BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83498_g1_i1 len=711 path=[1:0-710]

Length=711
                                                                      Score     E

ref|XP_006366619.1|  PREDICTED: dirigent protein 21-like                210   3e-64   
ref|XP_009601995.1|  PREDICTED: dirigent protein 21-like                206   8e-63   
ref|XP_011088575.1|  PREDICTED: dirigent protein 21-like                206   8e-63   
ref|XP_004248664.1|  PREDICTED: dirigent protein 22-like                205   2e-62   
ref|XP_006366617.1|  PREDICTED: dirigent protein 21-like                204   7e-62   
ref|XP_009759252.1|  PREDICTED: dirigent protein 21-like                203   9e-62   
ref|XP_007041903.1|  Disease resistance-responsive family protein...    196   7e-59   
ref|XP_006366609.1|  PREDICTED: dirigent protein 21-like                193   8e-58   
ref|XP_006366608.1|  PREDICTED: dirigent protein 21-like                192   2e-57   
ref|XP_009588577.1|  PREDICTED: dirigent protein 22-like                191   5e-57   
ref|XP_006366620.1|  PREDICTED: dirigent protein 7-like                 190   1e-56   
ref|XP_004248663.1|  PREDICTED: dirigent protein 22-like                189   2e-56   
ref|XP_009771303.1|  PREDICTED: dirigent protein 22-like                189   3e-56   
ref|XP_006361043.1|  PREDICTED: dirigent protein 19-like                189   4e-56   
emb|CDO96939.1|  unnamed protein product                                189   6e-56   
ref|XP_011088571.1|  PREDICTED: dirigent protein 21-like                189   6e-56   
emb|CDO96938.1|  unnamed protein product                                187   2e-55   
ref|XP_004248662.1|  PREDICTED: dirigent protein 22-like                186   3e-55   
ref|XP_009621800.1|  PREDICTED: dirigent protein 22-like                186   6e-55   
ref|XP_006363503.1|  PREDICTED: dirigent protein 19-like                186   6e-55   
ref|XP_004248124.1|  PREDICTED: dirigent protein 22-like                185   9e-55   
emb|CDP16947.1|  unnamed protein product                                185   9e-55   
ref|XP_009762401.1|  PREDICTED: dirigent protein 22-like                184   2e-54   
ref|XP_006363502.1|  PREDICTED: dirigent protein 19-like                183   4e-54   
ref|XP_011092911.1|  PREDICTED: dirigent protein 21-like                181   2e-53   
ref|XP_006366618.1|  PREDICTED: dirigent protein 21-like                181   3e-53   
ref|XP_007041902.1|  Disease resistance-responsive family protein...    180   1e-52   
emb|CDP14404.1|  unnamed protein product                                179   1e-52   
ref|XP_011088574.1|  PREDICTED: dirigent protein 22-like                179   2e-52   
ref|XP_004231597.1|  PREDICTED: dirigent protein 22-like                178   6e-52   
ref|XP_006366615.1|  PREDICTED: dirigent protein 20-like                177   1e-51   
dbj|BAF02555.1|  hypothetical protein                                   176   3e-51   Nicotiana benthamiana
ref|XP_004231598.1|  PREDICTED: dirigent protein 22-like                176   3e-51   
emb|CDP16948.1|  unnamed protein product                                175   2e-50   
gb|EYU37929.1|  hypothetical protein MIMGU_mgv1a025367mg                171   1e-49   
ref|XP_004231599.1|  PREDICTED: dirigent protein 22-like                172   1e-49   
ref|XP_009610659.1|  PREDICTED: dirigent protein 1-like                 171   2e-49   
ref|XP_010065287.1|  PREDICTED: dirigent protein 23-like                171   5e-49   
emb|CDP16946.1|  unnamed protein product                                170   3e-48   
ref|XP_009768004.1|  PREDICTED: dirigent protein 1-like                 168   4e-48   
emb|CDP15168.1|  unnamed protein product                                168   4e-48   
ref|XP_009601144.1|  PREDICTED: dirigent protein 11-like                168   6e-48   
ref|XP_009791435.1|  PREDICTED: dirigent protein 11-like                167   9e-48   
ref|XP_010023736.1|  PREDICTED: dirigent protein 23-like                166   3e-47   
ref|XP_010023728.1|  PREDICTED: dirigent protein 23-like                165   6e-47   
gb|KCW90019.1|  hypothetical protein EUGRSUZ_A02219                     165   7e-47   
ref|XP_010041372.1|  PREDICTED: dirigent protein 23-like                165   7e-47   
gb|KDP20413.1|  hypothetical protein JCGZ_06372                         164   1e-46   
ref|XP_007200808.1|  hypothetical protein PRUPE_ppa025557mg             162   3e-46   
emb|CDP16945.1|  unnamed protein product                                163   5e-46   
ref|XP_002276741.3|  PREDICTED: dirigent protein 23-like                162   5e-46   Vitis vinifera
ref|XP_008235983.1|  PREDICTED: dirigent protein 21-like                162   1e-45   
ref|XP_006359663.1|  PREDICTED: dirigent protein 1-like                 161   2e-45   
ref|XP_010065290.1|  PREDICTED: dirigent protein 23-like                161   4e-45   
ref|XP_010039751.1|  PREDICTED: dirigent protein 23-like isoform X2     159   1e-44   
emb|CAN76752.1|  hypothetical protein VITISV_009422                     157   3e-44   Vitis vinifera
ref|XP_010039750.1|  PREDICTED: dirigent protein 23-like isoform X1     160   6e-44   
emb|CDP16943.1|  unnamed protein product                                157   1e-43   
ref|XP_007029072.1|  Disease resistance-responsive family protein       156   2e-43   
ref|XP_006353783.1|  PREDICTED: dirigent protein 21-like                156   2e-43   
ref|XP_007041904.1|  Disease resistance-responsive (dirigent-like...    156   2e-43   
ref|XP_002280963.1|  PREDICTED: dirigent protein 22                     156   2e-43   Vitis vinifera
ref|XP_010257547.1|  PREDICTED: dirigent protein 21-like                155   3e-43   
ref|XP_009342232.1|  PREDICTED: dirigent protein 22-like                155   3e-43   
ref|XP_009630041.1|  PREDICTED: dirigent protein 22-like                155   4e-43   
ref|XP_009775777.1|  PREDICTED: dirigent protein 22-like                155   4e-43   
ref|XP_002323336.2|  hypothetical protein POPTR_0016s06070g             155   7e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006388055.1|  hypothetical protein POPTR_0378s00200g             154   1e-42   
ref|XP_004231011.1|  PREDICTED: dirigent protein 1-like                 154   1e-42   
emb|CDP19245.1|  unnamed protein product                                154   2e-42   
ref|XP_007029066.1|  Disease resistance-responsive family protein       153   2e-42   
ref|XP_004243690.1|  PREDICTED: dirigent protein 22-like                153   3e-42   
ref|XP_007203174.1|  hypothetical protein PRUPE_ppa024560mg             153   4e-42   
ref|XP_008356707.1|  PREDICTED: dirigent protein 22-like                152   4e-42   
ref|XP_010243406.1|  PREDICTED: dirigent protein 2-like                 153   4e-42   
ref|XP_006851948.1|  hypothetical protein AMTR_s00041p00182920          152   5e-42   
ref|XP_002280791.1|  PREDICTED: dirigent protein 22                     152   5e-42   Vitis vinifera
emb|CAN76521.1|  hypothetical protein VITISV_000433                     150   8e-42   Vitis vinifera
ref|XP_010101075.1|  hypothetical protein L484_007310                   152   2e-41   
emb|CDP15163.1|  unnamed protein product                                151   2e-41   
ref|XP_010048806.1|  PREDICTED: dirigent protein 21-like                149   5e-41   
ref|XP_010058355.1|  PREDICTED: dirigent protein 22-like                149   7e-41   
ref|XP_010048736.1|  PREDICTED: dirigent protein 22-like                149   8e-41   
gb|KCW62722.1|  hypothetical protein EUGRSUZ_G00300                     149   1e-40   
ref|XP_007162361.1|  hypothetical protein PHAVU_001G145500g             149   1e-40   
ref|XP_007204144.1|  hypothetical protein PRUPE_ppa021998mg             149   1e-40   
ref|XP_002280711.1|  PREDICTED: dirigent protein 22                     148   2e-40   Vitis vinifera
ref|XP_007029065.1|  Disease resistance-responsive family protein       148   3e-40   
gb|EYU37930.1|  hypothetical protein MIMGU_mgv11b012093mg               147   4e-40   
ref|XP_002313728.1|  disease resistance-responsive family protein       147   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008241180.1|  PREDICTED: dirigent protein 21-like                147   4e-40   
ref|XP_008241179.1|  PREDICTED: dirigent protein 21-like                147   5e-40   
ref|XP_002280817.1|  PREDICTED: dirigent protein 2                      147   7e-40   Vitis vinifera
ref|XP_006841309.1|  hypothetical protein AMTR_s00134p00117580          147   7e-40   
ref|XP_011046627.1|  PREDICTED: dirigent protein 23                     147   8e-40   
emb|CAN61168.1|  hypothetical protein VITISV_038109                     145   9e-40   Vitis vinifera
ref|XP_002309288.2|  hypothetical protein POPTR_0006s20990g             147   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011047083.1|  PREDICTED: dirigent protein 22-like                147   1e-39   
ref|XP_007162358.1|  hypothetical protein PHAVU_001G145200g             146   1e-39   
ref|XP_006841304.1|  hypothetical protein AMTR_s00134p00100380          146   1e-39   
ref|XP_006492824.1|  PREDICTED: dirigent protein 23-like                145   2e-39   
ref|XP_003554227.1|  PREDICTED: dirigent protein 21-like                145   2e-39   
ref|XP_009388280.1|  PREDICTED: dirigent protein 22-like                145   3e-39   
ref|XP_009342233.1|  PREDICTED: dirigent protein 22-like                145   3e-39   
gb|KCW44400.1|  hypothetical protein EUGRSUZ_L02111                     144   3e-39   
ref|XP_011037132.1|  PREDICTED: dirigent protein 4-like                 145   4e-39   
emb|CDP10173.1|  unnamed protein product                                144   4e-39   
gb|KDO70858.1|  hypothetical protein CISIN_1g043227mg                   145   4e-39   
gb|KDP27569.1|  hypothetical protein JCGZ_19574                         144   5e-39   
ref|XP_010058351.1|  PREDICTED: dirigent protein 22-like                144   7e-39   
ref|XP_007145709.1|  hypothetical protein PHAVU_007G261700g             144   8e-39   
ref|XP_009346640.1|  PREDICTED: dirigent protein 23-like                144   1e-38   
ref|XP_006849316.1|  hypothetical protein AMTR_s03766p00005550          144   1e-38   
emb|CAN69110.1|  hypothetical protein VITISV_006598                     142   1e-38   Vitis vinifera
ref|XP_010024241.1|  PREDICTED: dirigent protein 22-like                143   2e-38   
ref|XP_006841312.1|  hypothetical protein AMTR_s00134p00124080          144   2e-38   
ref|XP_010024253.1|  PREDICTED: dirigent protein 22-like                143   2e-38   
gb|ABK93789.1|  unknown                                                 143   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_002323339.2|  hypothetical protein POPTR_0016s06100g             143   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006492825.1|  PREDICTED: dirigent protein 3-like                 142   3e-38   
ref|XP_004289850.1|  PREDICTED: disease resistance response prote...    142   4e-38   
gb|KDO70859.1|  hypothetical protein CISIN_1g029641mg                   142   4e-38   
ref|XP_010935386.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    142   8e-38   
ref|XP_002323338.1|  hypothetical protein POPTR_0016s06090g             142   8e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011039496.1|  PREDICTED: dirigent protein 22-like                141   9e-38   
ref|XP_007162356.1|  hypothetical protein PHAVU_001G145000g             141   1e-37   
ref|XP_007029061.1|  Disease resistance-responsive (dirigent-like...    141   1e-37   
ref|XP_006487695.1|  PREDICTED: dirigent protein 23-like                140   1e-37   
ref|XP_006843315.1|  hypothetical protein AMTR_s00913p00008360          140   2e-37   
ref|XP_007029062.1|  Disease resistance-responsive family protein       140   2e-37   
ref|XP_010912514.1|  PREDICTED: dirigent protein 22-like                140   3e-37   
ref|XP_002531174.1|  Disease resistance response protein, putative      140   4e-37   Ricinus communis
ref|XP_009602000.1|  PREDICTED: dirigent protein 21-like                139   4e-37   
ref|XP_006495204.1|  PREDICTED: dirigent protein 4-like                 139   4e-37   
ref|XP_009367567.1|  PREDICTED: dirigent protein 22-like                140   4e-37   
ref|XP_004305538.1|  PREDICTED: disease resistance response prote...    140   5e-37   
ref|XP_006851957.1|  hypothetical protein AMTR_s00041p00187460          139   5e-37   
ref|XP_006851956.1|  hypothetical protein AMTR_s00041p00187220          140   5e-37   
ref|XP_010106404.1|  hypothetical protein L484_008609                   139   5e-37   
ref|XP_011075257.1|  PREDICTED: dirigent protein 21-like                139   6e-37   
ref|XP_003554226.1|  PREDICTED: dirigent protein 21-like                139   7e-37   
ref|XP_006829600.1|  hypothetical protein AMTR_s01147p00007290          138   8e-37   
ref|XP_008789330.1|  PREDICTED: dirigent protein 22-like                139   8e-37   
gb|KDO39789.1|  hypothetical protein CISIN_1g038159mg                   139   9e-37   
ref|XP_010912515.1|  PREDICTED: dirigent protein 19-like                139   9e-37   
ref|XP_008372887.1|  PREDICTED: dirigent protein 23                     139   1e-36   
ref|XP_007162359.1|  hypothetical protein PHAVU_001G145300g             138   1e-36   
ref|XP_011039494.1|  PREDICTED: dirigent protein 22-like                138   2e-36   
ref|XP_002312128.2|  disease resistance-responsive family protein       137   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_003519012.1|  PREDICTED: dirigent protein 21-like                138   2e-36   
ref|XP_006841401.1|  hypothetical protein AMTR_s00901p00009100          137   2e-36   
ref|XP_006851935.1|  hypothetical protein AMTR_s00041p00177300          137   3e-36   
ref|XP_010912513.1|  PREDICTED: dirigent protein 22-like                137   3e-36   
ref|XP_002276258.2|  PREDICTED: dirigent protein 22-like                137   3e-36   Vitis vinifera
ref|XP_006423624.1|  hypothetical protein CICLE_v10030187mg             137   3e-36   
gb|KDO35808.1|  hypothetical protein CISIN_1g029442mg                   137   3e-36   
gb|KDO43263.1|  hypothetical protein CISIN_1g045658mg                   137   3e-36   
gb|ABR27716.1|  dirigent-like protein                                   137   4e-36   Picea sitchensis
ref|XP_006495208.1|  PREDICTED: dirigent protein 4-like                 137   4e-36   
ref|XP_006836063.1|  hypothetical protein AMTR_s00114p00093910          138   4e-36   
ref|XP_010024264.1|  PREDICTED: dirigent protein 21-like                137   5e-36   
gb|KCW90339.1|  hypothetical protein EUGRSUZ_A02485                     136   5e-36   
ref|XP_006829349.1|  hypothetical protein AMTR_s01152p00009680          135   5e-36   
ref|XP_002266452.2|  PREDICTED: dirigent protein 22                     136   6e-36   Vitis vinifera
ref|XP_010531503.1|  PREDICTED: dirigent protein 23                     136   6e-36   
ref|XP_006833077.1|  hypothetical protein AMTR_s00995p00008650          136   6e-36   
ref|XP_006851938.1|  hypothetical protein AMTR_s00041p00178600          136   6e-36   
ref|XP_006836064.1|  hypothetical protein AMTR_s00114p00094280          135   6e-36   
ref|XP_006485326.1|  PREDICTED: dirigent protein 4-like                 136   7e-36   
ref|XP_006851932.1|  hypothetical protein AMTR_s00041p00176310          136   7e-36   
emb|CAN73498.1|  hypothetical protein VITISV_044265                     136   7e-36   Vitis vinifera
gb|KCW90335.1|  hypothetical protein EUGRSUZ_A02479                     136   8e-36   
ref|XP_002276722.1|  PREDICTED: dirigent protein 23-like                136   8e-36   Vitis vinifera
ref|XP_010520009.1|  PREDICTED: dirigent protein 22-like                136   8e-36   
gb|EYU28943.1|  hypothetical protein MIMGU_mgv1a014280mg                136   9e-36   
ref|XP_006423625.1|  hypothetical protein CICLE_v10030326mg             136   1e-35   
ref|XP_007162357.1|  hypothetical protein PHAVU_001G145100g             136   1e-35   
ref|XP_006492823.1|  PREDICTED: dirigent protein 11-like                136   1e-35   
gb|AAZ20288.1|  disease resistance-responsive family protein            136   1e-35   Arachis hypogaea [goober]
ref|XP_006851942.1|  hypothetical protein AMTR_s00041p00180140          135   1e-35   
ref|XP_006495161.1|  PREDICTED: dirigent protein 4-like                 136   1e-35   
ref|XP_007041905.1|  Disease resistance response protein, putative      136   1e-35   
ref|XP_010090301.1|  hypothetical protein L484_024966                   135   1e-35   
gb|KHN40690.1|  Disease resistance response protein 206                 135   1e-35   
ref|NP_001236063.1|  uncharacterized protein LOC100305740 precursor     135   2e-35   
ref|XP_010930785.1|  PREDICTED: dirigent protein 22-like                135   2e-35   
ref|XP_002528277.1|  Disease resistance response protein, putative      135   2e-35   Ricinus communis
gb|KEH41749.1|  disease resistance response protein                     135   2e-35   
gb|KDO36723.1|  hypothetical protein CISIN_1g030123mg                   135   3e-35   
ref|XP_008245704.1|  PREDICTED: dirigent protein 23                     134   4e-35   
ref|XP_010243405.1|  PREDICTED: dirigent protein 21-like                133   4e-35   
ref|XP_006851951.1|  hypothetical protein AMTR_s00041p00184120          134   4e-35   
ref|XP_008807680.1|  PREDICTED: dirigent protein 22-like                134   5e-35   
ref|XP_006851934.1|  hypothetical protein AMTR_s00041p00176950          134   5e-35   
ref|XP_004289851.1|  PREDICTED: disease resistance response prote...    134   6e-35   
ref|XP_008356340.1|  PREDICTED: dirigent protein 23-like                134   6e-35   
gb|ABD52123.1|  dirigent-like protein pDIR12                            134   6e-35   Picea glauca
gb|AFK35208.1|  unknown                                                 134   6e-35   
ref|XP_006829391.1|  hypothetical protein AMTR_s04829p00003930          134   7e-35   
ref|XP_010911804.1|  PREDICTED: dirigent protein 22-like                134   7e-35   
ref|NP_001241301.1|  uncharacterized protein LOC100775617 precursor     134   7e-35   
ref|XP_006837280.1|  hypothetical protein AMTR_s02003p00008260          134   7e-35   
ref|XP_010041373.1|  PREDICTED: dirigent protein 23-like                133   8e-35   
ref|XP_011093984.1|  PREDICTED: dirigent protein 21-like                134   8e-35   
gb|KCW55492.1|  hypothetical protein EUGRSUZ_I01390                     133   9e-35   
ref|XP_009340248.1|  PREDICTED: dirigent protein 1-like                 133   1e-34   
gb|ADP55095.1|  dirigent-like protein                                   133   1e-34   
gb|KEH28830.1|  disease resistance response protein                     133   1e-34   
gb|ADP55097.1|  dirigent-like protein                                   133   1e-34   
gb|KCW44402.1|  hypothetical protein EUGRSUZ_L02114                     132   1e-34   
ref|XP_010243404.1|  PREDICTED: dirigent protein 22-like                133   1e-34   
ref|XP_009346643.1|  PREDICTED: dirigent protein 23                     133   1e-34   
ref|XP_002313729.2|  hypothetical protein POPTR_0009s13340g             133   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010520657.1|  PREDICTED: dirigent protein 22-like                133   2e-34   
gb|ADP55098.1|  dirigent-like protein                                   132   2e-34   
ref|XP_010243401.1|  PREDICTED: dirigent protein 22-like isoform X1     132   2e-34   
ref|XP_009791434.1|  PREDICTED: dirigent protein 23-like                132   2e-34   
ref|XP_007134633.1|  hypothetical protein PHAVU_010G063400g             132   2e-34   
ref|XP_010024277.1|  PREDICTED: dirigent protein 21-like                132   2e-34   
ref|XP_011046639.1|  PREDICTED: dirigent protein 4-like                 132   3e-34   
ref|XP_008457663.1|  PREDICTED: dirigent protein 23-like                132   3e-34   
ref|XP_008384408.1|  PREDICTED: dirigent protein 22-like                132   3e-34   
gb|ABR27717.1|  dirigent-like protein                                   132   3e-34   Picea sitchensis
ref|XP_002276417.3|  PREDICTED: dirigent protein 22-like                133   3e-34   Vitis vinifera
ref|XP_006851952.1|  hypothetical protein AMTR_s00041p00184770          132   4e-34   
ref|XP_008799043.1|  PREDICTED: dirigent protein 21-like                132   4e-34   
gb|ADP55101.1|  dirigent-like protein                                   131   5e-34   
ref|XP_004514254.1|  PREDICTED: disease resistance response prote...    132   5e-34   
ref|XP_010416851.1|  PREDICTED: dirigent protein 23-like                131   6e-34   
ref|XP_006851937.1|  hypothetical protein AMTR_s00041p00178500          131   6e-34   
ref|XP_006464972.1|  PREDICTED: dirigent protein 23-like                131   7e-34   
ref|XP_010427714.1|  PREDICTED: dirigent protein 21-like                131   8e-34   
gb|EYU31698.1|  hypothetical protein MIMGU_mgv1a026952mg                130   9e-34   
ref|XP_011080616.1|  PREDICTED: dirigent protein 21-like                131   9e-34   
ref|XP_003529182.1|  PREDICTED: dirigent protein 19-like                131   9e-34   
gb|ABD52118.1|  dirigent-like protein pDIR7                             131   1e-33   Picea glauca
ref|NP_850009.1|  dirigent protein 23                                   130   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004514253.1|  PREDICTED: disease resistance response prote...    131   1e-33   
gb|ABD52114.1|  dirigent-like protein pDIR3                             130   1e-33   Picea engelmannii x Picea glauca
gb|AFK45947.1|  unknown                                                 131   1e-33   
ref|XP_009364104.1|  PREDICTED: dirigent protein 22-like                130   1e-33   
gb|KEH28829.1|  disease resistance response protein                     131   1e-33   
ref|XP_004153955.1|  PREDICTED: disease resistance response prote...    130   1e-33   
ref|XP_010030689.1|  PREDICTED: dirigent protein 23-like                130   1e-33   
ref|XP_010024289.1|  PREDICTED: dirigent protein 21-like                130   1e-33   
ref|XP_009377686.1|  PREDICTED: dirigent protein 22-like                130   1e-33   
ref|XP_009394038.1|  PREDICTED: dirigent protein 23-like                130   1e-33   
ref|XP_009404870.1|  PREDICTED: dirigent protein 22-like                130   1e-33   
ref|XP_009610660.1|  PREDICTED: dirigent protein 23-like                130   2e-33   
ref|XP_007201657.1|  hypothetical protein PRUPE_ppa022063mg             130   2e-33   
gb|EYU40130.1|  hypothetical protein MIMGU_mgv1a015023mg                130   2e-33   
ref|XP_006838077.1|  hypothetical protein AMTR_s01623p00005280          129   2e-33   
ref|XP_002880356.1|  hypothetical protein ARALYDRAFT_480959             130   2e-33   
ref|XP_010093168.1|  hypothetical protein L484_001308                   130   2e-33   
ref|XP_006445858.1|  hypothetical protein CICLE_v10016828mg             130   2e-33   
ref|XP_004147026.1|  PREDICTED: disease resistance response prote...    130   2e-33   
ref|XP_010058379.1|  PREDICTED: dirigent protein 22-like                130   2e-33   
gb|KDP21891.1|  hypothetical protein JCGZ_03029                         130   2e-33   
gb|ABD52121.1|  dirigent-like protein pDIR10                            130   2e-33   Picea glauca
ref|XP_010273310.1|  PREDICTED: dirigent protein 22-like                130   2e-33   
gb|ABD52112.1|  dirigent-like protein pDIR1                             130   2e-33   Picea glauca
ref|XP_010429003.1|  PREDICTED: dirigent protein 23                     130   3e-33   
gb|ACN41081.1|  unknown                                                 130   3e-33   Picea sitchensis
gb|AFK39378.1|  unknown                                                 130   3e-33   
ref|XP_007041913.1|  Disease resistance-responsive family protein       129   3e-33   
ref|XP_010910756.1|  PREDICTED: dirigent protein 22-like                129   4e-33   
ref|XP_011088956.1|  PREDICTED: dirigent protein 22-like                129   4e-33   
gb|EYU31570.1|  hypothetical protein MIMGU_mgv1a026142mg                129   4e-33   
ref|XP_010257546.1|  PREDICTED: dirigent protein 22-like                129   5e-33   
ref|XP_007140190.1|  hypothetical protein PHAVU_008G091600g             129   5e-33   
gb|AAB72169.1|  hypothetical protein                                    129   5e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AFK42454.1|  unknown                                                 129   5e-33   
ref|NP_173703.2|  disease resistance-responsive, dirigent domain-...    129   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006851940.1|  hypothetical protein AMTR_s00041p00179310          129   6e-33   
ref|XP_010257550.1|  PREDICTED: dirigent protein 22-like                129   6e-33   
ref|XP_011089696.1|  PREDICTED: dirigent protein 22-like                129   6e-33   
emb|CDP13134.1|  unnamed protein product                                127   7e-33   
gb|KEH28826.1|  disease resistance response protein                     129   8e-33   
ref|NP_001240070.1|  uncharacterized protein LOC100808529 precursor     129   8e-33   
gb|KHN07457.1|  Disease resistance response protein 206                 128   8e-33   
ref|XP_003521232.1|  PREDICTED: dirigent protein 21-like                129   8e-33   
ref|XP_011078493.1|  PREDICTED: dirigent protein 22-like                128   9e-33   
gb|ABD52120.1|  dirigent-like protein pDIR9                             128   1e-32   
ref|XP_007041912.1|  Disease resistance-responsive family protein       128   1e-32   
ref|XP_007014760.1|  Disease resistance-responsive (dirigent-like...    128   1e-32   
ref|XP_008783384.1|  PREDICTED: dirigent protein 22-like                128   1e-32   
ref|XP_006485705.1|  PREDICTED: dirigent protein 23-like                127   1e-32   
ref|XP_006492696.1|  PREDICTED: dirigent protein 19-like                128   1e-32   
gb|ACU55136.1|  dirigent-like protein 2                                 128   1e-32   
ref|XP_009388050.1|  PREDICTED: dirigent protein 22-like                128   1e-32   
ref|XP_008351083.1|  PREDICTED: dirigent protein 22-like                128   1e-32   
ref|XP_010257548.1|  PREDICTED: dirigent protein 19-like                128   1e-32   
emb|CDP13148.1|  unnamed protein product                                128   1e-32   
ref|XP_006601731.1|  PREDICTED: uncharacterized protein LOC100305...    135   2e-32   
ref|XP_006445860.1|  hypothetical protein CICLE_v10016848mg             127   2e-32   
ref|XP_002537933.1|  Disease resistance response protein, putative      127   2e-32   
ref|XP_010101147.1|  hypothetical protein L484_016711                   128   2e-32   
ref|XP_004294970.1|  PREDICTED: disease resistance response prote...    128   2e-32   
gb|KEH28824.1|  disease resistance response protein                     128   2e-32   
ref|XP_010257545.1|  PREDICTED: dirigent protein 19-like                128   2e-32   
ref|XP_004514163.1|  PREDICTED: disease resistance response prote...    127   2e-32   
gb|ABD52115.1|  dirigent-like protein pDIR4                             127   2e-32   
ref|XP_010693845.1|  PREDICTED: dirigent protein 21-like                127   2e-32   
ref|XP_009781679.1|  PREDICTED: dirigent protein 23-like                127   2e-32   
ref|XP_006359662.1|  PREDICTED: dirigent protein 23-like                127   2e-32   
ref|XP_008799193.1|  PREDICTED: dirigent protein 22-like                127   2e-32   
gb|EYU30477.1|  hypothetical protein MIMGU_mgv1a014173mg                127   2e-32   
gb|AFA36428.1|  dirigent-like protein                                   127   3e-32   
gb|ACN40835.1|  unknown                                                 127   3e-32   
gb|KDP34473.1|  hypothetical protein JCGZ_12756                         127   3e-32   
ref|XP_006487488.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    126   3e-32   
ref|XP_006344589.1|  PREDICTED: dirigent protein 19-like                127   3e-32   
gb|KDP40497.1|  hypothetical protein JCGZ_24496                         125   3e-32   
ref|XP_010472250.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    127   4e-32   
ref|XP_004493624.1|  PREDICTED: disease resistance response prote...    127   4e-32   
ref|XP_010472088.1|  PREDICTED: dirigent protein 23-like                126   4e-32   
ref|XP_010489788.1|  PREDICTED: dirigent protein 22-like                127   4e-32   
ref|XP_002280722.1|  PREDICTED: dirigent protein 2-like                 126   4e-32   
gb|KDP44330.1|  hypothetical protein JCGZ_19197                         127   4e-32   
ref|XP_009346642.1|  PREDICTED: dirigent protein 4-like                 126   5e-32   
ref|XP_003554229.1|  PREDICTED: dirigent protein 2-like                 126   5e-32   
ref|XP_004491522.1|  PREDICTED: disease resistance response prote...    126   5e-32   
gb|KDO65648.1|  hypothetical protein CISIN_1g043734mg                   126   5e-32   
ref|XP_011078809.1|  PREDICTED: dirigent protein 21-like                127   6e-32   
ref|NP_176762.1|  dirigent protein 21                                   126   6e-32   
emb|CDP13135.1|  unnamed protein product                                125   6e-32   
ref|XP_010999585.1|  PREDICTED: dirigent protein 22-like                126   7e-32   
emb|CDM86469.1|  unnamed protein product                                125   8e-32   
ref|XP_006851941.1|  hypothetical protein AMTR_s00041p00179870          125   8e-32   
ref|XP_006404548.1|  hypothetical protein EUTSA_v10000677mg             125   9e-32   
gb|KDP34475.1|  hypothetical protein JCGZ_12758                         125   1e-31   
gb|AAD29806.1|  putative disease resistance response protein            128   1e-31   
ref|XP_006295056.1|  hypothetical protein CARUB_v10024124mg             125   1e-31   
ref|XP_008443601.1|  PREDICTED: dirigent protein 22-like                126   1e-31   
gb|KEH28827.1|  disease resistance-responsive, dirigent domain pr...    125   1e-31   
gb|ACN40946.1|  unknown                                                 125   1e-31   
ref|XP_002315192.2|  hypothetical protein POPTR_0010s20440g             125   1e-31   
ref|XP_004292161.1|  PREDICTED: disease resistance response prote...    125   1e-31   
ref|XP_006386059.1|  hypothetical protein POPTR_0003s21460g             125   1e-31   
ref|XP_006284589.1|  hypothetical protein CARUB_v10005815mg             125   1e-31   
ref|XP_011088572.1|  PREDICTED: dirigent protein 22-like                125   1e-31   
ref|XP_006851933.1|  hypothetical protein AMTR_s00041p00176840          125   1e-31   
ref|XP_004294971.1|  PREDICTED: disease resistance response prote...    126   1e-31   
ref|XP_010468131.1|  PREDICTED: dirigent protein 22-like                125   1e-31   
ref|XP_003554228.1|  PREDICTED: dirigent protein 1-like                 125   2e-31   
ref|XP_008390157.1|  PREDICTED: dirigent protein 22-like                125   2e-31   
ref|XP_002880357.1|  disease resistance-responsive family protein       125   2e-31   
ref|XP_006411660.1|  hypothetical protein EUTSA_v10027029mg             125   2e-31   
ref|XP_004492507.1|  PREDICTED: disease resistance response prote...    125   2e-31   
ref|XP_004294972.1|  PREDICTED: disease resistance response prote...    125   3e-31   
ref|XP_007041910.1|  Disease resistance-responsive family protein       124   3e-31   
ref|XP_007207483.1|  hypothetical protein PRUPE_ppa011828mg             124   3e-31   
gb|KDP31386.1|  hypothetical protein JCGZ_11762                         124   3e-31   
ref|XP_002878187.1|  hypothetical protein ARALYDRAFT_348875             127   3e-31   
ref|XP_008225842.1|  PREDICTED: dirigent protein 22-like                124   4e-31   
ref|XP_008457658.1|  PREDICTED: dirigent protein 4-like                 124   4e-31   
ref|NP_001236934.1|  uncharacterized protein LOC100500621 precursor     124   4e-31   
gb|ADN34006.1|  disease resistance response protein                     124   4e-31   
ref|XP_010101145.1|  hypothetical protein L484_016709                   124   4e-31   
ref|XP_010427710.1|  PREDICTED: dirigent protein 21-like                124   4e-31   
ref|XP_004294973.1|  PREDICTED: disease resistance response prote...    124   4e-31   
ref|XP_003625315.1|  Disease resistance response protein                124   4e-31   
ref|XP_006492741.1|  PREDICTED: dirigent protein 7-like                 124   4e-31   
ref|XP_003617847.1|  Disease resistance response protein                124   5e-31   
ref|XP_007014759.1|  Disease resistance-responsive (dirigent-like...    124   5e-31   
gb|ACU24649.1|  unknown                                                 124   5e-31   
ref|XP_004490557.1|  PREDICTED: disease resistance response prote...    124   5e-31   
gb|EYU46052.1|  hypothetical protein MIMGU_mgv1a024219mg                124   5e-31   
ref|XP_002299656.2|  hypothetical protein POPTR_0001s22170g             123   5e-31   
ref|XP_003625316.1|  Disease resistance response protein                124   6e-31   
emb|CAB37526.1|  disease resistance response like protein               123   6e-31   
ref|XP_010535906.1|  PREDICTED: dirigent protein 19 isoform X1          123   6e-31   
ref|XP_010547336.1|  PREDICTED: dirigent protein 22-like                123   6e-31   
ref|XP_010549445.1|  PREDICTED: dirigent protein 21-like                123   7e-31   
ref|XP_008372888.1|  PREDICTED: dirigent protein 4-like                 123   7e-31   
ref|XP_010504752.1|  PREDICTED: dirigent protein 21-like                123   7e-31   
ref|XP_002882837.1|  hypothetical protein ARALYDRAFT_318143             122   8e-31   
ref|XP_009375347.1|  PREDICTED: dirigent protein 22-like                123   8e-31   
ref|XP_009388279.1|  PREDICTED: dirigent protein 22-like                123   8e-31   
ref|NP_179707.1|  dirigent protein 24                                   123   8e-31   
ref|XP_009790394.1|  PREDICTED: dirigent protein 22-like                123   8e-31   
ref|XP_002868856.1|  hypothetical protein ARALYDRAFT_912320             123   9e-31   
ref|NP_199065.1|  disease resistance-responsive (dirigent-like pr...    123   9e-31   
ref|XP_011088569.1|  PREDICTED: dirigent protein 23-like                123   9e-31   
ref|XP_010690411.1|  PREDICTED: dirigent protein 23-like                123   9e-31   
gb|ABK28504.1|  unknown                                                 123   1e-30   
ref|XP_006445861.1|  hypothetical protein CICLE_v10018248mg             123   1e-30   
ref|NP_195582.2|  disease resistance-responsive, dirigent domain-...    123   1e-30   
ref|XP_009613763.1|  PREDICTED: dirigent protein 22-like                123   1e-30   
ref|XP_009620474.1|  PREDICTED: dirigent protein 22                     123   1e-30   
emb|CDP13138.1|  unnamed protein product                                123   1e-30   
ref|XP_006407189.1|  hypothetical protein EUTSA_v10021596mg             122   1e-30   
emb|CDP11684.1|  unnamed protein product                                122   1e-30   
ref|XP_007149005.1|  hypothetical protein PHAVU_005G032500g             122   2e-30   
ref|XP_010504753.1|  PREDICTED: dirigent protein 21-like                122   2e-30   
emb|CDP13139.1|  unnamed protein product                                122   2e-30   
ref|XP_006354165.1|  PREDICTED: dirigent protein 19-like                122   2e-30   
ref|XP_008453355.1|  PREDICTED: dirigent protein 22-like                122   2e-30   
ref|XP_003625317.1|  Disease resistance response protein                122   2e-30   
gb|AFK34612.1|  unknown                                                 122   2e-30   
ref|XP_004289849.1|  PREDICTED: uncharacterized protein LOC101306772    122   2e-30   
dbj|BAK04824.1|  predicted protein                                      122   2e-30   
ref|XP_002449104.1|  hypothetical protein SORBIDRAFT_05g005200          122   2e-30   
ref|XP_010315363.1|  PREDICTED: dirigent protein 23-like                122   2e-30   
ref|XP_010911603.1|  PREDICTED: dirigent protein 22-like                122   2e-30   
ref|XP_007162362.1|  hypothetical protein PHAVU_001G145600g             122   2e-30   
gb|ABD52125.1|  dirigent-like protein pDIR14                            122   2e-30   
ref|XP_006851945.1|  hypothetical protein AMTR_s00041p00181310          122   2e-30   
ref|XP_009409210.1|  PREDICTED: dirigent protein 4-like                 122   2e-30   
gb|KDO83225.1|  hypothetical protein CISIN_1g047858mg                   122   3e-30   
ref|XP_010531506.1|  PREDICTED: dirigent protein 15                     122   3e-30   
ref|XP_007037651.1|  Disease resistance response protein, putative      121   3e-30   
ref|NP_001168549.1|  disease resistance response protein 206 prec...    121   3e-30   
ref|XP_004977240.1|  PREDICTED: disease resistance response prote...    121   3e-30   
ref|XP_004292159.1|  PREDICTED: uncharacterized protein LOC101303009    122   3e-30   
gb|KFK38713.1|  hypothetical protein AALP_AA3G150400                    121   4e-30   
ref|XP_002441906.1|  hypothetical protein SORBIDRAFT_08g004670          121   4e-30   
ref|XP_002285681.1|  PREDICTED: dirigent protein 22                     121   4e-30   
ref|XP_009339555.1|  PREDICTED: dirigent protein 23-like                121   4e-30   
ref|XP_003625319.1|  Disease resistance response protein                122   4e-30   
gb|AFG45326.1|  hypothetical protein 2_9838_01                          120   4e-30   
ref|XP_010465210.1|  PREDICTED: dirigent protein 22-like                121   4e-30   
ref|XP_009117439.1|  PREDICTED: dirigent protein 4                      121   4e-30   
gb|AFG45329.1|  hypothetical protein 2_9838_01                          120   4e-30   
ref|XP_002530866.1|  Disease resistance response protein, putative      119   4e-30   
ref|XP_003625312.1|  Disease resistance response protein                121   5e-30   
ref|XP_006404549.1|  hypothetical protein EUTSA_v10000597mg             121   5e-30   
emb|CDX81998.1|  BnaC08g36030D                                          121   5e-30   
emb|CDY66798.1|  BnaCnng52410D                                          121   6e-30   
ref|XP_010436971.1|  PREDICTED: dirigent protein 15-like                121   6e-30   
ref|XP_002285684.1|  PREDICTED: dirigent protein 22                     121   6e-30   
ref|XP_010243402.1|  PREDICTED: dirigent protein 22-like isoform X2     121   6e-30   
ref|XP_010260988.1|  PREDICTED: dirigent protein 22-like                120   6e-30   
emb|CDY13841.1|  BnaA09g43430D                                          120   7e-30   
ref|XP_002514607.1|  Disease resistance response protein, putative      120   7e-30   
ref|XP_004493625.1|  PREDICTED: disease resistance response prote...    121   7e-30   
ref|XP_009147520.1|  PREDICTED: dirigent protein 20-like                120   7e-30   
ref|XP_004142155.1|  PREDICTED: uncharacterized protein LOC101214318    120   7e-30   
gb|KDP30589.1|  hypothetical protein JCGZ_16242                         120   7e-30   
emb|CBI16483.3|  unnamed protein product                                119   7e-30   
gb|EYU37927.1|  hypothetical protein MIMGU_mgv1a018617mg                120   8e-30   
ref|XP_006407188.1|  hypothetical protein EUTSA_v10021903mg             120   8e-30   
ref|XP_010670412.1|  PREDICTED: dirigent protein 21-like                120   8e-30   
gb|EMS59623.1|  hypothetical protein TRIUR3_27692                       120   9e-30   
ref|XP_006386058.1|  hypothetical protein POPTR_0003s21450g             121   9e-30   
ref|XP_003540811.2|  PREDICTED: dirigent protein 23-like                120   9e-30   
ref|XP_011073065.1|  PREDICTED: dirigent protein 22-like                120   9e-30   
gb|KGN61910.1|  hypothetical protein Csa_2G264050                       120   9e-30   
ref|XP_006295932.1|  hypothetical protein CARUB_v10025069mg             120   1e-29   
emb|CDY60807.1|  BnaA01g37270D                                          120   1e-29   
ref|XP_011088570.1|  PREDICTED: dirigent protein 21-like                120   1e-29   
ref|XP_004296168.1|  PREDICTED: disease resistance response prote...    120   1e-29   
ref|XP_010429184.1|  PREDICTED: dirigent protein 4-like                 120   1e-29   
ref|XP_004147025.1|  PREDICTED: uncharacterized protein LOC101215304    120   1e-29   
ref|XP_007041907.1|  Disease resistance-responsive family protein       120   1e-29   
ref|XP_002283403.1|  PREDICTED: dirigent protein 19                     120   1e-29   
gb|KFK40908.1|  hypothetical protein AALP_AA2G058900                    120   1e-29   
ref|XP_004977239.1|  PREDICTED: disease resistance response prote...    120   1e-29   
ref|XP_007008799.1|  Disease resistance-responsive family protein       120   1e-29   
emb|CDY24048.1|  BnaA06g00460D                                          120   1e-29   
ref|XP_011037299.1|  PREDICTED: dirigent protein 23-like                119   1e-29   
ref|XP_009117440.1|  PREDICTED: dirigent protein 23                     120   1e-29   
ref|XP_003578856.1|  PREDICTED: dirigent protein 22-like                119   1e-29   
ref|XP_009138983.1|  PREDICTED: dirigent protein 21-like                120   1e-29   
ref|XP_008799203.1|  PREDICTED: uncharacterized protein LOC103713929    124   1e-29   
ref|XP_010477562.1|  PREDICTED: dirigent protein 11                     119   2e-29   
ref|XP_010516455.1|  PREDICTED: dirigent protein 21-like                119   2e-29   
ref|XP_006410704.1|  hypothetical protein EUTSA_v10017794mg             120   2e-29   
gb|EYU40431.1|  hypothetical protein MIMGU_mgv1a014192mg                120   2e-29   
ref|XP_006402810.1|  hypothetical protein EUTSA_v10006492mg             121   2e-29   
ref|NP_001149569.1|  disease resistance response protein 206 prec...    119   2e-29   
ref|XP_002285685.1|  PREDICTED: dirigent protein 19                     119   2e-29   
ref|XP_009803315.1|  PREDICTED: dirigent protein 22-like                119   2e-29   
ref|XP_006281178.1|  hypothetical protein CARUB_v10027213mg             119   2e-29   
ref|XP_004168161.1|  PREDICTED: uncharacterized LOC101212940            119   2e-29   
ref|XP_006415181.1|  hypothetical protein EUTSA_v10008817mg             119   2e-29   
gb|AFW56216.1|  disease resistance response protein 206                 119   2e-29   
emb|CDP13136.1|  unnamed protein product                                118   2e-29   
gb|KDP30588.1|  hypothetical protein JCGZ_16241                         119   3e-29   
ref|NP_199066.1|  disease resistance-responsive family protein          119   3e-29   
ref|XP_008360189.1|  PREDICTED: LOW QUALITY PROTEIN: dirigent pro...    119   3e-29   
ref|XP_004228729.1|  PREDICTED: dirigent protein 19                     119   3e-29   
ref|NP_001151025.1|  disease resistance response protein 206 prec...    119   3e-29   
emb|CDY04356.1|  BnaC04g18370D                                          119   3e-29   
ref|XP_003623402.1|  Disease resistance response protein                119   3e-29   
ref|XP_006482976.1|  PREDICTED: dirigent protein 7-like                 119   3e-29   
ref|XP_010501557.1|  PREDICTED: dirigent protein 11-like                119   3e-29   
ref|XP_006281166.1|  hypothetical protein CARUB_v10027200mg             119   4e-29   
gb|EMT29645.1|  hypothetical protein F775_13105                         118   4e-29   
ref|XP_006495202.1|  PREDICTED: dirigent protein 23-like                119   4e-29   
ref|XP_004978855.1|  PREDICTED: disease resistance response prote...    118   4e-29   
dbj|BAJ97815.1|  predicted protein                                      119   5e-29   
emb|CDM86466.1|  unnamed protein product                                118   5e-29   
gb|ABD52128.1|  dirigent-like protein pDIR17                            118   5e-29   
ref|XP_010494187.1|  PREDICTED: dirigent protein 2-like                 118   5e-29   
ref|XP_008807687.1|  PREDICTED: dirigent protein 19-like                116   5e-29   
ref|XP_011092999.1|  PREDICTED: dirigent protein 1-like                 119   6e-29   
ref|XP_002886706.1|  hypothetical protein ARALYDRAFT_475425             118   6e-29   
ref|XP_004228335.1|  PREDICTED: dirigent protein 22-like                119   6e-29   
dbj|BAJ99603.1|  predicted protein                                      118   6e-29   



