H+++ CE+T++ S ++DC E  + G  K ++    N  VNG+ R  NPL F K
Sbjct  66   SMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNT-VNGTTRTINPLGFFK  124

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  125  KEALPKCPQVFNKL  138



>ref|XP_004144129.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004171680.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN66323.1| hypothetical protein Csa_1G597700 [Cucumis sativus]
Length=165

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 82/136 (60%), Gaps = 6/136 (4%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            ++F V GKVYCDTCRVQF T++S+++ G  V+L+CK  +  +VT   E  T   GKY++ 
Sbjct  25   DQFFVEGKVYCDTCRVQFFTKVSKFLEGATVKLECKEIEGGSVTLDKEAVTDKSGKYSIE  84

Query  350  VDREHENDTCEVTVVKSPKEDC----KETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
             D +HE + CEV+++KS   DC    KE      + T+  T N G+   +R ANPL F+K
Sbjct  85   ADGDHEEEVCEVSLMKSVDPDCDEISKEGYGHTSRVTI--TNNSGITNPVRLANPLAFLK  142

Query  518  NKADERCHKVLEEINF  565
             +    C +VL E+ F
Sbjct  143  KEKLSECKEVLRELGF  158



>ref|NP_001148343.1| LOC100281953 precursor [Zea mays]
 gb|ACG30892.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + ++G+VYCDTCR  F T ++EY+AG  VRL+CK+     +  S +G T  +G Y   + 
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDGNGTYTXELK  91

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              HE D CEV +V+SP++DC +  A  ++A V+ T NVG++ ++R ANPL ++K+     
Sbjct  92   DSHEEDICEVVLVESPRKDCDQVQADRDRAGVLLTRNVGISDNLRPANPLGYLKDVPLPI  151

Query  536  CHKVLEEI  559
            C  +L+++
Sbjct  152  CASLLKQL  159



>pir||C53806 major allergen OLE1c - common olive (fragment)
Length=145

 Score =   111 bits (278),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F V+G+VYCDTCR +F T  SE++ G  VRL CK+ +N  +T++  G T A+G Y
Sbjct  6    PPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ ++R+H+N+ CE+T++ S ++DC E    G  K +V    N  VNG+ R  NPL F K
Sbjct  66   SMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNT-VNGTTRTINPLGFFK  124

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  125  KEALPKCPQVFNKL  138



>ref|NP_001052674.1| Os04g0398700 [Oryza sativa Japonica Group]
 emb|CAE05158.2| OSJNBa0039C07.14 [Oryza sativa Japonica Group]
 dbj|BAF14588.1| Os04g0398700 [Oryza sativa Japonica Group]
 gb|EAZ30594.1| hypothetical protein OsJ_14643 [Oryza sativa Japonica Group]
Length=165

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 84/138 (61%), Gaps = 0/138 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A  + V+G+VYCDTCR  F+T ++EY+ G  VRL+CK+   + V  + +G T   G Y +
Sbjct  27   APDYVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKI  86

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             +   HE D CEV +V SP  +C E  A  ++A V+ T NVG+  ++R ANPL ++K+  
Sbjct  87   ELKDSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIP  146

Query  527  DERCHKVLEEINFSSNEN  580
               C  +L++ + + ++N
Sbjct  147  LPICGALLKQFDLADDDN  164



>emb|CAH66537.1| H0209H04.4 [Oryza sativa Indica Group]
 gb|AFI71825.1| pollen specific protein [Oryza sativa]
Length=165

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 84/138 (61%), Gaps = 0/138 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A  + V+G+VYCDTCR  F+T ++EY+ G  VRL+CK+   + V  + +G T   G Y +
Sbjct  27   APDYVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKI  86

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             +   HE D CEV +V SP  +C E  A  ++A V+ T NVG+  ++R ANPL ++K+  
Sbjct  87   ELKDSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIP  146

Query  527  DERCHKVLEEINFSSNEN  580
               C  +L++ + + ++N
Sbjct  147  LPVCGALLKQFDLADDDN  164



>ref|XP_011079002.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=165

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 76/131 (58%), Gaps = 0/131 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A KF V GKVYC+ CR  F  R SE MAG  V+L+CKN   E+VTY+ EGET   G Y L
Sbjct  28   APKFIVDGKVYCEVCRANFTNRYSEPMAGAKVKLECKNEVTESVTYTLEGETNEKGVYTL  87

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
            + + +H  D C VT++KS   DC E       A V  T N G +   R+ANPL F + +A
Sbjct  88   TAEGDHGEDLCAVTLLKSSMADCAEVPDEKPAAEVTLTLNNGFHDEFRHANPLTFTRKEA  147

Query  527  DERCHKVLEEI  559
               C ++ +E+
Sbjct  148  LPECAELFKEL  158



>ref|XP_009408781.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 75/130 (58%), Gaps = 0/130 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A    V G+VYCDTCR  F+T+ +EY+ G  V+L+CKN      T +A   T   G Y +
Sbjct  27   APNLVVEGRVYCDTCRAGFETKATEYIEGAKVKLECKNYTTGASTLTAVAVTNNKGTYQI  86

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V  +H+ ++C V +V SP+ DC E   G   A VV T NVG+  S+RYAN L F+K+  
Sbjct  87   PVSDDHQEESCAVMLVSSPRSDCSEISDGRNHAAVVLTHNVGITSSVRYANSLGFLKDVP  146

Query  527  DERCHKVLEE  556
               C ++L +
Sbjct  147  LASCGQMLMQ  156



>ref|NP_001146979.1| LOC100280588 precursor [Zea mays]
 gb|ACG24873.1| pollen-specific protein C13 precursor [Zea mays]
 gb|ACN27364.1| unknown [Zea mays]
 tpg|DAA46881.1| TPA: pollen-specific protein C13 [Zea mays]
Length=172

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F VRG+V+CD CR  F+T  S Y+AG  VR+DCK+      T S EG T   G YN+ V 
Sbjct  38   FVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVI  97

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             EHE++ CE  +V SP + C   +AG E+A V  T N GV  ++R AN L F K+ A  R
Sbjct  98   DEHEHELCESVLVSSPDKGCANVVAGRERAPVFLTSNNGVASNVRLANALGFQKDVALPR  157

Query  536  CHKVLE  553
            C ++L+
Sbjct  158  CAQILK  163



>dbj|BAK06698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + V+G+VYCDTCR  F+T ++EY+ G  VRL+C+    + +  S +G T   G Y + + 
Sbjct  32   YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECRRFGTDKLERSIDGVTDESGTYKIELK  91

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              H  D CE+ +V+SP  +C E  A   +A +V + NVG++ +IR ANPL ++K+K    
Sbjct  92   DSHPEDICEMVLVQSPLPNCNEIQALRNRAEIVLSRNVGISDNIRLANPLGYLKDKPLPV  151

Query  536  CHKVLEEINFSSNEN  580
            C  +L+  N +++++
Sbjct  152  CPDLLKMFNLTTDDD  166



>ref|XP_004293940.1| PREDICTED: olee1-like protein-like [Fragaria vesca subsp. vesca]
Length=169

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 88/140 (63%), Gaps = 3/140 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            K  V G V+CD+CR+QF TRI + + G  V+L+CK+ D+ ++TYS E ET   G+Y++ V
Sbjct  29   KLQVEGVVFCDSCRIQFITRIDKLIQGAKVKLECKDLDSGSITYSKEAETNEQGRYSIEV  88

Query  353  DREHENDTCEVTVVKSPKEDCKETMAGLEK---ATVVCTENVGVNGSIRYANPLFFMKNK  523
            D +HE + CEV +V SP EDC +    L +   A +  T++ G+ G +R  NPL FMK +
Sbjct  89   DSDHEEEECEVVLVSSPDEDCNQISHELHQQISARISLTQHNGIAGPVRIPNPLGFMKKE  148

Query  524  ADERCHKVLEEINFSSNENM  583
                C +VL+E+  + + N+
Sbjct  149  PAPECPQVLKELGLTPDGNV  168



>emb|CAA73038.1| Ole e 1.0102 protein [Olea europaea]
Length=146

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR  F T +SE++ G  VRL CK+ +N  VT++  G T A+G Y
Sbjct  7    PPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLY  66

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K
Sbjct  67   SMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNT-VNGTTRTVNPLRFYK  125

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  126  KEALPKCAQVYNKL  139



>gb|ABP58632.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G++YCDTCR +F T +SE++ G  VRL C+  +N  +T++  G T A+G Y
Sbjct  1    PPVSQFHIQGQIYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLY  60

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E  + G  K ++    N  VNG+ R  NPL F K
Sbjct  61   SMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNT-VNGTTRTVNPLGFFK  119

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  120  KEALPKCAQVYNKL  133



>emb|CAA73036.1| Ole e 1 protein [Olea europaea]
Length=146

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR +F T +SE++ G  VRL C+  +N  +T++  G T A+G Y
Sbjct  7    PPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLY  66

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E  + G  K ++    N  VNG+ R  NPL F K
Sbjct  67   SMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNT-VNGTTRTVNPLGFFK  125

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  126  KEALPKCAQVYNKL  139



>ref|XP_004975466.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=163

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 80/130 (62%), Gaps = 0/130 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A  F ++G+VYCDTCR  FQT ++EY+ G  VRL+CK+     V  + +G T   G Y +
Sbjct  26   APDFVIQGRVYCDTCRAGFQTNVTEYIKGAKVRLECKHFGTGAVERAIDGVTDESGFYTI  85

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             +   HE D CEV +++SP++DC E  A  ++A+V+  ++ G++  +R+ NPL + K+  
Sbjct  86   KLKGGHEEDICEVILIESPRKDCAEVPAHSDRASVLLAKDAGISDDMRFPNPLGYFKDVP  145

Query  527  DERCHKVLEE  556
               C  VL+E
Sbjct  146  LPVCGAVLKE  155



>sp|P19963.2|ALL1_OLEEU RecName: Full=Major pollen allergen Ole e 1; AltName: Full=Allergen 
Ole e I; AltName: Allergen=Ole e 1 [Olea europaea]
Length=145

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR  F T +SE++ G  +RL CK+ +N  VT++  G T A+G Y
Sbjct  6    PPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K
Sbjct  66   SMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNT-VNGTTRTVNPLGFFK  124

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  125  KEALPKCAQVYNKL  138



>ref|XP_010261236.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=163

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 85/140 (61%), Gaps = 1/140 (1%)
 Frame = +2

Query  164  PAE-KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            PA+  F V G+VYCDTCR  F+T  + Y+ G  VR++C++ DN  + +S EG T A G Y
Sbjct  24   PAKNPFNVVGRVYCDTCRAGFETPATTYIPGARVRVECRDRDNLNLLFSVEGVTDATGTY  83

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
            N+ V  +H +  CE  +V+S +EDC +  +G E+A VV T N GV    R+AN + F+K+
Sbjct  84   NIQVAEDHGDQLCEAVLVRSSQEDCGKIESGRERANVVLTRNNGVLSDKRFANNMGFIKD  143

Query  521  KADERCHKVLEEINFSSNEN  580
            +    C ++L++      EN
Sbjct  144  QPLAGCAEILKQYQSEEYEN  163



>gb|ABP58634.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR  F T +SE++ G  +RL CK+ +N  VT++  G T A+G Y
Sbjct  1    PPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLY  60

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K
Sbjct  61   SMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNT-VNGTTRTVNPLGFFK  119

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  120  KEALPKCAQVYNKL  133



>gb|AEW90946.1| pollen-specific protein F8-4 [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AEW90947.1| pollen-specific protein F8-5 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + V+G+VYCDTCR  F+T ++EY+ G  VRL+CK    E V  S +G T   G Y + + 
Sbjct  30   YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKRFGTEKVERSIDGVTDETGTYKIELK  89

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              H  D CE+ +V+SP  +C E     ++A +V + NVG++ +IR ANPL ++K+K    
Sbjct  90   DSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVLSRNVGISDNIRMANPLGYLKDKPLPV  149

Query  536  CHKVLEEINFSSNEN  580
            C  +L+  N +++++
Sbjct  150  CPDLLKTFNPTTDDD  164



>gb|AAQ83588.1| allergen Fra e 1 [Fraxinus excelsior]
Length=146

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR +F T++SE++ G  VRL C++ +N  VT++  G T  +G Y
Sbjct  7    PPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLY  66

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E  + G  K ++    N  VNG+ R  NPL F K
Sbjct  67   SMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNT-VNGTTRTINPLGFFK  125

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  126  KEALPQCAQVYNKL  139



>ref|XP_009366359.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Pyrus x bretschneideri]
Length=162

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V+G+VYCDTCR  F+T  + Y++G  VR++CK+ +   + YS EGET + G YN+ ++
Sbjct  28   FHVQGRVYCDTCRCGFETTATNYISGARVRIECKDRNTLQLAYSVEGETDSTGTYNILIE  87

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  C+  +V SP  DCK    G  +A VV T   GV    RYAN + F K++    
Sbjct  88   EDHEDQICKSVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGFFKDEPLAD  147

Query  536  CHKVLEE  556
            C K+LE+
Sbjct  148  CEKILEQ  154



>ref|XP_002489221.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
 gb|EES20226.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
Length=171

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F VRG+V+CD CR  F+T  S Y+AG  VR+DCK+      T S EG T   G YN+ V 
Sbjct  37   FVVRGRVWCDNCRTGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVA  96

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             EHE++ CE  +V SP + C   + G E+A V  T N GV  +IR AN L F K+ A  R
Sbjct  97   DEHEHELCESILVSSPDKGCSNVVVGRERAPVFLTSNNGVASNIRLANALGFEKDVALPR  156

Query  536  CHKVLE  553
            C ++L+
Sbjct  157  CAQILK  162



>ref|XP_002513885.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF48468.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=159

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V G+VYCDTCR  F+T  + Y+AG  VR++CK+     + YS EG T + G Y + VD
Sbjct  27   FEVEGRVYCDTCRAGFETSKTTYVAGAKVRVECKDRKTMELVYSKEGTTDSTGTYRIHVD  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C+  +V SP+ DC +  +G ++A V+ T N G+  + RYAN + FMK  A   
Sbjct  87   EDHQDQLCDAMLVSSPQHDCMKPSSGRDRARVILTNNNGIVSNKRYANSIGFMKEDAMSG  146

Query  536  CHKVLEE  556
            C ++L +
Sbjct  147  CFELLRQ  153



>ref|XP_003573867.1| PREDICTED: pollen-specific protein C13 [Brachypodium distachyon]
Length=169

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F VRG V+CDTCR  F+T  S Y+AG  VR++CK+      T S EG T   G YN+SV
Sbjct  34   QFVVRGSVWCDTCRAGFETPASTYIAGAKVRVECKSKSTGVKTCSFEGHTDHTGTYNISV  93

Query  353  DREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADE  532
            D EHE++ CE  +V SP   C + +AG E+A V      GV  ++R AN L F K+ A  
Sbjct  94   DDEHEHELCESVLVSSPDRGCAKLVAGRERAPVFLNNKNGVASNVRLANALGFQKDVALA  153

Query  533  RCHKVLE  553
             C ++L+
Sbjct  154  ACAQILK  160



>ref|XP_010103032.1| hypothetical protein L484_005787 [Morus notabilis]
 gb|EXB94630.1| hypothetical protein L484_005787 [Morus notabilis]
Length=166

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 78/134 (58%), Gaps = 3/134 (2%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
              V G+VYCDTCR QF T++S Y+ G  VRL+C+ ++  +VTYS +G T   G Y ++VD
Sbjct  28   LIVEGRVYCDTCRAQFVTKVSNYIKGAKVRLECRESEGGSVTYSNDGVTDESGTYRIAVD  87

Query  356  REHENDTCEVTVVKSPKEDCKETM---AGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             +HE + CEV +VKS   DC E          A V  T N G+   +R ANPL F+K  +
Sbjct  88   GDHEEEVCEVKLVKSSVPDCSEISNDPYNKLNARVSLTSNNGITSPVRQANPLGFLKKNS  147

Query  527  DERCHKVLEEINFS  568
               C +VL E+  +
Sbjct  148  LPECPEVLRELGIT  161



>gb|AFK46977.1| unknown [Lotus japonicus]
Length=168

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 89/142 (63%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTD-NETVTYSAEGETGADGKYNL  346
            ++F + G VYCDTCR QF TR+SE+M+G  V + C+  D    VT+S E  T A+G Y++
Sbjct  25   DRFFIEGTVYCDTCRTQFLTRVSEFMSGATVGVVCRERDAGAKVTFSKEAVTDANGMYSV  84

Query  347  SVDREHENDTCEVTVVKSPKEDCKE--TMAGLEKAT-VVCTENVGVNGSIRYANPLFFMK  517
            +VD +HE++ CEV ++KS + DC E  T + LE+A+ +  T N G+   +R ANPL F+K
Sbjct  85   AVDGDHEDEVCEVKLLKSSRADCSEVDTESHLEQASRISITNNNGIVSPVRTANPLGFLK  144

Query  518  NKADERCHKVLEEINFSSNENM  583
             +    C  +L ++    + ++
Sbjct  145  TERLPECGHILLQLGLHEDGSL  166



>ref|XP_009764546.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Nicotiana sylvestris]
Length=161

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 86/134 (64%), Gaps = 0/134 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V+GK YCDTCR  F+T  ++Y+AG  VR++C++   E  TY+ EG T + G+YN+ V+
Sbjct  27   FLVKGKAYCDTCRCGFETPATKYLAGAKVRIECRHRVIEASTYTVEGVTNSKGEYNILVN  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +  +D C+V +VKSP   C +  AG +++ V+ T N G+  + R+AN + F++++    
Sbjct  87   SDRGDDACDVILVKSPDRTCTKPNAGRDRSRVILTRNNGMISNTRFANAMGFLRDEPLSS  146

Query  536  CHKVLEEINFSSNE  577
            C ++L++   + ++
Sbjct  147  CTQILQQYQLTDDQ  160



>gb|ACG32277.1| pollen-specific protein C13 precursor [Zea mays]
Length=172

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F VRG+V+CD CR  F+T  S Y+AG  VR+DCK+      T S EG T   G YN+ V 
Sbjct  38   FVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVI  97

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             EHE++ CE  +V SP + C   +AG E+A V    N GV  ++R AN L F K+ A  R
Sbjct  98   DEHEHELCESVLVSSPDKGCANVVAGRERAPVFLASNNGVASNVRLANALGFQKDVALPR  157

Query  536  CHKVLE  553
            C ++L+
Sbjct  158  CAQILK  163



>ref|XP_004983223.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=170

 Score =   110 bits (274),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            +  F VRG+V+CDTCR  F+T +S Y+AG  VR++C++      + + EG T   G YN+
Sbjct  33   SASFVVRGRVWCDTCRAGFETPVSTYIAGAKVRVECRSKTTGLKSCTYEGHTDRTGTYNI  92

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V  EHE++ CE  ++ SP   C  T+ G E+A V  T N GV  ++R AN L F K+ A
Sbjct  93   LVTDEHEDELCESVLISSPDMRCATTVPGRERAPVFLTSNNGVASNVRMANALGFQKDVA  152

Query  527  DERCHKVLE  553
              RC +VL+
Sbjct  153  LPRCAQVLK  161



>gb|EAY93952.1| hypothetical protein OsI_15725 [Oryza sativa Indica Group]
Length=165

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A  + V+G+VYCDTCR  F+T ++EY+ G  VRL+CK+   + V  + +G T   G Y +
Sbjct  27   APDYVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKI  86

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             +   HE D CEV +V SP  +C E  A  ++A V+ T NVG+  ++R ANPL ++K+  
Sbjct  87   ELKDSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIP  146

Query  527  DERCHKVLEEINFSSNE  577
               C  +L++ + + ++
Sbjct  147  LPVCGALLKQFDLADDD  163



>emb|CAA73037.1| Ole e 1.0103 protein [Olea europaea]
Length=146

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR  F T +SE++ G  VRL CK+ +N  VT++  G T A+G Y
Sbjct  7    PPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLY  66

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E    G  K ++    +  VNG+ R  NPL F K
Sbjct  67   SMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILST-VNGTTRTVNPLGFYK  125

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  126  KEALPKCAQVYNKL  139



>ref|XP_011080816.1| PREDICTED: major pollen allergen Ole e 1-like [Sesamum indicum]
Length=166

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (61%), Gaps = 4/137 (3%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A   +F V G+VYC+ CR+ F  ++SE M G  V+L+C+  +   +TY+ EG T   G+Y
Sbjct  23   ATTPEFFVVGEVYCEVCRINFINKLSEPMPGAKVKLECRGEETGNITYTQEGVTNEAGQY  82

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKET----MAGLEKATVVCTENVGVNGSIRYANPLF  508
             L V+ +HE + C +T+VKS + DC E      A    + +  T+N G +GS RYANPL 
Sbjct  83   RLKVEGDHEEEECGITLVKSGRADCDEIPNEGWASKPSSLITLTKNNGFHGSSRYANPLG  142

Query  509  FMKNKADERCHKVLEEI  559
            F K KA+  C ++++E+
Sbjct  143  FTKKKANHECAELIKEL  159



>pir||S43242 allergen-like protein Syr v I isoform 1 - Syringa vulgaris
Length=145

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR +F T +SE++ G  +RL CK+ +N  +T++  G T A+G Y
Sbjct  6    PPIPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDRENGKITFTEIGYTRAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+ +H+N+ CE+T++ S +EDC E  + G  K ++    N  VNG+ R  NP+ F K
Sbjct  66   SMLVEGDHKNEFCEITLISSGREDCDEIPVEGWAKPSLKFKLNT-VNGTTRTINPIGFFK  124

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  125  KEALPKCTQVYNKL  138



>sp|Q8LGR0.1|CHE1_CHEAL RecName: Full=Pollen allergen Che a 1; AltName: Allergen=Che 
a 1; Flags: Precursor [Chenopodium album]
 gb|AAL07319.1| Che a 1 allergen precursor [Chenopodium album]
Length=168

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 3/133 (2%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V+G VYCDTCR+QF TRIS  M G  V+L+C+N    T T+ AE  T   G+Y++ V+
Sbjct  30   FKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN  89

Query  356  REHENDTCEVTVVKSPKEDCKET---MAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             + E+D CE+ +VKSP  +C E    +   + A V  T N G    IR AN L FM+ + 
Sbjct  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP  149

Query  527  DERCHKVLEEINF  565
             + C +VL+E++ 
Sbjct  150  LKECPEVLKELDL  162



>dbj|BAJ86956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=169

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F VRG+V+CDTCR  F+T  S ++AG  VR++CK+      T S EG T   G YN+ V
Sbjct  34   QFVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGTYNIPV  93

Query  353  DREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADE  532
            D EHE++ CE  +V SP   C + +AG E+A V    N GV  ++R AN L F K+    
Sbjct  94   DDEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEKDTPLA  153

Query  533  RCHKVLE  553
             C ++L+
Sbjct  154  ACAQILK  160



>gb|ABP58633.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   108 bits (270),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR  F T +SE++ G  VRL C+   N  +T++  G T A+G Y
Sbjct  1    PPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCREKKNGDITFTEVGYTRAEGLY  60

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K
Sbjct  61   SMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNT-VNGTTRTINPLGFYK  119

Query  518  NKADERCHKVLEEIN  562
             +A  +C +V  +++
Sbjct  120  KEALPKCAQVYNKLD  134



>gb|AEK85661.1| major pollen allergen Ole e1 [Olea europaea]
Length=140

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G VYCDTCR  F T +SE++ G  +RL CK+ +N  VT++  G T A+G Y
Sbjct  1    PPVSQFHIQGLVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLY  60

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E    G  K ++    N  +NG+ R  NPL F K
Sbjct  61   SMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNT-LNGTTRTVNPLGFFK  119

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  120  KEALPKCAQVYNKL  133



>gb|ABP58636.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 83/134 (62%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR  F T +SE++ G  VRL C+   N  +T++  G T A+G Y
Sbjct  1    PPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCREKKNGDITFTEVGYTRAEGLY  60

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K
Sbjct  61   SMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNT-VNGTTRTINPLGFYK  119

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  120  KEALPKCAQVYNKL  133



>gb|KHN36879.1| Olee1-like protein [Glycine soja]
Length=165

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 88/142 (62%), Gaps = 5/142 (4%)
 Frame = +2

Query  164  PA-EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            PA +KF V GK+YCD C   F++R+S  + GV V L C  ++N+TVTY  EG+T A+G+Y
Sbjct  26   PALDKFFVEGKIYCDPCHFAFESRLSFPLEGVKVSLQCLRSENDTVTYVKEGKTDANGQY  85

Query  341  NLSVDREHENDTCEVTVVKSPKE-DCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V  +HE++ C + V  SP E  CKE M   +   +V T+N+GV+   RY NPL FM 
Sbjct  86   SIPVHGDHEDEIC-IVVADSPTEGQCKEAMPN-KSDRIVLTKNMGVSSMARYVNPLGFMT  143

Query  518  NKADE-RCHKVLEEINFSSNEN  580
               D  +C+ V++E+     +N
Sbjct  144  QGIDATQCNLVVQELGLDQLDN  165



>ref|XP_008225283.1| PREDICTED: olee1-like protein [Prunus mume]
Length=168

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 91/143 (64%), Gaps = 5/143 (3%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A+  +V G VYCD+CR+QF TRISE + G  V+L+C++ +  T+T S+E ET   G+Y +
Sbjct  26   ADNLSVDGLVYCDSCRIQFMTRISEALQGAKVKLECRDREGGTITLSSETETDEQGRYQI  85

Query  347  SVDREHENDTCEVTVVKSPKEDCKE----TMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             V+ +HE + CEV +VKSP++DC E    + A L  A +  T N G+ G  R  NPL F+
Sbjct  86   PVEGDHEEEVCEVVLVKSPRDDCSEISTDSHAKL-SARISLTNNNGIAGPHRIPNPLGFL  144

Query  515  KNKADERCHKVLEEINFSSNENM  583
            K + D +C +VL+E+  +   ++
Sbjct  145  KKEPDAQCAEVLKELGLTPEGDL  167



>gb|KHG13789.1| Anther-specific LAT52 [Gossypium arboreum]
Length=188

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 91/140 (65%), Gaps = 3/140 (2%)
 Frame = +2

Query  155  HGAPAEK--FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTY-SAEGETG  325
            +GA  E   + V G VYCDTCRV+F+T++SE ++G VV+L+C+N  NE +T+ S+E    
Sbjct  24   YGAAEENMHYMVVGHVYCDTCRVEFETKLSEPISGAVVKLECRNRTNEAITFQSSEIVAD  83

Query  326  ADGKYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPL  505
            + G Y++ V+ ++E   C+V +V+SP+ DC +      K+ VV T   G++  +R+AN L
Sbjct  84   SHGDYHIIVEGDYEESDCDVALVRSPRADCSDPTEAWRKSRVVLTTFDGLSNKLRFANNL  143

Query  506  FFMKNKADERCHKVLEEINF  565
             F K+ A  +C ++L+E+ +
Sbjct  144  GFKKDIALPQCTRILKEMGY  163



>gb|KHG12773.1| Olee1-like protein [Gossypium arboreum]
Length=187

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 86/138 (62%), Gaps = 1/138 (1%)
 Frame = +2

Query  155  HGAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKN-TDNETVTYSAEGETGAD  331
            +GA    + V G VYCDTCRV+F+T++SE + G VV+L+C+N TDN+    S E  T   
Sbjct  24   YGAENMTYIVVGHVYCDTCRVEFETKLSEPIGGAVVKLECRNRTDNQLTFQSQEIVTDEH  83

Query  332  GKYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFF  511
            G Y+++V+ ++E   C+V +V+SP  DC +       + VV T   GV+G +R+AN L F
Sbjct  84   GDYHIAVEGDYEESDCDVALVRSPNPDCNDPSEIWRISRVVLTTLDGVSGELRFANNLGF  143

Query  512  MKNKADERCHKVLEEINF  565
             K  A  +C +VL+EI +
Sbjct  144  KKKVALPQCTQVLQEIGY  161



>ref|XP_009759546.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=172

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 81/134 (60%), Gaps = 3/134 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F V G VYCD CR  F+T +S+ +AG  VRL C++ + E VT +   +T + G Y+L V
Sbjct  29   QFIVEGIVYCDPCRSAFKTNLSQPLAGAGVRLQCRHPETEEVTITIASQTNSTGYYHLLV  88

Query  353  DREHENDTCEVTVVKSPKEDCKET---MAGLEKATVVCTENVGVNGSIRYANPLFFMKNK  523
            + +HEN+ CE  + KSPKEDC E    +   E + V  T N G+ G++R AN LFF+  K
Sbjct  89   EGDHENEICETYLTKSPKEDCSEIPDEVHTKESSRVTLTNNNGMAGNLREANALFFLAKK  148

Query  524  ADERCHKVLEEINF  565
            +   C +  +++ +
Sbjct  149  SSSECAQEFKDMQY  162



>ref|XP_009403224.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            KF ++G+VYCDTCR  F+T +S+Y+ G  V+L C++ + +++ ++A G T   G YN+ V
Sbjct  26   KFVIQGRVYCDTCRAGFETVVSQYIPGAKVKLQCRHYETDSIEHTAVGVTDGTGTYNIEV  85

Query  353  DREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADE  532
            +  HE + CEV++V+SP   C E      +A V+ T   G+   +RYAN L F+K++  +
Sbjct  86   EDNHEEEICEVSLVQSPVPGCSEVSGTRNRARVLVTGRNGLASDVRYANSLGFLKDEPLK  145

Query  533  RCHKVLEE  556
             C  +L++
Sbjct  146  ECGLLLQQ  153



>ref|XP_008234009.1| PREDICTED: pollen-specific protein C13 [Prunus mume]
Length=159

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            FTV GKVYCDTCR  F+T  + Y+ G  VRL+C++     + Y+ EG T + G Y + V 
Sbjct  27   FTVEGKVYCDTCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPVT  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  C+  +V S ++DC     G ++A V+ T   G+    R+AN + FMKN+A   
Sbjct  87   EDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYNGIASYNRFANAMGFMKNEAVPG  146

Query  536  CHKVLEEIN  562
            C ++L+++ 
Sbjct  147  CAQILKQLQ  155



>ref|XP_002307393.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK95954.1| unknown [Populus trichocarpa]
 gb|EEE94389.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 78/125 (62%), Gaps = 0/125 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V+G VYCDTC   F+T  +  +AG  VRL+CK+   + + YS EG T + GKY ++VD
Sbjct  27   FVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITVD  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  C+  +V SP++DC+   AG ++A V+ T + G+  + RYAN + FM  +    
Sbjct  87   EDHEDQICDCMLVSSPRKDCRSPSAGRDRARVILTNDNGLVSTTRYANAMGFMAAQPMSG  146

Query  536  CHKVL  550
            C ++L
Sbjct  147  CTELL  151



>ref|XP_008376286.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008343323.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008353938.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_009369651.1| PREDICTED: pollen-specific protein C13-like [Pyrus x bretschneideri]
Length=159

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            FTV GKVYCDTCR  ++T+   Y+AG  VRL+C++  +  + Y+ EG T + G Y + V 
Sbjct  27   FTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKSSMALVYTKEGTTDSAGCYKIPVA  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H +  C+  +V SP++DC     G E+A V+ T   G+    R+AN + FM+ +A   
Sbjct  87   EDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTGYNGIASYTRFANAMGFMRTEALSG  146