>ref|XP_006366619.1| PREDICTED: dirigent protein 21-like [Solanum tuberosum]
Length=190

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = -1

Query  660  KTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVL  481
            KT LVV L  F   +  G   GP  V++WF KLP  +QKVT  HF+F+    G NP+ + 
Sbjct  3    KTRLVVLLCFFIVVIVQGVELGPNVVEKWFDKLPHAKQKVTKFHFYFHDIVSGKNPSAIT  62

Query  480  VAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVF  301
            +AQSN+T KSPT FG++A++D P+T+GPE NS+ +GR QG Y  +  +E +  M +N VF
Sbjct  63   IAQSNMTTKSPTFFGSVAMIDDPLTVGPEPNSTIVGRAQGIYGSADQNEAALLMTYNIVF  122

Query  300  THGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIE  121
            T GKYNGS+LSV+G NPV++++REM IVGGSG+FRLA+GI T KT W+N+T+  GD V+E
Sbjct  123  TTGKYNGSTLSVLGRNPVFNQYREMPIVGGSGVFRLAQGIATAKTYWFNLTS--GDAVVE  180

Query  120  CDVMLLHY  97
             +VM+LHY
Sbjct  181  YNVMVLHY  188



>ref|XP_009601995.1| PREDICTED: dirigent protein 21-like [Nicotiana tomentosiformis]
Length=192

 Score =   206 bits (524),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 134/186 (72%), Gaps = 2/186 (1%)
 Frame = -1

Query  654  ILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVA  475
            +L++  IV A  +  G    P+ V++WF KLP  +QKVT  HF+F+    G NP  + +A
Sbjct  7    VLLLCFIVMAMPMVKGVDLEPKAVEKWFEKLPHAKQKVTKFHFYFHDILSGKNPTAIQIA  66

Query  474  QSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTH  295
            +SN TAKSPTLFG +A+MD P+T+GPE NS+ +GR QG Y  +   E +  M  NFVFT 
Sbjct  67   RSNTTAKSPTLFGGVAMMDDPLTVGPEPNSTIVGRAQGIYGSADQKEAALLMNLNFVFTT  126

Query  294  GKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECD  115
            GKYNGS+LSV+G NPV++++REM IVGGSG+FRLA+GI T KT+W+N+T+  GD V+E +
Sbjct  127  GKYNGSTLSVLGRNPVFNQYREMPIVGGSGVFRLAQGIATAKTVWFNLTS--GDAVVEYN  184

Query  114  VMLLHY  97
            V++ HY
Sbjct  185  VIVRHY  190



>ref|XP_011088575.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=190

 Score =   206 bits (524),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 137/196 (70%), Gaps = 8/196 (4%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTA--QGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTV  505
            MEKL    IL  S+      +AHG +  +GPE V++WF  LP  ++KVT LHF+F+    
Sbjct  1    MEKLCTFLILYSSV----HAMAHGNSVDEGPEAVQEWFKNLPNAKEKVTQLHFYFHDIVS  56

Query  504  GANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISF  325
            G NP+ + VA+SN +  SPT+FG + +MD  +T+GPE +S  +GR QG Y  +S++EI  
Sbjct  57   GKNPSAITVAESNSSLDSPTMFGVIRMMDDALTVGPEPDSKIIGRAQGIYGSASMEEIGL  116

Query  324  TMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTT  145
             M  N VFTHGKYNGS+LSV+G+NP+ H++REM IVGGSG+FRLARGI T  T+W+N T+
Sbjct  117  LMTLNLVFTHGKYNGSTLSVLGHNPILHKYREMPIVGGSGVFRLARGIATANTVWFNATS  176

Query  144  KLGDTVIECDVMLLHY  97
            +  D V+E  V++LHY
Sbjct  177  Q--DAVVEYSVIVLHY  190



>ref|XP_004248664.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=189

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = -1

Query  660  KTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVL  481
            + I +V L+ F   +A G   GP  V++WF KLP  +QKVT  HF+F+    G NP+ + 
Sbjct  2    EKIKLVLLLFFMGFMAQGVELGPNAVEKWFDKLPHAKQKVTKFHFYFHDIVSGKNPSAIT  61

Query  480  VAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVF  301
            +AQSN+T+KSPT FG++A++D P+T+GPE NS+ +GR QG Y  +  +E    M +N VF
Sbjct  62   IAQSNMTSKSPTFFGSVAMIDDPLTVGPEPNSTIVGRAQGIYGSADQNEAGLLMTYNIVF  121

Query  300  THGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIE  121
            T GKYNGS+LSV+G NP+++++REM I+GGSG+FRLA+GI T KT W+N T+  GD V+E
Sbjct  122  TTGKYNGSTLSVLGRNPIFNQYREMSIIGGSGVFRLAQGIATAKTYWFNTTS--GDAVVE  179

Query  120  CDVMLLHY  97
             +V++LHY
Sbjct  180  YNVIVLHY  187



>ref|XP_006366617.1| PREDICTED: dirigent protein 21-like [Solanum tuberosum]
Length=193

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 130/186 (70%), Gaps = 2/186 (1%)
 Frame = -1

Query  654  ILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVA  475
            +L   ++V    +  G   GP+ V++WF KLP  +QKVT  HF+F+    G NP  V +A
Sbjct  8    LLFCFIVVMVMPIGQGAELGPKAVEKWFKKLPHAKQKVTKFHFYFHDIVSGKNPTAVQIA  67

Query  474  QSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTH  295
            Q+N+T KSPT FG +A+ D P+T+GPE NS+ +GR QG Y  +  +E    M  NFVFT 
Sbjct  68   QANMTTKSPTFFGFVAMADDPLTVGPEPNSTIVGRAQGIYGSADQNESGLLMNLNFVFTT  127

Query  294  GKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECD  115
            GKYNGS+LSV+G NPV+H++REM IVGGSG+FRLA+GI T KT W N+T+  GD ++E +
Sbjct  128  GKYNGSTLSVLGRNPVFHKYREMPIVGGSGVFRLAQGIATAKTYWINMTS--GDAIVEYN  185

Query  114  VMLLHY  97
            VM+LHY
Sbjct  186  VMVLHY  191



>ref|XP_009759252.1| PREDICTED: dirigent protein 21-like [Nicotiana sylvestris]
Length=192

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 137/194 (71%), Gaps = 4/194 (2%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEK +   +L++  IV A  +  G   GP+ V++WF  L   +QKVT  HF+F+    G 
Sbjct  1    MEKKSL--VLLLCFIVMAMPMVKGVELGPKAVEKWFENLSHAKQKVTRFHFYFHDIVSGK  58

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP  + +AQSN TAKSPTLFG +A++D P+T+GPE NS+ +GR QG Y  +   E +  M
Sbjct  59   NPTAIQIAQSNTTAKSPTLFGFVAMIDDPLTVGPEPNSTIVGRAQGIYGSADQKEAALLM  118

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              NFVFT GKYNGS+LSV+G NPV++++REM IVGGSG+FRLA+GI T KT+W+N+T+  
Sbjct  119  NLNFVFTTGKYNGSTLSVLGRNPVFNQYREMPIVGGSGVFRLAQGIATAKTVWFNLTS--  176

Query  138  GDTVIECDVMLLHY  97
            GD V+E +V++ HY
Sbjct  177  GDAVVEYNVIVRHY  190



>ref|XP_007041903.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
 gb|EOX97734.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
Length=189

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 128/194 (66%), Gaps = 5/194 (3%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEKL     LV+  +     +   + +GPEEV  WF KLP   +KV+ LHF+F+ T  G 
Sbjct  1    MEKLA---ALVICWLAMVMPMGQCSIEGPEEVYNWFHKLPYAEEKVSKLHFYFHDTLSGK  57

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP  V VAQ++ +AKSPT FG + V+D P+T GPE  S +LGR QG Y     +E+S  M
Sbjct  58   NPTAVRVAQASGSAKSPTFFGVVFVIDDPLTEGPEATSKELGRAQGLYGSDGKEEVSLLM  117

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              +FVFT GKYNGSSL+V+G NPV+H  REM I+GG+G+FRLARGI T+KT   N TT  
Sbjct  118  AMDFVFTSGKYNGSSLTVLGRNPVFHPLREMPIIGGTGVFRLARGIATVKTRSLNTTT--  175

Query  138  GDTVIECDVMLLHY  97
            GD + E  V+++HY
Sbjct  176  GDAIAEYHVVVIHY  189



>ref|XP_006366609.1| PREDICTED: dirigent protein 21-like [Solanum tuberosum]
Length=194

 Score =   193 bits (491),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 133/192 (69%), Gaps = 6/192 (3%)
 Frame = -1

Query  669  LTYKTILVVSLIVFATKLAH-GTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANP  493
            L Y +I +V  I+ +  LAH   AQGP+ V+ WF KL   + K+T LHF+F+    G NP
Sbjct  8    LLYCSIAIV--ILSSIPLAHCNIAQGPKAVENWFQKLSHAKPKITKLHFYFHDIVAGKNP  65

Query  492  NDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLF  313
              + +AQ+N T+ SPT FG +A++D  +T GPE NS+ +GR QG    +SL+E S  M  
Sbjct  66   TAIPIAQANSTSHSPTAFGLLAILDDRLTTGPEINSTTIGRAQGIVGAASLEEFSLLMSL  125

Query  312  NFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGD  133
            NFVFTHGKYNGS+LS++G NP+ +E+REM IVGGSG+FRLARG+ T KT   +  +K GD
Sbjct  126  NFVFTHGKYNGSTLSLLGRNPILNEYREMPIVGGSGVFRLARGVATAKT---HTLSKNGD  182

Query  132  TVIECDVMLLHY  97
             ++E +V++LHY
Sbjct  183  AIVEYNVVVLHY  194



>ref|XP_006366608.1| PREDICTED: dirigent protein 21-like [Solanum tuberosum]
Length=194

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 134/192 (70%), Gaps = 6/192 (3%)
 Frame = -1

Query  669  LTYKTILVVSLIVFATKLAH-GTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANP  493
            L Y +I +V  I+ +  LAH   AQGP+ V+ WF KL   + K+T LHF+F+    G NP
Sbjct  8    LLYCSIAIV--ILSSIPLAHCNIAQGPKAVENWFQKLSHAKPKITKLHFYFHDIVGGKNP  65

Query  492  NDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLF  313
              + +AQ+N T+ SPT FG++A++D  +T GPE NS+ +GR QG    +SL+E S  M  
Sbjct  66   TAIPIAQANSTSHSPTAFGSLAILDDRLTTGPEINSTTIGRAQGIVGAASLEEFSLLMSL  125

Query  312  NFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGD  133
            NFVFTHGKYNGS+LS++G NP+ +E+REM IVGGSG+FRLARG+ T KT  +   +K GD
Sbjct  126  NFVFTHGKYNGSTLSLLGRNPILNEYREMPIVGGSGVFRLARGVATAKTYTF---SKNGD  182

Query  132  TVIECDVMLLHY  97
             ++E +V++LHY
Sbjct  183  ALVEYNVVVLHY  194



>ref|XP_009588577.1| PREDICTED: dirigent protein 22-like [Nicotiana tomentosiformis]
Length=189

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 134/194 (69%), Gaps = 5/194 (3%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEKL     L++++ + +T   HG  + P+ V +WF KLP  ++K+T LHF+F+ T    
Sbjct  1    MEKLLLMVCLLMAITMPST---HGLDRSPKGVDKWFKKLPNAKEKMTKLHFYFHDTVTAK  57

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP+ + +AQ+N+T +SPTLFG + + D  +T+ P+ NS ++GR QG Y  +S  +I   M
Sbjct  58   NPSAIQIAQANITFQSPTLFGLLRMFDNSMTVQPDPNSKEIGRAQGIYGSASFQDIELLM  117

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              N VFT GKYNGS+LS++G+N ++HE+RE+ IVGGSG+FRLARGI T KT W + TT+ 
Sbjct  118  TLNLVFTEGKYNGSTLSILGHNRIFHEYRELPIVGGSGVFRLARGIATAKTYWASNTTQ-  176

Query  138  GDTVIECDVMLLHY  97
             + ++E  V++LHY
Sbjct  177  -NAIVEYHVVVLHY  189



>ref|XP_006366620.1| PREDICTED: dirigent protein 7-like [Solanum tuberosum]
Length=184

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = -1

Query  660  KTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVL  481
            K  LV+ L      +A G   GP+ V++WF KLP  +QKVT  HF+F+  T G NP  V 
Sbjct  3    KRSLVILLCFILMSMAQGVVLGPKAVEKWFKKLPYAKQKVTKFHFYFHDITSGKNPTAVP  62

Query  480  VAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVF  301
            + +S    KSPT FG +A++D P+T+GPE NS+ +GR QG Y  +   E +  M  NFVF
Sbjct  63   IIKS----KSPTFFGYVAMIDDPLTVGPEVNSTLVGRAQGIYGGAGQKEAALLMTLNFVF  118

Query  300  THGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIE  121
            T GKYNGS+LSV+G NP +H++REM IVGGSG+FRLA+GI T KT W N T    D ++E
Sbjct  119  TTGKYNGSTLSVLGRNPAFHKYREMPIVGGSGVFRLAQGIATAKTYWMNAT----DAIVE  174

Query  120  CDVMLLHY  97
             +V++LHY
Sbjct  175  YNVIVLHY  182



>ref|XP_004248663.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=194

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 131/190 (69%), Gaps = 6/190 (3%)
 Frame = -1

Query  663  YKTILVVSLIVFATKLAH-GTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPND  487
            Y +I +V  I+ +  LAH   AQGP+ V+ WF K+   + K+T LHF+F+    G NP  
Sbjct  10   YCSIAIV--ILSSIPLAHCNIAQGPKAVENWFQKVSHSKPKITKLHFYFHDIVAGKNPTS  67

Query  486  VLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNF  307
            + +AQ+N T+ SPT FG +A++D  +T GPE NS+ +GR QG    +SL+E S  M  NF
Sbjct  68   IPIAQANSTSHSPTAFGTLAILDDRLTTGPENNSTTIGRAQGIVGAASLEEFSLLMSLNF  127

Query  306  VFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTV  127
            VFTHGKYNGS+LS++G N V +E+REM IVGGSG+FRLARG+ T KT   +  +K GD +
Sbjct  128  VFTHGKYNGSTLSLLGRNTVLNEYREMPIVGGSGVFRLARGVATAKT---HTLSKNGDAI  184

Query  126  IECDVMLLHY  97
            +E +V++LHY
Sbjct  185  VEYNVVVLHY  194



>ref|XP_009771303.1| PREDICTED: dirigent protein 22-like [Nicotiana sylvestris]
Length=195

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 136/197 (69%), Gaps = 5/197 (3%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKL--AHGT-AQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTT  508
            M KL    +L+ S+ +  + +  AH   AQGP+ V+QWF KL   + K+T LHF+F+   
Sbjct  1    MGKLNLIGLLLCSIAITISSIPFAHANIAQGPKAVEQWFQKLSHAKPKITKLHFYFHDIV  60

Query  507  VGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEIS  328
             G NP  + +AQ+N T+ SPT FG +AV+D  +TIGP+ NS+ +GR QG    +S+DE S
Sbjct  61   SGKNPTAIPIAQANSTSHSPTSFGLLAVLDDRLTIGPQINSTTIGRAQGIVGAASIDEFS  120

Query  327  FTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVT  148
              M  NFVFT+GKYNGS+LS++G N V +E+REM IVGGSG+FRLARG+ T KT + + +
Sbjct  121  LLMSLNFVFTNGKYNGSTLSLLGRNTVLNEYREMPIVGGSGVFRLARGVATAKTYFLSNS  180

Query  147  TKLGDTVIECDVMLLHY  97
            +  GD ++E +V++LHY
Sbjct  181  S--GDAIVEYNVVVLHY  195



>ref|XP_006361043.1| PREDICTED: dirigent protein 19-like [Solanum tuberosum]
Length=190

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 131/194 (68%), Gaps = 4/194 (2%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            M+K  +   L++++   ++ L  G    P+ V++WF  L   ++K+T  HF+F+    G 
Sbjct  1    MKKFLFMICLLIAIANLSSTL--GLNLSPKGVEKWFKNLSHAKEKMTKFHFYFHDIVSGK  58

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP+ + +AQ+NVT+ SPT FG + +MD P+TIGP  NS  +GR QG Y  +S ++    M
Sbjct  59   NPSAIQIAQANVTSLSPTSFGLVRMMDNPMTIGPNINSEVIGRAQGMYGFTSFEDRELLM  118

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
             FNFVFT GK+NGS+LS++G+N    E+RE+ +VGGSG+FRLARG +T KT W+N TT+ 
Sbjct  119  TFNFVFTKGKHNGSTLSILGHNRASREYRELPVVGGSGVFRLARGTVTAKTYWYNATTR-  177

Query  138  GDTVIECDVMLLHY  97
             D +IEC V++LHY
Sbjct  178  -DVIIECHVIILHY  190



>emb|CDO96939.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   189 bits (479),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 136/202 (67%), Gaps = 11/202 (5%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLA---HGT----AQGPEEVKQWFAKLPTLRQ-KVTDLHFF  523
            M K T   +LVV  IV  T +A   HG      Q P+ V++WF KL   +Q K+T LHF+
Sbjct  1    MRKTTLSFLLVVFAIVM-TAMAPPVHGQINPDDQSPKAVERWFKKLGHAKQEKLTKLHFY  59

Query  522  FYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSS  343
            F+    G  P  V VAQ+N+T+KSPTLFG + VMD P+T+GPE +S  +G  QG YA +S
Sbjct  60   FHDILSGNKPTAVQVAQANITSKSPTLFGIVNVMDDPLTVGPEPDSRIIGSAQGLYASAS  119

Query  342  LDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTM  163
              ++   M  NFVFT GKYNGS+LS++G NPV+H++RE+ I+GGSG+FRLARGI T KT 
Sbjct  120  QKDVGLLMTLNFVFTDGKYNGSTLSILGRNPVFHKYRELPILGGSGVFRLARGIATAKTH  179

Query  162  WWNVTTKLGDTVIECDVMLLHY  97
             +N TT  GD ++E  V+++HY
Sbjct  180  TFNATT--GDAIVEYHVIVMHY  199



>ref|XP_011088571.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=197

 Score =   189 bits (479),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 125/171 (73%), Gaps = 2/171 (1%)
 Frame = -1

Query  609  GTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAM  430
            G+ +GP E+K W+ KLP ++ KVT+LHF+ +    G+NP +V +  +N T++SPT FG +
Sbjct  29   GSNEGPREMKDWYRKLPHMKHKVTELHFYLHDIVSGSNPTNVPLVVTNSTSQSPTYFGLI  88

Query  429  AVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNP  250
            A +D P+T GP  +S  +GR QG +  +SLD+I++ M FNFVFT GKYNGS+LSVVG+NP
Sbjct  89   AAIDDPLTEGPAPDSPIVGRAQGLFGSTSLDKIAYHMTFNFVFTSGKYNGSTLSVVGHNP  148

Query  249  VYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
               E+RE+ IVGGSG+FRLARG   + T+ +N T+  GD V+E DV++LHY
Sbjct  149  FMDEYRELPIVGGSGVFRLARGTALLNTLTFNSTS--GDAVVEYDVVVLHY  197



>emb|CDO96938.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 136/202 (67%), Gaps = 11/202 (5%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLA---HGT----AQGPEEVKQWFAKLPTLRQ-KVTDLHFF  523
            M K T   +LVV  IV  T +A   HG      Q P+ V++WF KL   +Q K+T LHF+
Sbjct  1    MRKTTLSFLLVVFAIVM-TAMAPPVHGQINPDDQSPKAVERWFKKLGHAKQEKLTKLHFY  59

Query  522  FYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSS  343
            F+    G  P  V VAQ+N+T+KSPTLFG + VMD P+T+GPE +S  +G  QG YA +S
Sbjct  60   FHDILSGNKPTAVQVAQANITSKSPTLFGIVNVMDDPLTVGPEPDSRIIGFAQGLYASAS  119

Query  342  LDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTM  163
              ++   M  NFVFT GKYNGS+LS++G NPV+H++RE+ I+GGSG+FRLARGI T KT 
Sbjct  120  QKDVGLLMTLNFVFTDGKYNGSTLSILGRNPVFHKYRELPILGGSGVFRLARGIATAKTH  179

Query  162  WWNVTTKLGDTVIECDVMLLHY  97
             +N TT  GD ++E  V+++HY
Sbjct  180  TFNATT--GDAIVEYHVIVMHY  199



>ref|XP_004248662.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=184

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 124/188 (66%), Gaps = 8/188 (4%)
 Frame = -1

Query  660  KTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVL  481
            KT L++ L      +  G   GP+ V++WF +LP  +QKVT  HF+F+  T G NP  V 
Sbjct  3    KTSLIILLCFILMSMVQGVVLGPKAVEKWFKELPHAKQKVTKFHFYFHDITSGKNPTAVP  62

Query  480  VAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVF  301
            + +S    KSPT FG +A++D P+T+GPE NS+ +GR QG Y  +   E +  M  NFVF
Sbjct  63   IIKS----KSPTFFGYVAMIDDPLTVGPEVNSTIVGRAQGIYGGAGQKEAALLMTLNFVF  118

Query  300  THGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIE  121
            T GKYNGS+LSV+G NP +H++REM IVGGSG+FR A+GI T KT W N T    D ++E
Sbjct  119  TTGKYNGSTLSVLGRNPAFHKYREMPIVGGSGVFRFAQGIATAKTYWMNAT----DAIVE  174

Query  120  CDVMLLHY  97
             +V++LHY
Sbjct  175  YNVIVLHY  182



>ref|XP_009621800.1| PREDICTED: dirigent protein 22-like [Nicotiana tomentosiformis]
Length=194

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 132/189 (70%), Gaps = 5/189 (3%)
 Frame = -1

Query  654  ILVVSLIVFATKLAHGTA---QGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDV  484
            +L+ S+ +  + +  G A   Q P+ V+QWF KL   + K+T LHF+F+    G NP  V
Sbjct  8    LLLCSIAITISSIPFGHANISQEPKAVEQWFQKLSHTKPKLTKLHFYFHDIVSGKNPTAV  67

Query  483  LVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFV  304
             +AQ+N T+ SPT FG +AV+D  +TIGPE NS+ +GR QG    +SLDE S  M  NFV
Sbjct  68   PIAQANSTSHSPTSFGLLAVLDDRLTIGPEINSTTIGRAQGIVGTASLDEFSLLMSLNFV  127

Query  303  FTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVI  124
            FT+GKYNGS+LS++G N V +E+REM IVGGSG+FRLARG+ T KT + + ++  GDT++
Sbjct  128  FTNGKYNGSTLSLLGRNTVLNEYREMPIVGGSGVFRLARGVATAKTYFLSNSS--GDTIV  185

Query  123  ECDVMLLHY  97
            E +V++LHY
Sbjct  186  EYNVVVLHY  194



>ref|XP_006363503.1| PREDICTED: dirigent protein 19-like [Solanum tuberosum]
Length=190

 Score =   186 bits (471),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = -1

Query  612  HGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGA  433
            HG  Q P+ V +WF KLP  + K+T LHF+F+ T    NP+ + +AQ+N T +SPTLFG 
Sbjct  21   HGLDQSPKGVDKWFKKLPHAKVKMTKLHFYFHDTVTAKNPSAIQIAQANNTFQSPTLFGL  80

Query  432  MAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYN  253
            + +MD P+T+ PE NS ++GR QG Y  +S ++I   M  N +FT GKYNGS+LS++G+N
Sbjct  81   VRMMDNPLTVKPEPNSKEIGRAQGIYGFASFEDIGLLMTLNLLFTDGKYNGSTLSILGHN  140

Query  252  PVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
             ++HE+REM IVGGSG+FRLA+G+ T KT   + TT+  + ++E  V+LLHY
Sbjct  141  QIFHEYREMPIVGGSGVFRLAQGVATAKTYSGDNTTQ--NAIVEYHVVLLHY  190



>ref|XP_004248124.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=190

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 129/194 (66%), Gaps = 4/194 (2%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            M+   +   L++++    + L  G    P+ V++WF  L   ++K+T  HF+F+    G 
Sbjct  1    MKNFLFMICLLIAIANLPSIL--GLNLSPKGVEKWFKNLSHAKEKMTKFHFYFHDIVSGK  58

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP+ + +AQ+N+T+ SPT FG + +MD P+TIGP  NS  +GR QG Y  +S ++    M
Sbjct  59   NPSAIQIAQANITSLSPTSFGLVRMMDNPMTIGPNINSEVIGRVQGMYGFTSFEDRELLM  118

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
             FNFVFT GKYNGS+LS++G+N V  E+RE+ +VGGSG+FRLARG +T +T W+N TT+ 
Sbjct  119  TFNFVFTQGKYNGSTLSILGHNRVSREYRELPVVGGSGVFRLARGTVTARTYWYNATTR-  177

Query  138  GDTVIECDVMLLHY  97
             D ++EC V +LHY
Sbjct  178  -DLIVECHVTILHY  190



>emb|CDP16947.1| unnamed protein product [Coffea canephora]
Length=192

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 127/182 (70%), Gaps = 3/182 (2%)
 Frame = -1

Query  639  LIVFATKLAHGTA-QGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNV  463
            +++FA  +AHG+  Q P+ V++WF +LP  ++K+T LHF+F+ T    NP  + VAQ+N+
Sbjct  13   VVIFAVPMAHGSIDQSPKAVEKWFKRLPQAKEKLTKLHFYFHDTVTDKNPTAIRVAQANI  72

Query  462  TAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYN  283
            T+KSPT FG   V+D P+T+GPE +S  +G  QG Y+  S +E S  M+ N VF  GK+N
Sbjct  73   TSKSPTRFGETLVVDDPLTLGPEPSSKIIGHAQGIYSSVSKEERSLIMILNLVFNDGKFN  132

Query  282  GSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLL  103
            GS+LS++G N ++HE+REM I+GG+G  RLARGI T KT   N TT+  + V+E  V++L
Sbjct  133  GSTLSLLGSNSIFHEYREMPILGGTGALRLARGIATAKTYASNTTTR--NAVVEYHVLVL  190

Query  102  HY  97
            HY
Sbjct  191  HY  192



>ref|XP_009762401.1| PREDICTED: dirigent protein 22-like [Nicotiana sylvestris]
Length=189

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 131/194 (68%), Gaps = 5/194 (3%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEKL     L+ ++ + +T   HG  Q P+ V++WF  LP   +K+T LHF+F+ T    
Sbjct  1    MEKLLLMICLLKAITIPST---HGLDQSPKGVEKWFKNLPHATEKMTKLHFYFHDTVTAK  57

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
             P+ + +AQ+N+T +SPTLFG + + D  +T+ P+ NS ++GR +G Y  +S ++I   M
Sbjct  58   KPSAIQIAQANITFQSPTLFGLLRMFDNSMTVQPDPNSKEIGRAEGIYGSASFEDIELLM  117

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              N VFT GKYNGS+LS++G+N ++HE+RE+ IVGGSG+FRLARGI T KT W +  T+ 
Sbjct  118  TLNLVFTKGKYNGSTLSILGHNRIFHEYRELPIVGGSGVFRLARGIATAKTFWASNATQ-  176

Query  138  GDTVIECDVMLLHY  97
             + ++E  V++LHY
Sbjct  177  -NAIVEYHVVVLHY  189



>ref|XP_006363502.1| PREDICTED: dirigent protein 19-like, partial [Solanum tuberosum]
Length=180

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 128/185 (69%), Gaps = 5/185 (3%)
 Frame = -1

Query  651  LVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQ  472
            L +++I+ +T   HG  Q P+ V +WF KLP  + K+T LHF+F+      NP+ + +AQ
Sbjct  1    LAITIILPST---HGLDQSPKGVDKWFEKLPHAKAKMTKLHFYFHDIVTAKNPSAIQIAQ  57

Query  471  SNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHG  292
            +N T +SPT FG + +MD P+T+ PE NS  +GR QG Y  +S ++I   M  N VFT+G
Sbjct  58   ANNTFQSPTFFGLVRMMDNPLTVNPEPNSKIIGRAQGIYGSASFEDIGLLMTLNLVFTNG  117