Query  536  CHKVLEEIN  562
            C ++L+E+ 
Sbjct  147  CTQILKELQ  155



>ref|XP_008378536.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=218

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 79/129 (61%), Gaps = 0/129 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            FTV GKVYCDTCR  ++T+   Y+AG  VRL+C++  +  + Y+ EG T + G Y + V 
Sbjct  86   FTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKTSMALLYTKEGTTDSAGCYKIPVA  145

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H +  C+  +V SP++DC     G E+A V+ T N G+    R+AN + FM+ +A   
Sbjct  146  EDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTANNGIASYNRFANAMGFMRTEALSG  205

Query  536  CHKVLEEIN  562
            C ++L+E+ 
Sbjct  206  CTQILKELQ  214



>ref|XP_006366520.1| PREDICTED: olee1-like protein-like [Solanum tuberosum]
Length=162

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            + F V GKVYCDTCR  F+T  S Y+ G  VR++CKN D   + Y+ EG T + G+Y + 
Sbjct  26   DTFLVVGKVYCDTCRCGFETSASMYLPGSRVRIECKNRDTNDLAYTVEGFTNSKGEYKIL  85

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V+ +  ++ C+V +++S    C E   G ++A VV T N G+  + R+AN + F+ N+  
Sbjct  86   VNSDRRDEFCDVVLIRSSDPMCAEPNTGRDRARVVLTSNNGMVSNTRFANSMGFLSNEPL  145

Query  530  ERCHKVLEEINFSSNE  577
              C K+L++  FS ++
Sbjct  146  ASCTKILQQYEFSEDQ  161



>gb|KGN49303.1| hypothetical protein Csa_6G519560 [Cucumis sativus]
Length=168

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCK---NTDNETVTYSAEGETGADGKY  340
            ++F + GKVYCDTCR+QF TR+S+Y+ G  V+L C+   N  NE  T++ EG T  +G Y
Sbjct  27   DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNE--TFTGEGVTDKNGVY  84

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE--TMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             + VD +HE + CEV+V++S  E+C +  T      A V  T N G+   +R ANPL F+
Sbjct  85   KIEVDGDHEEEICEVSVLESADEECSDIPTDGYGHFARVSITGNNGIINPVRQANPLGFL  144

Query  515  KNKADERCHKVLEEINF  565
            K  A  +C +VL E+ F
Sbjct  145  KKDALPQCKEVLRELGF  161



>ref|XP_006472638.1| PREDICTED: pollen-specific protein C13-like [Citrus sinensis]
Length=159

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            + F+V G+VYCDTC+  F+T  + Y+AG  V+++CK+  +  V YS EG+T + G Y + 
Sbjct  25   KPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKIL  84

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +H++  C+  +V SP+ DCK    G E++ V+ T   G++   RYAN + FMK +  
Sbjct  85   VSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPM  144

Query  530  ERCHKVL  550
              C +VL
Sbjct  145  SGCAEVL  151



>gb|AEK85659.1| major pollen allergen Ole e1 [Olea europaea]
Length=140

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR  F T +SE++ G  +RL CK+ +N  VT++  G T A+G Y
Sbjct  1    PPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLY  60

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++   ++DC E    G  K ++    N  +NG+ R  NPL F K
Sbjct  61   SMLVERDHKNEFCEITLISDGRKDCNEIPTEGWVKPSLKFILNT-LNGTTRTVNPLGFFK  119

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  120  KEALPKCAQVYNKL  133



>ref|NP_001235303.1| uncharacterized protein LOC100306199 precursor [Glycine max]
 gb|ACU14266.1| unknown [Glycine max]
Length=165

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 87/142 (61%), Gaps = 5/142 (4%)
 Frame = +2

Query  164  PA-EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            PA +KF V GK+YCD C   F++R+S  + GV V L C  ++N+TVTY  EG+T A+G+Y
Sbjct  26   PALDKFFVEGKIYCDPCHFAFESRLSFPLEGVKVSLQCLRSENDTVTYVKEGKTDANGQY  85

Query  341  NLSVDREHENDTCEVTVVKSPKE-DCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V  +HE + C + V  SP E  CKE M   +   +V T+N+GV+   RY NPL FM 
Sbjct  86   SIPVHGDHEEEIC-IVVADSPTEGQCKEAMPN-KSDRIVLTKNMGVSSMARYVNPLGFMT  143

Query  518  NKADE-RCHKVLEEINFSSNEN  580
               D  +C+ V++E+     +N
Sbjct  144  QGIDATQCNLVVQELGLDQLDN  165



>gb|KDO80906.1| hypothetical protein CISIN_1g031458mg [Citrus sinensis]
Length=159

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            + F+V G+VYCDTC+  F+T  + Y+AG  V+++CK+  +  V YS EG+T + G Y + 
Sbjct  25   KPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKIL  84

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +H++  C+  +V SP+ DCK    G E++ V+ T   G++   RYAN + FMK +  
Sbjct  85   VSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPM  144

Query  530  ERCHKVL  550
              C +VL
Sbjct  145  SGCAEVL  151



>gb|ABC86745.1| pollen-specific protein [Vitis pseudoreticulata]
Length=159

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 81/134 (60%), Gaps = 1/134 (1%)
 Frame = +2

Query  158  GAP-AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADG  334
            G P ++ F ++G+VYCDTCR  F+T  + Y+AG  VR++CK+ ++  + YS EG T + G
Sbjct  20   GRPVSQPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTG  79

Query  335  KYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             Y + V  +HE+  C+  +V SP+ DC     G ++A V+ T   G+    RYAN + F+
Sbjct  80   TYKIMVTEDHEDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRYNGIVSDNRYANSMGFL  139

Query  515  KNKADERCHKVLEE  556
            K+     C ++L++
Sbjct  140  KDHPMSECTQLLQQ  153



>ref|XP_009402012.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            KF + G+VYCDTCR  FQT +S+Y+AG  V+L C+N + + V +  E  T + G Y++ V
Sbjct  26   KFVIEGRVYCDTCRAGFQTAVSQYIAGAKVKLQCRNYETDAVEHLVEAVTDSTGTYHIEV  85

Query  353  DREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNK  523
            +  HE + CEV++++SP+  C E      +A ++ T   G+   IRYAN L F+K++
Sbjct  86   EDSHEEEICEVSLLQSPQPGCTEVAQSRNRARILVTGRSGLASDIRYANSLGFLKDE  142



>ref|XP_006434027.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
 gb|ESR47267.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
Length=159

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            + F+V G+VYCDTC+  F+T  + Y+AG  V+++CK+  +  V YS EG+T + G Y + 
Sbjct  25   KPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKIL  84

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +H++  C+  ++ SP+ DCK    G E++ V+ T   G++   RYAN + FMK +  
Sbjct  85   VSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPM  144

Query  530  ERCHKVL  550
              C +VL
Sbjct  145  SGCAEVL  151



>ref|XP_008782123.1| PREDICTED: pollen-specific protein C13-like [Phoenix dactylifera]
Length=175

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A  ++F V+G+V+CDTCR  F+T  + Y+AG  VR++C++      T S +G T   G Y
Sbjct  36   AANQRFVVQGRVFCDTCRAGFETPKTTYIAGAKVRVECRSRTTGAKTCSFDGTTDGSGAY  95

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
            N+ V  EHE++TCE  +V SP + C + + G E+A V  T N G+  S R+AN L F K+
Sbjct  96   NILVADEHEHETCEAMLVSSPVKGCDKMLEGRERARVFLTHNNGIASSKRFANSLGFQKD  155

Query  521  KADERCHKVLEEINFSSNE  577
                 C ++LE  +   NE
Sbjct  156  IPLAGCAQLLEMYHQYENE  174



>pir||S43244 allergen-like protein Syr v I isoform 3 - Syringa vulgaris
Length=145

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR +F T +SE++ G  +RL CK+ +N  +T++  G T A+G Y
Sbjct  6    PPVPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDGENGKITFTEIGYTRAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+ +H+N+ CE+T++ S ++DC E  + G  K ++    N  VNG+ R  NP+ F K
Sbjct  66   SMLVEGDHKNEFCEITLISSGRKDCDEIPVEGWVKPSLKFKLNT-VNGTTRTINPIGFFK  124

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  125  KEALPKCTQVYNKL  138



>ref|XP_004134662.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172168.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
Length=168

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCK---NTDNETVTYSAEGETGADGKY  340
            ++F + GKVYCDTCR+QF TR+S+Y+ G  V+L C+   N  NE  T++ EG T  +G Y
Sbjct  27   DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNE--TFTGEGVTDKNGVY  84

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE--TMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             + VD +HE + CEV++++S  E+C +  T      A V  T N G+   +R ANPL F+
Sbjct  85   KIEVDGDHEEEICEVSLLESADEECSDIPTDGYGHFARVSITGNNGIINPVRQANPLGFL  144

Query  515  KNKADERCHKVLEEINF  565
            K  A  +C +VL E+ F
Sbjct  145  KKDALPQCKEVLRELGF  161



>gb|AEW90948.1| pollen-specific protein F8-6 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 82/135 (61%), Gaps = 0/135 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + V+G+VYCDTCR  F+T ++EY+ G  VRL+CK    E V  S +G T   G Y + + 
Sbjct  30   YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKRFGTEKVECSIDGVTDETGTYKIELK  89

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              H  D CE+ +V+SP  +C E     ++A +V +  VG++ +IR ANPL ++K+K    
Sbjct  90   DSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVLSRYVGISDNIRMANPLGYLKDKPLPV  149

Query  536  CHKVLEEINFSSNEN  580
            C  +L+  N +++++
Sbjct  150  CPDLLKTFNPTTDDD  164



>ref|XP_007206364.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
 gb|EMJ07563.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
Length=160

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 80/135 (59%), Gaps = 1/135 (1%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F ++G+VYCDTCR  F+T  + Y+ G  VR++CK  +   + YS EGET A G YN+ V+
Sbjct  26   FHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNILVE  85

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  CE  +V SP  DCK    G ++A VV T   GV     YAN + F K++    
Sbjct  86   DDHEDQICESVLVSSPVNDCKSADPGRKRANVVVTRYNGVVKDKHYANNMGFFKDQPLAG  145

Query  536  CHKVLEE-INFSSNE  577
            C ++L++ +N+   E
Sbjct  146  CEELLKQYLNYDQPE  160



>emb|CAA78897.1| pollen specific gene [Oryza sativa Indica Group]
Length=164

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 85/140 (61%), Gaps = 5/140 (4%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A  + V+G+VYCDTCR +F+T ++EY+ G  VRL+CK+   + V  + +G T   G Y +
Sbjct  27   APDYVVQGRVYCDTCRAEFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKI  86

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             +   HE D CEV +V SP  +C E  A  ++A V+ T NVG+  ++R ANPL ++K   
Sbjct  87   ELKDSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLK---  143

Query  527  DERCHK--VLEEINFSSNEN  580
            D  C    +L++ + + ++N
Sbjct  144  DYHCPSAALLKQFDLADDDN  163



>gb|EPS70684.1| hypothetical protein M569_04073 [Genlisea aurea]
Length=170

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 82/138 (59%), Gaps = 4/138 (3%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F V+G+V+C+ CR  F  R+SE M G  VRL+C+  +   +T+  EG T A G Y L  
Sbjct  30   EFFVQGQVFCEVCRTNFINRLSEPMEGATVRLECRGDNVGNITFGIEGVTDAGGNYKLKA  89

Query  353  DREHENDTCEVTVVKSPKEDCKET----MAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
              +HE++ C+VT+VKS + DC+ET     A    + +  T+N G +  IR+ANPL F K 
Sbjct  90   TGDHEDEDCQVTLVKSSRLDCQETPSEGWAMQPSSKITITKNNGFHDDIRHANPLGFTKK  149

Query  521  KADERCHKVLEEINFSSN  574
            + D  C ++ +E+  + +
Sbjct  150  ERDPACQELFKELQINPD  167



>gb|AAV74343.1| Fra e 1.0102 major allergen [Fraxinus excelsior]
Length=145

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P   F V+G+VYCDTCR  F T +SE++ G  VRL CK  +N  VT++  G T A+G Y
Sbjct  6    PPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTRAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ ++R+H+N+ CE+ ++ S ++DC E    G  K ++    N  VNG+ R  NPL F K
Sbjct  66   SMVIERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNT-VNGTTRTINPLGFFK  124

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  125  KEALPKCPQVYNKL  138



>pir||S43243 allergen-like protein Syr v I isoform 2 - Syringa vulgaris
Length=145

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 86/134 (64%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR +F T +SE++ G  +RL CK+ ++  +T++  G T A+G Y
Sbjct  6    PPVPQFHIQGQVYCDTCRARFITELSEFIPGAGIRLQCKDGEHGKITFTEIGYTRAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+ +H+N+ CE+T++ S ++DC+E  + G  K ++    N  VNG+ R  NPL F K
Sbjct  66   SMLVEGDHKNEFCEITLLSSSRKDCEEIPIEGWVKPSLKFILNT-VNGTTRTINPLGFFK  124

Query  518  NKADERCHKVLEEI  559
             +   +C +V  ++
Sbjct  125  KEVLPKCPQVFNKL  138



>pir||E53806 major allergen OLE17 - common olive (fragment)
Length=136

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G+VYCDTC  +F T +SE++ G  VRL C+  +N  +T++  G T A+G Y++ V
Sbjct  1    QFHIQGQVYCDTCHARFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSMLV  60

Query  353  DREHENDTCEVTVVKSPKEDCKET-MAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            +R+H+N+ CE+T++ S ++DC E  + G  K ++    N  VNG+ R  NPL F K +A 
Sbjct  61   ERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEAL  119

Query  530  ERCHKVLEEI  559
             +C +V  ++
Sbjct  120  PKCAQVYNKL  129



>ref|XP_009760524.1| PREDICTED: pollen-specific protein C13-like [Nicotiana sylvestris]
Length=158

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 85/140 (61%), Gaps = 0/140 (0%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
             A    F V+GK YCDTCR  F+T  ++Y+AG  V+++C+N     +TY+  G T + G+
Sbjct  18   AAATSPFLVKGKCYCDTCRCGFETEATKYLAGSKVKIECRNRVTNEITYTIGGVTNSQGE  77

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            YN+ VDR+  +D C+V +V+S  + C +   G ++A V+ T N G+   +RYAN + F+ 
Sbjct  78   YNILVDRDCGDDVCDVVLVESSDKRCGKPNGGRDRARVILTRNNGMISDVRYANNMGFLS  137

Query  518  NKADERCHKVLEEINFSSNE  577
            ++    C ++L++   + ++
Sbjct  138  DEPLSACTRILQQYQLTEDQ  157



>gb|AAX93750.1| pollen allergen Cro s 1 [Crocus sativus]
Length=168

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 80/138 (58%), Gaps = 3/138 (2%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A    F V+G VYCDTCR+QF TR+S  M G  V+L+C+N    T T+ AE  T   G+Y
Sbjct  25   AAENHFKVQGMVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQY  84

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKET---MAGLEKATVVCTENVGVNGSIRYANPLFF  511
            ++ V  + ++D CE+ +VKSP  +C E    +   + A V  T N G    IR AN L F
Sbjct  85   SIPVHGDFQDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGF  144

Query  512  MKNKADERCHKVLEEINF  565
            M+ +  + C +VL+E++ 
Sbjct  145  MRKEPLKECPEVLKELDL  162



>gb|AEK85660.1| major pollen allergen Ole e1 [Olea europaea]
Length=140

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  ++ ++G+VYCDTCR  F T +SE++ G  +RL CK+ ++  VT++  G T A+G Y
Sbjct  1    PPVSQYHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKEDGDVTFTEVGYTRAEGLY  60

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T++ S ++DC E    G  K ++    N  +NG+ R  NPL F K
Sbjct  61   SMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNT-LNGTTRTVNPLGFFK  119