Query  291  KYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDV  112
            KYNGS+LS++G+N ++HE+REM IVGGSG+FRLA+GI T KT   + TT+  + ++E  V
Sbjct  118  KYNGSTLSILGHNQIFHEYREMPIVGGSGVFRLAKGIATAKTYQVDNTTQ--NAIVEYHV  175

Query  111  MLLHY  97
            ++LHY
Sbjct  176  VVLHY  180



>ref|XP_011092911.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=169

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 119/173 (69%), Gaps = 4/173 (2%)
 Frame = -1

Query  618  LAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLF  439
            + HG   GP   K WF KLP   QK T LHF+ +    G NP ++ +A SN TA+SPT F
Sbjct  1    MVHG--DGPSTKKNWFKKLPHKNQKATHLHFYLHDIVSGPNPTNIPIAMSNSTAQSPTYF  58

Query  438  GAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVG  259
            G +A +D P+T+GP  +S  +GR QG +  +SL+EI+F M F+ VFT+GKYNGS+L+VVG
Sbjct  59   GLIAAIDDPLTLGPSPDSGIVGRAQGLFGSTSLEEIAFHMTFDIVFTNGKYNGSTLTVVG  118

Query  258  YNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
             NP   E+RE+ IVGGSG+FRLARG   + T+ +N T+  GD V+E +VM+LH
Sbjct  119  RNPFLREYRELSIVGGSGVFRLARGTAILNTVTYNSTS--GDAVVEYNVMVLH  169



>ref|XP_006366618.1| PREDICTED: dirigent protein 21-like [Solanum tuberosum]
Length=174

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 118/174 (68%), Gaps = 1/174 (1%)
 Frame = -1

Query  618  LAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLF  439
            +A     GP+ V++WF KLP  + K+T  HF+++    G NP  + +AQ N TAK P  F
Sbjct  1    MAQCVELGPKAVEEWFEKLPYAKHKLTKFHFYYHDVVSGKNPTAITIAQPNTTAKPPIYF  60

Query  438  GAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVG  259
            G + ++D  +TIGP+ NS+ +GR QGFY  +  +E S  M  NFVFT G+YNGS+LS++G
Sbjct  61   GLVDMIDDKLTIGPDPNSTIVGRAQGFYGSADQNEFSLLMTLNFVFTSGEYNGSTLSMLG  120

Query  258  YNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
             NP++H++REM I+GGSG+FRLA+GI T  T  W  TT  GD V+E  +M+LHY
Sbjct  121  RNPLFHQYREMPIIGGSGVFRLAQGIATANTTCWLNTTS-GDAVVEYHIMVLHY  173



>ref|XP_007041902.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
 gb|EOX97733.1| Disease resistance-responsive family protein, putative [Theobroma 
cacao]
Length=187

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 129/194 (66%), Gaps = 7/194 (4%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEKL      ++ + + A  + H + +GPEEV +WF KLP  ++KVT LHFFF+    G 
Sbjct  1    MEKLA----ALMMIFLLAMPMGHCSIEGPEEVDEWFHKLPHAKEKVTKLHFFFHDRFAGK  56

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            N + V VA ++ TAKSPT FG + +MD P+T G +  + +LGR QG YA S  +E+S  M
Sbjct  57   NISAVRVAHASSTAKSPTAFGLVFIMDDPLTEGLKPTTKELGRAQGLYAFSGREELSLLM  116

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              N VFT G+YNGS+L+V+G NP    HREM I+GGSG+FRLARGI + +   +N TT  
Sbjct  117  AMNLVFTSGEYNGSTLTVLGRNPAV-PHREMPIIGGSGVFRLARGIASAQLREFNTTT--  173

Query  138  GDTVIECDVMLLHY  97
            G+ +IE +V+++HY
Sbjct  174  GNALIEYNVVVIHY  187



>emb|CDP14404.1| unnamed protein product [Coffea canephora]
Length=183

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 121/169 (72%), Gaps = 3/169 (2%)
 Frame = -1

Query  600  QGPEEVKQWFAKLPTLR-QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAV  424
            Q P+ V+ W  KL  ++ +K+T LHF+F+ T  G NP  V VAQ+N+T+KSPTLFG + V
Sbjct  17   QSPKVVELWLKKLGHVKHKKLTKLHFYFHDTLSGNNPTAVEVAQANITSKSPTLFGIVNV  76

Query  423  MDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVY  244
            MD P+T+GPE  S  +G  QGFYA +S  ++   M  NFVFT GKYNGS+LS++G N V+
Sbjct  77   MDDPLTVGPEPASKIVGFAQGFYASASQQDVGLLMTLNFVFTDGKYNGSTLSILGQNHVF  136

Query  243  HEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            H +RE+ I+GGSG+FRLARGI T KT  +N TT  GD ++E  V+++HY
Sbjct  137  HNYRELPILGGSGVFRLARGIATAKTYAFNATT--GDAIVEYHVIVMHY  183



>ref|XP_011088574.1| PREDICTED: dirigent protein 22-like [Sesamum indicum]
Length=193

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 124/194 (64%), Gaps = 2/194 (1%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            M+  TY   ++   ++ +  +A     GP  V+ WF+KLP  ++K+T LHF+F+    G 
Sbjct  2    MKPYTYFIFMLSCSLIISLLVAAEAQNGPIAVENWFSKLPNAKEKLTKLHFYFHDIVSGK  61

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
             P  V VA++N T  SPT FG ++V+D P+T GP   S  +GR QG    SS  E+S  M
Sbjct  62   KPTAVPVARANSTFASPTYFGLVSVIDNPLTAGPRPKSQIVGRAQGITGYSSFKELSLLM  121

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              N VFT G+YNGS+L+VVGYNP   ++REM IVGGSG+FRLARG+ T +T  +N  T  
Sbjct  122  TLNLVFTSGEYNGSTLTVVGYNPFTQQYREMPIVGGSGVFRLARGLATAQTAKFNRRT--  179

Query  138  GDTVIECDVMLLHY  97
            G+ V+E +VM+LHY
Sbjct  180  GNAVVEYNVMVLHY  193



>ref|XP_004231597.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=190

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 121/173 (70%), Gaps = 2/173 (1%)
 Frame = -1

Query  615  AHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFG  436
            +HG  Q P+ V++WF KL   + K+T LHF+F+ T     P+ + +AQ+N T +SPTLFG
Sbjct  20   SHGLDQSPKRVEKWFKKLSHAKLKMTKLHFYFHDTVTAKKPSAIQIAQANNTFQSPTLFG  79

Query  435  AMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGY  256
             + +MD P+T+ PE NS ++GR QG Y  +S ++I   M  N VFT GKYNGS+LS++G+
Sbjct  80   LVRMMDNPLTVKPEPNSKEIGRAQGIYGSASFEDIGLLMTLNLVFTDGKYNGSTLSILGH  139

Query  255  NPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            N ++H++RE+ IVGGSG+FRLA+G  T KT   + TT+  + ++E  V++LHY
Sbjct  140  NQIFHKYRELPIVGGSGVFRLAKGSATAKTYRGDNTTQ--NAIVEYHVVILHY  190



>ref|XP_006366615.1| PREDICTED: dirigent protein 20-like [Solanum tuberosum]
Length=184

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 122/188 (65%), Gaps = 8/188 (4%)
 Frame = -1

Query  660  KTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVL  481
            KT LV+ L      +  G   GP+ V++WF KLP  +QKVT  HF+F+    G NP+ V 
Sbjct  3    KTCLVLLLCFILMPITQGVEFGPKAVEKWFKKLPHAKQKVTKFHFYFHDIVSGKNPSAVP  62

Query  480  VAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVF  301
            + QS     SP  FG +A++D P+T+G E +S+ +GR QG Y  +  +E++  M  NFVF
Sbjct  63   IIQST----SPIFFGYVAMIDDPLTVGLEPDSTIVGRAQGIYGGADQNEVALLMTLNFVF  118

Query  300  THGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIE  121
            T GKYNGS+LSV+G NP  H++REM IVGGSG+FRLA+GI T KT W N T      V+E
Sbjct  119  TTGKYNGSTLSVLGRNPARHKYREMPIVGGSGIFRLAKGIATAKTSWLNST----GAVVE  174

Query  120  CDVMLLHY  97
             +V++LHY
Sbjct  175  YNVIVLHY  182



>dbj|BAF02555.1| hypothetical protein [Nicotiana benthamiana]
Length=194

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 121/175 (69%), Gaps = 3/175 (2%)
 Frame = -1

Query  618  LAHGT-AQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTL  442
             AH   +Q P+ V++WF KL   + K+T LHF+F+    G NP  + +AQ+N T+ SP+ 
Sbjct  22   FAHANISQEPKAVEKWFEKLSHAKPKITKLHFYFHDIVSGKNPTAIPIAQANSTSHSPSS  81

Query  441  FGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVV  262
            FG +AV+D  +TIGPE NS+ +GR QG    +SLDE S  M  NFVFT+GKYNG +LS++
Sbjct  82   FGLLAVLDDRLTIGPEINSTTIGRAQGIVGAASLDEFSLLMSLNFVFTNGKYNGGTLSLL  141

Query  261  GYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            G N V +E+REM IVGGSG+FRLARG+ T KT +  ++   GD ++E + ++LHY
Sbjct  142  GRNTVLNEYREMPIVGGSGVFRLARGVATAKTYF--LSNSSGDAIVEYNGVVLHY  194



>ref|XP_004231598.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=191

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 127/194 (65%), Gaps = 3/194 (2%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEK    + L +++ +      HG  Q P+ V +WF  LP  + K+T LHF+F+      
Sbjct  1    MEKFLLISFLFLAITIILPS-THGLDQSPKGVDKWFKNLPHAKTKMTKLHFYFHDIVTAK  59

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            +P+ + +AQ+N T +SPT FG + +MD  +T+ PE NS  +GR QG Y  +S ++I   M
Sbjct  60   SPSAIQIAQANNTFQSPTFFGFVRMMDNSLTVNPEPNSKIIGRAQGIYGSASFEDIGLLM  119

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              N VFT+GKYNGS+LS++G+N V+HE+REM IVGGSG+FRLA+GI T KT   + TT+ 
Sbjct  120  TLNLVFTNGKYNGSTLSILGHNQVFHEYREMPIVGGSGVFRLAKGIATAKTYQVDNTTQ-  178

Query  138  GDTVIECDVMLLHY  97
             + ++E  V++LHY
Sbjct  179  -NAIVEYHVVVLHY  191



>emb|CDP16948.1| unnamed protein product [Coffea canephora]
Length=203

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 129/203 (64%), Gaps = 11/203 (5%)
 Frame = -1

Query  678  MEKLTYK--------TILVVSLIVFATKLAHGT-AQGPEEVKQWFAKLPTLRQKVTDLHF  526
            M+KL+ K         +L +++++FA  LA G+  Q P+ V++WF +L   ++K+T LHF
Sbjct  1    MDKLSMKMKMTVLNIAMLWLAVVIFAAPLARGSIDQSPKAVEKWFKELRHGKEKMTKLHF  60

Query  525  FFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALS  346
            + +      NP  V VAQ+ +T+KSPT FG   V+D P+T GPE  S  +G  QG Y+  
Sbjct  61   YLHDIITAKNPTAVRVAQAKITSKSPTKFGETVVLDDPLTQGPEPYSKIIGHAQGIYSFV  120

Query  345  SLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKT  166
            S +E S  M+ N VF  GK+NGS+LS++  NP  HE+REM I+GG+G FRLARGI T KT
Sbjct  121  SKEEKSLIMILNLVFKDGKFNGSTLSLLASNPFLHEYREMPILGGTGAFRLARGIATEKT  180

Query  165  MWWNVTTKLGDTVIECDVMLLHY  97
               NVTTK  + + E  V++LHY
Sbjct  181  YAANVTTK--NAIAEYHVLVLHY  201



>gb|EYU37929.1| hypothetical protein MIMGU_mgv1a025367mg [Erythranthe guttata]
Length=151

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 111/153 (73%), Gaps = 2/153 (1%)
 Frame = -1

Query  555  LRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQL  376
            ++QKVT+LHF+ +    G +P ++ +A +N TA SPT FG +A MD  +T+GP RNS+ +
Sbjct  1    MKQKVTELHFYLHDVVSGPHPTNIPIATANSTATSPTFFGLIAAMDDLLTVGPTRNSTTV  60

Query  375  GRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFR  196
            GR QG +  +SLDEI F M FN VFT GKYNGS+LS+ G+NP   E RE+ +VGGSG+FR
Sbjct  61   GRAQGLFGSTSLDEIGFHMTFNIVFTAGKYNGSTLSLAGHNPFLDEFRELPVVGGSGVFR  120

Query  195  LARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            LARG   + T+ +N+T+  GD ++E D+M+LHY
Sbjct  121  LARGTALLDTVSYNMTS--GDAIVEYDIMVLHY  151



>ref|XP_004231599.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=191

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 124/194 (64%), Gaps = 3/194 (2%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEK        +++ +     +HG  Q P+ V  WF KLP  + K+T LHF+F+      
Sbjct  1    MEKFLLMAFFFLAITIILPS-SHGLDQSPKGVDTWFKKLPHSKAKMTKLHFYFHDIVTAE  59

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP+ + +AQ+N T +SPT FG + +MD P+T+ PE NS  +GR QG Y  +  +++   M
Sbjct  60   NPSAIQIAQANNTFQSPTFFGLVRMMDNPLTVNPEPNSKIIGRAQGIYGSTLFEDLGLLM  119

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              N VFT+GKYNGS+LS++G+N ++ E+REM I GGSG+FRLA+GI T KT   + TT+ 
Sbjct  120  TLNLVFTNGKYNGSTLSILGHNQIFQEYREMPINGGSGVFRLAKGIATAKTYQIDNTTQ-  178

Query  138  GDTVIECDVMLLHY  97
             + ++E  V++LHY
Sbjct  179  -NAILEYHVVVLHY  191



>ref|XP_009610659.1| PREDICTED: dirigent protein 1-like [Nicotiana tomentosiformis]
Length=188

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 126/194 (65%), Gaps = 6/194 (3%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEK     ++ +S++V AT  A    + P+ V++WF  LP  +QK T  HF+F+    G 
Sbjct  1    MEKQMAIRLISLSILVIAT--AAAIDKSPKAVEKWFKNLPYAKQKTTKFHFYFHEIFAGD  58

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            N    ++AQ+N+TA+SPT FG + + D P+TIGPE NS ++GR QG +  +S+ EI+   
Sbjct  59   NETAPVIAQANITAQSPTFFGMVRMFDNPLTIGPEPNSRKVGRAQGIHGATSMTEIALFF  118

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
             FNFVFT G YNGS+LSVVG      E+RE+ I+GGSG+FRLA+G+ T KT + N TT  
Sbjct  119  DFNFVFTTGPYNGSTLSVVGRVAESQEYRELPIIGGSGIFRLAQGVATAKTYFSNNTT--  176

Query  138  GDTVIECDVMLLHY  97
               ++E ++++ HY
Sbjct  177  --VIVEYNIIVRHY  188



>ref|XP_010065287.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
 gb|KCW62708.1| hypothetical protein EUGRSUZ_G00279 [Eucalyptus grandis]
Length=195

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 115/174 (66%), Gaps = 2/174 (1%)
 Frame = -1

Query  618  LAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLF  439
            LAH  A  P++V  WF  L    +K T LHF+F+ T  G NP  V VA++ +T KSPTLF
Sbjct  24   LAHAEADDPKKVDAWFNGLSHADRKTTRLHFYFHDTLSGRNPTAVRVAEATMTEKSPTLF  83

Query  438  GAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVG  259
            G + ++D P+T GPE  S  +GR QGFY    L+ ++  M  N VFT  +YNGS+LS++G
Sbjct  84   GVVNMIDDPLTEGPEPESPLVGRAQGFYGSVGLESMALHMNMNLVFTTPEYNGSTLSILG  143

Query  258  YNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            +NP    +REM IVGG+G+FRLA G++T KT + N+TT  GD V+E  V+ LHY
Sbjct  144  HNPALETYREMPIVGGTGVFRLASGVVTAKTYFLNLTT--GDAVVEYKVIALHY  195



>emb|CDP16946.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 123/181 (68%), Gaps = 3/181 (2%)
 Frame = -1

Query  636  IVFATKLAHGTA-QGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVT  460
            I  A   A+G+  Q P  V++WF +L   ++K+T LHF+ + T    NP  V VA++N+T
Sbjct  44   ISIAMPSAYGSVDQSPRAVEKWFKELRRGKEKLTKLHFYLHDTVTAKNPTTVQVAEANMT  103

Query  459  AKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNG  280
            +KSPTLFG   V+D P+T+GPE +S  +G  QG Y+  S +  S  M+ N +F +GK+NG
Sbjct  104  SKSPTLFGETVVLDDPLTVGPEPSSKIIGHAQGIYSSVSQEGYSQIMILNLIFNYGKFNG  163

Query  279  SSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            S+LS++G NP+++E+REM I+GG+G FRLARGI T K+   NVTTK  + + E  V++LH
Sbjct  164  STLSLLGSNPIFNEYREMPILGGTGAFRLARGIATEKSYAVNVTTK--NAIAEHHVLVLH  221

Query  99   Y  97
            Y
Sbjct  222  Y  222



>ref|XP_009768004.1| PREDICTED: dirigent protein 1-like [Nicotiana sylvestris]
Length=189

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 126/195 (65%), Gaps = 7/195 (4%)
 Frame = -1

Query  678  MEK-LTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVG  502
            MEK +  + I+ +S++V  T  A    + P+ V++WF  LP  +QK T  HF+F+    G
Sbjct  1    MEKQMAIRLIISLSILVMVT--AAAIDKTPKAVEKWFKNLPYAKQKTTKFHFYFHEIFAG  58

Query  501  ANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT  322
             N    ++AQ+N+TA+SPT FG + + D P+TIGPE NS Q+G  QG +  +SL EI+  
Sbjct  59   DNETAPVIAQANITAQSPTFFGMVRMFDNPLTIGPEPNSKQVGLAQGIHGATSLTEIALF  118

Query  321  MLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTK  142
              FNFVFT G YNGSSLSVVG      E+RE+ I+GGSG+FRLA+G+ T KT + + TT 
Sbjct  119  FDFNFVFTTGPYNGSSLSVVGRVAESQEYRELQIIGGSGIFRLAQGVATAKTYFSSNTT-  177

Query  141  LGDTVIECDVMLLHY  97
                ++E +V++ HY
Sbjct  178  ---VIVEYNVIVRHY  189



>emb|CDP15168.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 122/195 (63%), Gaps = 5/195 (3%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKL-AHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVG  502
            M+K     +L + L+     +  HG AQG E V +WF KL   ++KVT LHF+F  T  G
Sbjct  1    MQKQIQAVMLCLLLVGLDGPMDVHGVAQGREGVDEWFHKLDRTKEKVTRLHFYFQDTVSG  60

Query  501  ANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT  322
             +P  V VA + +   SPT+FG +   D P+T+GPE NS+ LGR QG YA +  +E+   
Sbjct  61   KSPTAVTVAGAKLA--SPTMFGLINTADDPMTVGPELNSTLLGRAQGIYASADQNEVGLA  118

Query  321  MLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTK  142
            M  N+ FT GKY GS+LS++G N   H  REM IVGG+G+FRLARGI T KT + N TT 
Sbjct  119  MYMNYYFTAGKYRGSTLSLLGRNAGLHSIREMSIVGGTGVFRLARGIATAKTYFVNATT-  177

Query  141  LGDTVIECDVMLLHY  97
              D ++E +V+++HY
Sbjct  178  -ADDIVEYNVVVVHY  191



>ref|XP_009601144.1| PREDICTED: dirigent protein 11-like [Nicotiana tomentosiformis]
Length=195

 Score =   168 bits (425),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -1

Query  654  ILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYT-TTVGANPNDVLV  478
            IL V L++ A  + H   + P+ V +WF KL   +QK T LHF+F+   T G N    ++
Sbjct  12   ILSVLLMLTAMPVVHALDKNPKAVGRWFKKLDNAKQKTTKLHFYFHDLATGGKNETSSVI  71

Query  477  AQS-NVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVF  301
            AQ+ N+T++SP LFG + ++D P+T+GPE +S ++G  QG Y  ++++E    M FNFVF
Sbjct  72   AQATNITSQSPFLFGILRMIDDPLTVGPELSSKRVGSAQGIYGSAAMNEFGLLMNFNFVF  131

Query  300  THGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIE  121
            T G YNGS+LS++G N + +E+REM IVGGSG+FRLARGI T KT + N T      ++E
Sbjct  132  TDGPYNGSTLSLLGRNAISNEYREMPIVGGSGVFRLARGIATAKTYFANFTV----AIVE  187

Query  120  CDVMLLHY  97
              V++LHY
Sbjct  188  YHVIVLHY  195



>ref|XP_009791435.1| PREDICTED: dirigent protein 11-like [Nicotiana sylvestris]
Length=195

 Score =   167 bits (424),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -1

Query  654  ILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYT-TTVGANPNDVLV  478
            IL V L++ A  + H   + P+ V +WF KL   +QK T LHF+F+   T G N    ++
Sbjct  12   ILSVLLMLTAIPVVHALDKSPKAVGRWFKKLSNAKQKTTKLHFYFHDLATGGKNETSSVI  71

Query  477  AQS-NVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVF  301
            AQ+ N+T+KSP LFG + ++D P+T+GPE +S ++G  QG Y  ++++E    M FNFVF
Sbjct  72   AQATNITSKSPFLFGILRMIDDPLTVGPELSSKRVGSAQGIYGSAAINEFGLLMNFNFVF  131

Query  300  THGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIE  121
            T G Y+GS+LS++G N + +E+REM IVGGSG+FRLARGI T KT + N T      ++E
Sbjct  132  TDGPYSGSTLSLLGRNAISNEYREMPIVGGSGVFRLARGIATAKTYFANFTV----AIVE  187

Query  120  CDVMLLHY  97
              V++LHY
Sbjct  188  YHVIVLHY  195



>ref|XP_010023736.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
 gb|KCW90020.1| hypothetical protein EUGRSUZ_A02220 [Eucalyptus grandis]
Length=195

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 113/172 (66%), Gaps = 2/172 (1%)
 Frame = -1

Query  612  HGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGA  433
            H  A  P++V +WF +L    +K T L F+F+ T  G +P    +A++ +T KSPTLFG 
Sbjct  26   HAVADDPKKVDKWFNRLSHAERKTTRLRFYFHDTVSGKSPTAARIAEATMTKKSPTLFGV  85

Query  432  MAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYN  253
            + ++D P+T GPE  S  +GR QGFY  + L+ +S  M  N VFT  +YNGS+LS++G+N
Sbjct  86   VFMIDDPLTEGPEPESPLVGRAQGFYGSAGLESLSLLMNINLVFTSPEYNGSTLSIMGHN  145

Query  252  PVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            P Y  +REM IVGG+G FRLA G+ T KT + N+TT   D V+E +V+ +HY
Sbjct  146  PTYETYREMPIVGGTGFFRLASGVATAKTYFLNLTTF--DAVVEYNVLAMHY  195



>ref|XP_010023728.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
Length=195

 Score =   165 bits (418),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 112/169 (66%), Gaps = 2/169 (1%)
 Frame = -1

Query  603  AQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAV  424
            A  P++V  WF +L   ++K T LHF+F+ T  G NP  V VA++ ++ KSPTLFG + +
Sbjct  29   ADDPKKVNAWFNRLSHAKRKTTRLHFYFHDTLSGKNPTAVRVAEAAMSEKSPTLFGVVNM  88

Query  423  MDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVY  244
            +D P+T GPE  S  +GR QGFY    L+ ++  M  N VFT  +YNGS+LS++G NP  
Sbjct  89   IDDPLTEGPEPESPLIGRAQGFYGSVGLESVALHMNVNLVFTTPEYNGSTLSILGRNPAL  148

Query  243  HEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
              +REM IVGG+G+FRLA G+ T KT + N+TT  GD V+E  V+ +HY
Sbjct  149  ETYREMPIVGGTGIFRLASGVATAKTYFLNLTT--GDAVVEYKVIAMHY  195



>gb|KCW90019.1| hypothetical protein EUGRSUZ_A02219 [Eucalyptus grandis]
Length=187

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 112/169 (66%), Gaps = 2/169 (1%)
 Frame = -1

Query  603  AQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAV  424
            A  P++V  WF +L   ++K T LHF+F+ T  G NP  V VA++ ++ KSPTLFG + +
Sbjct  21   ADDPKKVNAWFNRLSHAKRKTTRLHFYFHDTLSGKNPTAVRVAEAAMSEKSPTLFGVVNM  80

Query  423  MDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVY  244
            +D P+T GPE  S  +GR QGFY    L+ ++  M  N VFT  +YNGS+LS++G NP  
Sbjct  81   IDDPLTEGPEPESPLIGRAQGFYGSVGLESVALHMNVNLVFTTPEYNGSTLSILGRNPAL  140

Query  243  HEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
              +REM IVGG+G+FRLA G+ T KT + N+TT  GD V+E  V+ +HY
Sbjct  141  ETYREMPIVGGTGIFRLASGVATAKTYFLNLTT--GDAVVEYKVIAMHY  187



>ref|XP_010041372.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
 gb|KCW44401.1| hypothetical protein EUGRSUZ_L02112 [Eucalyptus grandis]
Length=195

 Score =   165 bits (418),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 110/166 (66%), Gaps = 2/166 (1%)
 Frame = -1

Query  594  PEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDG  415
            PE+V  WF +L     K T LHF+F+ T  G NP  V +A++ +T KSPTLFG + ++D 
Sbjct  32   PEKVNAWFNRLSHAEHKTTHLHFYFHDTLSGKNPTAVRIAEATMTEKSPTLFGVVNMIDD  91

Query  414  PVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEH  235
            P+T GPE  S  +GR QGFY    L+ ++  M  N VFT  +YNGS+LS++G NP    +
Sbjct  92   PLTEGPEPESPLIGRAQGFYGSVGLESLALHMNVNLVFTTPEYNGSTLSILGRNPALETY  151

Query  234  REMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            REM IVGG+G+FRLA G+ T KT ++N+TT  GD V+E  V+ +HY
Sbjct  152  REMPIVGGTGVFRLASGVATAKTYFFNLTT--GDAVVEYKVIAMHY  195



>gb|KDP20413.1| hypothetical protein JCGZ_06372 [Jatropha curcas]
Length=182

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 114/179 (64%), Gaps = 2/179 (1%)
 Frame = -1

Query  633  VFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAK  454
            V A  + +   Q   E+ QW  +L   +QKVT LHF+F+ T  G +P  +++A+SN+T K
Sbjct  6    VIAMPMVNSIFQDSREIDQWIHELTHAKQKVTHLHFYFHDTFSGPSPTAIVIARSNMTDK  65

Query  453  SPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSS  274
            SPTLFG   ++D P+T GPE +S ++GR QGFY  S    +   M    VFT  +YNGS+
Sbjct  66   SPTLFGLTTMIDDPLTEGPELDSKEVGRAQGFYGSSGQKTVGLLMATTLVFTGKEYNGST  125

Query  273  LSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            L+V+G NP    HRE+ IVGG+G+FRLARG   +KT  +N TT  GD ++E  V ++HY
Sbjct  126  LTVLGRNPALEPHRELPIVGGTGVFRLARGFAMLKTYSFNSTT--GDAIVEYHVTVIHY  182



>ref|XP_007200808.1| hypothetical protein PRUPE_ppa025557mg [Prunus persica]
 gb|EMJ02007.1| hypothetical protein PRUPE_ppa025557mg [Prunus persica]
Length=171

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 113/174 (65%), Gaps = 5/174 (3%)
 Frame = -1

Query  618  LAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLF  439
            +   T +GPE ++QWF  L   +QK+T LHF+F+   +G +   V VA++  T KSPTLF
Sbjct  3    MVQSTIEGPE-IEQWFQNLHLAKQKLTRLHFYFHDVVLGPSQTSVGVARAPNTFKSPTLF  61

Query  438  GAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVG  259
            G + + D P+T GPE  S  LGR QG Y  +S +E+S  M  NFVFT GK+NGSSL+V+G
Sbjct  62   GLVNIFDNPLTTGPEPTSELLGRAQGLYGFASQEEVSLLMSVNFVFTSGKHNGSSLTVLG  121

Query  258  YNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
             NPV H  RE+ I+GG+G+FRLARG    KT + N T      ++E +V+ LHY
Sbjct  122  RNPVVHSVRELPIIGGTGVFRLARGFALAKTYFINTTL----AIVEYNVVALHY  171



>emb|CDP16945.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   163 bits (413),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 117/175 (67%), Gaps = 5/175 (3%)
 Frame = -1

Query  618  LAHGTA-QGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTL  442
            LAHG+  Q PE VK+WF +L   ++K+T+LHF+ + T  G NP+ +LVAQ+N T+KSPT+
Sbjct  29   LAHGSIDQSPEAVKKWFKELGHAKEKLTELHFYVHDTVTGKNPSAILVAQANTTSKSPTM  88

Query  441  FGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVV  262
            FGA  V D P+T+GPE +S  +GR  G Y+  S  + S  ++ N  F  G++ GS+LSV+
Sbjct  89   FGATFVFDDPMTVGPEPSSKVIGRAHGVYSSVSKKDASLIVILNLAFNDGQFKGSTLSVL  148

Query  261  GYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            G  P+  +++EM I+GGSG FRLARGI+T       + T   + +IE  V++LHY
Sbjct  149  GSYPLSQKYKEMPILGGSGAFRLARGIVTATA----IATNGLNEIIEFHVLVLHY  199



>ref|XP_002276741.3| PREDICTED: dirigent protein 23-like [Vitis vinifera]
Length=185

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 109/162 (67%), Gaps = 1/162 (1%)
 Frame = -1

Query  639  LIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVT  460
            LI+F+  ++   A    EV +WF  L   +++ T LHF+F+ TT G NP+   VAQ+  T
Sbjct  8    LILFSLAISMAMADS-NEVDEWFGNLQHAKERTTRLHFYFHDTTSGKNPSARRVAQAPST  66

Query  459  AKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNG  280
             KSPT FG + +MD P+T GPE  S  +GR QG YA S LDE+S  M +N +F  G YNG
Sbjct  67   NKSPTFFGLINMMDDPLTEGPEATSKLVGRGQGLYASSGLDELSLLMAWNVIFKSGDYNG  126

Query  279  SSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWN  154
            SSL+++G NP  H  REM IVGG+G+FR+ARG++T+KT ++N
Sbjct  127  SSLTILGRNPTTHPLREMSIVGGTGVFRMARGVVTLKTYFFN  168



>ref|XP_008235983.1| PREDICTED: dirigent protein 21-like [Prunus mume]
 ref|XP_008245705.1| PREDICTED: dirigent protein 21-like [Prunus mume]
Length=189

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 114/177 (64%), Gaps = 5/177 (3%)
 Frame = -1

Query  627  ATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSP  448
            A  +   T +GPE ++QWF  L   +QK+T LHF+F+   +G +   V VA++  T KSP
Sbjct  18   AMPMVQCTIEGPE-IEQWFQNLHLAKQKLTRLHFYFHDVVLGPSQTSVGVARAPNTFKSP  76

Query  447  TLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLS  268
            T FG + + D P+T GPE  S  LGR QG Y  +S +E+S  M  NFVFT GK+NGSSL+
Sbjct  77   TFFGLVNIFDNPLTKGPEPTSELLGRAQGLYGFASQEEVSLLMSVNFVFTSGKHNGSSLT  136

Query  267  VVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            V+G NPV H  RE+ I+GG+G+FRLARG+   KT + N T      ++E +V+ LHY
Sbjct  137  VLGRNPVVHSVRELPIIGGTGVFRLARGLALAKTYFINTTL----AIVEYNVVALHY  189



>ref|XP_006359663.1| PREDICTED: dirigent protein 1-like [Solanum tuberosum]
Length=188

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 123/194 (63%), Gaps = 6/194 (3%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEK     I ++SL++     A    + P+ V++WF  LP    K T  HF+F+    G 
Sbjct  1    MEKQI--VIRLISLVLLTIATAAAIDKSPKAVEKWFKNLPYANTKTTKFHFYFHEIFGGD  58

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            N    ++AQ+N+TA+SPT FG + + D P+T+GP+ NS Q+GR QG +   SL E++   
Sbjct  59   NQTAPIIAQANITAQSPTFFGMLRMFDNPLTVGPDPNSKQVGRAQGIHGSPSLSELALFF  118

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
             FNFVFT+G YNGSS+SV+G      E+RE+ I+GGSG+FRLA+G+ T KT + N   KL
Sbjct  119  DFNFVFTNGPYNGSSVSVMGRVAESQEYRELSIIGGSGVFRLAKGVATGKTYFSN--DKL  176

Query  138  GDTVIECDVMLLHY  97
               ++E +++++HY
Sbjct  177  --VIVEYNLIIIHY  188



>ref|XP_010065290.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
 gb|KCW62710.1| hypothetical protein EUGRSUZ_G00281 [Eucalyptus grandis]
Length=202

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 111/175 (63%), Gaps = 2/175 (1%)
 Frame = -1

Query  621  KLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTL  442
            K A   A  P +V  WF  L    +K T LHF+F+ T  G  P  V VA++ +T KSPT 
Sbjct  30   KHARAEADDPGKVDAWFNGLSHADRKTTRLHFYFHDTLSGRKPTAVRVAEATMTDKSPTG  89

Query  441  FGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVV  262
            FG + ++D P+T GPE  S  +GR QGFY    L+ ++  M  N VFT  +YNGS+LS++
Sbjct  90   FGVVNMIDDPLTEGPEPESPLVGRAQGFYGSVGLESVALHMNMNLVFTTPEYNGSTLSIL  149

Query  261  GYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            G+NP    +REM IVGG+G+FRLA G++T KT + N+TT  GD V+E  V+ LHY
Sbjct  150  GHNPALETYREMPIVGGTGIFRLASGVVTAKTSFLNLTT--GDAVVEYKVIALHY  202



>ref|XP_010039751.1| PREDICTED: dirigent protein 23-like isoform X2 [Eucalyptus grandis]
 ref|XP_010039752.1| PREDICTED: dirigent protein 23-like isoform X2 [Eucalyptus grandis]
 ref|XP_010039754.1| PREDICTED: dirigent protein 23-like isoform X2 [Eucalyptus grandis]
 gb|KCW45766.1| hypothetical protein EUGRSUZ_L00429 [Eucalyptus grandis]
Length=198

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 111/175 (63%), Gaps = 6/175 (3%)
 Frame = -1

Query  621  KLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTL  442
            K AH  A  PE+V  WF  L    +K T LHF+F+ T  G NP  V +A+    AKSPT 
Sbjct  30   KHAHAEADDPEKVDAWFNGLSHADRKTTRLHFYFHDTLSGRNPTAVRIAE----AKSPTG  85

Query  441  FGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVV  262
            FG + ++D P+T GPE  S  +GR QGFY    L+ ++  M  N VFT  +Y+GS+LS++
Sbjct  86   FGVVNMIDDPLTKGPEPESPLVGRAQGFYGSVGLESMALHMSMNLVFTTPEYHGSTLSIL  145

Query  261  GYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            G NP    +REM IVGG+G+FRLA G++T KT + N+TT  GD V+E  V+ LHY
Sbjct  146  GRNPALETYREMPIVGGTGVFRLASGVVTAKTYFLNLTT--GDAVVEYKVIALHY  198



>emb|CAN76752.1| hypothetical protein VITISV_009422 [Vitis vinifera]
Length=154

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
             +K++ LHF+F+    G  P  V VA++ +T KSPT+FGA+ +MD P+T+GPE +S  +G
Sbjct  5    EEKLSHLHFYFHDIISGPKPTAVRVAEAAMTNKSPTVFGAVLMMDDPLTVGPEPSSKLVG  64

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +S +EI F M+ NF F  GKYNGS+LSV+G N ++ + REM IVGGSGLFR 
Sbjct  65   RAQGIYASASQEEIGFLMVLNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIVGGSGLFRF  124

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T  +NV T  GD V+E +V + HY
Sbjct  125  ARGYAQARTHTFNVKT--GDVVVEYNVYVFHY  154



>ref|XP_010039750.1| PREDICTED: dirigent protein 23-like isoform X1 [Eucalyptus grandis]
Length=273

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 111/175 (63%), Gaps = 6/175 (3%)
 Frame = -1

Query  621  KLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTL  442
            K AH  A  PE+V  WF  L    +K T LHF+F+ T  G NP  V +A+    AKSPT 
Sbjct  105  KHAHAEADDPEKVDAWFNGLSHADRKTTRLHFYFHDTLSGRNPTAVRIAE----AKSPTG  160

Query  441  FGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVV  262
            FG + ++D P+T GPE  S  +GR QGFY    L+ ++  M  N VFT  +Y+GS+LS++
Sbjct  161  FGVVNMIDDPLTKGPEPESPLVGRAQGFYGSVGLESMALHMSMNLVFTTPEYHGSTLSIL  220

Query  261  GYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            G NP    +REM IVGG+G+FRLA G++T KT + N+TT  GD V+E  V+ LHY
Sbjct  221  GRNPALETYREMPIVGGTGVFRLASGVVTAKTYFLNLTT--GDAVVEYKVIALHY  273



>emb|CDP16943.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 118/176 (67%), Gaps = 4/176 (2%)
 Frame = -1

Query  618  LAHGTA-QGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTL  442
            LAHG+  Q PE VK+WF +L   ++K+T+LHF+ +      +P  VLVAQ+N T+KSPT+
Sbjct  24   LAHGSIDQSPEAVKKWFKELRHAKEKLTELHFYVHDRVTAESPTSVLVAQANATSKSPTM  83

Query  441  FGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSL-DEISFTMLFNFVFTHGKYNGSSLSV  265
            FGA  V D P+T+GPE +S  +G  QG  + +S  D+ S  ++ N VF  GK+NGS+LSV
Sbjct  84   FGATYVFDDPMTLGPEPSSLIIGHAQGISSSASKEDDASQIVIMNLVFNDGKFNGSTLSV  143

Query  264  VGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            +G  P + +++EM I GGSG FRLARG++T     +N TT+  + +I   V++LHY
Sbjct  144  LGDYPFFQKYKEMPIAGGSGAFRLARGLVTAIIYAYNDTTQ--NEIINFHVLVLHY  197



>ref|XP_007029072.1| Disease resistance-responsive family protein [Theobroma cacao]
 gb|EOY09574.1| Disease resistance-responsive family protein [Theobroma cacao]
Length=196

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AKL   ++K++ LHF+F+    G  P+ V VA + +T KS T FGA+ ++D P+T+ PER
Sbjct  41   AKLGLKQEKLSHLHFYFHDIVSGPKPSAVRVASAAMTNKSATGFGAVVIIDDPLTVAPER  100

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
            NS  +G+ QG YA ++ DE    M+ NF FT GKYNGSSLS++G N V+   REM IVGG
Sbjct  101  NSKLVGKAQGIYASAAQDEFGLLMVMNFAFTKGKYNGSSLSLLGRNTVFSTVREMPIVGG  160

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFR ARG    KT  ++  TK GDTV+E +V + HY
Sbjct  161  SGLFRFARGYAQAKTHTFD--TKTGDTVVEYNVYVFHY  196



>ref|XP_006353783.1| PREDICTED: dirigent protein 21-like [Solanum tuberosum]
Length=187

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K++ LHFFF+    G NP  V +A++ VT +S T FG MA++D P+TIGPE NS  +G
Sbjct  38   REKLSHLHFFFHDIVSGKNPTAVKIAEAAVTNRSATGFGLMAMIDDPLTIGPEANSKIVG  97

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +S+++I   M+ NFVF  GKYNGSSLSV+G N V    REM IVGGSGLFR 
Sbjct  98   RAQGMYAQASINDIGLLMVLNFVFVEGKYNGSSLSVLGRNSVMSIVREMPIVGGSGLFRF  157

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
             RG +  KT  ++  T  GD V+E +V + HY
Sbjct  158  GRGYVQAKTHTFDFKT--GDAVVEYNVYVFHY  187



>ref|XP_007041904.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
 gb|EOX97735.1| Disease resistance-responsive (dirigent-like protein) family 
protein [Theobroma cacao]
Length=186

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 105/164 (64%), Gaps = 2/164 (1%)
 Frame = -1

Query  588  EVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPV  409
             V+ W A++   ++ VT+L F+F+ T  G NP+ + VAQ+  T KSPTLFGAM + D P+
Sbjct  24   RVQSWAARVEAKQEMVTNLQFYFHDTISGKNPSAIKVAQAPDTEKSPTLFGAMLMADDPL  83

Query  408  TIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHRE  229
            T  P+ NS  LGR QG Y  +   E+   M  +F FT GKYNGSS+S++G N      RE
Sbjct  84   TESPDPNSKLLGRAQGLYGSAGQTEVGLIMAMSFCFTDGKYNGSSISILGKNSALTPFRE  143

Query  228  MVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            M +VGG+GLFRLARG    KT W ++TT  GD ++  +V ++HY
Sbjct  144  MPVVGGTGLFRLARGYAIAKTHWMDITT--GDAIVGYNVTIVHY  185



>ref|XP_002280963.1| PREDICTED: dirigent protein 22 [Vitis vinifera]
Length=188

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 117/195 (60%), Gaps = 11/195 (6%)
 Frame = -1

Query  675  EKLTYKTILVVSLIVFATKLAHGTAQ--GPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVG  502
            + LTY   L  S +  A    H  ++   PE        L   R+K++ LHF+F+    G
Sbjct  3    KTLTYFAFLFFSTVAAAVGDGHTFSRNLSPES-------LDLKREKLSHLHFYFHDVITG  55

Query  501  ANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT  322
             NP  V VA++ VT KS TLFG +AV+D P+T+GPE +S  +GR QG YA +S  E    
Sbjct  56   PNPTVVRVAEAAVTNKSATLFGGVAVLDDPLTVGPEPSSKLVGRAQGMYAAASQKEFGLL  115

Query  321  MLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTK  142
            M+ NF F  GKYNGS+LSV+G N ++ + REM I+GGSG+FR ARG +  +T  +NV  K
Sbjct  116  MVMNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIIGGSGVFRYARGYVEARTYSFNV--K  173

Query  141  LGDTVIECDVMLLHY  97
             GD V+E +V   HY
Sbjct  174  SGDAVVEYNVYAFHY  188



>ref|XP_010257547.1| PREDICTED: dirigent protein 21-like [Nelumbo nucifera]
Length=171

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K+T LHF+F+    G NP  V VA++ +T KS T FGA+ VMD P+T  PE  S  +G
Sbjct  22   QEKITHLHFYFHDIVSGRNPTAVRVAEAPITNKSATFFGAVVVMDDPLTETPELTSKAVG  81

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y+ +S  E+SF + FNFVF+ GKYNGS+LSV+G  PV  + RE+ ++GGSG+FR 
Sbjct  82   RAQGIYSATSQSELSFLLAFNFVFSEGKYNGSTLSVLGREPVGPKVRELPVIGGSGIFRF  141

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG   +KT   ++ T  GD V+E DV ++HY
Sbjct  142  ARGYALVKTQALDLKT--GDAVLEYDVFVIHY  171



>ref|XP_009342232.1| PREDICTED: dirigent protein 22-like [Pyrus x bretschneideri]
 ref|XP_009349709.1| PREDICTED: dirigent protein 22-like [Pyrus x bretschneideri]
Length=182

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHF+F+    G NP  V VAQ+ ++ KSPTLFG++A+ D P+T+GP R+S  +G
Sbjct  33   QEKLSHLHFYFHDIVSGPNPAAVWVAQTPISKKSPTLFGSIAMFDDPLTVGPTRSSKLVG  92

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y  +S  E +  M  NFVF  G YNGSSLSV+G N V    REM ++GGSG+FRL
Sbjct  93   RAQGLYGSASQSEDALLMAMNFVFYEGNYNGSSLSVLGRNSVLEAVREMPVIGGSGVFRL  152

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG +  KT+ +N T+  GD ++E DV + HY
Sbjct  153  ARGYVQAKTVTFNATS--GDALVEYDVFVFHY  182



>ref|XP_009630041.1| PREDICTED: dirigent protein 22-like [Nicotiana tomentosiformis]
Length=193

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 111/174 (64%), Gaps = 7/174 (4%)
 Frame = -1

Query  612  HGTAQGPEEVKQWFAK--LPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLF  439
            HG +Q   E  +  +K  +   R+K++ LHF+F+    G NP  V +A++ +T +SPT F
Sbjct  25   HGNSQ---EFSRKLSKKSMGMKREKLSHLHFYFHDIVSGKNPTAVKIAEAAMTNRSPTGF  81

Query  438  GAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVG  259
            G MA++D P+T+GPE NS  +GR QG YA +SL+++   M+ NF F  GKYNGS+LS++G
Sbjct  82   GLMAMIDDPLTVGPEPNSKLVGRAQGIYAQASLNDVGLLMVLNFAFVEGKYNGSTLSILG  141

Query  258  YNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
             N V    REM IVGGSGLFR ARG    KT   +  T  GD V+E +V + HY
Sbjct  142  RNSVMSTVREMPIVGGSGLFRFARGYAKAKTHTLDFKT--GDAVVEYNVYVFHY  193



>ref|XP_009775777.1| PREDICTED: dirigent protein 22-like [Nicotiana sylvestris]
Length=191

 Score =   155 bits (392),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 119/195 (61%), Gaps = 9/195 (5%)
 Frame = -1

Query  681  NMEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVG  502
            N +KL+  T+L++S+      L HG  +     K     +   R+K++ LHF+F+    G
Sbjct  6    NFQKLSI-TVLLLSI------LTHGNCRQEFLRKLSKKSMGMKREKLSHLHFYFHDIVSG  58

Query  501  ANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT  322
             NP  V +A++ +T +S T FG MA++D P+T+GPE NS  +GR QG YA +SL++I   
Sbjct  59   KNPTAVKIAEAAMTNRSSTGFGLMAMIDDPLTVGPEPNSKLVGRAQGIYAQASLNDIGLL  118

Query  321  MLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTK  142
            M  NF F  GKYNGS+LS++G N V    REM IVGGSGLFR ARG +  KT   +  T 
Sbjct  119  MALNFAFVEGKYNGSTLSILGRNSVMSTVREMPIVGGSGLFRFARGYVQAKTHTLDFKT-  177

Query  141  LGDTVIECDVMLLHY  97
             GD V+E +V + HY
Sbjct  178  -GDAVVEYNVYVFHY  191



>ref|XP_002323336.2| hypothetical protein POPTR_0016s06070g [Populus trichocarpa]
 gb|EEF05097.2| hypothetical protein POPTR_0016s06070g [Populus trichocarpa]
Length=193

 Score =   155 bits (391),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 104/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  567  KLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERN  388
            KL   R+K++ LHF+F+ T  G NP  V VAQ+  T KS T FG +A++D P+T+ PE +
Sbjct  39   KLGLKREKLSHLHFYFHDTLSGKNPTAVPVAQAATTNKSSTSFGLVAMIDDPLTVKPEVS  98

Query  387  SSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGS  208
            S Q+GR QG YA +S  E+SF M+ N  FT GKYNGS+LS++G N ++   REM IVGGS
Sbjct  99   SKQVGRAQGIYASASQSEVSFLMVLNLFFTEGKYNGSTLSILGRNSIFSGIREMPIVGGS  158

Query  207  GLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            GLFR ARG    KT   N+  K  D ++E +V + HY
Sbjct  159  GLFRFARGYTQAKTYIANL--KTNDAIVEYNVYVFHY  193



>ref|XP_006388055.1| hypothetical protein POPTR_0378s00200g [Populus trichocarpa]
 gb|ERP46969.1| hypothetical protein POPTR_0378s00200g [Populus trichocarpa]
Length=193

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -1

Query  567  KLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERN  388
            KL   R+K++ LHF+F+ T  G NP  V VAQ+  T KS T FG + ++D P+T+ PE +
Sbjct  39   KLGLKREKLSHLHFYFHDTVSGKNPTAVPVAQAATTNKSSTSFGQVVMIDDPLTVKPEVS  98

Query  387  SSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGS  208
            S Q+GR QG YA +S  E+SF M+ N  FT GKYNGS+LS++G N ++   REM IVGGS
Sbjct  99   SKQVGRAQGIYASASQSEVSFLMVLNLFFTEGKYNGSTLSILGRNSIFSGIREMPIVGGS  158

Query  207  GLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            GLFR ARG    KT  + V  K  D V+E +V + HY
Sbjct  159  GLFRFARGYTQAKT--YTVNLKTNDAVVEYNVYVFHY  193



>ref|XP_004231011.1| PREDICTED: dirigent protein 1-like [Solanum lycopersicum]
Length=186

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 109/168 (65%), Gaps = 4/168 (2%)
 Frame = -1

Query  600  QGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVM  421
            + P+ V++WF  LP  + K T  HF+F+    G N    ++AQ+N TA+SPT FG + + 
Sbjct  23   KSPKAVEKWFKNLPYAKTKTTKFHFYFHEIFGGDNQTAPIIAQANTTAQSPTFFGMLRMF  82

Query  420  DGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYH  241
            D P+T+GP+ NS Q+GR QG +   SL E++    FNFVFT G YNG++LSV+G      
Sbjct  83   DNPLTVGPDPNSKQVGRAQGIHGSPSLSELALFFDFNFVFTDGPYNGTTLSVMGRVAESQ  142

Query  240  EHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            E+RE+ I+GGSG+FRLA G+ T KT + N +      ++E +++++HY
Sbjct  143  EYRELSIIGGSGIFRLANGVATAKTYFSNDSL----VIVEYNLIIIHY  186



>emb|CDP19245.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 118/176 (67%), Gaps = 4/176 (2%)
 Frame = -1

Query  618  LAHGTA-QGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTL  442
            LAHG+  Q P  VK+WF +L   ++K+T+LHF+ +      +P  VLVAQ+N T+KSPT+
Sbjct  29   LAHGSIDQSPAAVKKWFKELRHAKEKLTELHFYVHDRVTAESPTSVLVAQANSTSKSPTM  88

Query  441  FGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM-LFNFVFTHGKYNGSSLSV  265
            FGA  V D P+T+GPE +S  +G   G  + +S +E +  + + N VF  GK+NGSSL+V
Sbjct  89   FGATYVFDDPMTLGPEPSSKIIGHAHGITSSASKEEDASQIGIMNLVFNDGKFNGSSLTV  148

Query  264  VGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            +G  P + +++EM IVGGSG FRLARGI+T     +N TT+  + +I+  V++LHY
Sbjct  149  LGDYPFFQKYKEMPIVGGSGAFRLARGIVTAIIHTYNDTTQ--NEIIDFHVLVLHY  202



>ref|XP_007029066.1| Disease resistance-responsive family protein [Theobroma cacao]
 gb|EOY09568.1| Disease resistance-responsive family protein [Theobroma cacao]
Length=196

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AKL   ++K++ LHF+F+    G  P+ V VA + +T KS T FGA+ + D P+T+ PER
Sbjct  41   AKLGLKQEKLSHLHFYFHDIVSGRKPSAVRVASAAMTNKSETGFGAVVMADDPLTVAPER  100

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
            NS  +G+ QG YA ++ DE+   M+ NF FT GKYNGSSLS++G N V+   REM IVGG
Sbjct  101  NSKLVGKAQGIYASAAQDEVGLLMVMNFAFTEGKYNGSSLSLLGRNTVFWTVREMPIVGG  160

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFR ARG    KT  ++  TK GD V+E +V + HY
Sbjct  161  SGLFRFARGYAQAKTHTFD--TKTGDAVVEYNVYVFHY  196



>ref|XP_004243690.1| PREDICTED: dirigent protein 22-like [Solanum lycopersicum]
Length=187

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 114/183 (62%), Gaps = 7/183 (4%)
 Frame = -1

Query  639  LIVFATKLAHGTAQGPEEVKQWFAK--LPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSN  466
            LIV  + L +G      E  +  +K  +   R+K++ LHF+F+    G NP  V +A++ 
Sbjct  10   LIVLLSVLTNGNCH---EFSRILSKKAMGLKREKLSHLHFYFHDIVSGKNPTAVRIAEAA  66

Query  465  VTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKY  286
            VT +S T FG  A++D P+T+GPE NS  +GR QG YA +S++++   M+ NFVF  GKY
Sbjct  67   VTNRSATGFGLTAMIDDPLTVGPESNSKIVGRAQGIYAQASINDVGLLMVLNFVFIEGKY  126

Query  285  NGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVML  106
            NGSSLS++G N V    REM IVGGSGLFR ARG +  KT   N   K GD V+E +V +
Sbjct  127  NGSSLSILGRNSVASIVREMPIVGGSGLFRFARGYVQAKT--HNFDLKTGDAVVEYNVYV  184

Query  105  LHY  97
             HY
Sbjct  185  FHY  187



>ref|XP_007203174.1| hypothetical protein PRUPE_ppa024560mg [Prunus persica]
 gb|EMJ04373.1| hypothetical protein PRUPE_ppa024560mg [Prunus persica]
Length=191

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 122/201 (61%), Gaps = 17/201 (8%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLR-------QKVTDLHFFF  520
            M K +   ++ ++++ F T +   T++ P      F++ P+L+       +K++ LHF+F
Sbjct  1    MAKNSKSLLISLTILFFITMV---TSKSPN-----FSQNPSLQALGLNKQEKLSHLHFYF  52

Query  519  YTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSL  340
            +    G NP  +  AQ+  + KSPTLFG++A+ D P+T+GPER+S  +GR QG Y  +S 
Sbjct  53   HDIVSGPNPTAIWAAQTPTSKKSPTLFGSIAMFDDPLTVGPERSSKLVGRAQGIYGSASQ  112

Query  339  DEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMW  160
             E +  M  N  F  GK+NGSSLSV G N V    REM IVGGSG+FR ARG +  +T+ 
Sbjct  113  SEDALLMTMNLAFVEGKFNGSSLSVFGRNAVVEAVREMPIVGGSGVFRFARGYVQARTLK  172

Query  159  WNVTTKLGDTVIECDVMLLHY  97
            +N T+  GD ++E DV + HY
Sbjct  173  FNATS--GDALVEYDVFVFHY  191



>ref|XP_008356707.1| PREDICTED: dirigent protein 22-like [Malus domestica]
Length=171

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 109/175 (62%), Gaps = 5/175 (3%)
 Frame = -1

Query  618  LAHGTAQGPEE-VKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTL  442
            +   T + P E + QWF  LP  +QK+T LHF+F+   +G +P  V VA ++ T  SPT 
Sbjct  1    MVQSTIENPRENIDQWFQNLPHAKQKLTRLHFYFHDVVLGPHPTVVAVANASHTFTSPTF  60

Query  441  FGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVV  262
            FG + + D P+T GPE  S  +GR QG Y  +S +E+S  M  NFVF   K+NGSSL+V+
Sbjct  61   FGRVNIFDNPLTQGPEPGSKLVGRAQGLYGFTSQEEVSLLMAMNFVFRSWKHNGSSLTVL  120

Query  261  GYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            G NPV    RE+ IVGG+G+FRLARG +  KT ++N +       +E +V +LHY
Sbjct  121  GRNPVGQLVRELPIVGGTGVFRLARGFVLAKTYFFNASV----ATVEYNVAVLHY  171



>ref|XP_010243406.1| PREDICTED: dirigent protein 2-like [Nelumbo nucifera]
Length=197

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K+T LHF+F+    G NP  + VA +  T +S T FG + VMD P+T  PE  S Q+G
Sbjct  48   REKITHLHFYFHDIVSGRNPTAIKVAAAASTNRSLTEFGLVVVMDDPLTETPEPTSRQVG  107

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y+ +SLD++S  M+ N+ FTHGKYNGS+LS++G N V+ E REM +VGG+GLFR 
Sbjct  108  RAQGIYSSASLDDLSLLMVLNYAFTHGKYNGSTLSILGRNTVFSEVREMPVVGGTGLFRF  167

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT   ++ T  GD V+E +V ++HY
Sbjct  168  ARGYAQAKTHTIDLNT--GDAVVEYNVFVVHY  197



>ref|XP_006851948.1| hypothetical protein AMTR_s00041p00182920 [Amborella trichopoda]
 gb|ERN13415.1| hypothetical protein AMTR_s00041p00182920 [Amborella trichopoda]
Length=185

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 113/184 (61%), Gaps = 8/184 (4%)
 Frame = -1

Query  648  VVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQS  469
            V  L++F++ +A          + W   L   ++KV+ LHF+F+    G NP  + VA +
Sbjct  10   VAVLLLFSSHMA------TSNTESWREILGLQKEKVSHLHFYFHDVITGKNPTSIAVAGA  63

Query  468  NVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGK  289
            N T  SPT FG + V+D  +T GP+  S  +GR QGF+A SS  EISF M  NFVF  GK
Sbjct  64   NTTLTSPTFFGLVNVVDNTLTKGPKPTSKLIGRGQGFFASSSQSEISFFMAINFVFMEGK  123

Query  288  YNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVM  109
            +NGS+L++VG NP+ H+ REM +VGGSG FRLARG    KT   ++ TK  + ++E  + 
Sbjct  124  FNGSTLTMVGRNPIMHKEREMTVVGGSGAFRLARGYAIAKTFVSDLRTK--NAIVEYHIT  181

Query  108  LLHY  97
            ++H+
Sbjct  182  VIHF  185



>ref|XP_002280791.1| PREDICTED: dirigent protein 22 [Vitis vinifera]
Length=192

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 8/191 (4%)
 Frame = -1

Query  651  LVVSLIVFATKLAHGTAQGPEEVKQWFAK------LPTLRQKVTDLHFFFYTTTVGANPN  490
            L++   +F + +A   A G       F++      +    +K++ LHF+F+    G  P 
Sbjct  4    LLILFTIFFSTIAAVAASGSSGESHRFSRNLSPESIGLKEEKLSHLHFYFHDIISGPKPT  63

Query  489  DVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFN  310
             V VA++ +T KS T+FGA+ +MD P+T+GPE +S  +GR QG YA +S +E+ F M+ N
Sbjct  64   AVRVAEAAMTNKSATVFGAVLMMDDPLTVGPEPSSKLVGRAQGIYASASQEEMGFLMVLN  123

Query  309  FVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDT  130
            F F  GKYNGS+LSV+G N ++ + REM IVGGSGLFR ARG    +T  +N   K GD 
Sbjct  124  FAFMEGKYNGSTLSVLGRNTIFSKVREMSIVGGSGLFRFARGYAQARTHTFN--PKTGDV  181

Query  129  VIECDVMLLHY  97
            V+E +V + HY
Sbjct  182  VVEYNVYVFHY  192



>emb|CAN76521.1| hypothetical protein VITISV_000433 [Vitis vinifera]
Length=153

 Score =   150 bits (380),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
             +K++ LHF+F+    G  P  V VA++ +T KS T+FGA+ +MD P+T+GPE +S  +G
Sbjct  4    EEKLSHLHFYFHDIISGPKPTAVRVAEAAMTNKSATVFGAVLMMDDPLTVGPEPSSKLVG  63

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +S +E+ F M+ NF F  GKYNGS+LSV+G N ++ + REM IVGGSGLFR 
Sbjct  64   RAQGIYASASQEEMGFLMVLNFAFMEGKYNGSTLSVLGRNTIFSKVREMSIVGGSGLFRF  123

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T  +N   K GD V+E +V + HY
Sbjct  124  ARGYAQARTHTFN--PKTGDVVVEYNVYVFHY  153



>ref|XP_010101075.1| hypothetical protein L484_007310 [Morus notabilis]
 gb|EXB86887.1| hypothetical protein L484_007310 [Morus notabilis]
Length=212

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 102/160 (64%), Gaps = 7/160 (4%)
 Frame = -1

Query  576  WFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGP  397
            WF      R+K++ LHF+F+    G NP  + +A   VT  S T FG +  +D P+T+GP
Sbjct  60   WFK-----REKLSHLHFYFHDIVGGKNPTAIQIAGPPVTNASSTFFGLVTAIDDPLTVGP  114

Query  396  ERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIV  217
            E NS QLGR QG YA +S  E+   M+ N+VFT GKYNGS+LS++G N  +   REM IV
Sbjct  115  EPNSKQLGRAQGLYASASQSEVGLMMVLNYVFTEGKYNGSTLSILGRNAAFSAVREMPIV  174

Query  216  GGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            GGSGLFR ARG    +T  +++ T  GD V+E +V +LHY
Sbjct  175  GGSGLFRFARGYAQARTHKFDLKT--GDAVVEYNVYVLHY  212



>emb|CDP15163.1| unnamed protein product [Coffea canephora]
Length=196

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = -1

Query  606  TAQGPEE--VKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVT-AKSPTLFG  436
            TAQG +E  V +WF KL   ++KVT  HF+F+ T  G +P  V VA +N T   SPT FG
Sbjct  26   TAQGGQEESVDEWFHKLGRAKEKVTKFHFYFHDTVGGKSPTAVRVASANTTFTSSPTYFG  85

Query  435  AMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGY  256
             + + D P+T GPE  S+ LG+ QGFYA +  +E+   M  N+ FT G++ GS+L++VG 
Sbjct  86   LVVMFDDPLTAGPEITSTVLGKAQGFYASTDQNELGLAMYVNYHFTTGEHKGSTLTLVGR  145

Query  255  NPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            N V  + REM IVGG+G+FRLARGI T KT + N      D ++E +++++HY
Sbjct  146  NAVDQKTREMSIVGGTGVFRLARGIATAKTYFQNSANF--DAIVEYNLVVVHY  196



>ref|XP_010048806.1| PREDICTED: dirigent protein 21-like [Eucalyptus grandis]
Length=175

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 113/181 (62%), Gaps = 11/181 (6%)
 Frame = -1

Query  633  VFATKLAHGTAQG--PEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVT  460
            VF    +H  A+   P+E       L   ++K++ LHF+F+    G NP  V VA++ +T
Sbjct  4    VFVAANSHAFARSLLPQE-------LGLKKEKLSHLHFYFHDIVSGRNPTAVRVAEAKMT  56

Query  459  AKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNG  280
              S T FGA+ ++D P+T GPE +S ++GR QG YALSS +++   M+ N+VFT GKYNG
Sbjct  57   NSSATGFGAVVMIDDPLTEGPEMSSKEVGRAQGIYALSSQNDVGLLMVQNYVFTEGKYNG  116

Query  279  SSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            S+LSV+G N V+   REM IVGGSGLFR ARG    KT   +   K GDTV+  +V + H
Sbjct  117  STLSVLGRNAVFSGVREMSIVGGSGLFRFARGYAQAKTHTMD--RKTGDTVVNYNVYVFH  174

Query  99   Y  97
            Y
Sbjct  175  Y  175



>ref|XP_010058355.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 gb|KCW90334.1| hypothetical protein EUGRSUZ_A02478 [Eucalyptus grandis]
Length=190

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 123/194 (63%), Gaps = 12/194 (6%)
 Frame = -1

Query  672  KLTYKTILVVSLIVFATKLAHGTAQG--PEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            KL   ++L +S  VF +  AHG A+   P E       L   ++K++ LHF+F+    G+
Sbjct  7    KLAIFSLLFMS-SVFVSANAHGFARSLLPRE-------LGLKKEKLSHLHFYFHDIVSGS  58

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
             P  V VA++ +T  S T FGA+ ++D P+T GPE +S ++GR QG YAL+S +++   M
Sbjct  59   KPTAVRVAEAKMTNSSTTGFGAVVMVDDPLTEGPEMSSKEVGRAQGIYALASQNDVGLLM  118

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
            + N+VF+ GKYNGS+LSV+G N V+   REM IVGGSGLFR ARG +  KT  +++ T  
Sbjct  119  VQNYVFSEGKYNGSTLSVLGRNAVFSGVREMPIVGGSGLFRFARGYVRAKTHTFDLKT--  176

Query  138  GDTVIECDVMLLHY  97
            GD  +E +V + HY
Sbjct  177  GDACVEYNVYVFHY  190



>ref|XP_010048736.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 ref|XP_010040001.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 gb|KCW45566.1| hypothetical protein EUGRSUZ_L00694 [Eucalyptus grandis]
 gb|KCW81097.1| hypothetical protein EUGRSUZ_C02472 [Eucalyptus grandis]
Length=190

 Score =   149 bits (377),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 121/196 (62%), Gaps = 12/196 (6%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQG--PEEVKQWFAKLPTLRQKVTDLHFFFYTTTV  505
            + KL   ++L +S  VF    +H  A+   P+E       L   ++K++ LHF+F+    
Sbjct  5    IAKLVAFSLLCMS-TVFVAANSHTFARSLLPQE-------LGLKKEKLSHLHFYFHDIVS  56

Query  504  GANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISF  325
            G NP  V VA++ +T  S T FGA+ ++D P+T GPE +S ++GR QG YALSS +++  
Sbjct  57   GRNPTAVRVAEAKMTNSSATGFGAVVMIDDPLTEGPEMSSKEVGRAQGIYALSSQNDVGL  116

Query  324  TMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTT  145
             M+ N+VFT GKYNGS+LSV+G N V+   REM IVGGSGLFR ARG    KT   +   
Sbjct  117  LMVQNYVFTEGKYNGSTLSVLGRNAVFSGVREMSIVGGSGLFRFARGYAQAKTHTMD--R  174

Query  144  KLGDTVIECDVMLLHY  97
            K GDTV+  +V + HY
Sbjct  175  KTGDTVVNYNVYVFHY  190



>gb|KCW62722.1| hypothetical protein EUGRSUZ_G00300 [Eucalyptus grandis]
Length=182

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = -1

Query  588  EVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPV  409
            ++  WF +L   ++K T LHF+F+ T  G NP  V VA+S +T KSPTLFG + ++D P+
Sbjct  26   KLDAWFTRLSHAKRKTTHLHFYFHDTLSGRNPTAVRVAKSTMTEKSPTLFGVVNMIDDPL  85

Query  408  TIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHRE  229
            T GPE  S       GFY    L+  +  M  N VFT  +YNGS+LS++G+NP     RE
Sbjct  86   TKGPEPESPL-----GFYGSVGLESTALHMNMNLVFTTPEYNGSTLSILGHNPALETFRE  140

Query  228  MVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            M +VGG+G+FRLA G++T KT + N+TT  GD V+E  V++LHY
Sbjct  141  MPVVGGTGVFRLASGVVTAKTYFLNLTT--GDAVVEYKVIVLHY  182



>ref|XP_007162361.1| hypothetical protein PHAVU_001G145500g [Phaseolus vulgaris]
 gb|ESW34355.1| hypothetical protein PHAVU_001G145500g [Phaseolus vulgaris]
Length=185

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K+  LHFFF+  + G  P  V +AQ+  TA S + FG + + D P+T+GP+  S  +G
Sbjct  36   KEKLLHLHFFFHDVSSGPKPTAVTIAQAQTTANSSSFFGLLMIADDPLTVGPDPGSKLVG  95

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y  +   E++  MLFNFVFT GK+NGS+LS++G N ++H+ RE+ IVGGSG+F+ 
Sbjct  96   RGQGLYGFADQKEVALAMLFNFVFTEGKFNGSTLSLLGRNLIFHDERELPIVGGSGVFKF  155

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    K   +++ TK GDTV+E +  + HY
Sbjct  156  ARGFAHAKK--YSLDTKTGDTVVEYNFYVFHY  185



>ref|XP_007204144.1| hypothetical protein PRUPE_ppa021998mg [Prunus persica]
 gb|EMJ05343.1| hypothetical protein PRUPE_ppa021998mg [Prunus persica]
Length=198

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K++ LHF+F+    G NP  V VA++  T  S T+FGA+ VMD P+T+GPE  S  +G
Sbjct  49   REKLSHLHFYFHDILSGRNPTAVRVAEAPTTNTSSTVFGAVVVMDDPLTVGPELGSKLVG  108

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QG YA +S  E+   M FNFVF  GKYNGS+LSV+G N V  E REM IVGGSGLFR 
Sbjct  109  KAQGIYASASQSELGLLMAFNFVFEEGKYNGSTLSVLGRNSVLSEVREMPIVGGSGLFRF  168

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG     T   +  T  GD V+E +V + HY
Sbjct  169  ARGYAHASTHQVDFET--GDAVVEYNVYVFHY  198



>ref|XP_002280711.1| PREDICTED: dirigent protein 22 [Vitis vinifera]
Length=192

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 117/191 (61%), Gaps = 8/191 (4%)
 Frame = -1

Query  651  LVVSLIVFATKLAHGTAQGPEEVKQWFAK------LPTLRQKVTDLHFFFYTTTVGANPN  490
            L++ + +F + +A   A G  E    F++      +    +K++ LHF+F+       P 
Sbjct  4    LLILITIFFSTIAAVAASGSSEESHRFSRNLSPESMGLKEEKLSHLHFYFHDIISSPKPT  63

Query  489  DVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFN  310
             V VA++ +T KS T+FGA+ +MD  +T+GPE +S  +GR QG YA +S +E+   M+ N
Sbjct  64   AVRVAEAAMTNKSATVFGAVFMMDDLLTVGPEPSSKLVGRAQGIYASASQEEMGLLMVLN  123

Query  309  FVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDT  130
            F F  GKYNGS+LSV+G N ++ + REM IVGGSGLFR ARG    +T  +N+ T  GD 
Sbjct  124  FAFMEGKYNGSTLSVLGRNTIFSKVREMPIVGGSGLFRFARGYAQARTHTFNLKT--GDA  181

Query  129  VIECDVMLLHY  97
            V+E +V + HY
Sbjct  182  VVEYNVYVFHY  192



>ref|XP_007029065.1| Disease resistance-responsive family protein [Theobroma cacao]
 gb|EOY09567.1| Disease resistance-responsive family protein [Theobroma cacao]
Length=197

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 119/197 (60%), Gaps = 6/197 (3%)
 Frame = -1

Query  681  NMEKLTYKTILVVSL-IVFATKLAHGTAQGPEEVKQWFAK-LPTLRQKVTDLHFFFYTTT  508
             ++KLT  + L+++  I+F+  LA  TA+     +    + L   ++K++  HF+F+   
Sbjct  5    QLQKLTATSFLILTFTILFSLTLA--TAKSHRFSRSISPETLGLKKEKLSHFHFYFHDVL  62

Query  507  VGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEIS  328
             G  P  V VA + +T  S TLFG+M +MD P+T+ PE +S  +GR QG YA +S  E+ 
Sbjct  63   SGPRPTAVRVASATMTNTSATLFGSMVMMDNPLTVAPEFDSKLVGRAQGIYASASQTEVG  122

Query  327  FTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVT  148
              M+ N  FT GKYNGS LSV+G NPV+   REM IVGGSGLFR ARG    KT   ++ 
Sbjct  123  LLMVLNIAFTQGKYNGSVLSVLGRNPVFSTVREMPIVGGSGLFRFARGYAQAKTHSVDLN  182

Query  147  TKLGDTVIECDVMLLHY  97
            T  GD V+E +V + HY
Sbjct  183  T--GDAVVEYNVYVFHY  197



>gb|EYU37930.1| hypothetical protein MIMGU_mgv11b012093mg [Erythranthe guttata]
Length=187

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 115/181 (64%), Gaps = 2/181 (1%)
 Frame = -1

Query  639  LIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVT  460
            +++F+       + G   +K++   +  ++ KVT+L  +         P+++ VA +N T
Sbjct  9    IVLFSLATMAAKSNGATPIKEFLQNIDQVKSKVTELQLYVQDIFTSPTPSNLPVAFANST  68

Query  459  AKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNG  280
            + SPTLFG +AV+D P+ + P+ ++  +G+ QGF+A SSL++ SF M F+ VFT G+YNG
Sbjct  69   SASPTLFGLVAVLDDPIRVEPKPDAMIVGQAQGFFAFSSLEDTSFHMTFDLVFTRGRYNG  128

Query  279  SSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            S+L+V+G+N      RE+ IVGG+G FRLARGI+ + T+  N TT  GD   + ++ +LH
Sbjct  129  STLNVMGHNAYMQPRRELSIVGGTGAFRLARGIIGVSTVSMNATT--GDAFFQYNITILH  186

Query  99   Y  97
            Y
Sbjct  187  Y  187



>ref|XP_002313728.1| disease resistance-responsive family protein [Populus trichocarpa]
 gb|EEE87683.1| disease resistance-responsive family protein [Populus trichocarpa]
Length=184

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 102/163 (63%), Gaps = 2/163 (1%)
 Frame = -1

Query  588  EVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPV  409
              + W ++L   ++ VT+L F+F+    G NP  + VAQ +   KSPTLFG++ + D P+
Sbjct  24   NAESWASRLEAEKENVTNLQFYFHDILSGKNPTAIKVAQPSADNKSPTLFGSIMMADDPL  83

Query  408  TIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHRE  229
            T GP+ NS  +GR QG Y  +  +E++  M  NF FT G YNGS +S++G NP  +  RE
Sbjct  84   TEGPDPNSKPVGRAQGIYGSAGQNELALIMAMNFAFTDGIYNGSCISLLGKNPAMNPVRE  143

Query  228  MVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            M IVGG+GLFR ARG    +T W ++TT  GD ++  +V ++H
Sbjct  144  MPIVGGTGLFRFARGYAVAQTYWLDLTT--GDAIVGYNVTVVH  184



>ref|XP_008241180.1| PREDICTED: dirigent protein 21-like [Prunus mume]
Length=191

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ L F+F+    G NP  +  AQ+  + KSPTLFG++A+ D P+T+GPER+S  +G
Sbjct  42   QEKLSHLRFYFHDIVSGPNPTAIWAAQTPTSKKSPTLFGSIAMFDDPLTVGPERSSKLVG  101

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y  +S  E +  M  N  F  GK+NGSSLSV G N V    REM IVGGSG+FR 
Sbjct  102  RAQGIYGSASQSEDALLMTMNLAFVEGKFNGSSLSVFGRNAVVKAVREMPIVGGSGVFRF  161

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG +  +T+ +N T+  GD ++E DV + HY
Sbjct  162  ARGYVQARTLKFNATS--GDALVEYDVFVFHY  191