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  120  KEALPKCAQVYNKL  133



>gb|AAM08621.1|AC107314_12 Putative Pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAN31783.1| Putataive pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAP53386.1| Pollen proteins Ole e I family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAY78230.1| hypothetical protein OsI_33275 [Oryza sativa Indica Group]
 gb|EAZ15857.1| hypothetical protein OsJ_31276 [Oryza sativa Japonica Group]
Length=172

 Score =   107 bits (266),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F VRG+V+CDTC   F+T  S Y+AG  V+++C++      T S EG+T   G YN+ V+
Sbjct  38   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  97

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             EHE++ CE  +V SP   C + +AG E+A V  T N GV  ++R AN L F K+     
Sbjct  98   DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  157

Query  536  CHKVLE  553
            C ++L+
Sbjct  158  CAQILK  163



>ref|XP_004134927.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172170.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN49302.1| hypothetical protein Csa_6G519550 [Cucumis sativus]
Length=168

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCK---NTDNETVTYSAEGETGADGKY  340
            ++F + GKVYCDTCR+QF TR+S+Y+ G  V+L C+   N  NE  T++ EG T  +G Y
Sbjct  27   DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNE--TFTGEGVTDKNGVY  84

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE--TMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             + VD +HE + CEV++++S    C E  T      A V  T N G+   +R ANPL FM
Sbjct  85   KIEVDGDHEEEICEVSLLESADTGCGEIPTDGYGHFARVSITGNNGIINPVRQANPLGFM  144

Query  515  KNKADERCHKVLEEINF  565
            K  A  +C +VL E+ F
Sbjct  145  KKDALPQCKEVLRELGF  161



>ref|XP_010911793.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=175

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 80/134 (60%), Gaps = 0/134 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V+G+V+CDTCR  F+T  S Y+AG  VRL+C++      T S +G T   G YN+ V 
Sbjct  41   FVVQGRVFCDTCRAGFETPKSTYIAGAKVRLECRSRTTGAKTCSFDGVTDRSGTYNILVA  100

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             EHE++TCE  +V SP + C +T+ G E+A V  T N G+  + R+AN L F ++ A   
Sbjct  101  DEHEHETCEAVLVSSPVKGCAKTLEGRERARVFLTNNNGIASTKRFANSLGFQRDIALAG  160

Query  536  CHKVLEEINFSSNE  577
            C ++L+      NE
Sbjct  161  CAQLLKMYQQYENE  174



>gb|KDP32694.1| hypothetical protein JCGZ_11986 [Jatropha curcas]
Length=159

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V G+VYCDTCR  F+T  + Y+AG  VRL+CK+  +  + YS EG T + G Y + VD
Sbjct  27   FEVEGRVYCDTCRAGFETPKTTYIAGAKVRLECKDRKSMELVYSKEGTTDSTGTYKIYVD  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H +  C+  +V SPK+DC+   +G ++A V+ T   G+  + R+AN + F K+  +  
Sbjct  87   DDHADQLCDAVLVSSPKKDCRSPSSGRDRARVILTSYNGIASNKRFANAIGFEKDDIESG  146

Query  536  CHKVLEE  556
            C ++L +
Sbjct  147  CTELLRQ  153



>ref|XP_011075627.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 75/132 (57%), Gaps = 1/132 (1%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A KF V GKVYC+ CR  F  R S+ MAG  V+L+CKN   E VTY+ EGET   G Y L
Sbjct  25   APKFVVDGKVYCEVCRANFTNRYSKPMAGAKVKLECKNEVTEKVTYTLEGETNDKGVYTL  84

Query  347  SVDREH-ENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNK  523
            + + +H   D C VT+VKS   DC E       A V  T N G +   R+ANPL F + +
Sbjct  85   TAEGDHGSEDLCAVTLVKSSMADCAEIPDEKPAAEVTLTLNNGFHDEFRHANPLAFTRKE  144

Query  524  ADERCHKVLEEI  559
            A   C ++ +E+
Sbjct  145  ALPECAELFKEL  156



>ref|XP_011097595.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            +   + G VYCDTCR  ++T  ++Y+AG VVR++C+  D+  +TY+ E  T + G Y + 
Sbjct  25   DPLLLTGCVYCDTCRCGYETSATKYLAGAVVRVECRKRDSSELTYTKEAVTDSTGHYKIL  84

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V+ +  +D C+  +VKSP  +C    AG ++A V+ T N G+N + R+AN L F+KN   
Sbjct  85   VETDRGDDYCDSVLVKSPDPECSIPNAGRDRARVILTRNNGMNSNARFANALGFLKNTPL  144

Query  530  ERCHKVLEE  556
              C +VL++
Sbjct  145  ASCPQVLQQ  153



>ref|XP_010269200.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=159

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            FTV GKVYCD CR  F+T  + Y+ G  VR++C++ D   + +S +G T + G Y + V 
Sbjct  27   FTVFGKVYCDNCRAGFETSATTYIPGAKVRVECRDRDTLNLLFSVDGVTDSTGSYKIQVA  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  CE  +V SP+ DC     G E+A V+ T   G+    RYAN L F+K++    
Sbjct  87   EDHEDQLCESVLVSSPQNDCSAVEPGRERARVILTRGNGIASDNRYANSLGFIKDQPLPG  146

Query  536  CHKVLEE  556
            C +++++
Sbjct  147  CAEIMKQ  153



>ref|NP_001064462.2| Os10g0371000 [Oryza sativa Japonica Group]
 dbj|BAF26376.2| Os10g0371000, partial [Oryza sativa Japonica Group]
Length=196

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F VRG+V+CDTC   F+T  S Y+AG  V+++C++      T S EG+T   G YN+ V+
Sbjct  62   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  121

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             EHE++ CE  +V SP   C + +AG E+A V  T N GV  ++R AN L F K+     
Sbjct  122  DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  181

Query  536  CHKVLE  553
            C ++L+
Sbjct  182  CAQILK  187



>ref|XP_011075462.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 74/132 (56%), Gaps = 1/132 (1%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            A KF V GKVYC+ CR  F  R SE M G  V+L+CKN   E VTY+ EGET   G Y L
Sbjct  25   APKFVVDGKVYCEVCRANFTNRYSEPMPGAKVKLECKNEVTEKVTYTLEGETNDKGVYTL  84

Query  347  SVDREH-ENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNK  523
            + + +H   D C VT+VKS   DC E       A V  T N G +   R+ANPL F + +
Sbjct  85   TAEGDHGSEDLCAVTLVKSSMADCAEIPDEKPAAEVTLTLNNGFHDEFRHANPLAFTRKE  144

Query  524  ADERCHKVLEEI  559
            A   C ++ +E+
Sbjct  145  ALPECAELFKEL  156



>ref|XP_011006159.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011016058.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
Length=159

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V+G VYCDTC   F+T  +  +AG  VRL+CK+   + + YS EG T + GKY ++VD
Sbjct  27   FVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITVD  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C+  +V SP++DC+   AG ++A V+ T N G+  + RY N + FM       
Sbjct  87   EDHKDQICDCMLVSSPRKDCRSPSAGRDRARVILTNNNGLVSTTRYVNAMGFMAAHPMSG  146

Query  536  CHKVLE  553
            C ++L 
Sbjct  147  CTELLR  152



>ref|XP_004489034.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=166

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 77/132 (58%), Gaps = 1/132 (1%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            E F+V GK+YCD C  +F++R+S+ + GV V L C+  D+  VTY  E  T  +G Y ++
Sbjct  31   EIFSVVGKIYCDPCHFEFESRLSQPLEGVKVTLKCRKGDSNNVTYVKESRTDINGVYKIN  90

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            VD +HE + CEV    + K  C + MA  +   +V T+N+GV+  +R+ NPL FM    D
Sbjct  91   VDGDHEEEVCEVNADATGKGACSQVMAN-KSDRIVLTKNMGVSSLVRFVNPLGFMTQAID  149

Query  530  ERCHKVLEEINF  565
             +C  V  E+  
Sbjct  150  SQCGNVFSELGL  161



>gb|EMS52933.1| hypothetical protein TRIUR3_31283 [Triticum urartu]
Length=169

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F VRG+V+CDTCR  F+T  S ++AG  VR++CK+      T S EG T   G YN+ V
Sbjct  34   QFVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGTYNIPV  93

Query  353  DREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADE  532
              EHE++ CE  +V SP   C + +AG E+A V    N GV  ++R AN L F K+    
Sbjct  94   ADEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEKDTPLA  153

Query  533  RCHKVLE  553
             C ++L+
Sbjct  154  ACAQILK  160



>ref|XP_007153183.1| hypothetical protein PHAVU_003G013900g [Phaseolus vulgaris]
 gb|ESW25177.1| hypothetical protein PHAVU_003G013900g [Phaseolus vulgaris]
Length=162

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            EKF V GK+YCD C   F++R+S  ++GV V L C   +N TVTY     + A+G YN+ 
Sbjct  27   EKFFVEGKIYCDPCHFAFESRLSFPLSGVNVSLQCIQEENNTVTYLKNSTSDANGMYNIP  86

Query  350  VDREHENDTCEVTVVKSPKE-DCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
            V  +HE+D C V V  SP E  CKE M   +   ++ T+N+G     RY NPL FM    
Sbjct  87   VLGDHEDDIC-VVVADSPNEGQCKEAMPN-KSDRIILTDNMGAASLARYVNPLGFMTQTI  144

Query  527  DERCHKVLEEI  559
            D +C+ V+ E+
Sbjct  145  DSQCNAVVHEL  155



>gb|ADK22842.1| Sal k 5, partial [Salsola kali]
Length=151

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 76/133 (57%), Gaps = 3/133 (2%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + V+G VYCDTCR+QF TR+S  M G  V L C+N    T T+ AE  T   G Y + VD
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD  68

Query  356  REHENDTCEVTVVKSPKEDCKETMAGL---EKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             +HE+D C++ +VKSP ++C E    +   + A V  T N G    +R AN L F+K   
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP  128

Query  527  DERCHKVLEEINF  565
               C +VL+E++ 
Sbjct  129  LPECPEVLKELDM  141



>gb|AAQ08947.1| allergen Fra e 1.0101 [Fraxinus excelsior]
Length=145

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P   F V+G+VYCDTCR  F T +SE++ G  VRL CK+ +N  VT++  G T A+G Y
Sbjct  6    PPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLY  65

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ ++R+H+N+ CE+ ++ S ++DC E    G  K ++    N  VNG+ R  NPL F K
Sbjct  66   SMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNT-VNGTTRTINPLGFFK  124

Query  518  NKADERCHKVLEEI  559
             +   +C +V  ++
Sbjct  125  KEVLPKCPQVYNKL  138



>ref|XP_009622218.1| PREDICTED: pollen-specific protein C13-like [Nicotiana tomentosiformis]
Length=158

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
             A    F V+GK YCDTCR  F+T  ++Y+AG  V+++C++     +TY+ +G T + G+
Sbjct  18   AAATSPFLVKGKCYCDTCRCGFETEATKYLAGSKVKIECRHRVTNEITYTIDGVTNSQGE  77

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            YN+ V+R+  +D C+V +V+S  + C +   G ++A V+ T N G++  +RYAN + F+ 
Sbjct  78   YNILVNRDCGDDVCDVVLVESSDKRCGKPNGGRDRARVILTRNNGMSSDVRYANNMGFLS  137

Query  518  NKADERCHKVLEEINFSSNE  577
            ++  + C ++L++   + ++
Sbjct  138  DEPLKSCTQILQQYQLTEDQ  157



>pir||G53806 major allergen OLE26 - common olive (fragment)
Length=136

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 81/130 (62%), Gaps = 2/130 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G+VYCDTCR  F T +SE++ G  VRL CK   N  +T++  G T A+G Y++ V
Sbjct  1    QFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLV  60

Query  353  DREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            +R+H+N+ CE+T++ S  +DC E    G  K ++    N  VNG+ R  NPL F K +A 
Sbjct  61   ERDHKNEFCEITLISSGSKDCNEIPTEGWGKPSLKFILNT-VNGTTRTVNPLGFYKKEAL  119

Query  530  ERCHKVLEEI  559
             +C +V  ++
Sbjct  120  PKCAQVYNKL  129



>ref|XP_010942360.1| PREDICTED: pollen allergen Phl p 11-like [Elaeis guineensis]
Length=174

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            FT+ G+VYCDTCR  F+T ++ YM G  VRL+C     + +TY AE  T   G Y ++V 
Sbjct  40   FTLEGRVYCDTCRTGFETDLTTYMPGAKVRLECMRYGTDELTYKAEATTDFLGIYQMTVP  99

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H ND C V +VKS  ++C E   G ++  +   ++ G+  +IR AN L ++ +K    
Sbjct  100  DDHSNDQCSVVLVKSSLDNCTEIEPGRDRVRITLAQDGGLLSNIRQANALGYLIDKPLLE  159

Query  536  CHKVLEEINFSSNEN  580
            C K+L++  F+++++
Sbjct  160  CGKLLQKYGFANDDD  174



>ref|XP_009600627.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana tomentosiformis]
Length=162

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 83/138 (60%), Gaps = 0/138 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            + F V GKVYCDTCR  F+T  S+Y+AG  VR++CKN D   ++Y+ EG T + G+Y + 
Sbjct  25   DTFLVVGKVYCDTCRCGFETSASKYLAGSRVRIECKNRDTNDISYTIEGVTNSKGEYKIL  84

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +  ++ C+V +++S    C    AG ++A VV T N G+  + R+AN + F+ N+  
Sbjct  85   VYSDRGDEVCDVVLIRSSDPMCAVPNAGRDRARVVLTRNNGMVSNTRFANSIGFLSNEPL  144

Query  530  ERCHKVLEEINFSSNENM  583
              C+++L++   +  +  
Sbjct  145  ASCNQILQQYQLTDQDQF  162



>ref|XP_004289324.1| PREDICTED: pollen-specific protein C13-like [Fragaria vesca subsp. 
vesca]
Length=163

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 82/138 (59%), Gaps = 1/138 (1%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
             + F V+G+VYCDTCR  F+T  + Y+AG  V + C N ++ ++ YS EG T   G YN+
Sbjct  26   GKPFHVQGRVYCDTCRCGFETSATIYIAGATVGIKCMNRNSMSLAYSVEGVTDETGTYNI  85

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V+ +HE+  CE  +V SP  DCK    G  +A VV T   GV  + R+AN + F K++A
Sbjct  86   LVEDDHEDQICESVLVSSPISDCKSADPGRSRANVVLTRFNGVVKTKRFANNMGFFKDQA  145

Query  527  DERCHKVLEE-INFSSNE  577
               C ++L++ +N+   E
Sbjct  146  LPECTELLKQYLNYDQPE  163



>ref|XP_002268073.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CBI33037.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 81/132 (61%), Gaps = 1/132 (1%)
 Frame = +2

Query  164  PAEK-FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            P  K F + G+VYCDTCR  F+T  + Y+AG  VR++CK+ ++  + YS EG T + G Y
Sbjct  22   PMRKPFVLHGRVYCDTCRAGFETSATTYIAGARVRIECKDRNSLQLVYSVEGVTDSTGTY  81

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
              S+  +H +  C+  +VKSP+ DC +  AG +++ +  T + G+    R+AN + FMK+
Sbjct  82   KFSIADDHGDQMCDAVLVKSPQPDCAKVDAGRDRSRLSLTRSNGLVSDTRFANAMGFMKD  141

Query  521  KADERCHKVLEE  556
            +    C ++L++
Sbjct  142  EPASGCTQLLKQ  153



>ref|XP_010321468.1| PREDICTED: LOW QUALITY PROTEIN: major pollen allergen Lol p 11-like 
[Solanum lycopersicum]
Length=162