>ref|XP_008241179.1| PREDICTED: dirigent protein 21-like [Prunus mume]
Length=199

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 97/152 (64%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K++ LHF+F+    G NP  V VA++  T  S T FGA+ VMD P+T+GPE  S  +G
Sbjct  50   REKLSHLHFYFHDILSGRNPTAVRVAEAPTTNTSLTAFGAVVVMDDPLTVGPELGSKLVG  109

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QG YA +S  E+   M FNFVF  GKYNGS+LSV+G N V  E REM IVGGSGLFR 
Sbjct  110  KAQGIYASASQSELGLLMAFNFVFVEGKYNGSTLSVLGRNSVLSEVREMPIVGGSGLFRF  169

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG     T    V  K GD ++E +V + HY
Sbjct  170  ARGYAHAST--HQVDFKTGDAIVEYNVYVFHY  199



>ref|XP_002280817.1| PREDICTED: dirigent protein 2 [Vitis vinifera]
 emb|CBI29981.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 115/191 (60%), Gaps = 11/191 (6%)
 Frame = -1

Query  651  LVVSLIVFATKLAHGTAQGPEEVKQWFAK------LPTLRQKVTDLHFFFYTTTVGANPN  490
            L++   +F + +A   A G       F++      +    +K++ LHF+F+    G  P 
Sbjct  4    LLILFTIFFSTIAAVAASGSSGESHRFSRNLSPESMGLKEEKLSHLHFYFHDIISGPKPT  63

Query  489  DVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFN  310
             V VA++ +T KS T+FGA+ +MD P+T+GPE +S  +GR QG YA +S +E+   M+ N
Sbjct  64   AVRVAEAAMTNKSATMFGAVLMMDDPLTVGPEPSSKLVGRAQGIYASASQEEMGLLMVLN  123

Query  309  FVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDT  130
            F F  GKYNGS+LSV+G N ++ + REM IVGGSGLFR ARG    +T  +N+     D 
Sbjct  124  FAFMEGKYNGSTLSVLGRNTIFSKVREMPIVGGSGLFRFARGYAQARTRTFNL-----DV  178

Query  129  VIECDVMLLHY  97
            V+E +V + HY
Sbjct  179  VVEYNVYVFHY  189



>ref|XP_006841309.1| hypothetical protein AMTR_s00134p00117580 [Amborella trichopoda]
 gb|ERN02984.1| hypothetical protein AMTR_s00134p00117580 [Amborella trichopoda]
Length=194

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 101/150 (67%), Gaps = 2/150 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++ V+ LHFFF+    G  P  + VA+++ T  SPT FGA+ ++D P+T GP  +S  LG
Sbjct  46   KENVSHLHFFFHDIVGGPKPTAIRVAEADFTKTSPTGFGAIVMIDDPLTEGPMLSSKLLG  105

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QGFYA S+L+E+ F M  N+VF  G+Y GS+LS++G NPV +E REM +VGGSG FR 
Sbjct  106  RAQGFYASSALEELGFLMTLNYVFVEGEYKGSTLSILGRNPVMNEVREMAVVGGSGAFRF  165

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLL  103
            ARG    KT  +N TT  GD V+E +V ++
Sbjct  166  ARGYALAKTHSFNDTT--GDAVVEYNVEII  193



>ref|XP_011046627.1| PREDICTED: dirigent protein 23 [Populus euphratica]
Length=184

 Score =   147 bits (370),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 113/185 (61%), Gaps = 8/185 (4%)
 Frame = -1

Query  654  ILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVA  475
            +LV+SL V   + A+ T       + W ++L   ++ VT+L F+F+    G NP  + VA
Sbjct  8    LLVISL-VGVMQWANST-----NAESWASRLEAEKENVTNLQFYFHDILSGKNPTAIKVA  61

Query  474  QSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTH  295
            Q +   KSPTLFG++ + D P+T GP+ +S  +GR QG Y  +  +E++  M  NF FT 
Sbjct  62   QPSADNKSPTLFGSIMMADDPLTEGPDPSSKPVGRAQGIYGSAGQNELALIMAMNFAFTD  121

Query  294  GKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECD  115
            G YNGS +S++G NP  +  REM IVGG+GLFR ARG    +T W +VTT  GD ++  +
Sbjct  122  GIYNGSCISLLGKNPAMNPVREMPIVGGTGLFRFARGYAVAQTYWLDVTT--GDAIVGYN  179

Query  114  VMLLH  100
            V ++H
Sbjct  180  VTVVH  184



>emb|CAN61168.1| hypothetical protein VITISV_038109 [Vitis vinifera]
Length=151

 Score =   145 bits (367),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 101/152 (66%), Gaps = 5/152 (3%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
             +K++ LHF+F+    G  P  V VA++ +T KS T+FGA+ +MD P+T+GPE +S  +G
Sbjct  5    EEKLSHLHFYFHDIISGPKPTAVRVAEAAMTNKSATMFGAVLMMDDPLTVGPEPSSKLVG  64

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +S +E+   M+ NF F  GKYNGS+LSV+G N ++ + REM IVGGSGLFR 
Sbjct  65   RAQGIYASASQEEMGLLMVLNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIVGGSGLFRF  124

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T  +N+     D V+E +V + HY
Sbjct  125  ARGYAQARTRTFNL-----DVVVEYNVYVFHY  151



>ref|XP_002309288.2| hypothetical protein POPTR_0006s20990g [Populus trichocarpa]
 gb|EEE92811.2| hypothetical protein POPTR_0006s20990g [Populus trichocarpa]
Length=195

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 117/188 (62%), Gaps = 7/188 (4%)
 Frame = -1

Query  654  ILVVSLIVFATKLAHGTAQGPEEVKQWFAK--LPTLRQKVTDLHFFFYTTTVGANPNDVL  481
            I + ++I+F+  LA   A  PE   +  +   L   R+K++ LHF+F+    G+NP  V 
Sbjct  13   IFLFNVILFSLTLA---AAKPEGFSRNLSPKTLGLKREKLSHLHFYFHDIVSGSNPTAVP  69

Query  480  VAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVF  301
            VA++ +T  S + FG + +MD P+T+ PE +S  +GR QG YA +S  E+SF M  NFVF
Sbjct  70   VARAAMTNNSFSSFGLVTMMDDPLTVKPEISSKLVGRAQGIYASASQSELSFLMALNFVF  129

Query  300  THGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIE  121
            T GKYNGS+LS++G N V    REM +VGGSGLFR ARG    KT   ++  K GD ++E
Sbjct  130  TEGKYNGSTLSILGRNSVLSGIREMPVVGGSGLFRFARGYAQAKT--HDLDFKTGDAIVE  187

Query  120  CDVMLLHY  97
             +V + HY
Sbjct  188  YNVYVFHY  195



>ref|XP_011047083.1| PREDICTED: dirigent protein 22-like [Populus euphratica]
Length=195

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K++ L F+F+    G+NP  V VA++++T  S +LFG + +MD P+T+ PE +S  +G
Sbjct  46   REKLSHLRFYFHDIVSGSNPTAVPVARASMTKNSFSLFGMVTMMDDPLTVKPEISSKLVG  105

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +S  E+SF M  NFVFT GKYNGS+LS++G N V+   REM +VGGSGLFR 
Sbjct  106  RAQGIYASASQSELSFLMALNFVFTEGKYNGSTLSILGRNSVFSGIREMPVVGGSGLFRF  165

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT   ++  K GD ++E +V + HY
Sbjct  166  ARGYAQAKT--HDLDFKTGDAIVEYNVYVFHY  195



>ref|XP_007162358.1| hypothetical protein PHAVU_001G145200g [Phaseolus vulgaris]
 gb|ESW34352.1| hypothetical protein PHAVU_001G145200g [Phaseolus vulgaris]
Length=192

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 118/197 (60%), Gaps = 8/197 (4%)
 Frame = -1

Query  684  NNMEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAK-LPTLRQKVTDLHFFFYTTT  508
            N+    T  TI+V++L+      +   A+ P   +   AK L   ++K++ LHFFF+   
Sbjct  3    NSKSLTTIFTIIVLNLL-----FSLAAAKSPTFYRNLSAKSLGLKKEKLSHLHFFFHDIV  57

Query  507  VGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEIS  328
             G NP  V VA++  T  S TLFG +A++D P+T+GPE  S  +G+ QG Y  ++  E  
Sbjct  58   SGPNPTAVRVAEAASTNSSSTLFGFIAMIDDPLTVGPEPGSKLVGKAQGVYGSAAQTETG  117

Query  327  FTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVT  148
              M+ NFVF+ GKYNGS+LS++G N V+   REM IVGGSG FR ARG    KT  ++  
Sbjct  118  LLMVMNFVFSEGKYNGSTLSLLGRNAVFSTVREMPIVGGSGAFRFARGYAQAKTHTFD--  175

Query  147  TKLGDTVIECDVMLLHY  97
            TK GD V+E +V + HY
Sbjct  176  TKTGDAVVEYNVFVFHY  192



>ref|XP_006841304.1| hypothetical protein AMTR_s00134p00100380 [Amborella trichopoda]
 gb|ERN02979.1| hypothetical protein AMTR_s00134p00100380 [Amborella trichopoda]
Length=203

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 6/189 (3%)
 Frame = -1

Query  651  LVVSLIVFATKLAHGTAQGPEEVKQWFA-KLPTL---RQKVTDLHFFFYTTTVGANPNDV  484
            LV+ L    + LA      P      F  + P L   ++KVT LHF+F+    G  P  +
Sbjct  17   LVIVLFFCNSALARKPGHLPRNQPPKFGFEAPMLGFRKEKVTHLHFYFHDIVSGPKPTAI  76

Query  483  LVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFV  304
             VA+++ T KS T FGA+ ++D P+T GPE  S  +GR QG YA ++ +E+   M  N+V
Sbjct  77   QVARADSTNKSATGFGAIVMIDDPLTEGPEVTSKLIGRAQGIYASAAQEEVGLLMTLNYV  136

Query  303  FTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVI  124
            F  GKY GS+LS++G N V++  REM IVGGSG FRLARG    KT  +++ T  GD V+
Sbjct  137  FVKGKYKGSTLSILGRNAVFNGVREMAIVGGSGAFRLARGYALAKTYTFDLKT--GDAVV  194

Query  123  ECDVMLLHY  97
            E +V++LHY
Sbjct  195  EYNVVVLHY  203



>ref|XP_006492824.1| PREDICTED: dirigent protein 23-like [Citrus sinensis]
Length=190

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHF+F+    G NP  V VAQ+ +T  SPTLFG + ++D P+T+ PE +S  +G
Sbjct  41   KEKLSHLHFYFHDIVSGKNPTAVRVAQAAMTNHSPTLFGVVVMIDDPLTMEPEPSSKLVG  100

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +S +E    M+ NF F  GKYNGS+LSV+G N V    REM IVGGSGLFR 
Sbjct  101  RAQGIYASASQNETGLLMVMNFSFMEGKYNGSTLSVLGRNAVLSTVREMPIVGGSGLFRF  160

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT  ++   K GD V+E +V + HY
Sbjct  161  ARGYAQAKTHTFD--PKTGDAVVEYNVNVFHY  190



>ref|XP_003554227.1| PREDICTED: dirigent protein 21-like [Glycine max]
 gb|KHN45401.1| Disease resistance response protein 206 [Glycine soja]
Length=183

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 115/195 (59%), Gaps = 14/195 (7%)
 Frame = -1

Query  681  NMEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVG  502
            N + LT+   +V++L+      +  TA+ P         L   ++K++ LHFFF+    G
Sbjct  3    NTKHLTFTFTIVLTLL-----FSFATAKSP-------TALGVQKEKLSHLHFFFHDIVSG  50

Query  501  ANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT  322
              P  V VAQ+++T  S TLFG + + D P+T+GPE  S  +G+ QG Y  +S +++   
Sbjct  51   PKPTAVRVAQAHMTNTSSTLFGLLMMADDPLTVGPEPGSKLVGKAQGIYGFASQEDMGLL  110

Query  321  MLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTK  142
            M+ NF FT GKYNGS+LS++G+N V    REM IVGGSG FR ARG    KT    V  K
Sbjct  111  MIMNFAFTEGKYNGSTLSLLGWNAVLSTVREMPIVGGSGAFRFARGYAQAKT--HTVDYK  168

Query  141  LGDTVIECDVMLLHY  97
             GD V+E +V +LHY
Sbjct  169  TGDAVVEYNVYVLHY  183



>ref|XP_009388280.1| PREDICTED: dirigent protein 22-like [Musa acuminata subsp. malaccensis]
Length=197

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 115/187 (61%), Gaps = 8/187 (4%)
 Frame = -1

Query  657  TILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLV  478
            T ++ ++   A + AHG  Q    VK+       +R+K++ L F+++    G +P+ V V
Sbjct  19   TAVLFTVACAAEEEAHGFLQSQRAVKK------PVREKLSHLRFYWHDVISGPSPSAVRV  72

Query  477  AQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFT  298
            A++  +  S T FG + +MD PVT+GPE  S  +GR QGFYA +S +E +  M  NF F 
Sbjct  73   AEAASSNASTTAFGVVVMMDDPVTLGPELTSRLVGRAQGFYAFASKEESALLMAMNFAFV  132

Query  297  HGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIEC  118
             GKYNGS+++V+G N V+   REM +VGGSGLFRLARG    +T  ++  T  GDTV+E 
Sbjct  133  EGKYNGSTIAVLGRNAVFSGVREMPVVGGSGLFRLARGYAQART--YSFDTNTGDTVVEY  190

Query  117  DVMLLHY  97
            ++ + HY
Sbjct  191  NLFVTHY  197



>ref|XP_009342233.1| PREDICTED: dirigent protein 22-like [Pyrus x bretschneideri]
 ref|XP_009349708.1| PREDICTED: dirigent protein 22-like [Pyrus x bretschneideri]
Length=196

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 99/152 (65%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHF+F+    G  P  V VA++  T  S T FG + +MD P+TIGP+ +S  +G
Sbjct  47   KEKLSHLHFYFHDIVSGRTPTAVKVAEAPTTNTSMTGFGTVVMMDDPLTIGPKSSSKLVG  106

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QG YA++S  E+ F M  NFVF  GKYNGS+LSV+G N V+   REM IVGGSGLFR 
Sbjct  107  KAQGIYAVASQSEVGFLMALNFVFVEGKYNGSTLSVLGRNAVFSAVREMPIVGGSGLFRF  166

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG     T  +N+  K GD V+E +V + HY
Sbjct  167  ARGYAHASTHQFNI--KTGDAVVEYNVYVFHY  196



>gb|KCW44400.1| hypothetical protein EUGRSUZ_L02111 [Eucalyptus grandis]
Length=163

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 0/156 (0%)
 Frame = -1

Query  630  FATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKS  451
             A  LA   A  P++V  WF +L    +K T LHFFF+ T  G +P  V VA++ +T KS
Sbjct  1    MAMPLACAMADDPKKVDNWFNRLSHAERKTTCLHFFFHDTISGKSPTAVRVAEATITKKS  60

Query  450  PTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSL  271
            PTLF  + +MD P+T G E  S  +GR QG Y  + L+ +   M  N VFT  KYNGS+L
Sbjct  61   PTLFRVVNMMDDPLTEGLEPESPLVGRAQGLYGSAGLESLGLLMNMNLVFTSPKYNGSTL  120

Query  270  SVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTM  163
            S +G NP Y  +REM+IVGG+G  RLA GI T K +
Sbjct  121  STLGRNPAYETYREMLIVGGTGFLRLASGIATGKDI  156



>ref|XP_011037132.1| PREDICTED: dirigent protein 4-like [Populus euphratica]
Length=185

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 121/191 (63%), Gaps = 16/191 (8%)
 Frame = -1

Query  654  ILVVSLIVFA-TKLAHGTAQGPEEVKQWFAK---LPTLRQKVTDLHFFFYTTTVGANPND  487
            +L ++LI++  T  AHG         Q++++     +L +K T+LHFFF+ T  G NP+ 
Sbjct  6    VLGLALILYMITTHAHG---------QYYSQSVSYESLPEKTTNLHFFFHDTLSGKNPSA  56

Query  486  VLVAQSNVT-AKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFN  310
            VLVA+ N+T  +S   FG++ V+D P+T+GPE  S  +G  QG Y LSS D  S  + F+
Sbjct  57   VLVARPNITTGQSVAPFGSVFVIDDPLTVGPELTSEVIGNAQGLYVLSSQDIPSLVVYFD  116

Query  309  FVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDT  130
            F FT G++NGSS+SV   NP+ +  RE+ +VGG G FRLARG   +KT + N ++  GD 
Sbjct  117  FGFTSGEFNGSSISVFSRNPIINTERELAVVGGRGKFRLARGFAQLKTYFINASS--GDA  174

Query  129  VIECDVMLLHY  97
            ++E +V +LHY
Sbjct  175  IVEYNVTVLHY  185



>emb|CDP10173.1| unnamed protein product [Coffea canephora]
Length=154

 Score =   144 bits (362),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K++ LHF+F+    G NP  V VA +  T  S T FGA+ +MD P+T GP+ +S  +G
Sbjct  5    REKLSHLHFYFHDIVSGRNPTAVRVAAATTTNSSATGFGAVVMMDDPLTAGPDLSSKLVG  64

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA ++ +E  + M+ N+VF  GKYNGS+LS++G N V    REM +VGGSGLFR 
Sbjct  65   RAQGIYASAAQEESGYLMVLNYVFVEGKYNGSTLSILGRNTVLSTVREMPVVGGSGLFRF  124

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T ++++  K GD V+E +V ++HY
Sbjct  125  ARGYAQARTHYFDL--KTGDAVVEYNVYVIHY  154



>gb|KDO70858.1| hypothetical protein CISIN_1g043227mg [Citrus sinensis]
Length=190

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHF+F+    G NP  V VAQ+ +T  SPTLFG + ++D P+T+ PE +S  +G
Sbjct  41   KEKLSHLHFYFHDIVSGKNPTAVRVAQAAMTNHSPTLFGVVVMIDDPLTMEPEPSSKLVG  100

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +S +E    M  NF F  GKYNGS+LSV+G N V    REM IVGGSGLFR 
Sbjct  101  RAQGIYASASQNETGLLMAMNFSFMEGKYNGSTLSVLGRNAVLSTVREMPIVGGSGLFRF  160

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT  ++   K GD V+E +V + HY
Sbjct  161  ARGYAQAKTHTFD--PKTGDAVVEYNVNVFHY  190



>gb|KDP27569.1| hypothetical protein JCGZ_19574 [Jatropha curcas]
Length=184

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 100/156 (64%), Gaps = 2/156 (1%)
 Frame = -1

Query  567  KLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERN  388
            +L   ++ VT+L F+F+ T  G NP+ + VAQS  T KSPTLFG + + D P+T GP+  
Sbjct  31   RLKPKKETVTNLQFYFHDTVSGKNPSAIKVAQSAYTEKSPTLFGTIMMADDPLTEGPDPK  90

Query  387  SSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGS  208
            S  +GR QG Y  +  DE+   M  NF FT+G  NGSSLSV+G N      RE+ IVGG+
Sbjct  91   SKLVGRAQGLYGSAGQDELCLIMAMNFAFTNGMSNGSSLSVLGKNSALSPVRELPIVGGT  150

Query  207  GLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            G+FRLARG    KT W+++TT  GD ++  ++ ++H
Sbjct  151  GVFRLARGYAVAKTHWFDITT--GDAIVGYNITVMH  184



>ref|XP_010058351.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 gb|KCW90333.1| hypothetical protein EUGRSUZ_A02477 [Eucalyptus grandis]
Length=190

 Score =   144 bits (364),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 120/194 (62%), Gaps = 12/194 (6%)
 Frame = -1

Query  672  KLTYKTILVVSLIVFATKLAHGTAQG--PEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            KL   ++L  S I+F T  +H  A+   PE       KL   ++K++ LHF+F+    G 
Sbjct  7    KLVIFSLLFTSTILF-TANSHTFARSLLPE-------KLGLKKEKLSHLHFYFHDIVSGR  58

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP  V VA++ +T KS T FG + ++D P+T GPE +S  +GR QG Y+ +S +++   M
Sbjct  59   NPTAVRVAEAKMTNKSATGFGLVVMIDDPLTEGPELSSKVVGRAQGLYSSASQNDLGLLM  118

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
            + N+VFT GKYNGS+LSV+G N V+ E REM IVGGS LFR ARG    +T   ++ T  
Sbjct  119  VQNYVFTEGKYNGSTLSVLGRNAVFSEVREMPIVGGSRLFRFARGYAQARTHLLDLQT--  176

Query  138  GDTVIECDVMLLHY  97
            GD V+E +V + HY
Sbjct  177  GDAVVEYNVYVFHY  190



>ref|XP_007145709.1| hypothetical protein PHAVU_007G261700g [Phaseolus vulgaris]
 gb|ESW17703.1| hypothetical protein PHAVU_007G261700g [Phaseolus vulgaris]
Length=183

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 4/151 (3%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            QK++ LHFF +    G N   V VA +  T KSPT+FGA+ +MD P+T  P+  S+ +GR
Sbjct  37   QKLSHLHFFLHDVVAGTNQTAVRVAAAPATEKSPTMFGAVVMMDDPLTELPDAASAVVGR  96

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG YA +S  E+ F M  NFVFT GKYNGSSL+V+G N V    REM +VGGSGLFR A
Sbjct  97   AQGIYASASTSELGFLMAMNFVFTEGKYNGSSLAVLGRNTVQSAVREMPVVGGSGLFRFA  156

Query  189  RGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            RG  T KT ++     L + V+E +V + HY
Sbjct  157  RGYATAKTHYFG----LLEAVVEYNVYVFHY  183



>ref|XP_009346640.1| PREDICTED: dirigent protein 23-like [Pyrus x bretschneideri]
Length=193

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 115/195 (59%), Gaps = 12/195 (6%)
 Frame = -1

Query  669  LTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPT-----LRQKVTDLHFFFYTTTV  505
            +T   +L+++++   T+ A  T+  P    +W  KL T     L + VT+LHF+F+ T  
Sbjct  6    VTMMLMLIIAVVAATTEGAQSTSTQP----KWANKLKTRKNMTLSETVTNLHFYFHDTVS  61

Query  504  GANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISF  325
            G NP+ V +AQ+  T KS TLFGA+ ++D P+T  P+ NS  +GR QG Y  S   E   
Sbjct  62   GKNPSAVRIAQATDTNKSLTLFGALLMVDDPLTETPDPNSKLVGRAQGMYGSSGQQEFGL  121

Query  324  TMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTT  145
            TM   F F  G Y+GSS+S+ G NP  +  REM +V G+G+FR ARG    +T W+N+  
Sbjct  122  TMAMCFAFCDGIYDGSSISIFGKNPALNLVREMPVVAGTGVFRFARGYAIARTHWFNI--  179

Query  144  KLGDTVIECDVMLLH  100
             +GD ++E  V ++H
Sbjct  180  -MGDAIVEYHVTVIH  193



>ref|XP_006849316.1| hypothetical protein AMTR_s03766p00005550 [Amborella trichopoda]
 gb|ERN10897.1| hypothetical protein AMTR_s03766p00005550 [Amborella trichopoda]
Length=199

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHF+F+    G NP+ + VA+++ T+K  TLFGA+ ++D P+T GP+  S   G
Sbjct  50   KEKISHLHFYFHDVLSGRNPSAIQVARADTTSKFLTLFGAVYMIDDPLTEGPDPKSKLFG  109

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QGFYA +S  ++   M  NF F  GKY GS+L+++G NPV +  REM I+GGSGLFRL
Sbjct  110  RAQGFYASASQTDLGLLMAMNFAFVEGKYKGSTLTILGRNPVLNPVREMPIIGGSGLFRL  169

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG +  KT  +++ T  GD V+E +V + HY
Sbjct  170  ARGYVLAKTHLFDLKT--GDAVVEYNVYVTHY  199



>emb|CAN69110.1| hypothetical protein VITISV_006598 [Vitis vinifera]
Length=154

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
             +K++ LHF+F+       P  V VA++ +T KS T+FGA+ +MD  +T+GPE +S  +G
Sbjct  5    EEKLSHLHFYFHDIISSPKPTAVRVAEAAMTNKSATVFGAVFMMDDLLTVGPEPSSKLVG  64

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +S +E+   M+ NF F  GKYNGS+LSV+G N ++ + REM IVGGSGLFR 
Sbjct  65   RAQGIYASASQEEMGLLMVLNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIVGGSGLFRF  124

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T  +N+ T  GD V+E +V + HY
Sbjct  125  ARGYAQARTHTFNLKT--GDAVVEYNVYVFHY  154



>ref|XP_010024241.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
 gb|KCW90332.1| hypothetical protein EUGRSUZ_A02475 [Eucalyptus grandis]
Length=190

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 117/194 (60%), Gaps = 12/194 (6%)
 Frame = -1

Query  672  KLTYKTILVVSLIVFATKLAHGTAQG--PEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            KL   ++L  S I+F T  +H  ++   PEE       L   ++K++ LHF+F+    G 
Sbjct  7    KLIISSLLFTSTILF-TANSHTFSRSLLPEE-------LGLKKEKLSHLHFYFHDIVSGR  58

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP  V VA++ +T  S T FGA+ ++D P+T GPE +S  +GR QG YA +SL EI   M
Sbjct  59   NPTAVRVAEAKMTNTSTTAFGAVVMIDDPLTEGPELSSKIVGRAQGLYAFASLSEIGLLM  118

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
            + N+ FT GK NGS+LSV+G N V+   REM IVGGS LFR ARG    KT   ++ T  
Sbjct  119  VQNYFFTEGKCNGSTLSVLGRNAVFSGVREMPIVGGSRLFRFARGYAQAKTHSLDLQT--  176

Query  138  GDTVIECDVMLLHY  97
            GD V+E +V + HY
Sbjct  177  GDAVVEYNVYVFHY  190



>ref|XP_006841312.1| hypothetical protein AMTR_s00134p00124080 [Amborella trichopoda]
 gb|ERN02987.1| hypothetical protein AMTR_s00134p00124080 [Amborella trichopoda]
Length=206

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 2/151 (1%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            +KVT LHF+F+       P  + VA+++ T KS T FGA+ ++D P+T GPE +S  +GR
Sbjct  55   EKVTHLHFYFHDIVSCPKPTAIQVARADSTNKSATGFGAIVMIDDPLTEGPEVSSKLIGR  114

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG YAL++ +E+   M  N+VF  GKY GS+LSV+G N V+   REM IVGG G FRLA
Sbjct  115  AQGIYALAAQEEVGLLMTLNYVFVEGKYKGSTLSVLGRNAVFSGVREMAIVGGGGAFRLA  174

Query  189  RGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            RG    KT  +N +T  GD V+E +V++LHY
Sbjct  175  RGYALAKTHTFNSST--GDAVVEYNVVVLHY  203



>ref|XP_010024253.1| PREDICTED: dirigent protein 22-like [Eucalyptus grandis]
Length=190

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHF+ +    G NP  VLVA++  T  S T FGA+ V+D P+T GPE +S  +G
Sbjct  41   KEKLSHLHFYLHDVVSGRNPTAVLVAEAKTTNTSATGFGAIVVIDDPLTEGPEASSKIVG  100

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y+ +SL+E    M+ N+VFT GKYNGS+LSV+G N V+   REM IVGGS LFR 
Sbjct  101  RAQGLYSSASLNEAGLLMVQNYVFTEGKYNGSTLSVLGRNAVFSSMREMPIVGGSRLFRF  160

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T   N  T  GD V+E +V + HY
Sbjct  161  ARGYAQARTHTVNPHT--GDAVVEYNVYVFHY  190



>gb|ABK93789.1| unknown [Populus trichocarpa]
Length=194

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 119/189 (63%), Gaps = 7/189 (4%)
 Frame = -1

Query  657  TILVVSLIVFATKLAHGTAQGPEEVKQWF--AKLPTLRQKVTDLHFFFYTTTVGANPNDV  484
            + LV+S+++    +A+  +Q      ++   A L   ++K++ LHF+F+    G NP  V
Sbjct  11   SFLVLSIVLSYLIIANAKSQ---RFTKYLSPATLGLKKEKLSHLHFYFHDIVSGKNPTAV  67

Query  483  LVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFV  304
             +A++++T  S T FG +A++D P+T+ PE +S  +GR QGFYA +S +++   M  NFV
Sbjct  68   RIARADMTNTSSTGFGMVAMIDDPLTMTPELSSKLVGRAQGFYASASQNDVGLLMTMNFV  127

Query  303  FTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVI  124
            F  GK+NGS+LSV+G N V+   REM IVGGSGLFR ARG     T  ++ TT  GD V+
Sbjct  128  FMEGKFNGSTLSVLGRNSVFSTVREMPIVGGSGLFRFARGYAQASTHMFDRTT--GDAVV  185

Query  123  ECDVMLLHY  97
            E +V + HY
Sbjct  186  EYNVYVFHY  194



>ref|XP_002323339.2| hypothetical protein POPTR_0016s06100g [Populus trichocarpa]
 gb|EEF05100.2| hypothetical protein POPTR_0016s06100g [Populus trichocarpa]
Length=194

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 104/158 (66%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            A L   ++K++ LHF+F+    G NP  V +A++++T  S T FG +A++D P+T+ PE 
Sbjct  39   ATLGLKKEKLSHLHFYFHDIVSGKNPTAVRIARADMTNTSSTGFGMVAMIDDPLTMTPEL  98

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
            +S  +GR QGFYA +S +++   M  NFVF  GK+NGS+LSV+G N V+   REM IVGG
Sbjct  99   SSKLVGRAQGFYASASQNDVGLLMTMNFVFMEGKFNGSTLSVLGRNSVFSTVREMPIVGG  158

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFR ARG     T  ++ TT  GD V+E +V + HY
Sbjct  159  SGLFRFARGYAQASTHMFDRTT--GDAVVEYNVYVFHY  194



>ref|XP_006492825.1| PREDICTED: dirigent protein 3-like [Citrus sinensis]
Length=190

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 96/152 (63%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            +QK++ LHF+ +    G N   V VAQ+ +T +SPT FGA+ + D  +T+ PERNS  +G
Sbjct  41   KQKLSHLHFYLHDKVSGQNATAVRVAQAAMTNQSPTFFGAVIMFDDALTMEPERNSKLVG  100

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y  +S  E    ++ NF F  GKYNGS+LSV+G N V+   REM I+GGSGLFR 
Sbjct  101  RAQGMYGSASQTETGLAVVMNFAFMEGKYNGSTLSVMGRNAVFSTVREMPIIGGSGLFRF  160

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG +  KT    +  K GD V+E +V + HY
Sbjct  161  ARGYVQAKT--HTIDLKTGDAVVEYNVYVFHY  190



>ref|XP_004289850.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=190

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 112/193 (58%), Gaps = 7/193 (4%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            M   T  T++++ +I  A   A     G  E K    K     ++VT+L F+F+ T  G 
Sbjct  5    MANNTVATLMMIVVISLAMAFAEAKWGGSVEAK----KETKPSERVTNLQFYFHDTVSGK  60

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP+ + VAQ+  T KSPTLFGA+ + D P+T  P+ +S  +GR QG Y  S   E+   M
Sbjct  61   NPSAIRVAQAPDTEKSPTLFGALLMADDPLTETPDPDSKLVGRAQGLYGSSGQHELGLIM  120

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              +F FT G YNGSS+S+ G NP  +  RE+ +VGG+G+FRLARG     T W++V+   
Sbjct  121  AMSFAFTDGTYNGSSISIFGKNPALNPVRELPVVGGTGMFRLARGYAIACTHWFDVS---  177

Query  138  GDTVIECDVMLLH  100
            GD ++  +V ++H
Sbjct  178  GDAIVGYNVTVIH  190



>gb|KDO70859.1| hypothetical protein CISIN_1g029641mg [Citrus sinensis]
Length=190

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 96/152 (63%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            +QK++ LHF+ +    G N   V VAQ+ +T +SPT FGA+ + D  +T+ PERNS  +G
Sbjct  41   KQKLSHLHFYLHDKVSGQNATAVRVAQAAMTNQSPTFFGAVIMFDDALTMEPERNSKLVG  100

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y  +S  E    ++ NF F  GKYNGS+LSV+G N V+   REM I+GGSGLFR 
Sbjct  101  RAQGMYGSASQTETGLAVVMNFAFMEGKYNGSTLSVMGRNAVFSTVREMPIIGGSGLFRF  160

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG +  KT    +  K GD V+E +V + HY
Sbjct  161  ARGYVQAKT--HTIDLKTGDAVVEYNVYVFHY  190



>ref|XP_010935386.1| PREDICTED: LOW QUALITY PROTEIN: dirigent protein 23-like [Elaeis 
guineensis]
Length=193

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 100/168 (60%), Gaps = 5/168 (3%)
 Frame = -1

Query  594  PEEVKQW---FAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAV  424
            PE   +W    A+    +++VT LHF+F+    G +P  V VAQ+  + +SPT FG + +
Sbjct  28   PERFDKWSRRLARAGVTQEQVTQLHFYFHDIVSGEHPTAVRVAQAANSDRSPTGFGMVVM  87

Query  423  MDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVY  244
             D P+T GP+ NS  +GR QG Y  +  +E+   M  N+ FT GKYNGSS S+ G N   
Sbjct  88   ADDPLTEGPDPNSRLVGRAQGLYGSAGQEELGLIMAMNYRFTDGKYNGSSFSLNGLNRAL  147

Query  243  HEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
               REM IVGG+G FRLARG+   KT   N TT  GD ++E +V L+H
Sbjct  148  DPVREMAIVGGTGXFRLARGVAMAKTYSLNATT--GDAIVEYNVTLVH  193



>ref|XP_002323338.1| hypothetical protein POPTR_0016s06090g [Populus trichocarpa]
 gb|EEF05099.1| hypothetical protein POPTR_0016s06090g [Populus trichocarpa]
Length=196

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -1

Query  567  KLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERN  388
            KL   R+K++ LHF+F+    G NP  V V ++ +T KS + FG + +MD P+T+ PE  
Sbjct  42   KLGLKREKLSHLHFYFHDIVGGRNPTAVPVVRAAITKKSFSSFGLVTMMDDPLTVKPEIG  101

Query  387  SSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGS  208
            S  +GR QG YA +S  E+SF M  NFVFT GKYNGS+LS++G N V+   REM IVGGS
Sbjct  102  SKLVGRAQGIYASASQSELSFLMALNFVFTEGKYNGSTLSILGRNNVFSGIREMPIVGGS  161

Query  207  GLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            GLFR ARG     T    +  K G+ ++E +V + HY
Sbjct  162  GLFRFARGYAQANT--HEIDFKTGNAIVEYNVYVFHY  196



>ref|XP_011039496.1| PREDICTED: dirigent protein 22-like [Populus euphratica]
Length=194

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            A L   ++K++ LHF+F+    G NP  V +A++++T  S T FG +A++D P+T+ PE 
Sbjct  39   ATLGLKKEKLSHLHFYFHDIVSGKNPTAVRIARADMTNTSSTGFGMVAMIDDPLTMTPEL  98

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
            +S  +GR QG YA +S ++I   M  NFVF  GKYNGS+LSV+G N V    REM IVGG
Sbjct  99   SSKLVGRAQGIYASASQNDIGLLMTMNFVFMEGKYNGSTLSVLGRNSVLSTVREMPIVGG  158

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFR ARG     T  ++ TT  GD V+E +V + HY
Sbjct  159  SGLFRFARGYAQASTHMFDSTT--GDAVVEYNVYVFHY  194



>ref|XP_007162356.1| hypothetical protein PHAVU_001G145000g [Phaseolus vulgaris]
 gb|ESW34350.1| hypothetical protein PHAVU_001G145000g [Phaseolus vulgaris]
Length=192

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 99/152 (65%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHFFF+    G NP  V VA++  T  S TLFG +A++D P+T+GPE  S  +G
Sbjct  43   KEKLSHLHFFFHDIVSGPNPTAVRVAEAASTNSSSTLFGFIAMIDDPLTVGPEPGSKLVG  102

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QG Y  ++  E+   M+ NFVFT GKYNGS+LS++G N V+   REM I+GGS  FR 
Sbjct  103  KAQGVYGSAAQYELDLLMVMNFVFTEGKYNGSTLSLLGRNAVFSTVREMPIIGGSRAFRF  162

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT  ++  TK GD V+E +V + HY
Sbjct  163  ARGYAQAKTHTFD--TKTGDAVVEYNVYVFHY  192



>ref|XP_007029061.1| Disease resistance-responsive (dirigent-like protein) family 
protein, putative [Theobroma cacao]
 gb|EOY09563.1| Disease resistance-responsive (dirigent-like protein) family 
protein, putative [Theobroma cacao]
Length=194

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 103/153 (67%), Gaps = 5/153 (3%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVT-AKSPTLFGAMAVMDGPVTIGPERNSSQL  376
            R+K++ LHF+F+      NP  + VAQ+N T A SP  FGA+ ++D P+T+ P+ NS  +
Sbjct  46   REKLSHLHFYFHDIVAAKNPTAMRVAQANTTSASSP--FGAVVMIDDPLTVDPDINSKPV  103

Query  375  GRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFR  196
            G+ QG YAL+S  + S  M +NF F  GKYNGS+LS++G N V+   REM IVGGSG+FR
Sbjct  104  GKAQGIYALASQSDASLLMAYNFAFMEGKYNGSNLSLLGRNTVFSPVREMPIVGGSGVFR  163

Query  195  LARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            LARG    +T  +++ T  G+TV+E +V + HY
Sbjct  164  LARGYAEARTHTFDLKT--GNTVVEYNVYVFHY  194



>ref|XP_006487695.1| PREDICTED: dirigent protein 23-like [Citrus sinensis]
 gb|KDO40833.1| hypothetical protein CISIN_1g045008mg [Citrus sinensis]
Length=182

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 114/194 (59%), Gaps = 13/194 (7%)
 Frame = -1

Query  678  MEKL-TYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVG  502
            M KL T  ++L++SL+          A    + + W  +L + ++  T+L F+F+ T  G
Sbjct  1    MAKLSTVVSLLIISLV----------APAALQAETWATRLESAKETTTNLQFYFHDTLSG  50

Query  501  ANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT  322
             NP+ V +AQ+  T KSPTLFG + + D P+T  P+  S  +GR QG Y  +S D++   
Sbjct  51   QNPSAVRIAQATDTDKSPTLFGVLMMADDPLTETPDPKSKLVGRAQGLYGSASQDQLGLI  110

Query  321  MLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTK  142
            M  +FVF  G YNGSS+S++G N   +  REM IVGG+G FRLARG    +T W ++  K
Sbjct  111  MSMSFVFVDGSYNGSSISLLGNNRAMNPVREMPIVGGTGAFRLARGYAIAQTHWMDL--K  168

Query  141  LGDTVIECDVMLLH  100
             GD ++  +V ++H
Sbjct  169  SGDAIVGYNVTVIH  182



>ref|XP_006843315.1| hypothetical protein AMTR_s00913p00008360 [Amborella trichopoda]
 gb|ERN04990.1| hypothetical protein AMTR_s00913p00008360 [Amborella trichopoda]
Length=182

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 101/158 (64%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AKL     KV+ + F+ +   V   P  V+VA++N    SPTLFG + V+D P+T GPE 
Sbjct  27   AKLGLGEPKVSCIEFYLHDLLVAEKPTAVIVAEANTAKASPTLFGEVVVVDDPLTKGPEL  86

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +G+ QG YA SS  E+S     NFVFT GK+NGS+L+V+G NPV H+ RE+ I GG
Sbjct  87   TSKVIGKAQGLYAYSSQSELSLIEAMNFVFTDGKFNGSTLTVMGRNPVLHKVRELSINGG  146

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SG FRLARG +  +T   ++TT+  + V+  +V +LHY
Sbjct  147  SGAFRLARGYILKQTYSVDLTTQ--NAVVHYNVTVLHY  182



>ref|XP_007029062.1| Disease resistance-responsive family protein [Theobroma cacao]
 gb|EOY09564.1| Disease resistance-responsive family protein [Theobroma cacao]
Length=195

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 113/193 (59%), Gaps = 7/193 (4%)
 Frame = -1

Query  666  TYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTL---RQKVTDLHFFFYTTTVGAN  496
            T  +I  + L    +  A   AQ  +EV   +    +L   ++K++ LHF+F+    G N
Sbjct  7    TQSSIFFLILFTIISFSALAIAQQSDEVFSRYISPSSLGLKQEKLSHLHFYFHDIVSGKN  66

Query  495  PNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTML  316
               V VA++  T  S + FGA+ +MD P+TI P+ NS  +GR QG YA +S  + S  M+
Sbjct  67   STAVRVAEAPSTNSSSSFFGAVVMMDDPLTIKPDVNSKMVGRAQGIYAFASQTDFSLLMV  126

Query  315  FNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLG  136
             NFVFT GKYNGS+LSV+G N V    REM IVGGSG+FR ARG    +T + N  T   
Sbjct  127  LNFVFTQGKYNGSTLSVLGRNKVVSTVREMPIVGGSGVFRFARGYAQART-YSNSQT---  182

Query  135  DTVIECDVMLLHY  97
            D+++E +V + HY
Sbjct  183  DSIVEYNVYVFHY  195



>ref|XP_010912514.1| PREDICTED: dirigent protein 22-like [Elaeis guineensis]
Length=191

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 100/155 (65%), Gaps = 2/155 (1%)
 Frame = -1

Query  561  PTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSS  382
            P +RQK++ L  F++    G +P  V VAQ+    KS T FG + ++D  +T+ PE  S 
Sbjct  39   PRVRQKLSHLRLFWHDLVSGPDPTAVRVAQAASADKSATGFGTLVMIDDALTVSPEPTSK  98

Query  381  QLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGL  202
             +GR QGFYAL+S +E +  M  NF F  GKYNGS+++++G N V+ E REM ++GGSGL
Sbjct  99   LVGRAQGFYALASKEEAALLMSMNFAFIEGKYNGSTVTILGRNAVFSEVREMPVIGGSGL  158

Query  201  FRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            FR+A+G    +T  +N   K GD V+E +V ++HY
Sbjct  159  FRMAQGYAQARTHSFN--PKTGDAVVEYNVFVMHY  191



>ref|XP_002531174.1| Disease resistance response protein, putative [Ricinus communis]
 gb|EEF31217.1| Disease resistance response protein, putative [Ricinus communis]
Length=196

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 100/158 (63%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            A L   R+K++ LHF+F+    G N   V VA +++T  S + FG + +MD P+T  P  
Sbjct  41   ATLGLKREKLSHLHFYFHDIVSGRNATAVPVASADMTNHSSSAFGLVNMMDDPLTAEPHL  100

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
            +S  +GR QG YA +S  E+SF M+ NF FT GKYNGS+LSV+G N V+   REM IVGG
Sbjct  101  SSKIVGRAQGIYASASQSELSFLMVLNFAFTQGKYNGSNLSVLGRNSVFSGIREMPIVGG  160

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFR ARG    KT   ++ T  GD ++E +V + HY
Sbjct  161  SGLFRFARGYAQAKTHELDLKT--GDAIVEYNVYVFHY  196



>ref|XP_009602000.1| PREDICTED: dirigent protein 21-like [Nicotiana tomentosiformis]
Length=156

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 105/174 (60%), Gaps = 26/174 (15%)
 Frame = -1

Query  618  LAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLF  439
            +  G   GP+ V++ F KLP  +QK                        SN  AKSPTLF
Sbjct  1    MVQGVDLGPKVVEKRFEKLPHAKQK------------------------SNTIAKSPTLF  36

Query  438  GAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVG  259
            G +A+MD P+T+GPE NS  +GR QG Y  +   E +  +  NFVFT  K+N S+LSV+G
Sbjct  37   GFVAMMDDPLTVGPEPNSIIVGRAQGIYGSTDQKEGALHINLNFVFTSCKFNDSTLSVLG  96

Query  258  YNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
             NP+++++RE+ IV  SG+FRLA+ I T KT W+N+T   GD +IE +V++LHY
Sbjct  97   RNPMFNQYREIPIVSNSGVFRLAQRIATTKTGWFNITN--GDAIIEYNVIVLHY  148



>ref|XP_006495204.1| PREDICTED: dirigent protein 4-like [Citrus sinensis]
Length=188

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 108/178 (61%), Gaps = 8/178 (4%)
 Frame = -1

Query  618  LAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTA--KSPT  445
            +A  TAQG E   +  A +P ++QKVT LHFF +    G NP+ V+VA++N+T   KSPT
Sbjct  15   VAAATAQG-EYYSESVAAVP-MQQKVTKLHFFLHDILSGQNPSAVMVARANLTDGDKSPT  72

Query  444  LFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT--MLFNFVFTHGKYNGSSL  271
             FG++  +D  + +GPE NS  +G  QG Y  SS D  +F   M  +F  T G++ GSS 
Sbjct  73   PFGSVFAVDDALRVGPESNSEIIGNAQGLYVSSSQDANNFAIVMYIDFALTSGEFKGSSF  132

Query  270  SVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SV   NPV    RE+ +VGG G FR+ARG   +KT ++N T   GD +I+ +V L HY
Sbjct  133  SVFSRNPVSEPSRELAVVGGRGKFRMARGFAVLKTAYFNGTN--GDAIIDYNVSLFHY  188



>ref|XP_009367567.1| PREDICTED: dirigent protein 22-like [Pyrus x bretschneideri]
Length=196

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 111/190 (58%), Gaps = 4/190 (2%)
 Frame = -1

Query  666  TYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPND  487
            TY  ++ +S   F+T +   T      +    +K    R+K++ LHF+F+    G  P  
Sbjct  11   TYTILITISFFFFSTLVTSETHHFSRSLSP--SKHGLKREKLSHLHFYFHDIVGGRTPTA  68

Query  486  VLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNF  307
            + VA++  T  S T FG + ++D P+TI PE +S  +G+ QG YA +S  E+ F M  NF
Sbjct  69   IKVAEALTTNTSMTGFGTVVMIDDPLTISPESSSKLVGKAQGIYASASQSEVGFLMALNF  128

Query  306  VFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTV  127
            VF  GKYNGS+LSV+G N V+   REM IVGGSGLFR ARG     T  +++  K GD V
Sbjct  129  VFVEGKYNGSTLSVLGRNAVFSAVREMPIVGGSGLFRFARGYALASTHQFDI--KSGDAV  186

Query  126  IECDVMLLHY  97
            +E +V + H+
Sbjct  187  VEYNVYVFHH  196



>ref|XP_004305538.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=194

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK    ++K++ +HF+F+    G +P  + VA++  T  S T FGA+ ++D P+T GPE 
Sbjct  39   AKHGLKKEKLSHVHFYFHDIVSGRSPTAIRVAEAPTTQNSSTAFGAVVMIDDPLTAGPEL  98

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +G+ QG YA +S  E+ F M+ NF F  GKYNGS LSV+G N V+   REM IVGG
Sbjct  99   GSKLVGKAQGIYASASQTELGFLMVLNFAFMEGKYNGSYLSVLGRNTVFSAVREMPIVGG  158

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFR ARG    KT   +  T  GD V+E +V +LHY
Sbjct  159  SGLFRFARGYARAKTHKVDFNT--GDAVVEYNVYVLHY  194



>ref|XP_006851957.1| hypothetical protein AMTR_s00041p00187460 [Amborella trichopoda]
 gb|ERN13424.1| hypothetical protein AMTR_s00041p00187460 [Amborella trichopoda]
Length=182

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = -1

Query  579  QWFAKLPTLRQKVTDLHFFFYTTTVGA-NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTI  403
             W   L   ++KV+ LHF+F+    G  N   ++VA +N T  S T FG + V+D P+T 
Sbjct  23   DWKKSLGLGKEKVSYLHFYFHDIASGTKNATALIVAMANTTITSSTFFGMLNVVDDPLTQ  82

Query  402  GPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMV  223
            GP   S  +GR QG YA +S  E S  M  NF+FT G++NGS+L+++G NP     REM 
Sbjct  83   GPAITSKVIGRMQGVYASASQTEFSLFMGLNFLFTTGEFNGSTLTMIGRNPTMENVREMS  142

Query  222  IVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            IVGGSG FRLARG L  KT   N  T+    V+ECDV ++HY
Sbjct  143  IVGGSGAFRLARGFLLAKTYSANTVTR--SFVVECDVTVIHY  182



>ref|XP_006851956.1| hypothetical protein AMTR_s00041p00187220 [Amborella trichopoda]
 gb|ERN13423.1| hypothetical protein AMTR_s00041p00187220 [Amborella trichopoda]
Length=205

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 102/158 (65%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AKL     KV+ + F+ +   V   P  V+VA++N    SPTLFG + V+D P+T GPE 
Sbjct  26   AKLGLGEPKVSCIEFYLHDLLVAEKPTAVIVAEANTAKASPTLFGEVVVVDDPLTKGPEL  85

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +G+ QG YA SS  E+S     NFVFT GK+NGS+L+V+G NPV H+ RE+ I GG
Sbjct  86   TSKVIGKAQGLYAYSSQSELSLIEGMNFVFTDGKFNGSTLTVMGRNPVLHKVRELSINGG  145

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SG+FRLARG +  +T   ++TT+  + V+  +V +LHY
Sbjct  146  SGVFRLARGYILKQTYSVDLTTQ--NAVVHYNVTVLHY  181



>ref|XP_010106404.1| hypothetical protein L484_008609 [Morus notabilis]
 gb|EXC10443.1| hypothetical protein L484_008609 [Morus notabilis]
Length=190

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 100/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPT-LFGAMAVMDGPVTIGPERNSSQLG  373
            +K++ LHF+F+    G  P+ V +  S   AKS T LFG   + D  +T+G E  S  +G
Sbjct  41   EKLSHLHFYFHDILSGKTPSAVKIISSPPKAKSATGLFGTTFMTDDALTVGQEPTSKIVG  100

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QGFY+ +S  ++SF M+ N+VFT GKYNGS++S++G NPV  + REM IVGGSGLFR 
Sbjct  101  RAQGFYSAASQSDVSFLMVMNYVFTEGKYNGSTISILGRNPVLDDVREMPIVGGSGLFRF  160

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG     T+W++   K GD ++E +V +LHY
Sbjct  161  ARGYALAHTVWFD--PKTGDAIVEYNVFVLHY  190



>ref|XP_011075257.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=191

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 116/191 (61%), Gaps = 7/191 (4%)
 Frame = -1

Query  654  ILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLR-----QKVTDLHFFFYTTTVGANPN  490
            I  ++LI+F   L   +A    + +Q+  KL         +K++ LHF+F+    G+NP 
Sbjct  3    ITALNLIIFTILLFLASALPLTKSQQFSRKLSKKEMGLKVEKLSHLHFYFHDIGSGSNPT  62

Query  489  DVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFN  310
             V VAQ+  T  S TLFG++ V+D  +T+GPE +S  +GR QG Y  +   E++ ++++N
Sbjct  63   AVHVAQAATTNSSATLFGSVTVIDNLLTLGPEISSKTVGRAQGIYVFADTTELALSVVYN  122

Query  309  FVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDT  130
            F F+ G +NGS LSV+G NP+    RE+ IVGGSG+FR ARG   +KT+  N+    GD 
Sbjct  123  FAFSEGVFNGSVLSVLGRNPLLSGVRELSIVGGSGVFRFARGHAKLKTVETNMQN--GDA  180

Query  129  VIECDVMLLHY  97
            V+E +V + HY
Sbjct  181  VVEYNVYVFHY  191



>ref|XP_003554226.1| PREDICTED: dirigent protein 21-like [Glycine max]
 gb|KHN45402.1| Disease resistance response protein 206 [Glycine soja]
Length=191

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 112/194 (58%), Gaps = 8/194 (4%)
 Frame = -1

Query  675  EKLTYK-TILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            + LTY  TI++  L  FAT  +H   +           L   ++K++ LHFFF+    G 
Sbjct  5    KNLTYIFTIVLTLLFSFATAKSHSFHRSISPTA-----LGLQKEKLSHLHFFFHDIGSGP  59

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
             P  V VAQ+++T  S   FG + + D P+T+GPE  S  +G+ QG Y  +S +++   M
Sbjct  60   KPTAVRVAQAHMTNTSSAFFGILVMADDPLTVGPEPGSKLVGKAQGIYGFASQEDVGLLM  119

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
            + +F FT GKYNGS+LS++G N V+   REM IVGGSG FR ARG    KT  ++   K 
Sbjct  120  IMSFAFTEGKYNGSTLSLLGRNAVFSTVREMPIVGGSGAFRFARGYAQAKTHTFDY--KT  177

Query  138  GDTVIECDVMLLHY  97
            GD V+E +V + HY
Sbjct  178  GDAVVEYNVYVFHY  191



>ref|XP_006829600.1| hypothetical protein AMTR_s01147p00007290 [Amborella trichopoda]
 gb|ERM97016.1| hypothetical protein AMTR_s01147p00007290 [Amborella trichopoda]
Length=174

 Score =   138 bits (348),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = -1

Query  579  QWFAKLPTLRQKVTDLHFFFYTTTVGA-NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTI  403
             W   L   ++KV+ LHF+F+    G  N   ++VA +N T  S T FG ++V+D P+T 
Sbjct  15   DWKKSLGLGKEKVSYLHFYFHDIASGTKNATALIVAMANTTITSSTFFGMLSVVDDPLTQ  74

Query  402  GPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMV  223
            GP   S  +GR QG YA +S  E S  M  NF+ T G++NGS+L+++G NP     REM 
Sbjct  75   GPAITSKVIGRMQGIYASASQIEFSLFMGLNFLLTTGEFNGSTLTMIGRNPTMENVREMS  134

Query  222  IVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            IVGGSG FRLARG L  KT   N  T+    V+ECDV ++HY
Sbjct  135  IVGGSGAFRLARGFLLAKTYSANTVTR--SFVVECDVTIIHY  174



>ref|XP_008789330.1| PREDICTED: dirigent protein 22-like [Phoenix dactylifera]
Length=192

 Score =   139 bits (350),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 94/153 (61%), Gaps = 4/153 (3%)
 Frame = -1

Query  555  LRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQL  376
            LRQKV+ LHFFF+    G N   + V  ++     P+ FG   +MD  +T GPE  S  +
Sbjct  44   LRQKVSHLHFFFHDVVSGRNATAMPV--TDPVMPLPSSFGKTVMMDDLLTEGPEPTSKPV  101

Query  375  GRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFR  196
            GR QG YA ++  E+   M+ N VFT GKYNGS L+V+G NPV H  REM +VGGSGLFR
Sbjct  102  GRAQGMYAFAAQQELGLLMVMNLVFTEGKYNGSVLTVLGRNPVLHRVREMPVVGGSGLFR  161

Query  195  LARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
             ARG    +T W+N  T  GD ++E +  +LHY
Sbjct  162  FARGYAQAQTHWFNPNT--GDAIVEYNAYVLHY  192



>gb|KDO39789.1| hypothetical protein CISIN_1g038159mg [Citrus sinensis]
Length=188

 Score =   139 bits (349),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 107/178 (60%), Gaps = 8/178 (4%)
 Frame = -1

Query  618  LAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTA--KSPT  445
            +A  TAQG E   +  A +P ++QKVT LHFF +    G NP+ V+VA +N+T   KSPT
Sbjct  15   VAAATAQG-EYYSESVAAVP-MQQKVTKLHFFLHDILSGPNPSAVMVAHANLTDGDKSPT  72

Query  444  LFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT--MLFNFVFTHGKYNGSSL  271
             FG++  +D  + +GPE NS  +G  QG Y  SS D  +F   M  +F  T G++NGSS 
Sbjct  73   PFGSVFAVDDALRVGPESNSEIIGNAQGLYVSSSQDANNFAIVMYIDFALTSGEFNGSSF  132

Query  270  SVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SV   N V    RE+ +VGG G FR+ARG   +KT ++N T   GD +IE +V L HY
Sbjct  133  SVFSRNQVSEPSRELAVVGGRGKFRMARGFAELKTAYFNGTN--GDAIIEFNVSLFHY  188



>ref|XP_010912515.1| PREDICTED: dirigent protein 19-like [Elaeis guineensis]
Length=191

 Score =   139 bits (349),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 100/155 (65%), Gaps = 2/155 (1%)
 Frame = -1

Query  561  PTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSS  382
            P + QK++ L  F++    G +P  V VAQ+    KS T FG + ++D P+T+GPE  S 
Sbjct  39   PRVPQKLSHLRLFWHDIVSGPDPTAVRVAQAASANKSATGFGTLVIIDDPLTVGPELTSK  98

Query  381  QLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGL  202
             +GR QG YAL+S +E    +  NF F  GKYNGS+++++G N V+ E RE+ +VGGSGL
Sbjct  99   LVGRAQGIYALASKEEAGLLVSMNFAFIEGKYNGSTVTILGRNAVFSEVREIPVVGGSGL  158

Query  201  FRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            FR+A+G    +T  +N   K GDTV+E +V ++HY
Sbjct  159  FRMAQGYALARTYSFN--RKTGDTVVEYNVFVMHY  191



>ref|XP_008372887.1| PREDICTED: dirigent protein 23 [Malus domestica]
Length=193

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 114/195 (58%), Gaps = 12/195 (6%)
 Frame = -1

Query  669  LTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLR-----QKVTDLHFFFYTTTV  505
            +T   +L+++++   T+ A   +  P    +W  KL T +     + VT+L F+F+ T  
Sbjct  6    VTVMLVLIIAVVAATTEGAXSXSTQP----KWAKKLKTRKKMTSSETVTNLQFYFHDTVS  61

Query  504  GANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISF  325
            G NP+ V +AQ+  T KS TLFGA+ ++D P+T  P+ NS  +GR QG Y  S   E   
Sbjct  62   GENPSAVRIAQATDTNKSLTLFGALLMVDDPLTETPDPNSKLVGRAQGMYGSSGQQEFGL  121

Query  324  TMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTT  145
            TM   F F  G Y+GSS+S+ G NP  +  REM +V G+G+F+ ARG    +T W+N+  
Sbjct  122  TMAMCFAFCDGIYDGSSISIFGKNPALNLVREMPVVAGTGIFQFARGYAIARTHWFNI--  179

Query  144  KLGDTVIECDVMLLH  100
             +GD ++E +V ++H
Sbjct  180  -MGDAIVEYNVTVIH  193



>ref|XP_007162359.1| hypothetical protein PHAVU_001G145300g [Phaseolus vulgaris]
 gb|ESW34353.1| hypothetical protein PHAVU_001G145300g [Phaseolus vulgaris]
Length=189

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 96/152 (63%), Gaps = 4/152 (3%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHFFF+    G NP  V V Q   T  S TLFG M++ D P+T GPE+ S  +G
Sbjct  42   KEKLSHLHFFFHDILSGPNPTAVRVVQPQNT--SSTLFGFMSMADDPLTAGPEQGSKLVG  99

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QG Y  ++ +EI   M+ NFVF  GKYNGS+LS++G N V+   REM IVGGSGLFR 
Sbjct  100  KAQGIYGSAAQEEIGLLMIMNFVFCEGKYNGSTLSLLGRNTVFSTVREMPIVGGSGLFRF  159

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT   +   K GD ++E +V + HY
Sbjct  160  ARGYAQAKTHTLDF--KTGDAIVEYNVYVFHY  189



>ref|XP_011039494.1| PREDICTED: dirigent protein 22-like [Populus euphratica]
Length=196

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -1

Query  567  KLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERN  388
            KL   R+K++ LHF+F+    G NP  V + ++ +T KS + FG + +MD P+T+ PE  
Sbjct  42   KLGLKREKLSHLHFYFHDIVGGRNPTAVPIVRAAITKKSFSSFGLVTMMDDPLTVKPEIG  101

Query  387  SSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGS  208
            S  +GR QG YA +S  E+SF M  NFVFT G+Y GS+LS++G N V+   REM IVGGS
Sbjct  102  SKLVGRAQGIYASASQSELSFLMALNFVFTEGRYKGSTLSILGRNNVFSGIREMPIVGGS  161

Query  207  GLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            GLFR ARG     T    +  K G+ ++E +V + HY
Sbjct  162  GLFRFARGYAQANT--HEIDFKTGNAIVEYNVYVFHY  196



>ref|XP_002312128.2| disease resistance-responsive family protein [Populus trichocarpa]
 gb|EEE89495.2| disease resistance-responsive family protein [Populus trichocarpa]
Length=185

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 116/191 (61%), Gaps = 16/191 (8%)
 Frame = -1

Query  654  ILVVSLIVFA-TKLAHGTAQGPEEVKQWFAK---LPTLRQKVTDLHFFFYTTTVGANPND  487
            +L ++LI+F  T  AHG         Q++++     +L ++ T+LHFFF+ T  G NP+ 
Sbjct  6    VLGLALILFMITTHAHG---------QYYSQSVPYESLPERTTNLHFFFHDTLSGKNPSA  56

Query  486  VLVAQSNVT-AKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFN  310
            VLVA+ N+T  +S   FG++ V   P+T+GPE  S  +G  QG Y  SS D  S    F+
Sbjct  57   VLVARPNITTGQSLAPFGSIFVFHDPLTVGPELTSEVIGNAQGLYVSSSQDIPSLVAYFD  116

Query  309  FVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDT  130
            F FT G++NGSS+SV   NP+ +  RE+ +VGG G FRLARG   +KT + N T   GD 
Sbjct  117  FGFTTGEFNGSSISVFSRNPIINTERELAVVGGRGKFRLARGFAQLKTYFINATN--GDA  174

Query  129  VIECDVMLLHY  97
            ++E +V ++HY
Sbjct  175  IVEYNVTVIHY  185



>ref|XP_003519012.1| PREDICTED: dirigent protein 21-like [Glycine max]
Length=196

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            +K++ LHFFF+    G N   V VA +  T KSPTLFGA+ +MD P+T  PE  S  +GR
Sbjct  50   EKLSHLHFFFHDVVSGQNQTAVRVAAAPATDKSPTLFGAVVMMDDPLTEQPEATSKVVGR  109

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG YA +S  E+ F M  NF FT GKYNGSSL+V+G N V    REM +VGGS LFR A
Sbjct  110  AQGIYASASQSELGFLMAMNFAFTEGKYNGSSLAVLGRNTVASAVREMPVVGGSELFRFA  169

Query  189  RGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            RG    KT  ++      + ++E +V + HY
Sbjct  170  RGYAQAKTHSFSAV----EAIVEYNVYVFHY  196



>ref|XP_006841401.1| hypothetical protein AMTR_s00901p00009100 [Amborella trichopoda]
 gb|ERN03076.1| hypothetical protein AMTR_s00901p00009100 [Amborella trichopoda]
Length=174

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = -1

Query  579  QWFAKLPTLRQKVTDLHFFFY-TTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTI  403
             W   L   ++KV+ LHF+F+   +   N   ++VA +N T  S T FG ++V+D P+T 
Sbjct  15   DWKKSLGLGKEKVSYLHFYFHDIASCTKNATALIVAMANTTITSSTFFGMLSVVDDPLTQ  74

Query  402  GPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMV  223
            GP   S  +GR QG YA +S  E S  M  NF+ T G++NGS+L+++G NP     REM 
Sbjct  75   GPAITSKVIGRMQGIYASASQIEFSLFMGLNFLLTTGEFNGSTLTMIGRNPTMENVREMS  134

Query  222  IVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            IVGGSG FRLARG L  KT   N  T+    V+ECDV ++HY
Sbjct  135  IVGGSGAFRLARGFLLAKTYSANTVTR--SFVVECDVTIIHY  174



>ref|XP_006851935.1| hypothetical protein AMTR_s00041p00177300 [Amborella trichopoda]
 gb|ERN13402.1| hypothetical protein AMTR_s00041p00177300 [Amborella trichopoda]
Length=179

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 100/160 (63%), Gaps = 4/160 (3%)
 Frame = -1

Query  576  WFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGP  397
            W   +   + KV+ LHF+F+    G+NP  +LVA++N T  SPT FG++ V D P+T GP
Sbjct  24   WRETVGMGQPKVSHLHFYFHEVGKGSNPTPILVAEANSTKTSPTSFGSVYVADDPLTEGP  83

Query  396  ERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIV  217
               S  +GR QG  A  S+ E +  M  NFVFT G++NGS+L+VVG NP+  + REM +V
Sbjct  84   NLTSKLIGRAQGIQAACSMTEFNLIMALNFVFTDGEFNGSTLTVVGRNPILQDVREMSVV  143

Query  216  GGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            GG+G+FRLA+G   ++T+        G   +E +V ++HY
Sbjct  144  GGNGVFRLAQGYAQLRTILL----ATGSLTVEYNVTVIHY  179



>ref|XP_010912513.1| PREDICTED: dirigent protein 22-like [Elaeis guineensis]
Length=191

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 100/155 (65%), Gaps = 2/155 (1%)
 Frame = -1

Query  561  PTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSS  382
            P +RQK++ L  F++    G +P  V VAQ+    KS T FG + ++D  +T+GPE  S 
Sbjct  39   PRVRQKLSHLRLFWHDLVSGPDPTAVRVAQAASANKSATGFGTLVMIDDALTVGPEPTSK  98

Query  381  QLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGL  202
             +GR QGF+AL+S +E +  M  NF F  GKYNGS+++++G N V+ E REM ++GGSGL
Sbjct  99   LVGRAQGFFALASKEEKALLMSMNFAFIEGKYNGSTVTILGRNAVFSEVREMPVIGGSGL  158

Query  201  FRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            FR+A+G    +T  +N  T   D V+E +V ++HY
Sbjct  159  FRMAQGYAQARTHSFNPKTH--DAVVEYNVFVMHY  191



>ref|XP_002276258.2| PREDICTED: dirigent protein 22-like [Vitis vinifera]
Length=191

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 111/194 (57%), Gaps = 3/194 (2%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            M+K      L+ S IVF +    G +    E K    KL    +K+T L+FFF+    G 
Sbjct  1    MDKTLIPVFLIFSTIVFFSTTVAGKSHKFSE-KLSPEKLGFKHEKLTHLNFFFHDIVTGQ  59

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP  V VA++ +T  S TLFG++ ++D P+T GPE  S  +GR QG YA +  +E    M
Sbjct  60   NPTAVRVAEAAMTNTSKTLFGSVMIIDDPLTEGPEMESKLVGRAQGMYASAGQNEPGLLM  119

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
               F F  GK+NGS+LS +G N V+ E RE+ IVGGSGLFR ARG    +T   ++ T  
Sbjct  120  AMTFHFVEGKFNGSNLSFLGRNSVFSEVRELPIVGGSGLFRFARGYAEARTRTLDMKT--  177

Query  138  GDTVIECDVMLLHY  97
            G+ V+E +V + HY
Sbjct  178  GNAVVEYNVYVFHY  191



>ref|XP_006423624.1| hypothetical protein CICLE_v10030187mg [Citrus clementina]
 gb|ESR36864.1| hypothetical protein CICLE_v10030187mg [Citrus clementina]
Length=188

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 108/187 (58%), Gaps = 10/187 (5%)
 Frame = -1

Query  636  IVFATKLAHGTAQGP---EEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSN  466
            ++F   +    A  P   E   +  A +P ++QKVT LHFF +    G NP+ V+VA +N
Sbjct  5    VIFCLAVILCVATAPTQGEYYSESVAAVP-MQQKVTKLHFFLHDILSGQNPSAVMVAHAN  63

Query  465  VTA--KSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT--MLFNFVFT  298
            +T   KSPT FG++  +D  + +GPE NS  +G  QG Y  SS D  +F   M  +F  T
Sbjct  64   LTDGDKSPTPFGSVFAVDDALRVGPESNSEIIGNAQGLYVSSSQDANNFAIVMYIDFALT  123

Query  297  HGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIEC  118
             G++ GSS SV   NPV    RE+ +VGG G FR+ARG   +KT ++N TT  GD +IE 
Sbjct  124  SGEFKGSSFSVFSRNPVSEPSRELAVVGGRGKFRMARGFAELKTAYFNGTT--GDAIIEY  181

Query  117  DVMLLHY  97
            +V L HY
Sbjct  182  NVSLFHY  188



>gb|KDO35808.1| hypothetical protein CISIN_1g029442mg [Citrus sinensis]
Length=193

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (63%), Gaps = 4/152 (3%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K++ LHF+F+    G N   V VAQ+ +T  S T FGA+ +MD P+TI PE +S  +G
Sbjct  46   REKLSHLHFYFHDIVGGPNTTTVRVAQAAMTNTSSTFFGAVVMMDDPLTIQPELSSKLVG  105

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +SL E+ F M+ NF FT GKYNGS+LSV+G N      REM IVGGSGLFR 
Sbjct  106  RAQGIYASASLSELGFLMVMNFAFTEGKYNGSTLSVLGRNTPLSTVREMPIVGGSGLFRF  165

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T   +        V+E +V + HY
Sbjct  166  ARGYAQARTHTIDSEV----AVVEYNVYVFHY  193



>gb|KDO43263.1| hypothetical protein CISIN_1g045658mg [Citrus sinensis]
Length=188

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 114/192 (59%), Gaps = 11/192 (6%)
 Frame = -1

Query  660  KTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVL  481
            + I  +++I+    +A   AQG E   +  A +P ++QKVT LHFF +    G NP+ V+
Sbjct  4    RVIFCLAVILC---VAAAPAQG-EYYSESVAAVP-MQQKVTKLHFFLHDILSGQNPSAVM  58

Query  480  VAQSNVTA--KSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT--MLF  313
            VA++N+T   KSPT FG++  +D  + +GPE NS  +G  QG Y  SS D  +F   M  
Sbjct  59   VARANLTDGDKSPTPFGSVFAVDDALRVGPESNSEIIGNAQGLYVSSSQDANNFAIVMYI  118

Query  312  NFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGD  133
            +F  T G++ GSS SV   NPV    RE+ +VGG G FR+ARG   +KT ++N T   GD
Sbjct  119  DFALTSGEFKGSSFSVFSRNPVSEPSRELAVVGGRGKFRMARGFAVLKTAYFNGTN--GD  176

Query  132  TVIECDVMLLHY  97
             +I+ +V L HY
Sbjct  177  AIIDYNVSLFHY  188



>gb|ABR27716.1| dirigent-like protein [Picea sitchensis]
Length=186

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 95/158 (60%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK+   R+K++ LHF+F+    G N   V VA +  +  S TLFG + VMD  +T GPE 
Sbjct  31   AKVKLGREKISHLHFYFHDLVSGKNVTTVKVASAPTSNSSATLFGTVMVMDDWLTEGPEA  90

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  LGR QG Y  SS +     M   FVF  GKYNGS+L+++G N    + REM IVGG
Sbjct  91   TSKMLGRAQGIYVSSSQENFHLLMASTFVFESGKYNGSTLAMIGKNAALEQVREMPIVGG  150

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFRLARG    +T  W + T  G+ V+E +V +LHY
Sbjct  151  SGLFRLARGYALARTHSWELNT--GNAVVEYNVTVLHY  186



>ref|XP_006495208.1| PREDICTED: dirigent protein 4-like [Citrus sinensis]
Length=189

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 114/198 (58%), Gaps = 18/198 (9%)
 Frame = -1

Query  672  KLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAK---LPTLRQKVTDLHFFFYTTTVG  502
            KLT   +L V + +     AHG         Q+++K      ++++VT+LHFFF+    G
Sbjct  4    KLTLAWVLTVCVTI-TWAAAHG---------QYYSKTVPYSPMKEQVTNLHFFFHDILGG  53

Query  501  ANPNDVLVAQSNVTA---KSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEI  331
             NP+ VLVA++N T    KSPT F  +  +D P+T GPE  S  +G  QG YA +  D +
Sbjct  54   KNPSAVLVAKANNTTIGDKSPTPFSTVFAVDDPLTAGPELTSEVIGNCQGLYASTGQDNL  113

Query  330  SFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNV  151
            S  + F+F FT G++NGS++SV   NPV    RE+ +VGG G FR+ARG   +KT   N 
Sbjct  114  SLVVYFDFGFTKGEFNGSAISVFSRNPVLETERELAVVGGRGKFRMARGFAQLKTFSVNQ  173

Query  150  TTKLGDTVIECDVMLLHY  97
            T   GD ++E +V + HY
Sbjct  174  TN--GDAIVEYNVTVFHY  189



>ref|XP_006836063.1| hypothetical protein AMTR_s00114p00093910 [Amborella trichopoda]
 gb|ERM98916.1| hypothetical protein AMTR_s00114p00093910 [Amborella trichopoda]
Length=229

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++KV+ LHF+F+    G NP  + VA ++ T  S T FGA+ ++D P+T GPE  S  LG
Sbjct  80   KEKVSHLHFYFHDILSGPNPTAIEVACAHSTNSSMTGFGAIMMIDDPLTEGPELTSKLLG  139

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA ++ +E+   M  N++F  GKYNGS+LS++G N V    RE+ +VGGSG FRL
Sbjct  140  RAQGIYASAAQEEVGLLMSLNYMFMEGKYNGSTLSILGRNAVMSGVRELAVVGGSGAFRL  199

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT  ++ +T  GD V+E +V++LHY
Sbjct  200  ARGYALAKTHAFDPST--GDAVVEYNVVVLHY  229



>ref|XP_010024264.1| PREDICTED: dirigent protein 21-like [Eucalyptus grandis]
Length=192

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -1

Query  657  TILVVSL-IVFATKLAHGTAQGPE-EVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDV  484
            TIL VS  + F T +   T    E   +  F   P   +K+T L F+ + T  G +P  V
Sbjct  9    TILAVSFSLAFLTVIKSETMFARELSARDQFRLKP---KKMTHLRFYLHDTLTGRHPTTV  65

Query  483  LVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFV  304
             VAQ+  T  S TLFG +AV D P+T+ P+ NS+ +GR Q  YA SS  E S TM  N V
Sbjct  66   PVAQAATTNGSATLFGTVAVFDDPLTVSPDLNSALVGRAQAIYASSSQSEWSLTMTMNLV  125