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            + F V GKVYCDTCR  ++T  S+Y+ G  VR++CKN D   + Y+ EG T + G+Y + 
Sbjct  26   DTFLVIGKVYCDTCRCGYETSASKYLPGSRVRIECKNRDTNDLAYTVEGVTNSKGEYKIL  85

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V+ +  ++ C+V +++S    C E   G ++  VV T N G+  + R+AN L F+ N+  
Sbjct  86   VNSDRRDEFCDVVLIRSSDPMCAEPNTGRDRTRVVLTSNNGMVSNTRFANSLGFLYNEPL  145

Query  530  ERCHKVLEEINFSSNE  577
              C K+L++  FS ++
Sbjct  146  ASCTKILKQYEFSEDQ  161



>ref|XP_007225977.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
 gb|EMJ27176.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
Length=159

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 76/129 (59%), Gaps = 0/129 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            FTV GKV+CD CR  F+T  + Y+ G  VRL+C++     + Y+ EG T + G Y + V 
Sbjct  27   FTVEGKVFCDPCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPVT  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  C+  +V S ++DC     G ++A V+ T   G+    R+AN + FMKN+A   
Sbjct  87   EDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYNGIASYNRFANAMGFMKNEAVSG  146

Query  536  CHKVLEEIN  562
            C ++L+++ 
Sbjct  147  CAQILKQLQ  155



>ref|XP_011016068.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011027685.1| PREDICTED: pollen-specific protein C13 isoform X1 [Populus euphratica]
 ref|XP_011027686.1| PREDICTED: pollen-specific protein C13 isoform X2 [Populus euphratica]
Length=159

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 78/126 (62%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F+V+G+VYCDTC   F+T  + Y+AG  V+++C++   + + YS EG T + G Y ++VD
Sbjct  27   FSVQGRVYCDTCHAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGTYIITVD  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C+  +V SP++DC    AG E+A V+ T   G+  + RYAN + FM  +    
Sbjct  87   EDHKDQICDAMLVSSPRQDCSSPSAGRERARVILTNYNGLVSTTRYANSMGFMAAQPMSG  146

Query  536  CHKVLE  553
            C ++L 
Sbjct  147  CTELLR  152



>ref|XP_009608960.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=172

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 78/134 (58%), Gaps = 3/134 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F V G VYCD CR  F+T +S+ +AG  VRL C++ + E VT +   ET   G Y+L V
Sbjct  29   QFIVEGIVYCDPCRSAFKTNLSQPLAGAGVRLQCRHPETEEVTITIASETNTTGYYHLLV  88

Query  353  DREHENDTCEVTVVKSPKEDCKET---MAGLEKATVVCTENVGVNGSIRYANPLFFMKNK  523
            + +HEN+ CE  + KS KEDC E    +   E + V  T N G+ G++R AN LFF+   
Sbjct  89   EGDHENEICETYLTKSSKEDCSEIPDEVHTKESSRVTLTNNNGIAGNLREANALFFLAKN  148

Query  524  ADERCHKVLEEINF  565
            A   C +  +++ +
Sbjct  149  ASSECAQEFKDMQY  162



>pir||H53806 major allergen OLE6 - common olive (fragment)
Length=136

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G+VYCDTCR +F T +SE++ G  VRL+CK+    ++T++  G T A+G Y++ +
Sbjct  1    QFHIQGQVYCDTCRARFITELSEFIPGAGVRLECKDGGKGSITFTEVGYTRAEGLYSMLI  60

Query  353  DREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            +R+H+N+ CE+T+  S ++DC E  + G  K ++    N  VNG+ R  NPL F K +  
Sbjct  61   ERDHKNEFCEITLASSSRKDCDEIPVEGWVKPSLKFKLNT-VNGTTRTINPLGFFKKEVL  119

Query  530  ERCHKVLEEI  559
             +C +V  ++
Sbjct  120  PKCPQVFNKL  129



>ref|XP_002273294.1| PREDICTED: olee1-like protein [Vitis vinifera]
 emb|CBI30683.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 85/132 (64%), Gaps = 3/132 (2%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V+G+VYCDTCR+QF TR+SEY+ G  VRL+C++ +  +VTYS +GET   G Y L V+
Sbjct  30   FFVKGQVYCDTCRIQFITRVSEYVPGAKVRLECRDREGGSVTYSIDGETDETGSYRLPVE  89

Query  356  REHENDTCEVTVVKSPKEDCKETMAGL---EKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             EHE + CEV ++KS K +C E   G+     A +    N G+  S R ANPL F+K ++
Sbjct  90   GEHEEEVCEVQLIKSSKPECSEISRGVFARRSARISLASNNGMASSDRLANPLGFLKQES  149

Query  527  DERCHKVLEEIN  562
               C +VL+E+ 
Sbjct  150  LSECPEVLKELG  161



>gb|AAN18042.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAN18043.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAN18044.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 80/125 (64%), Gaps = 2/125 (2%)
 Frame = +2

Query  188  GKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHE  367
            G+VYCDTCR  F T +SE++ G  VRL CK+ +N  +T++  G T A+G Y++ V+R+H+
Sbjct  2    GQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHK  61

Query  368  NDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHK  544
            N+ CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +
Sbjct  62   NEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQ  120

Query  545  VLEEI  559
            V  ++
Sbjct  121  VYNKL  125



>pir||I53806 major allergen OLE16 - common olive (fragment)
Length=137

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G+VYCDTCR +F T +SE++ G  VRL+C++ +  ++T++  G T A+G Y++ +
Sbjct  2    QFHIQGQVYCDTCRARFITELSEFIPGAGVRLECRDGEKGSITFTEVGYTRAEGLYSMLI  61

Query  353  DREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            +R+H+N+ CE+T+  S ++DC E  + G  K ++    N  VNG+ R  NPL F K +  
Sbjct  62   ERDHKNEFCEITLASSSRKDCDEIPVEGWVKPSLKFKLNT-VNGTTRTINPLGFFKKEVL  120

Query  530  ERCHKVLEEI  559
             +C +V  ++
Sbjct  121  PKCPQVFNKL  130



>ref|XP_003634471.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CAN61642.1| hypothetical protein VITISV_029644 [Vitis vinifera]
 emb|CBI19132.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = +2

Query  158  GAP-AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADG  334
            G P ++ F ++G+VYCDTCR  F+T  + Y+AG  VR++CK+ ++  + YS EG T + G
Sbjct  20   GRPVSQPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTG  79

Query  335  KYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             Y + V  + E+  C+  +V SP+ DC     G ++A V+ T   G+    RYAN + F+
Sbjct  80   TYKIMVTEDREDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRYNGIVSDNRYANSMGFL  139

Query  515  KNKADERCHKVLEE  556
            K+     C ++L++
Sbjct  140  KDHPMSECTQLLQQ  153



>ref|XP_006661725.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=175

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F VRG+V+CDTC   F+T  S Y+AG  V+++C++      T S EGET   G YN++VD
Sbjct  40   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGETDHTGTYNIAVD  99

Query  356  REHENDTCEVTVVKSP-KEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADE  532
             EHE++ CE  +V SP    C + +AG E+A V  T N GV  ++R AN L F K+    
Sbjct  100  DEHEHELCESVLVSSPDAARCGKAVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLA  159

Query  533  RCHKVLE  553
             C ++++
Sbjct  160  ACAQIMK  166



>pir||F53806 major allergen OLE19 - common olive (fragment)
Length=136

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G+VYCDTCR  F   +SE++ G  VRL C+   N  +T++  G T A+G Y++ V
Sbjct  1    QFHIQGQVYCDTCRAGFINELSEFIPGASVRLQCREKKNGDITFTEVGYTRAEGLYSMLV  60

Query  353  DREHENDTCEVTVVKSPKEDCKET-MAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            +R+H+N+ CE+T++ S ++DC E  + G  K ++    N  VNG+ R  NPL F K +A 
Sbjct  61   ERDHKNEFCEITLISSGRKDCNEIPIEGWAKPSLKFILNT-VNGTTRTINPLGFYKKEAL  119

Query  530  ERCHKVLEEI  559
             +C +V  ++
Sbjct  120  PKCAQVYNKL  129



>ref|XP_008775180.1| PREDICTED: pollen-specific protein C13-like [Phoenix dactylifera]
Length=168

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 87/143 (61%), Gaps = 4/143 (3%)
 Frame = +2

Query  164  PAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTY-SAEGETGADGKY  340
            P   F VRG+VYCDTCR  F    +EY+ G  VRL+CK+  +  + + S E  T  +G Y
Sbjct  26   PTPTFHVRGRVYCDTCRAGFVHEYTEYLEGAKVRLECKHYGSGEIAHRSEEAVTDGNGNY  85

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA--GLEKATVVCTENVGVNGSIRYANPLFFM  514
             + +  +H+ +TCEV +V+SP++DCKE  A  G+ +A V+ T N G++   R ANP+ F+
Sbjct  86   VIDITDDHQEETCEVVLVESPRDDCKEIPADHGI-RARVMLTSNNGISSEWREANPIGFL  144

Query  515  KNKADERCHKVLEEINFSSNENM  583
            ++    +C  +L+     +++++
Sbjct  145  RDAPLPKCGAMLQRYALFTDDDL  167



>ref|XP_004237415.1| PREDICTED: pollen-specific protein C13 [Solanum lycopersicum]
Length=159

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 84/137 (61%), Gaps = 0/137 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
            +  F V+GK YCDTCR  F+T  ++Y+AG  V+++CKN     +TY+ +G T + G+YN+
Sbjct  22   SNPFLVKGKCYCDTCRCGFETPATKYLAGSKVKVECKNRVTNKITYTIDGVTNSQGEYNI  81

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V R+  +D C+V +V+S  + C    AG ++A V  T N G+   +R+AN + F+ N+ 
Sbjct  82   LVKRDCGDDVCDVVLVESGDKSCNIPNAGRDRARVALTRNNGMTSDVRFANNMGFLSNEP  141

Query  527  DERCHKVLEEINFSSNE  577
               C ++L++   + ++
Sbjct  142  LAACTQILQQYQLTEDQ  158



>ref|XP_009421183.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F ++G+VYCD CR  F+T  ++Y+ G  V+L+C+  D   V  +A   T A G Y L V+
Sbjct  27   FRIQGRVYCDKCRAGFETSATDYIEGAKVKLECRQYDTGVVEQTATAVTDASGTYTLEVE  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              HE + CEV +V+SP+  C E M G ++A V+ +   G+  S+RYAN L F+       
Sbjct  87   DNHEEEICEVVLVESPRPGCSEIMTGRDRARVLISAESGLTTSVRYANSLGFLNAAPLPE  146

Query  536  CHKVLEE  556
            C  +L++
Sbjct  147  CGLLLQK  153



>gb|AEK85663.1| major pollen allergen Ole e1 [Olea europaea]
Length=141

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 83/134 (62%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F ++G+VYCDTCR  F T +SE++ G  +RL CK+ +N  VT++  G T A+G Y
Sbjct  2    PPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLY  61

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ V+R+H+N+ CE+T + S ++D  E    G  K ++    N  +NG+ R  NPL F K
Sbjct  62   SMLVERDHKNEFCEITPISSGRKDRNEIPTEGWVKPSLKFILNT-LNGTTRTVNPLGFFK  120

Query  518  NKADERCHKVLEEI  559
             +A  +C +V  ++
Sbjct  121  KEALPKCAQVYNKL  134



>ref|XP_010538956.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=159

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F VRG+VYCDTCR  F+T  S Y+ G VV+L+CK+  +  + YS E  T + G Y + V+
Sbjct  27   FVVRGRVYCDTCRAGFETPASTYIPGAVVKLECKDRRSMELVYSHEARTDSTGAYKIWVN  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  C++ +VKSP+  C +   G E+A V  T   G+    RY N + F +++A   
Sbjct  87   EDHEDQLCDIMLVKSPQLGCSKVSHGRERARVTLTRYNGIASDDRYVNNMGFERDEALSG  146

Query  536  CHKVLEE  556
            C +++ +
Sbjct  147  CSEIMRQ  153



>ref|XP_006355373.1| PREDICTED: pollen-specific protein C13-like [Solanum tuberosum]
Length=159

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 83/139 (60%), Gaps = 0/139 (0%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A +  F V+GK YCDTCR  F+T  ++Y+AG  V+++CKN     +TY  +G   + G+Y
Sbjct  20   ATSNPFLVKGKCYCDTCRCGFETPATKYLAGCKVKVECKNRVTNKITYRIDGVANSKGEY  79

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
            N+ V R+  +D C+V +V+S  + C    AG ++A V  T N G+   +RYAN + F+ N
Sbjct  80   NILVKRDCGDDVCDVVLVESGDKTCNIPNAGRDRARVALTRNNGMTSDVRYANNMGFLSN  139

Query  521  KADERCHKVLEEINFSSNE  577
            +    C ++L++   + ++
Sbjct  140  EPLATCTQILQQYQLTEDQ  158



>emb|CDX99789.1| BnaC05g22110D [Brassica napus]
Length=171

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            ++F + G VYCDTCRVQF TR+S+++ G  V+L+CK+  N+TVT + E  T  DGKY + 
Sbjct  30   DRFNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQME  89

Query  350  VDREHENDTCEVTVVKSPKEDCKETM---AGLEKATVVCTENVG-VNGSIRYANPLFFMK  517
            V  +HE + CE+ +V+SP  +C E          A +  T N G V+  IR  NPL FM+
Sbjct  90   VMGDHEEELCEIILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMR  149

Query  518  NKADERCHKVLEEI  559
                  C +V +E+
Sbjct  150  KTPLADCPQVFKEL  163



>ref|XP_002301038.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK93129.1| unknown [Populus trichocarpa]
 gb|ABK94485.1| unknown [Populus trichocarpa]
 gb|ABK95752.1| unknown [Populus trichocarpa]
 gb|EEE80311.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F+V+G VYCDTC   F+T  + Y+AG  V+++C++   + + YS EG T + GKY ++VD
Sbjct  27   FSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGKYIITVD  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C+  +V SP++DC    AG ++A V+ T   G+  + RYAN + FM  +    
Sbjct  87   EDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMSG  146

Query  536  CHKVLEE  556
            C ++L  
Sbjct  147  CTELLRS  153



>gb|ABK92993.1| unknown [Populus trichocarpa]
Length=159

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F+V+G VYCDTC   F+T  + Y+AG  V+++C++   + + YS EG T + GKY ++VD
Sbjct  27   FSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGKYIITVD  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C+  +V SP++DC    AG ++A V+ T   G+  + RYAN + FM  +    
Sbjct  87   EDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMSG  146

Query  536  CHKVLEE  556
            C ++L  
Sbjct  147  CTELLRS  153



>ref|XP_006442530.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
 gb|ESR55770.1| hypothetical protein CICLE_v10024378mg [Citrus clementina]
Length=163

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 81/129 (63%), Gaps = 3/129 (2%)
 Frame = +2

Query  179  TVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDR  358
            TV G VYCD+CRV+++T +S+Y+AG  V L+CK ++   V YS E  +   G Y + ++ 
Sbjct  32   TVEGLVYCDSCRVKYKTELSDYIAGATVALECKESEGGEVVYSREVVSDQSGTYKIPIEG  91

Query  359  EHENDTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGS-IRYANPLFFMKNKADE  532
             H    C+V +VKSPK +C E +A GL  A +  T +VG +   IRYAN L FMK ++  
Sbjct  92   CHAK-LCQVRLVKSPKPECSEIVADGLSSARIDLTPSVGSDPELIRYANDLGFMKKESLP  150

Query  533  RCHKVLEEI  559
             C KVLEE+
Sbjct  151  ECAKVLEEM  159



>gb|ABK94215.1| unknown [Populus trichocarpa]
Length=159

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F+V+G VYCDTC   F+T  + Y+AG  V+++C++   + + YS EG T + GKY ++VD
Sbjct  27   FSVQGIVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGKYIITVD  86