Query  303  FTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVI  124
            FT G Y+GS+LSV+G NP+    RE+ IVGG+G+FR ARG + ++T  +N TT+  + ++
Sbjct  126  FTVGAYSGSTLSVLGQNPLLKNPRELTIVGGTGVFRFARGYIQLRTYAFNKTTR--NAIV  183

Query  123  ECDVMLLHY  97
            + D   LH+
Sbjct  184  KYDAYALHH  192



>gb|KCW90339.1| hypothetical protein EUGRSUZ_A02485, partial [Eucalyptus grandis]
Length=166

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            +K+T L F+ + T  G +P  V VAQ+  T  S TLFG +AV D P+T+ P+ NS+ +GR
Sbjct  18   KKMTHLRFYLHDTLTGRHPTTVPVAQAATTNGSATLFGTVAVFDDPLTVSPDLNSALVGR  77

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             Q  YA SS  E S TM  N VFT G Y+GS+LSV+G NP+    RE+ IVGG+G+FR A
Sbjct  78   AQAIYASSSQSEWSLTMTMNLVFTVGAYSGSTLSVLGQNPLLKNPRELTIVGGTGVFRFA  137

Query  189  RGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            RG + ++T  +N TT+  + +++ D   LH+
Sbjct  138  RGYIQLRTYAFNKTTR--NAIVKYDAYALHH  166



>ref|XP_006829349.1| hypothetical protein AMTR_s01152p00009680 [Amborella trichopoda]
 gb|ERM96765.1| hypothetical protein AMTR_s01152p00009680 [Amborella trichopoda]
Length=155

 Score =   135 bits (341),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 96/152 (63%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++ VT LHF+F+    G  P  + VA+++ T KS T FGA+ ++D P+T GPE  S  +G
Sbjct  6    KEHVTHLHFYFHDIVSGPKPTAIEVARADSTNKSATGFGAVVMIDDPLTEGPEVTSKPIG  65

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA ++ +E+   M  N+VF  GKY GS+LS++G N V+    EM IVGGSG FRL
Sbjct  66   RAQGIYASAAQEEVGLLMTLNYVFVEGKYEGSTLSILGRNAVFSGVTEMAIVGGSGTFRL  125

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            A G    KT   ++  K GD V+E  V++LHY
Sbjct  126  AHGYALAKTHTLDL--KTGDVVVEYTVLVLHY  155



>ref|XP_002266452.2| PREDICTED: dirigent protein 22 [Vitis vinifera]
 emb|CAN62170.1| hypothetical protein VITISV_027159 [Vitis vinifera]
 emb|CBI17737.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 101/168 (60%), Gaps = 9/168 (5%)
 Frame = -1

Query  594  PEEVKQWFAK-LPTLR-QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVM  421
            P    Q FA+ + T+R +KV+ LHF+F+    G NP       + +       FG   ++
Sbjct  22   PAAFSQQFAEEIATMRLEKVSHLHFYFHDILSGKNPT-----ATQIAGPKKGHFGVTMMV  76

Query  420  DGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYH  241
            D  +T GPE +S  LGR QG YALS+  E +  M+ NF F  GKYNGSS+SV+G NPV H
Sbjct  77   DDALTEGPEPSSKLLGRAQGLYALSAQQEPALLMVMNFAFMEGKYNGSSISVLGRNPVMH  136

Query  240  EHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
              REM IVGGSGLFR ARG     T+W++   K GD ++E +V +LH+
Sbjct  137  AVREMPIVGGSGLFRYARGYALAHTVWFD--GKTGDAIVEYNVSVLHF  182



>ref|XP_010531503.1| PREDICTED: dirigent protein 23 [Tarenaya hassleriana]
Length=180

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 108/189 (57%), Gaps = 13/189 (7%)
 Frame = -1

Query  660  KTILVVSLIVFA-TKLAHGT-AQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPND  487
            K +L++ L  +  T++   + A  PEE           ++KVT+L F+F+ T  G NP  
Sbjct  3    KAVLLILLSAYVITEMPQASWANRPEEAP---------KEKVTNLQFYFHDTLSGKNPTA  53

Query  486  VLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNF  307
            V VAQ+  + KSPTLFGA  ++D P+T  P+ NS  LGR QG Y  S   EI   M  +F
Sbjct  54   VRVAQAPDSDKSPTLFGATFMVDDPLTETPDPNSRLLGRAQGLYGSSGKQEIGLIMAMSF  113

Query  306  VFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTV  127
             F  G Y  S++S+VG NP  +  REM IVGG+GLFR+ARG    +T W + TT  GD +
Sbjct  114  CFVDGPYKDSTISLVGKNPAMNPVREMPIVGGTGLFRMARGYAIAQTHWLDPTT--GDAI  171

Query  126  IECDVMLLH  100
            +  +V +  
Sbjct  172  VGYNVTVFQ  180



>ref|XP_006833077.1| hypothetical protein AMTR_s00995p00008650 [Amborella trichopoda]
 gb|ERM98355.1| hypothetical protein AMTR_s00995p00008650 [Amborella trichopoda]
Length=182

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = -1

Query  579  QWFAKLPTLRQKVTDLHFFFYTTTVGA-NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTI  403
             W   L   ++KV+ LHF+F+    G  N   ++VA +N T  S T FG + V+D P+T 
Sbjct  23   DWKKSLGLGKEKVSYLHFYFHDIASGTKNATALIVAMANTTITSSTFFGMLNVVDDPLTQ  82

Query  402  GPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMV  223
            G    S  +GR QG YA +S  E S  M  NF+FT G++NGS+L+++G NP     REM 
Sbjct  83   GRAITSKVIGRMQGIYASTSQTEFSLFMGLNFLFTTGEFNGSTLTMIGRNPTMENVREMF  142

Query  222  IVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            IVGGSG FRLARG L  KT   N  T+    V+ECDV+++HY
Sbjct  143  IVGGSGAFRLARGFLLAKTYSANKVTR--SFVVECDVIVIHY  182



>ref|XP_006851938.1| hypothetical protein AMTR_s00041p00178600 [Amborella trichopoda]
 gb|ERN13405.1| hypothetical protein AMTR_s00041p00178600 [Amborella trichopoda]
Length=181

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AKL     KV+ + F+ +   V   P  V+VA++N T  SPTLFG + V+D P+T GPE 
Sbjct  26   AKLGLGEPKVSQIEFYMHDLLVTEKPTAVIVAEANTTKSSPTLFGQVVVVDDPMTEGPEL  85

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +G+ QG YA SS  EIS +   NFVF  GK+NGS+LSV+G NP+ ++ RE+ I+GG
Sbjct  86   TSKLIGKAQGLYAPSSQSEISLSEAVNFVFIDGKFNGSTLSVMGRNPILYKERELWIIGG  145

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            SG FRLARG    +T  ++ TT   + V+  +V ++H
Sbjct  146  SGAFRLARGYALKQTYSFDTTTL--NAVVHYNVTVIH  180



>ref|XP_006836064.1| hypothetical protein AMTR_s00114p00094280 [Amborella trichopoda]
 gb|ERM98917.1| hypothetical protein AMTR_s00114p00094280 [Amborella trichopoda]
Length=155

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 99/152 (65%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++KV+ LHF+F+    G NP  + VA+++ T  S T FG + ++D P+T GPE  S  +G
Sbjct  6    KEKVSHLHFYFHDIVSGPNPTAIEVARAHSTNTSDTGFGLIMMIDDPLTKGPELTSKLIG  65

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA ++ +E+   M  N++F  GKYNGS+LS++G N      RE+ +VGGSG FRL
Sbjct  66   RAQGIYASAAQEELGLLMSLNYMFVEGKYNGSTLSILGRNAAMSGVRELAVVGGSGAFRL  125

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT  ++ +T  GD V+E +V++LHY
Sbjct  126  ARGYALAKTHAFDPST--GDAVVEYNVVVLHY  155



>ref|XP_006485326.1| PREDICTED: dirigent protein 4-like [Citrus sinensis]
 ref|XP_006487436.1| PREDICTED: dirigent protein 4-like [Citrus sinensis]
Length=189

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 113/198 (57%), Gaps = 18/198 (9%)
 Frame = -1

Query  672  KLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAK---LPTLRQKVTDLHFFFYTTTVG  502
            KLT   +L V + +     AHG         Q+++K      ++++VT+LHFFF+    G
Sbjct  4    KLTLAWVLTVCVTI-TWAAAHG---------QYYSKTVPYSPMKEQVTNLHFFFHDILGG  53

Query  501  ANPNDVLVAQSNVTA---KSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEI  331
             NP+ VLVA++N T    KSPT F  +  +D P+T GPE  S  +G  QG YA +  D +
Sbjct  54   KNPSAVLVAKANNTTIGDKSPTPFSTVFAVDDPLTAGPELTSEVIGNCQGLYASTGQDNL  113

Query  330  SFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNV  151
            S    F+F FT G++NGS++SV   NPV    RE+ +VGG G FR+ARG   +KT   N 
Sbjct  114  SLIAYFDFGFTKGEFNGSAISVFSRNPVLETERELAVVGGRGKFRMARGFAQLKTFSVNQ  173

Query  150  TTKLGDTVIECDVMLLHY  97
            T   GD ++E +V + HY
Sbjct  174  TN--GDAIVEYNVTVFHY  189



>ref|XP_006851932.1| hypothetical protein AMTR_s00041p00176310 [Amborella trichopoda]
 gb|ERN13399.1| hypothetical protein AMTR_s00041p00176310 [Amborella trichopoda]
Length=181

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AKL     KV+ + F+ +   V   P  V+VA++N T  SPTLFG + V+D P+T GPE 
Sbjct  26   AKLGLGEPKVSQIEFYMHDLLVAEKPTAVIVAEANTTKSSPTLFGQVVVVDDPLTEGPEL  85

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +G+ QG YA SS  EIS     NFVFT GK+NGS+L+V+G N + H  RE+ I+GG
Sbjct  86   TSQVIGKAQGLYAPSSQSEISLFEAVNFVFTDGKFNGSTLTVMGRNTILHTVRELSIIGG  145

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SG FRLA G +  +T   + TT  G+ V+  +V ++HY
Sbjct  146  SGTFRLAHGYILKQTYSLDTTT--GNAVLYYNVTVIHY  181



>emb|CAN73498.1| hypothetical protein VITISV_044265 [Vitis vinifera]
Length=174

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K   LHF+F+    G NP  V VA++ VT KS TLFG +AV+D P+T+GPE +S  +G
Sbjct  39   REKXXHLHFYFHDVITGPNPTVVRVAEAAVTNKSATLFGGVAVLDDPLTVGPEPSSKLVG  98

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +S  E+   M+ NF F  GKYNGS+LSV+G N ++ + REM I+GGSG+FR 
Sbjct  99   RAQGMYASASQKELGLLMVMNFAFMEGKYNGSTLSVLGRNTIFSKVREMPIIGGSGVFRY  158

Query  192  ARG  184
            ARG
Sbjct  159  ARG  161



>gb|KCW90335.1| hypothetical protein EUGRSUZ_A02479, partial [Eucalyptus grandis]
Length=184

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHF+ +    G NP  VLVA++  T  S T FGA+ V+D P+T GPE +S  +G
Sbjct  41   KEKLSHLHFYLHDVVSGRNPTAVLVAEAKTTNTSATGFGAIVVIDDPLTEGPEASSKIVG  100

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y+ +SL+E    M+ N+VFT GKYNGS+LSV+G N V+   REM IVGGS LFR 
Sbjct  101  RAQGLYSSASLNEAGLLMVQNYVFTEGKYNGSTLSVLGRNAVFSSMREMPIVGGSRLFRF  160

Query  192  ARGILTIKTMWWNVTTKLGDTVIE  121
            ARG    +T   N  T  GD V+E
Sbjct  161  ARGYAQARTHTVNPHT--GDAVVE  182



>ref|XP_002276722.1| PREDICTED: dirigent protein 23-like [Vitis vinifera]
Length=184

 Score =   136 bits (342),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = -1

Query  594  PEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDG  415
            P+++K W  +L +  Q  T+L F+F+ T  G  P  V VAQ++ T KSPTLFGA+ + D 
Sbjct  22   PQDLK-WAKRLDSGGQPTTNLQFYFHDTLSGKTPTAVRVAQASQTDKSPTLFGALLMADD  80

Query  414  PVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEH  235
            P+T GP+ +S  +GR QG Y  +S +     M  ++ F  G YNGSS+SV+G N   +  
Sbjct  81   PLTEGPDLSSKLVGRAQGLYGSASQEGFGLIMALSYGFCDGIYNGSSISVLGLNQALNPV  140

Query  234  REMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            RE+ +VGG+G+FR+ARG    +T W++  T  GD ++  +V + HY
Sbjct  141  RELPVVGGTGVFRMARGFAEARTHWFDPAT--GDAIVAYNVTVFHY  184



>ref|XP_010520009.1| PREDICTED: dirigent protein 22-like [Tarenaya hassleriana]
Length=190

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 111/184 (60%), Gaps = 5/184 (3%)
 Frame = -1

Query  639  LIVF--ATKLAHGTAQGPEEVKQWF-AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQS  469
            LI+F  A  LA G+++  +  K    + L   ++K++ LHF+F+    G NP  V VA +
Sbjct  9    LIIFTLAFCLALGSSKSHKYSKTISPSSLGLKKEKLSHLHFYFHDVLSGQNPTAVRVAAA  68

Query  468  NVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGK  289
             +T  S + FG++ +MD P+T+ P+  S  +G  QG YA +S  E+   M+ NFVF  GK
Sbjct  69   AMTNTSRSFFGSVMMMDDPLTLLPDPKSKTIGYAQGIYASASQTEVGLLMVLNFVFKEGK  128

Query  288  YNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVM  109
            YNGS+LSV+G N V+   REM IVGGSG FR ARG    KT   ++ T  GD V+E +V 
Sbjct  129  YNGSTLSVLGRNAVFSGIREMPIVGGSGAFRFARGYAKAKTHSLDMNT--GDAVVEYNVY  186

Query  108  LLHY  97
             LHY
Sbjct  187  ALHY  190



>gb|EYU28943.1| hypothetical protein MIMGU_mgv1a014280mg [Erythranthe guttata]
Length=194

 Score =   136 bits (343),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 100/181 (55%), Gaps = 0/181 (0%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEKL    IL + LI  A   +       +E  +WF      +QK   L F+      G 
Sbjct  1    MEKLCRVLILCLLLISAAHATSRRREAKEDEADKWFKSFSQQKQKFAKLRFYIQDKLGGP  60

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            N     VA++ +TA SPT+FG + V+D  +T  P+RNS+++GR QG  A S L   + TM
Sbjct  61   NATIWEVARAEITATSPTMFGQVRVLDDLITAEPDRNSAKVGRAQGHIASSDLTTSALTM  120

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              NFVFT GKYNGS+L ++G NP+    RE+ +VGG+G+FR+ARG     T  ++     
Sbjct  121  NLNFVFTAGKYNGSTLCILGQNPIGSSDRELPVVGGTGVFRMARGFSISNTYSYDAVEDY  180

Query  138  G  136
            G
Sbjct  181  G  181



>ref|XP_006423625.1| hypothetical protein CICLE_v10030326mg [Citrus clementina]
 gb|ESR36865.1| hypothetical protein CICLE_v10030326mg [Citrus clementina]
Length=189

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 114/198 (58%), Gaps = 18/198 (9%)
 Frame = -1

Query  672  KLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAK---LPTLRQKVTDLHFFFYTTTVG  502
            KLT   +L V + +     AHG         Q+++K      ++++VT+LHFFF+    G
Sbjct  4    KLTLAWVLTVCVTI-TWAAAHG---------QYYSKTVPYSPMKEQVTNLHFFFHDILGG  53

Query  501  ANPNDVLVAQSNVTA---KSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEI  331
             NP+ VLVA++  T    KSPT F  +  +D P+T+GPE  S  +G  QG YA +  D +
Sbjct  54   KNPSAVLVAKAKNTTIGDKSPTPFSTVFAVDDPLTVGPELTSEVIGNCQGLYASTGQDNL  113

Query  330  SFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNV  151
            S  + F+F FT G++NGS++SV   NPV    RE+ +VGG G FR+ARG   +KT   N 
Sbjct  114  SLVVYFDFGFTKGEFNGSAISVFSRNPVLETERELAVVGGRGKFRMARGFAQLKTFSVNQ  173

Query  150  TTKLGDTVIECDVMLLHY  97
            T   GD ++E +V + HY
Sbjct  174  TN--GDAIVEYNVTVFHY  189



>ref|XP_007162357.1| hypothetical protein PHAVU_001G145100g [Phaseolus vulgaris]
 gb|ESW34351.1| hypothetical protein PHAVU_001G145100g [Phaseolus vulgaris]
Length=192

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 96/152 (63%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ LHFFF+    G NP  V VA++  T  S TLFG +A++D P+T+GPE  S  +G
Sbjct  43   KEKLSHLHFFFHDIVSGPNPTAVRVAEAASTNSSSTLFGFVAMVDDPLTVGPEPGSKLVG  102

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QG Y  ++  E    M+ N VFT GKYNGS+LS++G N V+   REM IVGGS  FR 
Sbjct  103  KAQGVYGSAAQTETGLLMVMNLVFTEGKYNGSTLSLLGRNAVFSTVREMPIVGGSKAFRF  162

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT  ++   K GD V+E +V + HY
Sbjct  163  ARGYAQAKTHTFD--PKTGDAVVEYNVYVFHY  192



>ref|XP_006492823.1| PREDICTED: dirigent protein 11-like [Citrus sinensis]
Length=193

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 95/152 (63%), Gaps = 4/152 (3%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K++ LHF+F+    G N   V VAQ+ +T  S T FGA+ +MD P+TI PE +S  +G
Sbjct  46   REKLSHLHFYFHDIVGGPNTTTVRVAQAAMTNTSSTFFGAVVMMDDPLTIHPELSSKLVG  105

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG YA +SL E+ F M+ NF FT GKYNGS+LSV+G N      REM IVGGSGLFR 
Sbjct  106  RAQGIYASASLSELGFLMVMNFAFTEGKYNGSTLSVLGRNTPLSTVREMPIVGGSGLFRF  165

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T   +        V+E +V + HY
Sbjct  166  ARGYAQARTHTIDSEV----AVVEYNVYVFHY  193



>gb|AAZ20288.1| disease resistance-responsive family protein [Arachis hypogaea]
Length=203

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 110/187 (59%), Gaps = 4/187 (2%)
 Frame = -1

Query  675  EKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLR-QKVTDLHFFFYTTTVGA  499
            + LT+ + L V   +F++ +   TA+ P   +        LR +K++ LHF+F+    G 
Sbjct  3    KTLTFFSTLTVLFFLFSSYV---TAKQPRFYRSISPTSLGLRKEKLSHLHFYFHDIVSGP  59

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
             P  + VA++ VT  SPTLFGA+ ++D P+T+GPE  S  +G+ QG YA +S +++   M
Sbjct  60   KPTAIRVAEAQVTKHSPTLFGAVVMIDDPLTVGPEPTSKLVGKAQGIYASASQNDMGLLM  119

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
            + N  F+ GKYNGS+LS++G N V H  REM IVGGSGLFR A G    KT W     + 
Sbjct  120  VMNLEFSEGKYNGSTLSLLGRNAVLHTIREMPIVGGSGLFRFAHGYAQAKTHWDQYHFRG  179

Query  138  GDTVIEC  118
                ++C
Sbjct  180  RHCRVQC  186



>ref|XP_006851942.1| hypothetical protein AMTR_s00041p00180140 [Amborella trichopoda]
 gb|ERN13409.1| hypothetical protein AMTR_s00041p00180140 [Amborella trichopoda]
Length=174

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = -1

Query  579  QWFAKLPTLRQKVTDLHFFFYTTTVGA-NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTI  403
             W   L   ++KV+ LHF+F+    G  N   ++VA ++ T  SPT FG + V+D P+T 
Sbjct  15   DWKKSLGLGKEKVSYLHFYFHDIASGTKNAMALIVAMADTTITSPTFFGMLNVVDDPLTQ  74

Query  402  GPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMV  223
            GP   S  +GR  G YAL+S  E S  M  NF+FT G++NGS+L+++G NP     REM 
Sbjct  75   GPAITSKVIGRMPGIYALASQPEFSLFMGLNFLFTTGEFNGSTLTMIGRNPTMENVREMS  134

Query  222  IVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            IVGGSG FRLARG L  KT   N  T+    V+EC+  ++HY
Sbjct  135  IVGGSGAFRLARGFLLAKTYSANTVTR--SFVVECEFTVIHY  174



>ref|XP_006495161.1| PREDICTED: dirigent protein 4-like [Citrus sinensis]
 ref|XP_006495201.1| PREDICTED: dirigent protein 4-like [Citrus sinensis]
Length=189

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 114/198 (58%), Gaps = 18/198 (9%)
 Frame = -1

Query  672  KLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAK---LPTLRQKVTDLHFFFYTTTVG  502
            KLT   +L V + +     AHG         Q+++K      ++++VT+LHFFF+    G
Sbjct  4    KLTLAWVLTVCVTI-TWAAAHG---------QYYSKTVPYSPMKEQVTNLHFFFHDILGG  53

Query  501  ANPNDVLVAQSNVTA---KSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEI  331
             NP+ VLVA++N T    KSPT F  +  +D P+T GPE  S  +G  QG YA +  D +
Sbjct  54   KNPSAVLVAKANNTTIGDKSPTPFSTVFAVDDPLTAGPELTSEVIGNCQGLYASTGQDNL  113

Query  330  SFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNV  151
            S  + F+F FT G++NGS++S+   NPV    RE+ +VGG G FR+ARG   +KT   N 
Sbjct  114  SLVVYFDFGFTKGEFNGSAISLFSRNPVLETERELAVVGGRGKFRMARGFAQLKTFSVNQ  173

Query  150  TTKLGDTVIECDVMLLHY  97
            T   GD ++E +V + HY
Sbjct  174  TN--GDAIVEYNVTVFHY  189



>ref|XP_007041905.1| Disease resistance response protein, putative [Theobroma cacao]
 gb|EOX97736.1| Disease resistance response protein, putative [Theobroma cacao]
Length=199

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 97/155 (63%), Gaps = 6/155 (4%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAK--SPTLFGAMAVMDGPVTIGPERNSSQL  376
            +K T LHFF +    G NP+ V+VA++N+T K  SPT FG++  +D P+ +GP+  S  +
Sbjct  47   EKKTHLHFFLHDILSGQNPSAVMVARANLTKKDDSPTPFGSLFAIDDPLRVGPDPTSKII  106

Query  375  GRFQGFYALSSLDEISFTMLF--NFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGL  202
            G  QG Y  SS D   FT++   +F FT GK+NGSS S+   NPV    RE+ IVGG G 
Sbjct  107  GNAQGLYLSSSQDASKFTIVLYADFAFTTGKFNGSSFSLFSRNPVTEADREVAIVGGRGE  166

Query  201  FRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            FR+ARG   IKT ++N TT  GD ++E  V L HY
Sbjct  167  FRMARGFAKIKTSYFNATT--GDAILEYSVTLYHY  199



>ref|XP_010090301.1| hypothetical protein L484_024966 [Morus notabilis]
 gb|EXB39271.1| hypothetical protein L484_024966 [Morus notabilis]
Length=176

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 101/166 (61%), Gaps = 4/166 (2%)
 Frame = -1

Query  588  EVKQWF--AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDG  415
            E   WF   +    ++K+ +L F+F+ T  G  P+ V VAQ+  T KSPTLFGA+ + D 
Sbjct  13   EFTIWFQSCRAEDTKEKIANLQFYFHDTLSGKTPSAVKVAQAPETDKSPTLFGALLMADD  72

Query  414  PVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEH  235
            P+T   + NS  +GR QG Y  +   E++  M  +F F  G+Y+GSS+S+ G NP  +  
Sbjct  73   PLTETSDPNSKLVGRAQGLYGSAGQHELALIMAMSFEFIEGEYSGSSISIFGRNPALNPV  132

Query  234  REMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            REM +VGG+G+FRLARG    KT W++  T  GD ++  +V +LHY
Sbjct  133  REMPVVGGTGVFRLARGYAIAKTHWYDPLT--GDAIVGYNVTVLHY  176



>gb|KHN40690.1| Disease resistance response protein 206 [Glycine soja]
Length=192

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 106/176 (60%), Gaps = 3/176 (2%)
 Frame = -1

Query  624  TKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPT  445
            + +AH T      + +    L   ++K     F+++    G NP+ V V    +   S T
Sbjct  19   STIAHDTDDFVRTLDRKMLGLDEKKEKFIHFRFYWHDAMSGRNPSSVEVVPPPL-KNSTT  77

Query  444  LFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSV  265
             FG + ++D P+T+GP+ NS  +G+ QGFYA +S  E    M  N V T GKYNGS++++
Sbjct  78   RFGLVNMLDNPLTLGPQLNSKLVGQAQGFYASTSQSEFVLLMAMNLVITEGKYNGSTITI  137

Query  264  VGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            +G NP+Y+E REM ++GGSGLFR ARG   ++T W++ +T+  D ++E +V +LHY
Sbjct  138  LGRNPIYYEEREMPVIGGSGLFRFARGYAKLRTYWFSPSTR--DAIVEYNVFVLHY  191



>ref|NP_001236063.1| uncharacterized protein LOC100305740 precursor [Glycine max]
 gb|ACU13591.1| unknown [Glycine max]
Length=192

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 106/176 (60%), Gaps = 3/176 (2%)
 Frame = -1

Query  624  TKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPT  445
            + +AH T      + +    L   ++K     F+++    G NP+ V V    +   S T
Sbjct  19   STIAHDTDDFVRTLDRKMLGLDEKKEKFIHFRFYWHDAMSGRNPSSVEVVPPPL-KNSTT  77

Query  444  LFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSV  265
             FG + ++D P+T+GP+ NS  +G+ QGFYA +S  E    M  N V T GKYNGS++++
Sbjct  78   RFGLVNMLDNPLTLGPQLNSKLVGQAQGFYASTSQSEFVLLMAMNLVITEGKYNGSTITI  137

Query  264  VGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            +G NP+Y+E REM ++GGSGLFR ARG   ++T W++ +T+  D ++E +V +LHY
Sbjct  138  LGRNPIYYEEREMPVIGGSGLFRFARGYAKLRTYWFSPSTR--DAIVEYNVYVLHY  191



>ref|XP_010930785.1| PREDICTED: dirigent protein 22-like [Elaeis guineensis]
Length=194

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 96/158 (61%), Gaps = 4/158 (3%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            A +  LRQKV+ LHF+F+    G N   V V +  +    P+ FG + +MD  +T  PE 
Sbjct  41   AHMKKLRQKVSHLHFYFHDVVSGRNATAVPVTEPVMNL--PSAFGMITMMDDLLTEAPEP  98

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +GR QG YA ++  E+   M  N VFT GKYNGS L+V+G NP + + REM +VGG
Sbjct  99   TSKAVGRAQGMYASAAQQELGLLMAMNLVFTEGKYNGSVLTVLGRNPPFQQVREMPVVGG  158

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFR ARG     T W+++  K GD V+E +V ++HY
Sbjct  159  SGLFRFARGFAQAHTHWFDL--KSGDAVVEYNVYVMHY  194



>ref|XP_002528277.1| Disease resistance response protein, putative [Ricinus communis]
 gb|EEF34115.1| Disease resistance response protein, putative [Ricinus communis]
Length=186

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 105/169 (62%), Gaps = 3/169 (2%)
 Frame = -1

Query  603  AQGPEEVKQWFAKLPTLRQK-VTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMA  427
            A+G +  K    KL T +++ VT+L F+F+    G N   + VAQS  T KSPTLFGA+ 
Sbjct  20   ARGFKLDKHMAKKLKTQKKETVTNLQFYFHDIVSGKNRTAIRVAQSADTEKSPTLFGALI  79

Query  426  VMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPV  247
            + D P+T GP+  S  +GR QG Y  +  +E+   M  N+ FT G YNGSS+S++G N  
Sbjct  80   MADDPLTEGPDPKSKLVGRAQGLYGSAGQNELCLIMAMNYAFTSGAYNGSSISILGKNSA  139

Query  246  YHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
                RE+ +VGG+G+FR+ARG    +T W+++TT  GD ++  ++ ++H
Sbjct  140  MSPVRELPVVGGTGVFRMARGYAIARTHWFDITT--GDAIVGYNLTVVH  186



>gb|KEH41749.1| disease resistance response protein [Medicago truncatula]
Length=192

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 108/196 (55%), Gaps = 6/196 (3%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLR--QKVTDLHFFFYTTTV  505
            M KL +    ++SLI F       TA+    +K        L   QK++ + F+F+    
Sbjct  1    MAKLFFSNSFLLSLISFLFITTITTAKPHSFIKTISPTTLGLHKPQKLSHIRFYFHDIIG  60

Query  504  GANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISF  325
            G N   V VA S  T KSPT FG++ +MD P+T  PE NS  +GR QG YA +S  E+ F
Sbjct  61   GKNQTAVRVASSPTTEKSPTGFGSVVMMDDPLTARPESNSEVVGRAQGIYASASQSEVGF  120

Query  324  TMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTT  145
             M+ NF FT GKYNGS+LS++G N +    REM +VGGSGLFR ARG     T   N   
Sbjct  121  LMVLNFAFTQGKYNGSNLSILGRNTIESAVREMPVVGGSGLFRFARGYAQASTHSINAL-  179

Query  144  KLGDTVIECDVMLLHY  97
               + ++E +V + HY
Sbjct  180  ---EAIVEYNVYVFHY  192



>gb|KDO36723.1| hypothetical protein CISIN_1g030123mg [Citrus sinensis]
Length=182

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 112/193 (58%), Gaps = 11/193 (6%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            M KL+   +L++S +V A  +         +   W  +L + ++  T+L F+F+ T  G 
Sbjct  1    MAKLSAVVLLLISRLVAAAAI---------QTVTWATRLESAKETTTNLQFYFHDTLSGK  51

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP+ V +AQ+  T +S TLFG + ++D P+T  P+  S  +GR QG Y  +  D++S  M
Sbjct  52   NPSAVRIAQAIDTDRSRTLFGIVMMVDDPLTETPDPQSKLVGRAQGLYGSACQDQLSLIM  111

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              +FVF  G YNGSS+S++G N   +  REM IVGG+G FRLARG    +T W +   K 
Sbjct  112  SMSFVFVDGPYNGSSISLLGNNRAMNPVREMPIVGGTGFFRLARGYAVAQTHWMDF--KT  169

Query  138  GDTVIECDVMLLH  100
            GD ++  +V ++H
Sbjct  170  GDAIVGYNVTVVH  182



>ref|XP_008245704.1| PREDICTED: dirigent protein 23 [Prunus mume]
Length=192

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 93/150 (62%), Gaps = 2/150 (1%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            + VT+L F+F+ T  G  P+ V VAQ+  T KSPTLFGA+ + D P+T  P+ NS  +GR
Sbjct  45   ETVTNLQFYFHDTVSGKTPSAVRVAQATDTEKSPTLFGALLMADDPLTETPDPNSKLVGR  104

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG Y  S   E+   M  NF FT G YNGSS+S++G N   +  REM +V G+G+FRL 
Sbjct  105  AQGLYGSSCQQELGLIMAMNFGFTDGMYNGSSISILGKNSAMNPVREMPVVAGTGVFRLG  164

Query  189  RGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            RG    KT W + TT  GD ++  +V ++H
Sbjct  165  RGYAIAKTHWIDFTT--GDAIVGYNVTVIH  192



>ref|XP_010243405.1| PREDICTED: dirigent protein 21-like [Nelumbo nucifera]
Length=154

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 96/152 (63%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K+T LHF+F+    G NP  + VA +  T +S T FG + V+D  +T  PE  S Q+G
Sbjct  5    REKITHLHFYFHDIVSGRNPTAIQVAAAASTNRSLTRFGLVVVLDDILTETPELTSRQVG  64

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG  + +S  ++S  M+ N+ FTHGKYNG++LS++G N V  E RE  +VGGSGLFR 
Sbjct  65   RAQGMCSFASQGDLSLLMVLNYAFTHGKYNGNTLSILGRNSVLSEVREKPVVGGSGLFRF  124

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT   +   K G+ V+E +V ++HY
Sbjct  125  ARGYAQAKTHTLD--PKTGNAVVEYNVFVVHY  154



>ref|XP_006851951.1| hypothetical protein AMTR_s00041p00184120 [Amborella trichopoda]
 gb|ERN13418.1| hypothetical protein AMTR_s00041p00184120 [Amborella trichopoda]
Length=179

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 97/161 (60%), Gaps = 4/161 (2%)
 Frame = -1

Query  579  QWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIG  400
             W   +   + KV+ LHF+F+    G+NP  +LVA++N T  SPT FG++ V D P+T G
Sbjct  23   DWRETVGMGQPKVSHLHFYFHEVGKGSNPTPILVAEANSTKTSPTSFGSVYVADDPLTEG  82

Query  399  PERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVI  220
            P   S  +GR QG  A  S  E S  M  NFVFT G++NGS+L+V G NP+  + REM +
Sbjct  83   PNLTSKLIGRAQGIQAACSKTEFSLIMALNFVFTDGEFNGSTLTVDGRNPILQDVREMSV  142

Query  219  VGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            VGG+G+FRLA+G   ++T         G   +E +V ++HY
Sbjct  143  VGGNGVFRLAQGYAQLRTFLL----ATGSLTVEYNVTVIHY  179



>ref|XP_008807680.1| PREDICTED: dirigent protein 22-like [Phoenix dactylifera]
Length=192

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 102/155 (66%), Gaps = 2/155 (1%)
 Frame = -1

Query  561  PTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSS  382
            P +RQK++ L  F++    G +P+ V VAQ+    +S T FG + ++D  +T+GPE  S 
Sbjct  40   PLVRQKLSHLRLFWHDVVSGPDPSAVRVAQAASANQSATGFGTLVMIDDALTLGPELTSK  99

Query  381  QLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGL  202
             +GR QGFYAL+S +E    M  NF FT GKYNGS+++++G N V+ E REM ++GGSGL
Sbjct  100  LVGRAQGFYALASKEESGLLMSMNFAFTEGKYNGSTVTILGRNTVFSEVREMPVIGGSGL  159

Query  201  FRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            FR+A+G    +T  +N   K GD V+E +V +LHY
Sbjct  160  FRMAQGYAQARTHSFN--PKTGDAVVEYNVFVLHY  192



>ref|XP_006851934.1| hypothetical protein AMTR_s00041p00176950 [Amborella trichopoda]
 gb|ERN13401.1| hypothetical protein AMTR_s00041p00176950 [Amborella trichopoda]
Length=196

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AKL     KV+ +  + +   V   P  V+VA++N T  SPTLFG + V+D P+T GPE 
Sbjct  41   AKLGLGEPKVSQIEIYMHDLLVAEKPTAVIVAEANTTKSSPTLFGQVVVVDDPMTEGPEL  100

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +G+ QG YA SS  EIS     +FVFT+ K+NGS+LSV+G NP+  + RE+ I+GG
Sbjct  101  TSKLIGKAQGLYAPSSQSEISLFEAVDFVFTYDKFNGSTLSVMGRNPILQKERELSIIGG  160

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SG FRLARG    +T  ++  T   + V+  +V ++HY
Sbjct  161  SGAFRLARGYALKQTYSFDTATL--NAVVHYNVTVIHY  196



>ref|XP_004289851.1| PREDICTED: disease resistance response protein 206-like [Fragaria 
vesca subsp. vesca]
Length=187

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 93/148 (63%), Gaps = 2/148 (1%)
 Frame = -1

Query  543  VTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQ  364
            VT+L F+F+ T  G NP+ V VAQ++ T KSPTLFGA+ + D P+T  P+ NS  LGR Q
Sbjct  42   VTNLQFYFHDTISGKNPSAVRVAQASDTEKSPTLFGALLMADDPLTETPDPNSKLLGRAQ  101

Query  363  GFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARG  184
            G Y  S   E    M  +F FT G YNGSS+S+ G NP+ +  RE+ +VGG+G+FR ARG
Sbjct  102  GMYGSSGQQEFGLIMAMSFAFTEGTYNGSSISIFGKNPITNPIRELPVVGGTGIFRSARG  161

Query  183  ILTIKTMWWNVTTKLGDTVIECDVMLLH  100
                 T W+N     GD ++  ++ ++H
Sbjct  162  YAIAHTHWFN--NDSGDAIVGYNLTVVH  187



>ref|XP_008356340.1| PREDICTED: dirigent protein 23-like [Malus domestica]
Length=192

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 110/190 (58%), Gaps = 3/190 (2%)
 Frame = -1

Query  669  LTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPN  490
            +T   +L+++++   T+ A  ++  P+  K+   +  T  + VT+L F+F+ T  G NP+
Sbjct  6    VTVMLMLIMAVVAETTEGAQSSSTQPKWAKKLKTRKKTTSETVTNLQFYFHDTVSGKNPS  65