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C+  +V SP++DC    AG ++A V+ T   G+  + RYAN + FM  +    
Sbjct  87   EDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMSG  146

Query  536  CHKVLEE  556
            C ++L  
Sbjct  147  CTELLRS  153



>ref|XP_008245042.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F ++G+VYCDTCR  F+T  + Y+ G  VR++CK  +   + YS EGET   G YN+ V+
Sbjct  28   FHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDTTGTYNILVE  87

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  CE  +V SP  DCK    G  +A VV T   GV     YAN + F K++    
Sbjct  88   DDHEDQICESVLVSSPVNDCKSADPGRNRANVVVTRYNGVVKDKHYANNMGFFKDQPLAG  147

Query  536  CHKVLEE  556
            C ++L++
Sbjct  148  CEELLKQ  154



>ref|XP_009797814.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana sylvestris]
Length=161

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            + F V GKVYCDTCR  F+T  S+Y+AG  VR++CK  D   V+Y+ EG T + G+Y + 
Sbjct  25   DTFLVVGKVYCDTCRCGFETSASKYLAGSRVRIECKKRDTNDVSYTIEGVTNSKGEYKIL  84

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +  ++ C+V +++S    C    AG ++A VV T N G+  + R+AN + F+ ++  
Sbjct  85   VYSDRGDEVCDVVLIRSSDPMCATPAAGRDRARVVLTRNNGMISNTRFANSIGFLSDEPL  144

Query  530  ERCHKVLEEINFSSNE  577
              C+++L++   + ++
Sbjct  145  ASCNQILQQYQLTEDQ  160



>ref|XP_010540511.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 77/133 (58%), Gaps = 4/133 (3%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G VYCDTCRVQF TR+S+++ G  V+L+CKN DN+TVT + E  T   G Y + V
Sbjct  30   RFHIKGSVYCDTCRVQFFTRLSKFLEGAKVKLECKNIDNQTVTLTKEAVTDKSGNYEMVV  89

Query  353  DREHENDTCEVTVVKSPKEDCKETM---AGLEKATVVCTENVG-VNGSIRYANPLFFMKN  520
              +HE++ CE+ + +SP  +C +          A +  T N G V+   R  NPL FM+ 
Sbjct  90   MGDHEDEVCEIVLAESPDTECSDINNEEFTRNAARISLTANDGIVSNETRTVNPLGFMRR  149

Query  521  KADERCHKVLEEI  559
                 C K  EE+
Sbjct  150  TPLSDCPKAFEEL  162



>ref|XP_009109686.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX90169.1| BnaA08g18150D [Brassica napus]
Length=171

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 80/133 (60%), Gaps = 4/133 (3%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G VYCDTCRVQF TR+S+ + G  V+L+CK  +N+TVT + E  T  DGKY + V
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKARENQTVTLTKEAVTDKDGKYEMVV  90

Query  353  DREHENDTCEVTVVKSPKEDCKET--MAGLEKAT-VVCTENVG-VNGSIRYANPLFFMKN  520
              +HE + CE+ +V+SP  +C E      L  A  +  T N G V+  +R  NPL FM+ 
Sbjct  91   MGDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRK  150

Query  521  KADERCHKVLEEI  559
                 C +V +E+
Sbjct  151  TPLADCPQVFKEL  163



>ref|XP_009115274.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=171

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 79/134 (59%), Gaps = 4/134 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            ++F + G VYCDTCRVQF TR+S+++ G  V+L+CK+  N+TVT + E  T  DGKY + 
Sbjct  30   DRFNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQME  89

Query  350  VDREHENDTCEVTVVKSPKEDCKETM---AGLEKATVVCTENVG-VNGSIRYANPLFFMK  517
            V  +HE + CE  +V+SP  +C E          A +  T N G V+  IR  NPL FM+
Sbjct  90   VMGDHEEELCEFILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMR  149

Query  518  NKADERCHKVLEEI  559
                  C +V +E+
Sbjct  150  KTPLADCPQVFKEL  163



>ref|XP_010686203.1| PREDICTED: pollen allergen Che a 1 [Beta vulgaris subsp. vulgaris]
Length=169

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 79/138 (57%), Gaps = 3/138 (2%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            A    F V+G VYCDTCR+QF TR+S  M G  VRL+C+N    T T+ +E  T   G Y
Sbjct  25   AATNHFKVQGMVYCDTCRIQFITRVSTMMEGATVRLECRNITAGTETFKSEAITDKLGMY  84

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKET---MAGLEKATVVCTENVGVNGSIRYANPLFF  511
            +++VD ++E+D CE+ + KS   +C +    +   + A V  T N G +  +R AN L F
Sbjct  85   SINVDGDYEDDICEIVLAKSSNNECTDISHDVYAKQAAKVSLTSNNGESSDVRSANALGF  144

Query  512  MKNKADERCHKVLEEINF  565
            M+      C +VL+E++ 
Sbjct  145  MRKTPLPECPEVLKELDL  162



>ref|XP_008439742.1| PREDICTED: olee1-like protein isoform X1 [Cucumis melo]
 ref|XP_008439744.1| PREDICTED: olee1-like protein isoform X3 [Cucumis melo]
Length=168

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCK---NTDNETVTYSAEGETGADGKY  340
            ++F + GKVYCDTCR+QF TR+S+Y+ G  V+L C+   N  NE  T++ E  T  +G Y
Sbjct  27   DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNE--TFTGEAVTDKNGVY  84

Query  341  NLSVDREHENDTCEVTVVKSPKEDCK--ETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             + VD +HE + CEV++++S  ++C    T      A V  T N G+   +R ANPL F+
Sbjct  85   KIEVDGDHEEEICEVSLLESADKECSGIPTDGYGHFARVSITGNNGITNPVRQANPLGFL  144

Query  515  KNKADERCHKVLEEINF  565
            +  A  +C +VL E+ F
Sbjct  145  RKDALPQCKEVLRELGF  161



>ref|XP_008234688.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 78/135 (58%), Gaps = 1/135 (1%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F ++G+VYCDTCR  F+T  + Y+ G  VR++CK  +   + YS EGET A G YN+ V+
Sbjct  28   FHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNILVE  87

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +HE+  CE  +V SP  DCK       +A VV T   G+     YAN + F K++    
Sbjct  88   DDHEDQICESVLVSSPVNDCKSADPRRNRANVVVTRYNGIVKDKHYANNMGFFKDQPLAG  147

Query  536  CHKVLEE-INFSSNE  577
            C ++L++ +N+   E
Sbjct  148  CEELLKQYLNYDQPE  162



>ref|XP_007153182.1| hypothetical protein PHAVU_003G013800g [Phaseolus vulgaris]
 gb|ESW25176.1| hypothetical protein PHAVU_003G013800g [Phaseolus vulgaris]
Length=163

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 77/132 (58%), Gaps = 4/132 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDC-KNTDNETVTYSAEGETGADGKYNL  346
            EKF+V+GK+YCD C   F++R+S  ++GV V L C K  +N  +TY     + A+G YN+
Sbjct  27   EKFSVQGKIYCDPCHFAFESRLSFPLSGVSVSLQCIKEENNTIITYLKNSTSDANGMYNI  86

Query  347  SVDREHENDTCEVTVVKSPKE-DCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNK  523
             V  +HE+D C V V  SP E  CKE M   +   ++ T N+G     RY NPL FM   
Sbjct  87   PVLGDHEDDIC-VVVADSPNEGQCKEAMPN-KSDRIIITNNMGAASLTRYVNPLGFMTQT  144

Query  524  ADERCHKVLEEI  559
             D +C+ V+ E+
Sbjct  145  IDSQCNVVVHEL  156



>gb|AAQ07442.1| major pollen allergen Ole e 1 [Olea europaea]
 gb|AAQ08186.1| major pollen allergen Ole e 1 [Olea europaea]
 gb|AAQ08187.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ08189.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ08190.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = +2

Query  194  VYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHEND  373
            VYCDTCR  F T +SE++ G  VRL CK+ +N  +T++  G T A+G Y++ V+R+H+N+
Sbjct  4    VYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKNE  63

Query  374  TCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKVL  550
             CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V 
Sbjct  64   FCEITLISSGRKDCNEIPTEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQVY  122

Query  551  EEI  559
             ++
Sbjct  123  NKL  125



>ref|XP_006464247.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Citrus sinensis]
Length=161

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 78/130 (60%), Gaps = 0/130 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
             + F +RG+VYCDTCR  F+T  + Y+ G  VR++CK+ ++  + YS +GET + G YN+
Sbjct  22   GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             VD +H++  C   ++ SP  DCK    G   + V+ T + G   ++ +AN L F+K + 
Sbjct  82   HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  527  DERCHKVLEE  556
               C ++L++
Sbjct  142  LAFCPELLKK  151



>gb|KHN19737.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 76/140 (54%), Gaps = 1/140 (1%)
 Frame = +2

Query  164  PAE-KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            PA+  F V+G+VYCD CR  F+T  + Y+AG  + L CK+  +  V Y+ +G T + G Y
Sbjct  23   PAKNPFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAY  82

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
             + VD +H +  C   +V SP   CKE   G ++A V+ T   G+    R+AN + FM  
Sbjct  83   TMYVDEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQ  142

Query  521  KADERCHKVLEEINFSSNEN  580
            +    C ++L +     NEN
Sbjct  143  EVASGCAEILRQYQEFDNEN  162



>ref|NP_001238723.1| uncharacterized protein LOC100499710 precursor [Glycine max]
 gb|ACU13342.1| unknown [Glycine max]
 gb|KHN09136.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 76/140 (54%), Gaps = 1/140 (1%)
 Frame = +2

Query  164  PAE-KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            PA+  F V+G+VYCD CR  F+T  + Y+AG  + L CK+  +  V Y+ +G T + G Y
Sbjct  23   PAKNPFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAY  82

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
             + VD +H +  C   +V SP   CKE   G ++A V+ T   G+    R+AN + FM  
Sbjct  83   TMYVDEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQ  142

Query  521  KADERCHKVLEEINFSSNEN  580
            +    C +VL +     NEN
Sbjct  143  EVASGCAEVLRQYEEFDNEN  162



>pir||A38968 major allergen OLE20 - common olive (fragment)
Length=137

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 81/123 (66%), Gaps = 2/123 (2%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G+VYCDTCR +F T +SE++ G  VRL+C++ +  ++T++  G T A+G Y++ +
Sbjct  1    QFHIQGQVYCDTCRARFITELSEFIPGAGVRLECRDGEKGSITFTEVGYTRAEGLYSMLI  60

Query  353  DREHENDTCEVTVVKSPKEDCKET-MAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            +R+H+N+ CE+T+  S ++DC E  + G  K ++    N  VNG+ R  NPL F K +  
Sbjct  61   ERDHKNEFCEITLASSSRKDCDEIPVEGWVKPSLKFKLNT-VNGTTRTINPLGFFKKEVL  119

Query  530  ERC  538
             +C
Sbjct  120  PKC  122



>ref|XP_010529196.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=173

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 4/134 (3%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            ++F ++G VYCDTCRVQF TR+S+++ G  VRL+CKN  N T+T S E  T   G + + 
Sbjct  32   DRFQIQGSVYCDTCRVQFITRLSKFLQGAKVRLECKNRVNGTLTVSKEAVTDESGSFLME  91

Query  350  VDREHENDTCEVTVVKSPKEDCKETM--AGLEKAT-VVCTENVG-VNGSIRYANPLFFMK  517
            V  +HE + CE+ +V+SP +DC E    A L  A  +  T N G V+   R  NPL FM 
Sbjct  92   VTGDHEEEVCEIVLVESPDKDCSEVSKEAFLRNAAKISLTANDGIVSNETRIVNPLGFMV  151

Query  518  NKADERCHKVLEEI  559
                  C    +E+
Sbjct  152  KTPSTECPAAFKEL  165



>ref|XP_010538209.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 78/134 (58%), Gaps = 4/134 (3%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F ++G VYCDTCRVQF TR+S+++ G  V+L+CKN  N+TVT   E  T   G Y + V 
Sbjct  31   FHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKNRVNQTVTLVEEAVTDKSGNYEMVVT  90

Query  356  REHENDTCEVTVVKSPKEDCKETM---AGLEKATVVCTENVG-VNGSIRYANPLFFMKNK  523
             +HE + CE+ +V+SP+ +C+E          A +  T N G V+   R  NPL FM+N 
Sbjct  91   GDHEEEVCEIVLVESPEAECREINNEEFLRNAARISLTANDGIVSNETRTVNPLGFMRNT  150

Query  524  ADERCHKVLEEINF  565
                C K  +E++ 
Sbjct  151  PLPDCPKAFKELDI  164



>gb|AAQ10269.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10270.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10271.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = +2

Query  194  VYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHEND  373
            VYCDTCR  F T +SE++ G  VRL CK+ +N  +T++  G T A+G Y++ V+R+H+N+
Sbjct  4    VYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKNE  63

Query  374  TCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKVL  550
             CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V 
Sbjct  64   FCEITLISSGRKDCDEIPTEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQVY  122

Query  551  EEI  559
             ++
Sbjct  123  NKL  125



>gb|EPS62385.1| hypothetical protein M569_12405, partial [Genlisea aurea]
Length=150

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 75/133 (56%), Gaps = 0/133 (0%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
            G+  +   V+G VYCDTCR  F+   ++YMAG  VR++C+      +TY  +G T + G 
Sbjct  13   GSAGQPLVVKGSVYCDTCRCGFENEATKYMAGAAVRIECREAHTSQITYVEDGVTNSAGH  72

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            Y + V  +  +D C+  ++KS   +C    AG ++A VV T N G+    R+AN + F++
Sbjct  73   YEIRVHGDRGDDVCDAVLLKSSDPECSTPDAGRDRARVVLTRNNGIASDHRFANSMGFLR  132

Query  518  NKADERCHKVLEE  556
            N     C +VL++
Sbjct  133  NAPLAACAQVLQK  145



>gb|AAQ10267.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10268.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = +2

Query  194  VYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHEND  373
            VYCDTCR  F T +SE++ G  VRL CK+ +N  +T++  G T A+G Y++ V+R+H+N+
Sbjct  4    VYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKNE  63

Query  374  TCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKVL  550
             CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V 
Sbjct  64   FCEITLISSGRKDCDEIPTEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQVY  122

Query  551  EEI  559
             ++
Sbjct  123  NKL  125



>ref|XP_008439743.1| PREDICTED: olee1-like protein isoform X2 [Cucumis melo]
Length=168

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCK---NTDNETVTYSAEGETGADGKY  340
            ++F + GKVYCDTCR+QF TR+S+Y+ G  V+L C+   N  NE  T++ E  T  +G Y
Sbjct  27   DRFFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNE--TFTGEAVTDKNGVY  84

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE--TMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
             + VD +HE + CEV++++S  + C E  T      A V  T N G+   +R ANPL F 
Sbjct  85   KIEVDGDHEEEICEVSLLESGDKGCGEIPTDGYGHFARVSITGNNGIIDPVRQANPLGFK  144

Query  515  KNKADERCHKVLEEINF  565
            K +A  +C +VL E+ F
Sbjct  145  KKEALPQCKEVLRELGF  161



>gb|AAF16869.1|AF109693_1 allergen-like protein BRSn20 [Sambucus nigra]
Length=159

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 80/134 (60%), Gaps = 0/134 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F ++G VYCDTCR  F+T  ++Y+ G  VR++CK+ D   +TYS E  T + GKY++ V 
Sbjct  26   FLLKGSVYCDTCRAGFETDATKYLHGARVRIECKDRDTLRLTYSDEAVTDSKGKYSVLVS  85

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H +  C+  +V SP  +C     G ++A V+ T + G+    R+AN + F+KN+    
Sbjct  86   DDHGDQMCDAILVSSPDPECAVPDKGRDRACVILTRSNGMTSDERFANAMGFLKNEPMAG  145

Query  536  CHKVLEEINFSSNE  577
            C ++L++   + ++
Sbjct  146  CTQILQKYQLNEDD  159



>emb|CDY43319.1| BnaC03g58910D [Brassica napus]
Length=171

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 80/133 (60%), Gaps = 4/133 (3%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G VYCDTCRVQF TR+S+ + G  V+L+CK  +N+TVT + E  T  +GKY + V
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAVTDKEGKYEMVV  90

Query  353  DREHENDTCEVTVVKSPKEDCKET--MAGLEKAT-VVCTENVG-VNGSIRYANPLFFMKN  520
              +HE + CE+ +V+SP  +C E      L  A  +  T N G V+  +R  NPL FM+ 
Sbjct  91   MGDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRK  150

Query  521  KADERCHKVLEEI  559
                 C +V +E+
Sbjct  151  TPLADCPQVFKEL  163



>gb|AEK85662.1| major pollen allergen Ole e1 [Olea europaea]
Length=130

 Score =   100 bits (249),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = +2

Query  191  KVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHEN  370
            ++YCDTCR  F T +SE++ G  +RL CK+ +N  VT++  G T A+G Y++ V+R+H+N
Sbjct  1    QIYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKN  60

Query  371  DTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKV  547
            + CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V
Sbjct  61   EFCEITLISSGRKDCNEIPTEGWVKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQV  119

Query  548  LEEI  559
              ++
Sbjct  120  YNKL  123



>ref|XP_002392460.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
 gb|EEB93390.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
Length=160

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
             TV GKVYCDTCR  F+T  S Y+AG  V+++CK+  +  + YS E  T + G Y L V 
Sbjct  28   LTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEATTDSTGTYKLFVS  87

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C+  ++ SP+ +C++  AG ++A V+ T   G+    RYAN + F  ++    
Sbjct  88   EDHQDQLCDAMLLSSPQPNCQKPAAGRDRARVILTRYNGIVSDTRYANNMGFEMDQPLAG  147

Query  536  CHKVLEE  556
            C +VL++
Sbjct  148  CTQVLQQ  154



>ref|XP_003581152.1| PREDICTED: pollen-specific protein C13-like [Brachypodium distachyon]
Length=171

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            + V+G+VYCDTCR  F+T ++ Y+ G  VRL+CK    E V  + +G T   G Y + + 
Sbjct  31   YIVQGRVYCDTCRAGFETNVTTYIKGAKVRLECKRFGTEKVERALDGVTDETGTYKIELK  90

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
              H  D CEV +++SP  DC +  A  ++A V  T N+G++ ++R AN L ++K+     
Sbjct  91   DSHPEDICEVVLIQSPLADCNKIQALRDRARVELTRNIGISDNLRLANSLGYLKDVPLPV  150

Query  536  CHKVLEE  556
            C ++L++
Sbjct  151  CAQLLKQ  157



>gb|AAQ10277.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=131

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = +2

Query  194  VYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHEND  373
            VYCDTCR  F T +SE++ G  VRL CK+ +N  +T++  G T A+G Y++ V+R+H+N+
Sbjct  3    VYCDTCRAGFITELSEFIPGASVRLQCKDRENGDITFTEVGYTRAEGLYSMLVERDHKNE  62

Query  374  TCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKVL  550
             CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V 
Sbjct  63   FCEITLISSGRKDCDEIPTEGWVKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQVY  121

Query  551  EEI  559
             ++
Sbjct  122  NKL  124



>gb|KFK44745.1| hypothetical protein AALP_AA1G297400 [Arabis alpina]
Length=171

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 80/134 (60%), Gaps = 6/134 (4%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G VYCDTCRVQF TR+S+++ G  V+L+CK  +N+TVT + E  T   G Y + V
Sbjct  31   RFHIKGSVYCDTCRVQFVTRVSKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEV  90

Query  353  DREHENDTCEVTVVKSPKEDC-----KETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
              +HE + CE+ +V+SP  +C     +E +    + ++   + + V+   R  NPL FM+
Sbjct  91   MGDHEEEVCEIVLVQSPDPECGDINNQEFLRNAARISLTANDGI-VSNETRTINPLGFMR  149

Query  518  NKADERCHKVLEEI  559
                E C +V +E+
Sbjct  150  KNPLEDCSQVFKEL  163



>ref|XP_006428158.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
 gb|ESR41398.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
Length=250

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 79/131 (60%), Gaps = 0/131 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
             + F +RG+VYCDTCR  F+T  + Y+ G  VR++CK+ ++  + YS +GET + G YN+
Sbjct  22   GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             VD +H++  C   ++ SP  DCK    G   + V+ T + G   ++ +AN L F+K + 
Sbjct  82   HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  527  DERCHKVLEEI  559
               C ++L+++
Sbjct  142  LAFCPELLKKL  152



>gb|ABP58637.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 81/134 (60%), Gaps = 2/134 (1%)
 Frame = +2

Query  161  APAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
             P  +F V+G++YCDTCR  F   +SE++ G  VRL C+++    +T++  G T A+G Y
Sbjct  1    PPVSQFHVQGQIYCDTCRAGFIAELSEFILGAGVRLQCRDSKKGNITFTEVGYTRAEGLY  60

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKE-TMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            ++ ++R+H+N+ CEV  + S ++DC E  + G  + ++    N  VNG+     PL F K
Sbjct  61   SMLIERDHKNEFCEVNSLSSSRKDCDEIPIEGWVRPSLRFLLNT-VNGTTCTIKPLGFFK  119

Query  518  NKADERCHKVLEEI  559
            NKA  +C +V  ++
Sbjct  120  NKALPKCPQVFNKL  133



>ref|XP_004146873.1| PREDICTED: pollen allergen Che a 1-like [Cucumis sativus]
 ref|XP_004169639.1| PREDICTED: pollen allergen Che a 1-like [Cucumis sativus]
 gb|KGN53218.1| hypothetical protein Csa_4G028420 [Cucumis sativus]
Length=163

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = +2

Query  155  HGAPA--EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGA  328
            HG PA  + F V G VYCDTCR  F+T +S  ++G  VRL+C++     + ++ E  T +
Sbjct  20   HGLPASAQLFVVNGCVYCDTCRCGFETNVSTPISGAKVRLECRDRATWVLKFTKEAITDS  79

Query  329  DGKYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLF  508
             GKY ++V  +H++++C+V +V SP   C     G   ATV+ T N G+    RYAN + 
Sbjct  80   KGKYKINVYEDHKDESCKVVLVSSPHLGCNRPDVGRNSATVILTNNNGLTSIFRYANAMG  139

Query  509  FMKNKADERCHKVLEE  556
            F+  +    C  +L++
Sbjct  140  FLIRRPLAFCPTILKQ  155



>ref|NP_001150330.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG38668.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 76/130 (58%), Gaps = 1/130 (1%)
 Frame = +2

Query  164  PAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYN  343
            P+  F V G+VYCD CR  F+T +S  + G  V ++C++ +++ V   AE  T A G Y 
Sbjct  23   PSPGFVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYR  82

Query  344  LSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGS-IRYANPLFFMKN  520
            + +  +H+++ CEV ++KSP+ DC E     E+  V  T N G+  S IRYANP+ F + 
Sbjct  83   MEISGDHQDEICEVLLLKSPEADCAEIERTRERCRVPLTRNDGIRQSGIRYANPIAFFRK  142

Query  521  KADERCHKVL  550
            +    C ++L
Sbjct  143  EPLSNCGELL  152



>gb|AEK85658.1| major pollen allergen Ole e1 [Olea europaea]
Length=130

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = +2

Query  191  KVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHEN  370
            +VYCDTCR  F T +SE++ G  +RL CK+ +N  VT++  G T A+G Y++ V+R+H+N
Sbjct  1    QVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKN  60

Query  371  DTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKV  547
            + CE+T++ S ++DC E    G  K ++    N  +NG+ R  NPL F K +A  +C +V
Sbjct  61   EFCEITLISSGRKDCNEIPTEGWVKPSLKFILNT-LNGTTRTVNPLGFFKKEALPKCAQV  119

Query  548  LEEI  559
              ++
Sbjct  120  YNKL  123



>ref|XP_002533139.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF29251.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=161

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 76/128 (59%), Gaps = 0/128 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F ++G+VYCDTCR  F+T+ + Y+ G  VR++C++     + YS EGET   G YN+ V+
Sbjct  29   FHIKGRVYCDTCRCGFETKKTTYIPGARVRIECEDRTTLRLKYSVEGETDETGTYNILVE  88

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C   +V SP   C     G  +A VV T N G    + +AN + F++N+A   
Sbjct  89   DDHQDQICYAALVSSPWPSCNTADPGRSRAHVVVTRNNGAISDLHFANSMGFLRNQAMSG  148

Query  536  CHKVLEEI  559
            C ++++++
Sbjct  149  CTELVKQL  156



>ref|NP_001131377.1| uncharacterized protein LOC100192702 precursor [Zea mays]
 gb|ACF79764.1| unknown [Zea mays]
 gb|AFW82076.1| hypothetical protein ZEAMMB73_949741 [Zea mays]
Length=164

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 78/137 (57%), Gaps = 1/137 (1%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
             AP   F V G++YCD CR  F+T +S  + G  V ++C++ +++ V   AE  TG  G 
Sbjct  20   AAPGVGFVVTGRIYCDNCRAGFETNVSHAIQGATVEMECRHFESQQVHDKAEATTGPGGW  79

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGS-IRYANPLFFM  514
            Y + +  +H+++ C+V ++KSP+ DC E     ++  V  T N G+  S +RYANP+ F+
Sbjct  80   YRMEISGDHQDEICDVRLLKSPEADCAEIDHSRDRCRVPLTRNDGIKQSGVRYANPIAFL  139

Query  515  KNKADERCHKVLEEINF  565
            + +    C ++L   + 
Sbjct  140  RKEPLPNCGELLRAYDL  156



>gb|AAB32652.2| main olive allergen, partial [Olea europaea]
Length=130

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +2

Query  191  KVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHEN  370
            +VYCDTCR  F T +SE++ G  VRL CK   N  +T++  G T A+G Y++ V+R+H+N
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN  60

Query  371  DTCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKV  547
            + CE+T++ S  +DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQV  119

Query  548  LEEI  559
              ++
Sbjct  120  YNKL  123



>ref|XP_010060161.1| PREDICTED: protein DOWNSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW66732.1| hypothetical protein EUGRSUZ_F00490 [Eucalyptus grandis]
Length=160

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
             TV GKVYCDTCR  F+T  S Y+AG  V+++CK+  +  + YS E  T + G Y L V 
Sbjct  28   LTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEATTDSTGTYKLFVS  87

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C+  ++ SP+ +C++  AG ++A V+ T   G+    RYAN + F  ++    
Sbjct  88   EDHQDQLCDAMLLSSPQLNCQKPAAGRDRARVILTRYNGIVSDTRYANNMGFEMDQPLAG  147

Query  536  CHKVLEE  556
            C +VL++
Sbjct  148  CTQVLQQ  154



>ref|XP_007149397.1| hypothetical protein PHAVU_005G066800g [Phaseolus vulgaris]
 gb|ESW21391.1| hypothetical protein PHAVU_005G066800g [Phaseolus vulgaris]
Length=162

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 75/133 (56%), Gaps = 3/133 (2%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            EKF V GK+YCD C+  F++R+S  ++GV V L C   +N+ V+Y     T A+G Y++ 
Sbjct  27   EKFFVEGKIYCDPCQFAFESRLSFALSGVNVTLKCIKEENDIVSYQKNSTTDANGMYSIP  86

Query  350  VDREHENDTCEVTVVKSPKE-DCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
            V  +HE + C V V   P E  CKE M   +   ++ T+N+G     RY NPL FM    
Sbjct  87   VHGDHEEEIC-VVVADPPNEGQCKEAMPN-KSDRIILTKNMGAASMTRYVNPLGFMTQTT  144

Query  527  DERCHKVLEEINF  565
            D +C  V++E+  
Sbjct  145  DSQCFAVVQELGL  157



>ref|NP_174209.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAF88123.1|AC021043_16 Similar to major allergen OLE5c [Arabidopsis thaliana]
 gb|AEE31049.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 80/135 (59%), Gaps = 6/135 (4%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            +KF ++G VYCDTCRVQF TRIS+++ G  V+L+CK  +N+TVT + E  T   G Y + 
Sbjct  30   DKFHIKGSVYCDTCRVQFITRISKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQME  89

Query  350  VDREHENDTCEVTVVKSPKEDC-----KETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
            V  +HE + CE+ +++SP  +C     +E +    + ++   + + V+   R  NPL FM
Sbjct  90   VMGDHEEEVCEIVLLQSPDPECGDVNNQEFLRNAARISLTANDGI-VSNETRTINPLGFM  148

Query  515  KNKADERCHKVLEEI  559
            +      C +V +E+
Sbjct  149  RKTPLAECPQVFKEL  163



>ref|XP_008453801.1| PREDICTED: major pollen allergen Lol p 11-like [Cucumis melo]
Length=163

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 77/136 (57%), Gaps = 2/136 (1%)
 Frame = +2

Query  155  HGAPA--EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGA  328
            HG PA  + F V G VYCDTCR  F+T +S  ++G  VRL+C++     + ++ E  T +
Sbjct  20   HGLPASAQLFVVNGCVYCDTCRCGFETNVSTPVSGAKVRLECRDRATWVLKFTKEATTNS  79

Query  329  DGKYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLF  508
             GKY + V  +H++++C+V +V SP   C     G   ATV+ T N G+    RYAN + 
Sbjct  80   KGKYKIDVYEDHKDESCKVVLVSSPHRGCDRPDIGRNSATVILTNNNGLTSISRYANAMG  139

Query  509  FMKNKADERCHKVLEE  556
            F+  +    C  +L++
Sbjct  140  FLIRRPLAFCPTILKQ  155



>ref|XP_010942359.1| PREDICTED: major pollen allergen Lol p 11-like [Elaeis guineensis]
Length=174

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 76/135 (56%), Gaps = 0/135 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F + G+VYCDTCR  F+T I+  M G  VRL+CK    + +TY AE  T   G Y + V 
Sbjct  40   FVLTGRVYCDTCRAGFETDITSSMPGAKVRLECKRYGTDELTYEAEATTQLSGMYQMIVP  99

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H ND C V +VKS    C E   G ++  +   ++ G+  + R AN L F+ ++    
Sbjct  100  DDHSNDQCSVVLVKSSFNKCTEIEPGRDRVRITLAQDGGLLSNSRQANALGFLIDEPLPS  159

Query  536  CHKVLEEINFSSNEN  580
            C K+L++  F+++++
Sbjct  160  CGKLLQKYGFANDDD  174



>gb|AAQ08188.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = +2

Query  194  VYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHEND  373
            V+CDTCR  F T +SE++ G  VRL CK+ +N  +T++  G T A+G Y++ V+R+H+N+
Sbjct  4    VHCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKNE  63

Query  374  TCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKVL  550
             CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V 
Sbjct  64   FCEITLISSGRKDCNEIPTEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQVY  122

Query  551  EEI  559
             ++
Sbjct  123  NKL  125



>ref|XP_003566418.1| PREDICTED: major pollen allergen Lol p 11-like [Brachypodium 
distachyon]
Length=169

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 76/131 (58%), Gaps = 1/131 (1%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V G+VYCDTCR  F+T  S  + G VV+++C++ +   + + AE  T A G Y + V 
Sbjct  31   FLVTGRVYCDTCRAGFETNASHSIPGAVVQMECRHFETNELHHKAEATTDAQGWYKMEVG  90

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGS-IRYANPLFFMKNKADE  532
             +H+ + CEV +++SP++DC E     ++  V  T N G+  S +RYANP+ F + +   
Sbjct  91   EDHQEEICEVALLRSPEKDCAEIEKSRDRCRVPLTRNNGIKQSGVRYANPIAFFRKEPLA  150

Query  533  RCHKVLEEINF  565
             C  VL + + 
Sbjct  151  NCGDVLRKYDL  161



>gb|AFK42345.1| unknown [Lotus japonicus]
Length=164

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 75/136 (55%), Gaps = 1/136 (1%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
            G   +KF V GK+YCD C  +F++R+S  + GV + L+CK  D   VT++ E  T  +G 
Sbjct  25   GPVDDKFVVVGKIYCDPCHFEFESRLSHPLEGVKITLECKKADTNNVTFTTEAVTDKNGV  84

Query  338  YNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
            Y L+ D +HE + CEV    + K +C   M   +   +V T N+GV+   RY NPL FM 
Sbjct  85   YTLTCDGDHEEEVCEVNTDANTKGECTIPMVN-KFDRIVLTRNMGVSSLTRYVNPLGFMT  143

Query  518  NKADERCHKVLEEINF  565
                 +C  V++E+  
Sbjct  144  KAIHSQCGNVVQELGL  159



>ref|XP_009386950.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGK  337
            G     F V+G+V+CDTCR  F+T +S Y+ G  VR++C++      T S EG T   G 
Sbjct  27   GVVKRGFVVQGRVFCDTCRAGFETPVSTYIQGATVRVECRSEFTGAKTCSFEGTTDHTGT  86

Query  338  YNLSVDREHEN-DTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
            YN+ V+ EH++ + CE  +V SP+  CK  + G E+A V  + N G+    R+AN L F+
Sbjct  87   YNILVEGEHDDHEICESLLVSSPESGCKTALQGRERAPVFLSHNNGIASDTRFANSLGFL  146

Query  515  KNKADERCHKVLE  553
            K+ +   C ++L+
Sbjct  147  KDTSLPVCTELLK  159



>ref|XP_007149396.1| hypothetical protein PHAVU_005G066700g [Phaseolus vulgaris]
 gb|ESW21390.1| hypothetical protein PHAVU_005G066700g [Phaseolus vulgaris]
Length=162

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 74/133 (56%), Gaps = 3/133 (2%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            EKF V GK+YCD C+  F++R+S  ++GV V L C   +N+ V+Y     T A+G YN+ 
Sbjct  27   EKFFVEGKIYCDPCQFAFESRLSFALSGVNVTLKCIKEENDIVSYLKNSTTDANGMYNIP  86

Query  350  VDREHENDTCEVTVVKSPKE-DCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
            V  +HE + C V V   P E  CKE M   +   ++ T+N+G     RY NPL FM    
Sbjct  87   VRGDHEEEICMV-VADPPNEGQCKEAMPN-KSDRIILTKNMGAASMTRYVNPLGFMTQTT  144

Query  527  DERCHKVLEEINF  565
            D +C  V+ E+  
Sbjct  145  DSQCFSVVHELGL  157



>ref|XP_011090511.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            + F V G VYCDTCR  ++T  + Y+AG  VR++C+N DN  +TY+ E  T + G Y++ 
Sbjct  25   DPFHVTGSVYCDTCRCGYETDATTYIAGATVRIECRNKDNGQLTYTKEAVTDSTGHYSVL  84

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V+ +  +D C+  +VKS   +C     G ++A V+ T N G+  + R+AN + F+KN   
Sbjct  85   VETDRGDDFCDAVLVKSADPECSTPNEGRDRARVILTRNNGMISNKRFANAMGFLKNTPL  144

Query  530  ERCHKVLEE  556
              C  +L++
Sbjct  145  ANCPMILQK  153



>sp|Q7M1X5.1|LOLB_LOLPR RecName: Full=Major pollen allergen Lol p 11; AltName: Full=Allergen 
Lol p XI; AltName: Allergen=Lol p 11 [Lolium perenne]
 prf||2118270A allergen Lol p XI
Length=134

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F V G+VYCD CR  F+T +S  + G  V +DC+  D       AE  T  DG Y + +D
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID  65

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGV-NGSIRYANPLFFMKNKADE  532
            ++H+ + CEV + KSP + C E     ++A V  T N G+    IRYANP+ F + +  +
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKEPLK  125

Query  533  RCHKVLE  553
             C  +L+
Sbjct  126  ECGGILQ  132



>ref|XP_008797140.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
 ref|XP_008797142.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
Length=174

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 79/137 (58%), Gaps = 0/137 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            +   + G VYCDTCR  F+T ++ Y+ G  VRL+C     + VTY+AE  T   G Y + 
Sbjct  38   DGLVLEGHVYCDTCRAGFETDLTAYIPGAKVRLECTRYGTDEVTYAAEATTDLLGIYQIV  97

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  +H  D C V ++KS  ++C E   G ++A VV  ++ G+  ++R AN L F+  +  
Sbjct  98   VPGDHSEDQCSVVLMKSAVDNCTEIKPGRDRARVVLAQDGGLLSNVRRANALGFLIAEPL  157

Query  530  ERCHKVLEEINFSSNEN  580
              C K+L++  F+++++
Sbjct  158  AECGKLLQKYGFANDDD  174



>ref|XP_010460686.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 78/133 (59%), Gaps = 4/133 (3%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G VYCDTCRVQF TR+S+++ G  V+L+CK  +N+TVT + E  T + G Y + V
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEV  90

Query  353  DREHENDTCEVTVVKSPKEDCKET--MAGLEKAT-VVCTENVG-VNGSIRYANPLFFMKN  520
              +HE + CE+ +V+SP  +C E      L  A  +  T N G V+   R  NPL FM+ 
Sbjct  91   MGDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRK  150

Query  521  KADERCHKVLEEI  559
                 C +  +E+
Sbjct  151  TPLADCPQAFKEL  163



>gb|AAQ10272.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10275.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10276.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=129

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 77/122 (63%), Gaps = 2/122 (2%)
 Frame = +2

Query  197  YCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHENDT  376
            YCDTCR  F T +SE++ G  VRL CK+ +N  +T++  G T A+G Y++ V+R+H+N+ 
Sbjct  2    YCDTCRAGFITELSEFIPGAGVRLQCKDGENGNITFTEVGYTRAEGLYSMLVERDHKNEF  61

Query  377  CEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKVLE  553
            CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V  
Sbjct  62   CEITLISSGRKDCDEIPTEGWVKPSLKFILNT-VNGTTRTINPLGFFKKEALPKCAQVYN  120

Query  554  EI  559
            ++
Sbjct  121  KL  122



>gb|AAO22132.1| major pollen allergen Ole e 1 [Olea europaea]
Length=135

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 77/122 (63%), Gaps = 2/122 (2%)
 Frame = +2

Query  197  YCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHENDT  376
            YCDTCR  F T +SE++ G  +RL CK+ +N  VT++  G T A+G Y++ V+R+H+N+ 
Sbjct  4    YCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKNEF  63

Query  377  CEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKVLE  553
            CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V  
Sbjct  64   CEITLISSGRKDCNEIPTEGWVKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQVYN  122

Query  554  EI  559
            ++
Sbjct  123  KL  124



>ref|XP_009409254.1| PREDICTED: major pollen allergen Lol p 11-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 73/128 (57%), Gaps = 0/128 (0%)
 Frame = +2

Query  170  EKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLS  349
            + F V+G+V+CDTCR  F+T +S Y  G  VR++C++      T + EG T   G YN+ 
Sbjct  34   QGFVVQGRVFCDTCRAGFETPVSTYTKGAKVRIECRSKATGAKTCNFEGTTDHTGTYNIL  93

Query  350  VDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKAD  529
            V  EHE++ CE  +V SP+  CK  + G E+A V  + N G+    RYAN L F  +   
Sbjct  94   VADEHEHEICESMLVSSPESRCKTPLQGRERARVFLSHNNGIASDTRYANSLGFQTDTPL  153

Query  530  ERCHKVLE  553
              C ++L+
Sbjct  154  SVCAELLK  161



>ref|XP_010499433.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 78/133 (59%), Gaps = 4/133 (3%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G VYCDTCRVQF TR+S+++ G  V+L+CK  +N+TVT + E  T + G Y + V
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEV  90

Query  353  DREHENDTCEVTVVKSPKEDCKET--MAGLEKAT-VVCTENVG-VNGSIRYANPLFFMKN  520
              +HE + CE+ +V+SP  +C E      L  A  +  T N G V+   R  NPL FM+ 
Sbjct  91   MGDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRK  150

Query  521  KADERCHKVLEEI  559
                 C +  +E+
Sbjct  151  TPLADCPQAFKEL  163



>gb|AFW77548.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 76/130 (58%), Gaps = 1/130 (1%)
 Frame = +2

Query  164  PAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYN  343
            P+  F V G+VYCD CR  F+T +S  + G  V ++C++ +++ V   AE  T A G Y 
Sbjct  23   PSPGFVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYR  82

Query  344  LSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGS-IRYANPLFFMKN  520
            + +  +H+++ CEV ++KSP+ DC E     ++  V  T N G+  S IRYANP+ F + 
Sbjct  83   MEISGDHQDEICEVLLLKSPEADCAEIERTRDRCRVPLTRNDGIRQSGIRYANPIAFFRK  142

Query  521  KADERCHKVL  550
            +    C ++L
Sbjct  143  EPLSNCGELL  152



>ref|XP_010478273.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 78/133 (59%), Gaps = 4/133 (3%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G VYCDTCRVQF TR+S+++ G  V+L+CK  +N+TVT + E  T + G Y + V
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYEMEV  90

Query  353  DREHENDTCEVTVVKSPKEDCKET--MAGLEKAT-VVCTENVG-VNGSIRYANPLFFMKN  520
              +HE + CE+ +V+SP  +C E      L  A  +  T N G V+   R  NPL FM+ 
Sbjct  91   MGDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRK  150

Query  521  KADERCHKVLEEI  559
                 C +  +E+
Sbjct  151  TPLADCPQAFKEL  163



>emb|CDY69202.1| BnaCnng62360D [Brassica napus]
Length=171

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 78/134 (58%), Gaps = 6/134 (4%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G VYCDTCRVQF TR+S+ + G  V+L+CK  +N+TVT + E  T  DG Y + V
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAMTDKDGNYEMEV  90

Query  353  DREHENDTCEVTVVKSPKEDC-----KETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
              +HE + CE+ +V+SP  +C     +E +    + ++   + + V+   R  NPL FM+
Sbjct  91   MGDHEEEVCEIILVQSPDAECGDVNNQEFLRNAARISLTANDGI-VSNETRTINPLGFMR  149

Query  518  NKADERCHKVLEEI  559
                  C +  +E+
Sbjct  150  KTPLADCPQAFKEL  163



>gb|EYU31033.1| hypothetical protein MIMGU_mgv1a015328mg [Erythranthe guttata]
Length=161

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 78/136 (57%), Gaps = 0/136 (0%)
 Frame = +2

Query  167  AEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNL  346
             + F V+G VYCD+CR  F+T +++YM    VR++C++ D+  +TY+ E  T   G Y+ 
Sbjct  26   GDPFLVKGCVYCDSCRCGFETDVTKYMPSAKVRIECRDRDSAKLTYTQEAVTDESGCYSA  85

Query  347  SVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKA  526
             V  +   D C+  +VKS  ++C    AG ++A V+ T N G+  ++RYAN + F+KN  
Sbjct  86   VVQSDRGEDFCDAVLVKSSDDECSVPNAGRDRARVILTRNNGMTDNVRYANNMGFLKNIP  145

Query  527  DERCHKVLEEINFSSN  574
               C ++L +     N
Sbjct  146  LSNCAQILHKYQIIDN  161



>ref|XP_009102877.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY15649.1| BnaA07g08200D [Brassica napus]
Length=171

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 78/134 (58%), Gaps = 6/134 (4%)
 Frame = +2

Query  173  KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSV  352
            +F ++G VYCDTCRVQF TR+S+ + G  V+L+CK  +N+TVT + E  T  DG Y + V
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAMTDKDGNYEMEV  90

Query  353  DREHENDTCEVTVVKSPKEDC-----KETMAGLEKATVVCTENVGVNGSIRYANPLFFMK  517
              +HE + CE+ +V+SP  +C     +E +    + ++   + + V+   R  NPL FM+
Sbjct  91   MGDHEEEVCEIILVQSPDAECGDVNNQEFLRNAARISLTANDGI-VSNETRTINPLGFMR  149

Query  518  NKADERCHKVLEEI  559
                  C +  +E+
Sbjct  150  KTPLADCPQAFKEL  163



>ref|NP_001237189.1| uncharacterized protein LOC100305566 precursor [Glycine max]
 gb|ACU13310.1| unknown [Glycine max]
Length=162

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (54%), Gaps = 1/140 (1%)
 Frame = +2

Query  164  PAE-KFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKY  340
            PA+  F V+G+VYC  CR  F+T  + Y+AG  + L CK+  +  V Y+ +G T + G Y
Sbjct  23   PAKNPFCVKGRVYCGPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAY  82

Query  341  NLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKN  520
             + VD +H +  C   +V SP   CKE   G ++A V+ T   G+    R+AN + FM  
Sbjct  83   TMCVDEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVIPTRYNGIASDDRFANAMGFMSQ  142

Query  521  KADERCHKVLEEINFSSNEN  580
            +    C ++L +     NEN
Sbjct  143  EVASGCAEILRQYQEFDNEN  162



>gb|AAQ10274.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=131

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 77/123 (63%), Gaps = 2/123 (2%)
 Frame = +2

Query  194  VYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVDREHEND  373
            V CDTCR  F T +SE++ G  VRL CK+ +N  +T++  G T A+G Y++ V+R+H+N+
Sbjct  3    VSCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKNE  62

Query  374  TCEVTVVKSPKEDCKETMA-GLEKATVVCTENVGVNGSIRYANPLFFMKNKADERCHKVL  550
             CE+T++ S ++DC E    G  K ++    N  VNG+ R  NPL F K +A  +C +V 
Sbjct  63   FCEITLISSGRKDCDEIPTEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQVY  121

Query  551  EEI  559
             ++
Sbjct  122  NKL  124



>ref|XP_006289520.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
 gb|EOA22418.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
Length=160

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +2

Query  176  FTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDNETVTYSAEGETGADGKYNLSVD  355
            F VRG+VYCDTC   F+T  S Y+ G VVRL+CK+     +TYS E  T + G Y + V 
Sbjct  28   FVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILVS  87

Query  356  REHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFMKNKADER  535
             +H++  C+ T+V+S +  C     G ++A V  T   G+    R+AN L F+++ A   
Sbjct  88   EDHDDQFCDATLVRSSQLRCSNVSPGHDRARVTLTRFNGIASDERFANSLGFVRDAAMPG  147

Query  536  CHKVLE  553
            C ++++
Sbjct  148  CAEIMK  153



>emb|CDP01424.1| unnamed protein product [Coffea canephora]
Length=159

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = +2

Query  158  GAPAEKFTVRGKVYCDTCRVQFQTRISEYMAGVVVRLDCKNTDN-ETVTYSAEGETGADG  334
             A  E FTV GKVYCDTCRV ++T  + Y+ G +V+L CK  DN + +T++ E  T + G
Sbjct  19   AAIPEPFTVTGKVYCDTCRVGYETPATTYLPGCIVKLVCKKRDNPDQITFTKEATTDSTG  78

Query  335  KYNLSVDREHENDTCEVTVVKSPKEDCKETMAGLEKATVVCTENVGVNGSIRYANPLFFM  514
            KY + V  +  +D CE+  VKS    C    AG + A +  T N G+  ++R+AN + + 
Sbjct  79   KYEMQVAYDAGDDICEMEHVKSSDPTCATPNAGRDHARICLTRNNGMVSNVRHANNIGYF  138

Query  515  KNKADERCHKVLE  553
            ++    RC ++L+
Sbjct  139  RDVPLARCPQILQ  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1130594545322