Query  489  DVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFN  310
             V VAQ+  T KS TLFGA+ + D P+T  P+  S  +GR QG Y  S   E   TM   
Sbjct  66   AVRVAQAPETEKSLTLFGALLMADDPLTETPDPKSKLVGRAQGMYGSSGQQEFGLTMAMC  125

Query  309  FVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDT  130
            F F  G YNGSS+S+ G N   +  REM +V G+G+FRLARG    KT W+N    +GD 
Sbjct  126  FAFCDGMYNGSSISIFGKNSAMNPVREMPVVAGTGVFRLARGYAIAKTHWFNT---MGDA  182

Query  129  VIECDVMLLH  100
            ++  +V L+H
Sbjct  183  IVGYNVTLIH  192



>gb|ABD52123.1| dirigent-like protein pDIR12 [Picea glauca]
 gb|ADP55104.1| dirigent-like protein [Picea jezoensis]
 gb|ADP55105.1| dirigent-like protein [Picea jezoensis]
 gb|ADP55106.1| dirigent-like protein [Picea jezoensis]
 gb|ADP55107.1| dirigent-like protein [Picea glauca]
 gb|ADP55108.1| dirigent-like protein [Picea glauca]
 gb|ADP55109.1| dirigent-like protein [Picea glauca]
Length=184

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 94/158 (59%), Gaps = 4/158 (3%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK    R+KV+ LHF+F+    G N   V VA + +T  SPT FG++ VMD  +T GPE 
Sbjct  31   AKTKLGREKVSHLHFYFHDIVAGQNATAVQVASAPMTKSSPTGFGSVVVMDDCLTEGPEV  90

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +GR QG Y  SS +     M   FVF  GKYNGS+L+++G N    E REM IVGG
Sbjct  91   TSKVVGRAQGIYVSSSQENFHLLMASTFVFESGKYNGSTLAMIGKNAALEEVREMPIVGG  150

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFRLARG    +T   + TT     V+E +V +LHY
Sbjct  151  SGLFRLARGYALARTHSIDSTT----AVVEYNVTVLHY  184



>gb|AFK35208.1| unknown [Medicago truncatula]
 gb|KEH28825.1| disease resistance response protein [Medicago truncatula]
Length=199

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 92/146 (63%), Gaps = 2/146 (1%)
 Frame = -1

Query  534  LHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFY  355
              F+++    G NP  V V    +   S T FG++ ++D P+T+GP+ NS  +G+ QGFY
Sbjct  56   FRFYWHDIVSGKNPTSVAVVPPPMKLNSTTAFGSVRMIDNPLTLGPQLNSKIVGKAQGFY  115

Query  354  ALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILT  175
            A +  DE+   M  NF FT GKYNGS+L+++G N V+H+ REM ++GGSG FR ARG   
Sbjct  116  ASACKDEVDLLMAMNFAFTEGKYNGSTLTILGRNAVFHKVREMPVIGGSGFFRFARGYAE  175

Query  174  IKTMWWNVTTKLGDTVIECDVMLLHY  97
              T W+++  K GD ++E +V + HY
Sbjct  176  ANTHWFDI--KSGDAIVEYNVYVFHY  199



>ref|XP_006829391.1| hypothetical protein AMTR_s04829p00003930 [Amborella trichopoda]
 gb|ERM96807.1| hypothetical protein AMTR_s04829p00003930 [Amborella trichopoda]
Length=186

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 95/146 (65%), Gaps = 5/146 (3%)
 Frame = -1

Query  606  TAQGPEEVKQWFAKLPTL---RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFG  436
            +AQ    V Q F  LP     ++KV  LHFFF+ T  G NP  + VA++  T  S T FG
Sbjct  27   SAQKQSNVPQKF--LPENGFGKEKVGHLHFFFHDTLNGLNPTAIHVAEATSTKTSKTGFG  84

Query  435  AMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGY  256
            A+ ++D P+T GP  +S  LGR QGF+A ++L+E  + M FN+VF  GKY GS+LS++G 
Sbjct  85   AIVMIDDPLTEGPMLSSMLLGRAQGFFASAALEEFGYLMTFNYVFVEGKYKGSALSILGR  144

Query  255  NPVYHEHREMVIVGGSGLFRLARGIL  178
            NPV +E REM +VGGSG FR ARG+ 
Sbjct  145  NPVLNEMREMAVVGGSGAFRFARGLC  170



>ref|XP_010911804.1| PREDICTED: dirigent protein 22-like [Elaeis guineensis]
Length=185

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 97/149 (65%), Gaps = 3/149 (2%)
 Frame = -1

Query  540  TDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQG  361
            T LHFFF+    G +P  + VA+S +T  SPT FGA+ +MD P+T GPE +S  +G  QG
Sbjct  39   THLHFFFHDIVTGPSPTAMRVAESKITNTSPTGFGAVVMMDDPLTEGPESDSKIVGHAQG  98

Query  360  FYALSSLDEIS-FTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARG  184
             YAL+SLDE+    M  N  F  G++NGS+++V+G N V+++ REM +VGGSG FR ARG
Sbjct  99   MYALASLDEVGHLLMAMNLAFVDGEFNGSTITVMGRNSVFNDVREMPVVGGSGKFRFARG  158

Query  183  ILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
                +T    + T  G+ V+E DV +LH+
Sbjct  159  YALARTHTLEMLT--GNAVVEYDVYVLHH  185



>ref|NP_001241301.1| uncharacterized protein LOC100775617 precursor [Glycine max]
 gb|ACU18829.1| unknown [Glycine max]
Length=194

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++   F+++    G NP+ V V        + T FG + ++D P+T+GPE +S  +G
Sbjct  45   KEKLSHFKFYWHDIVSGRNPSSVAVVMPPTRMNTTTAFGLVNMIDNPLTLGPELSSKLVG  104

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QGFYA +S  EI   M  NF F  GKYNGS+++++G N V+H+ REM ++GGSGLFR 
Sbjct  105  KSQGFYASASQSEIGLLMAMNFAFIEGKYNGSTITILGRNCVFHKVREMPVIGGSGLFRF  164

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T W+++  K GD ++E +V ++HY
Sbjct  165  ARGYAEARTHWFDL--KAGDAIVEYNVYVMHY  194



>ref|XP_006837280.1| hypothetical protein AMTR_s02003p00008260 [Amborella trichopoda]
 gb|ERN00134.1| hypothetical protein AMTR_s02003p00008260 [Amborella trichopoda]
Length=182

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 96/162 (59%), Gaps = 3/162 (2%)
 Frame = -1

Query  579  QWFAKLPTLRQKVTDLHFFFYTTTVGA-NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTI  403
             W   L   ++KV+ LHF+F+    G  N   ++VA +N T  S T FG + V+D P+T 
Sbjct  23   DWKKSLGLGKEKVSYLHFYFHDIASGTKNATALIVAMANTTITSSTFFGMLNVVDDPLTQ  82

Query  402  GPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMV  223
            G    S  +GR QG YA +S  E S  M  NF+FT G+ NGS+L+++G NP     REM 
Sbjct  83   GRAITSKVIGRMQGIYASASQTEFSLFMGLNFLFTTGELNGSTLTMIGRNPTMENVREMS  142

Query  222  IVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            IVGGSG FRLARG L  KT   N  T+    V+ECDV ++HY
Sbjct  143  IVGGSGAFRLARGFLLAKTYSANKVTR--SFVLECDVTVIHY  182



>ref|XP_010041373.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
Length=179

 Score =   133 bits (335),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 107/184 (58%), Gaps = 10/184 (5%)
 Frame = -1

Query  648  VVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQS  469
            + +++  AT LA   A  PE+V  WF++L   + K T L F+F+ T    +P  V VA++
Sbjct  6    LTAMVATATTLAGAEADNPEKVDAWFSRLSPTKLKTTRLRFYFHDTLSAKSPTAVHVAKA  65

Query  468  NVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGK  289
             +T KS  LFGA+ ++D P+T G E  S  +G  QGFY  + L+ ++  M  N VFT   
Sbjct  66   AMTKKSRMLFGAVNIIDDPLTEGLEPESPLVGPTQGFYGSTRLESVAPLMDMNLVFTSPN  125

Query  288  YNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVM  109
            YNGS+LS++G N     ++E+ I GG+G+FRLA GI T K  +          V+E +V+
Sbjct  126  YNGSTLSILGRNLALETYQELPIAGGTGIFRLASGIATAKKYF----------VVEYNVI  175

Query  108  LLHY  97
             +HY
Sbjct  176  AMHY  179



>ref|XP_011093984.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=188

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 96/156 (62%), Gaps = 0/156 (0%)
 Frame = -1

Query  603  AQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAV  424
            +Q PE  +Q F +L   +QKV  LHFF      G++P  + VA+S++TA S T FG + V
Sbjct  16   SQSPEAEEQRFTRLLQAKQKVAKLHFFVQDALGGSSPTVLEVARSSITANSTTSFGQVRV  75

Query  423  MDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVY  244
            +D  +T  P  +S +LGR QG    S LD+ + TM  N  FT GKY GS+L +VG NP+ 
Sbjct  76   VDDLITAEPYPDSEKLGRAQGMITSSDLDKAALTMSLNLYFTCGKYKGSTLCIVGRNPLD  135

Query  243  HEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLG  136
             ++RE+ +VGG+G+FR+ARG     T  ++V T  G
Sbjct  136  RKNRELPVVGGTGVFRMARGYAISNTYSYDVDTNYG  171



>gb|KCW55492.1| hypothetical protein EUGRSUZ_I01390 [Eucalyptus grandis]
Length=174

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 89/142 (63%), Gaps = 1/142 (1%)
 Frame = -1

Query  594  PEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDG  415
            P++V  WF +L    +K T LHFF + T  G +P  V VA+  +T KSPTLF  + +MD 
Sbjct  26   PKKVDNWFNRLSHAERKTTCLHFF-HDTISGKSPTAVRVAEPTITKKSPTLFRVVNMMDD  84

Query  414  PVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEH  235
            P+T G E  S  +GR QG Y  + L+ +   M  N VFT  KYNGS+LS +G NP Y  +
Sbjct  85   PLTEGLEPESPLVGRAQGLYGSAGLESLGLLMNMNLVFTSPKYNGSTLSTLGRNPAYETY  144

Query  234  REMVIVGGSGLFRLARGILTIK  169
            REM+IVGG+G  RLA GI T++
Sbjct  145  REMLIVGGTGFLRLASGIATVE  166



>ref|XP_009340248.1| PREDICTED: dirigent protein 1-like [Pyrus x bretschneideri]
 ref|XP_009340256.1| PREDICTED: dirigent protein 1-like [Pyrus x bretschneideri]
Length=171

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 100/165 (61%), Gaps = 4/165 (2%)
 Frame = -1

Query  591  EEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGP  412
            E + QW+  LP  +QK+T LHF+ +    G +   V VA ++ T+ +   FG + + D P
Sbjct  11   ENIDQWYQNLPHAQQKLTMLHFYLHEVVFGPHRTLVTVANASNTSTTAPYFGLVNIFDNP  70

Query  411  VTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHR  232
            +T GP+  S  +GR QG Y  SS +E+S     NFVFT GK++GSSL+V+G NP+    R
Sbjct  71   LTKGPKPGSKLVGRAQGLYGFSSQEEVSLLTAMNFVFTSGKHSGSSLTVLGRNPIEQSVR  130

Query  231  EMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            E+ I+ G+G+FRLA G   +KT + + +      ++E +V +LHY
Sbjct  131  ELPIIAGTGVFRLAHGFALVKTYFLDTS----GAIVEYNVTILHY  171



>gb|ADP55095.1| dirigent-like protein [Picea abies]
 gb|ADP55096.1| dirigent-like protein [Picea abies]
Length=184

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 94/158 (59%), Gaps = 4/158 (3%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK    R+KV+ LHF+F+    G N   V VA + +T  SPT FG++ VMD  +T GPE 
Sbjct  31   AKTKLGREKVSHLHFYFHDIVAGQNATAVQVASAPMTKSSPTGFGSVVVMDDCLTEGPEV  90

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +GR QG Y  SS +     M   FVF  GKYNGS+L+++G N    E REM IVGG
Sbjct  91   TSKVVGRAQGIYVSSSQENFHLLMASTFVFESGKYNGSTLAMIGKNAALEEVREMPIVGG  150

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFRLARG    +T   + TT     V+E +V +LHY
Sbjct  151  SGLFRLARGYAFARTHSIDSTT----AVVEYNVTVLHY  184



>gb|KEH28830.1| disease resistance response protein [Medicago truncatula]
Length=197

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 93/152 (61%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++   F+++    G NP  V +   +    S T FG + ++D P+T+GPE +S  +G
Sbjct  48   KEKLSHFRFYWHDVLSGKNPTSVAIIPPSSKVNSTTAFGLVNMIDNPLTLGPELSSKLVG  107

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QGFYA +S +E+ F M  NF F  GKYNGS+L++VG NP  +  REM +VGGSGLFR 
Sbjct  108  RAQGFYASASQEELGFLMTMNFAFIEGKYNGSTLTIVGRNPAINLVREMPVVGGSGLFRF  167

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG     T W  +  K GD  +E +V + HY
Sbjct  168  ARGYAQANTHW--IDFKTGDACVEYNVHVFHY  197



>gb|ADP55097.1| dirigent-like protein [Picea abies]
Length=184

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 94/158 (59%), Gaps = 4/158 (3%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK    R+KV+ LHF+F+    G N   V VA + +T  SPT FG++ VMD  +T GPE 
Sbjct  31   AKTKLGREKVSHLHFYFHDIMAGQNATAVQVASAPMTKSSPTGFGSVVVMDDCLTEGPEV  90

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +GR QG Y  SS +     M   FVF  GKYNGS+L+++G N    E REM IVGG
Sbjct  91   TSKVVGRAQGIYVSSSQENFHLLMASTFVFESGKYNGSTLAMIGKNAALEEVREMPIVGG  150

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFRLARG    +T   + TT     V+E +V +LHY
Sbjct  151  SGLFRLARGYAFARTHSIDSTT----AVVEYNVTVLHY  184



>gb|KCW44402.1| hypothetical protein EUGRSUZ_L02114 [Eucalyptus grandis]
Length=171

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 105/181 (58%), Gaps = 10/181 (6%)
 Frame = -1

Query  639  LIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVT  460
            ++  AT LA   A  PE+V  WF++L   + K T L F+F+ T    +P  V VA++ +T
Sbjct  1    MVATATTLAGAEADNPEKVDAWFSRLSPTKLKTTRLRFYFHDTLSAKSPTAVHVAKAAMT  60

Query  459  AKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNG  280
             KS  LFGA+ ++D P+T G E  S  +G  QGFY  + L+ ++  M  N VFT   YNG
Sbjct  61   KKSRMLFGAVNIIDDPLTEGLEPESPLVGPTQGFYGSTRLESVAPLMDMNLVFTSPNYNG  120

Query  279  SSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            S+LS++G N     ++E+ I GG+G+FRLA GI T K  +          V+E +V+ +H
Sbjct  121  STLSILGRNLALETYQELPIAGGTGIFRLASGIATAKKYF----------VVEYNVIAMH  170

Query  99   Y  97
            Y
Sbjct  171  Y  171



>ref|XP_010243404.1| PREDICTED: dirigent protein 22-like [Nelumbo nucifera]
Length=184

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++    +++    G+NP+ V VA +  T  S TLFG + V+D  +T GPE +S  +G
Sbjct  35   KEKLSHFRLYWHDIVGGSNPSAVQVAAAPTTNTSATLFGTVMVIDDALTEGPELSSKLVG  94

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QGFY LSS  E+   M  NF F  GKYNGS+++++G N V+ + REM ++GGSGLFR 
Sbjct  95   RAQGFYTLSSQSEVGLLMSMNFAFMEGKYNGSTITILGRNAVFTKVREMPVIGGSGLFRF  154

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG +  +T  +N+  K GD  +E ++ +LHY
Sbjct  155  ARGYVQARTHTFNL--KTGDATVEYNIYVLHY  184



>ref|XP_009346643.1| PREDICTED: dirigent protein 23 [Pyrus x bretschneideri]
Length=192

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 109/190 (57%), Gaps = 3/190 (2%)
 Frame = -1

Query  669  LTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPN  490
            +T   +L+++++   T+ A  ++  P   K+   +  T  + VT+L F+F+ T  G NP+
Sbjct  6    VTVMLMLIMAVVAATTEGAQSSSTQPNWAKKLKTRKKTRSETVTNLQFYFHDTVSGKNPS  65

Query  489  DVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFN  310
             V VAQ+  T KS TLFGA+ + D P+T  P+  S  +GR QG Y  S   E   TM   
Sbjct  66   AVRVAQAPETEKSLTLFGALLMADDPLTETPDPKSKIVGRAQGMYGSSGQQEFGLTMAMC  125

Query  309  FVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDT  130
            F F  G YNGSS+S+ G N   +  REM +V G+G+FRLARG    KT W+N    +GD 
Sbjct  126  FAFCDGIYNGSSISIFGKNSALNPVREMPVVAGTGVFRLARGYAIAKTHWFNT---MGDA  182

Query  129  VIECDVMLLH  100
            ++  +V L+H
Sbjct  183  IVGYNVTLIH  192



>ref|XP_002313729.2| hypothetical protein POPTR_0009s13340g [Populus trichocarpa]
 gb|EEE87684.2| hypothetical protein POPTR_0009s13340g [Populus trichocarpa]
Length=187

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 93/155 (60%), Gaps = 6/155 (4%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTA--KSPTLFGAMAVMDGPVTIGPERNSSQ  379
            ++KVT LHFF +    G NP+ V VA SN T   KSPT FG++  +D P+ +GPE +S  
Sbjct  35   KEKVTRLHFFLHDILSGKNPSAVKVAGSNRTEGDKSPTPFGSVYAIDDPLKVGPEPDSKT  94

Query  378  LGRFQGFYALSSLDEISFT--MLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSG  205
            +G  QG Y  SS D   FT  M  +F FT GK+ GSS SV   NPV    RE+ +VGG G
Sbjct  95   IGNAQGLYLSSSQDYSKFTIVMCVDFGFTEGKFKGSSFSVFSRNPVTEADREVAVVGGRG  154

Query  204  LFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
             FR+ARG   +KT  +N T   GD V+E  V L+H
Sbjct  155  KFRMARGFAKVKTSHFNATN--GDAVLEYKVTLIH  187



>ref|XP_010520657.1| PREDICTED: dirigent protein 22-like [Tarenaya hassleriana]
Length=194

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 95/152 (63%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
             +K+T + F+F+    G NP  V VA+++ T  S TLFG + VMD P+TI P+  S  +G
Sbjct  45   EEKLTHIKFYFHDIVSGRNPTAVRVAEADYTNASRTLFGDVMVMDDPLTILPDPASETVG  104

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
              QG Y  +S  E+S  M+ NF F  G +NGSSLSV+G N V+   REM IVGG+G FR 
Sbjct  105  YAQGMYVSASRTELSLLMVLNFAFKGGDFNGSSLSVLGRNAVFSGVREMPIVGGNGAFRF  164

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT  +++  K GD V+E DV ++HY
Sbjct  165  ARGYAQAKTYSFDL--KTGDAVVEYDVYVMHY  194



>gb|ADP55098.1| dirigent-like protein [Picea mariana]
 gb|ADP55099.1| dirigent-like protein [Picea mariana]
 gb|ADP55100.1| dirigent-like protein [Picea mariana]
Length=184

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 93/158 (59%), Gaps = 4/158 (3%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK    R+KV+ LHF+F+    G N   V VA + +T  SPT FG++ VMD  +T GPE 
Sbjct  31   AKTKLGREKVSHLHFYFHDIVAGQNATAVQVASAPMTKSSPTGFGSVVVMDDCLTEGPEV  90

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +GR QG Y  SS +     M   FVF  GKYNGS+L+++G N    E REM IVGG
Sbjct  91   TSKVVGRAQGIYVSSSQENFHLLMASTFVFESGKYNGSTLAMIGKNAALEEVREMPIVGG  150

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFRLARG     T   + TT     V+E +V +LHY
Sbjct  151  SGLFRLARGYALAHTHSIDSTT----AVVEYNVTVLHY  184



>ref|XP_010243401.1| PREDICTED: dirigent protein 22-like isoform X1 [Nelumbo nucifera]
Length=191

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            A L   ++K++    +++    G+NP+ V VA +  T  S TLFG + V+D  +T GPE 
Sbjct  36   AALGLKKEKLSHFRVYWHDVVSGSNPSAVQVAAAPTTNTSATLFGTVFVIDDALTEGPEL  95

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
            +S  +GR QGFY LSS  E+   M  NF F  GKYNGS+++++G N V+ + REM ++GG
Sbjct  96   SSKLVGRAQGFYTLSSQSEVGLLMAMNFAFMEGKYNGSTITILGRNAVFTKVREMPVIGG  155

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFR ARG +  +T  +N   K GD  +E ++ +LHY
Sbjct  156  SGLFRFARGYVQARTHTFN--PKTGDATVEYNIYVLHY  191



>ref|XP_009791434.1| PREDICTED: dirigent protein 23-like [Nicotiana sylvestris]
Length=184

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 110/194 (57%), Gaps = 11/194 (6%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            MEK T   +LV ++I     L+ G  Q     + W  ++    + VT L F+F+    G+
Sbjct  1    MEKRTLLVVLVATII----SLSQGQNQ-----ESWAKRVEAGNEVVTTLQFYFHDILSGS  51

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP+ V +AQ   T  S T+FGA+ ++D P+TIGP+  S  +GR +G Y  +   ++   M
Sbjct  52   NPSAVRIAQGTSTNNSGTIFGALMMVDDPLTIGPDPRSKIVGRARGMYGFAGQTDLGLIM  111

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
            +FN+ F  G Y G S S++  NP  +  REM +VGG+GLFRLARG    +T  ++ TT  
Sbjct  112  VFNYGFIDGIYQGGSFSLLSINPALNPVREMAVVGGTGLFRLARGYAIAQTYSFDATT--  169

Query  138  GDTVIECDVMLLHY  97
            GD ++  +V L+ Y
Sbjct  170  GDAIVGYNVTLVTY  183



>ref|XP_007134633.1| hypothetical protein PHAVU_010G063400g [Phaseolus vulgaris]
 gb|ESW06627.1| hypothetical protein PHAVU_010G063400g [Phaseolus vulgaris]
Length=192

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++   F+++    G NP  V V    +   + T FG + ++D P+T+GPE +S  +G
Sbjct  43   KEKLSHFKFYWHDIVGGRNPTSVAVVPPTLKLNTTTAFGLVNMIDNPLTLGPELSSKLVG  102

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QGFYA +S  EI   M  NF F+ GKYNGS+++++G N V+++ REM ++GGSGLFR 
Sbjct  103  KAQGFYASASQSEIDLLMAMNFAFSEGKYNGSTITILGRNCVFNKVREMPVIGGSGLFRF  162

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    +T W+N+  K GD  +E +V ++HY
Sbjct  163  ARGYAEARTHWFNL--KSGDATVEYNVYVMHY  192



>ref|XP_010024277.1| PREDICTED: dirigent protein 21-like [Eucalyptus grandis]
 gb|KCW90340.1| hypothetical protein EUGRSUZ_A02486 [Eucalyptus grandis]
Length=192

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            +K+T L F+ +      +P  V VAQ+  T  S T FG + VMD P+T+GP+ NS+ +GR
Sbjct  44   EKMTHLRFYLHDIVTAQHPTAVPVAQAATTNTSSTFFGLVMVMDDPLTVGPDLNSTLVGR  103

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG +  SS  E+S TM  N VFT G Y GS+LSV+  N +    RE+ IVGG+G+FR A
Sbjct  104  AQGMFVKSSQSELSLTMTMNLVFTEGAYKGSTLSVLAQNLILKNPRELAIVGGTGVFRFA  163

Query  189  RGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            RG + ++T   N+TTK  + +++ D   LHY
Sbjct  164  RGYIQLRTHTINMTTK--NAIVKYDAYALHY  192



>ref|XP_011046639.1| PREDICTED: dirigent protein 4-like [Populus euphratica]
Length=187

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 94/155 (61%), Gaps = 6/155 (4%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTA--KSPTLFGAMAVMDGPVTIGPERNSSQ  379
            ++KVT LHFF +    G NP+ V VA SN T   KSPT FG++  +D P+ +GPE +S  
Sbjct  35   KEKVTRLHFFLHDILSGKNPSAVKVAGSNRTEGDKSPTPFGSVYAIDDPLKVGPEPDSKT  94

Query  378  LGRFQGFYALSSLDEISFT--MLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSG  205
            +G  QG Y  SS D   FT  M  +F FT GK+ GSS SV   NPV    RE+ +VGG G
Sbjct  95   IGNAQGLYLSSSQDYSKFTIVMCVDFGFTKGKFKGSSFSVFSRNPVTEADREVAVVGGRG  154

Query  204  LFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
             FR+ARG   +KT ++N T   GD V+E  V L++
Sbjct  155  KFRMARGFAKVKTSYFNATN--GDAVLEYKVTLIY  187



>ref|XP_008457663.1| PREDICTED: dirigent protein 23-like [Cucumis melo]
 gb|ADN34005.1| disease resistance response protein [Cucumis melo subsp. melo]
Length=184

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 96/151 (64%), Gaps = 3/151 (2%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            +Q VT++ F+F+ T  G  P+ + VA++  ++KSPTLFGA+ + D P+T  P+  S ++G
Sbjct  37   KQTVTNIQFYFHDTVSGKTPSAIKVAEAPTSSKSPTLFGALFIADDPLTESPDPKSKEVG  96

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QG Y  ++  EI   M   + FT G++ GSS+ V+G N V H  RE+ +VGG+G+FR 
Sbjct  97   RAQGLYGSAAQQEIGLMMALTYEFTAGEFKGSSIVVLGKNSVMHTVRELPVVGGTGVFRF  156

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            ARG    +T W+N    LGD ++  +V ++H
Sbjct  157  ARGYAEARTYWFNT---LGDAIVGYNVTVIH  184



>ref|XP_008384408.1| PREDICTED: dirigent protein 22-like [Malus domestica]
 ref|XP_008349419.1| PREDICTED: dirigent protein 22-like [Malus domestica]
Length=193

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 115/192 (60%), Gaps = 7/192 (4%)
 Frame = -1

Query  669  LTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLR-QKVTDLHFFFYTTTVGANP  493
            L  + I++  L  FA  L HG  Q  + V+    KL  L+ +K +    +++    G NP
Sbjct  8    LATQFIILSLLSSFALILVHGEDQ--DFVRALDRKLLGLKKEKFSHFKMYWHDIYSGKNP  65

Query  492  NDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLF  313
            + V V   N    S TLFG+++++D P+T GPE +S  LG+ QGFYA +S  E+   M  
Sbjct  66   SAVGVV--NPPINSSTLFGSVSMIDDPLTEGPESSSKLLGKAQGFYASASQKEVGLLMAM  123

Query  312  NFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGD  133
            NF F  GKYNGS+++++G N V+ + REM ++GGSGLFR ARG +   T  +N TT  GD
Sbjct  124  NFHFNQGKYNGSTITILGRNQVFDKVREMPVIGGSGLFRFARGYVQASTHTFNPTT--GD  181

Query  132  TVIECDVMLLHY  97
             V+E ++ +LHY
Sbjct  182  AVVEYNIYVLHY  193



>gb|ABR27717.1| dirigent-like protein [Picea sitchensis]
 gb|ACN39977.1| unknown [Picea sitchensis]
Length=184

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 94/158 (59%), Gaps = 4/158 (3%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK    R+KV+ LHF+F+    G N   V VA + +T  SPT FG++ VMD  +T GPE 
Sbjct  31   AKTKLGREKVSHLHFYFHDIVAGQNATAVQVASAPMTKSSPTGFGSVVVMDDCLTEGPEV  90

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +GR QG Y  SS +     M   FVF  GKYNGS+L+++G N    E REM IVGG
Sbjct  91   TSKVVGRAQGIYVSSSQENFHLLMASTFVFESGKYNGSTLAMIGKNAALEEVREMPIVGG  150

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFRLA+G    +T   + TT     V+E +V +LHY
Sbjct  151  SGLFRLAQGYALARTHSIDSTT----AVVEYNVTVLHY  184



>ref|XP_002276417.3| PREDICTED: dirigent protein 22-like [Vitis vinifera]
 emb|CBI29979.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 96/146 (66%), Gaps = 2/146 (1%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            +K++ LHF+F+      NP  V VA++ ++    T FG + VMD P+T+GPE +S  +GR
Sbjct  73   EKLSHLHFYFHDIVTDPNPTTVRVAEATMSNTLVTTFGDVFVMDDPLTVGPEPSSKLVGR  132

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG YA +  +E+   M+ NF F  GKYNGS+LSV+G N ++ E REM I+GGSGLFR A
Sbjct  133  AQGIYASAWQEEVGLLMVMNFAFMEGKYNGSTLSVLGRNTIFSEVREMPIIGGSGLFRFA  192

Query  189  RGILTIKTMWWNVTTKLGDTVIECDV  112
            RG +  +T  +NV  K G+ V+E +V
Sbjct  193  RGYVEARTHSFNV--KSGNAVVEYNV  216



>ref|XP_006851952.1| hypothetical protein AMTR_s00041p00184770 [Amborella trichopoda]
 gb|ERN13419.1| hypothetical protein AMTR_s00041p00184770 [Amborella trichopoda]
Length=179

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 105/183 (57%), Gaps = 10/183 (5%)
 Frame = -1

Query  645  VSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSN  466
            V+L++F   +A   A        W   +   + KV+ LHF+F     G NP  VLVA+ N
Sbjct  7    VALLLFFLAIATSMA------DDWRETVGMGQPKVSHLHFYFQGVLTGPNPTSVLVAELN  60

Query  465  VTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKY  286
             T  SPT FG++ V D  +T GP   S  +G  QG   +SS  E+S TM  NFVFT G++
Sbjct  61   STQASPTSFGSIYVHDDLLTEGPNLTSKLIGTVQGIEVVSSQTELSVTMALNFVFTDGEF  120

Query  285  NGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVML  106
            NGS+L+VVG NP+  + REM +VGG+G FRLA+G   ++T+        G   +E +V +
Sbjct  121  NGSTLTVVGRNPILQDVREMSVVGGNGAFRLAQGYAQLRTILL----ATGSLTVEYNVTV  176

Query  105  LHY  97
            +HY
Sbjct  177  IHY  179



>ref|XP_008799043.1| PREDICTED: dirigent protein 21-like [Phoenix dactylifera]
Length=183

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 95/149 (64%), Gaps = 3/149 (2%)
 Frame = -1

Query  540  TDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQG  361
            T LHFFF+    G  P  + VA+S++T  SPT FGA+ +MD P+T GPE +S  +G  QG
Sbjct  37   THLHFFFHDIVTGPRPTAMRVAESSITNTSPTGFGAVMMMDDPLTEGPEADSKLVGHAQG  96

Query  360  FYALSSLDEIS-FTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARG  184
             YA +SLDE+    M  N  F  G++NGS+++V+G N V+ + REM +VGGSG FR ARG
Sbjct  97   MYATASLDELGHLLMAMNLAFVDGEFNGSAITVMGRNSVFDDVREMPVVGGSGKFRFARG  156

Query  183  ILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
                KT    + T  G+ V+E DV +LH+
Sbjct  157  YALAKTHTLEMLT--GNAVVEYDVYVLHH  183



>gb|ADP55101.1| dirigent-like protein [Picea omorika]
 gb|ADP55102.1| dirigent-like protein [Picea omorika]
 gb|ADP55103.1| dirigent-like protein [Picea omorika]
Length=184

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 93/158 (59%), Gaps = 4/158 (3%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK    R+KV+ LHF+F+    G N   V VA + +T  SPT FG++ VMD  +T GPE 
Sbjct  31   AKTKLGREKVSHLHFYFHDIVAGQNATAVQVASAPMTKSSPTGFGSVVVMDDCLTEGPEV  90

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +GR QG Y  SS +     M   FVF  GKYNGS+L+++G N    E REM IVGG
Sbjct  91   TSKVVGRAQGIYVSSSQENFHLLMASTFVFESGKYNGSTLAMIGKNAALEEVREMPIVGG  150

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFRLARG     T   + T+     V+E +V +LHY
Sbjct  151  SGLFRLARGYALAHTHSIDSTS----AVVEYNVTVLHY  184



>ref|XP_004514254.1| PREDICTED: disease resistance response protein 206-like [Cicer 
arietinum]
Length=202

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 95/152 (63%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++   F+++    G NP  + +    +   + T FG + ++D P+T+GP+ +S  +G
Sbjct  53   KEKLSHFKFYWHDILSGKNPTTITINPPTLKLNTSTAFGLVNMIDNPLTLGPQLSSKLVG  112

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QGFYA +S DE+   M  NF F  GKYNGS++S++G NP +H  REM ++GGSGLFR 
Sbjct  113  KAQGFYASTSKDELGLFMAMNFAFIEGKYNGSTISIMGRNPAFHNVREMPVIGGSGLFRF  172

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG +   T W++   K GD  ++ +V + HY
Sbjct  173  ARGYVQAHTYWFDY--KSGDACVQYNVYVFHY  202



>ref|XP_010416851.1| PREDICTED: dirigent protein 23-like [Camelina sativa]
Length=187

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 112/193 (58%), Gaps = 11/193 (6%)
 Frame = -1

Query  675  EKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLP-TLRQKVTDLHFFFYTTTVGA  499
            E L+   +L+++++  A       AQG   +  W  +L  T ++KVT+L F+F+ T  G 
Sbjct  5    EDLSRMLVLLITILPLA-------AQG-SRLYSWANRLEETEKEKVTNLQFYFHDTLSGK  56

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP  V VAQ   T KSPTLFGA+ ++D  +T   +  S  +GR QG Y  S  +E+  TM
Sbjct  57   NPTAVKVAQGTDTEKSPTLFGAVFMVDDALTETADPKSKLVGRAQGLYGSSCKEEVGLTM  116

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              +F F  G Y  S++S++G N   +  REM IVGG+G+FR+ARG    +T W+++  K 
Sbjct  117  AMSFCFEDGPYKDSTISMIGKNSAMNPIREMPIVGGTGMFRMARGYAIAQTNWFDI--KT  174

Query  138  GDTVIECDVMLLH  100
            GD ++  +V + H
Sbjct  175  GDAIVGYNVTVFH  187



>ref|XP_006851937.1| hypothetical protein AMTR_s00041p00178500 [Amborella trichopoda]
 gb|ERN13404.1| hypothetical protein AMTR_s00041p00178500 [Amborella trichopoda]
Length=181

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            A+L     KV+ + F+ +   V   P  V VA++N T+ SPT+FG + + D P+T GPE 
Sbjct  26   AQLGLGEAKVSYIDFYLHDLLVADKPTAVTVAKANTTSASPTVFGEVVIADDPLTEGPEL  85

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +G+ QG YA SS  E S  M  N  FT G++NGS+L+V+G NPV  + RE+ IVGG
Sbjct  86   TSKWIGKAQGLYAFSSQSEFSLFMALNLAFTDGEFNGSTLTVIGRNPVQEKVRELSIVGG  145

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            +G FRLA G + I+T + + TT   + V+  +V ++HY
Sbjct  146  TGAFRLASGYVLIQTFFLDTTTL--NAVVHYNVTVIHY  181



>ref|XP_006464972.1| PREDICTED: dirigent protein 23-like [Citrus sinensis]
 gb|KDO36136.1| hypothetical protein CISIN_1g030136mg [Citrus sinensis]
Length=182

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 109/193 (56%), Gaps = 11/193 (6%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            M KL+    L++S +V A  +         +   W  +L + ++  T+L F+F+ T  G 
Sbjct  1    MAKLSAVVSLLISRLVAAAAI---------QTVTWATRLESAKETTTNLQFYFHDTLSGK  51

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP+ V +AQ+  T KSPTLFG + + D P+T  P+  S  +GR QG Y  +  D++S  M
Sbjct  52   NPSAVRIAQAIDTDKSPTLFGIVMMADDPLTETPDPQSKLVGRAQGLYGSACQDQLSLIM  111

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
              +FVF  G YN SS+S++G N   +  REM IVGG+G FRLARG    +T   +   K 
Sbjct  112  SMSFVFVDGPYNRSSISLLGNNRAMNPVREMPIVGGTGFFRLARGYAIAQTHRMDF--KT  169

Query  138  GDTVIECDVMLLH  100
            GD ++  +V ++H
Sbjct  170  GDAIVRYNVTVVH  182



>ref|XP_010427714.1| PREDICTED: dirigent protein 21-like [Camelina sativa]
Length=185

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            +K+T LHF+F+    G  P DVLVA+   T  S T FG +A+ D P+T GP+  S ++GR
Sbjct  38   EKLTHLHFYFHVIDSGNKPTDVLVAKGPTTNSSATNFGLVAIDDDPLTTGPDITSEEIGR  97

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG YA +  +++   M FNFVFT G+++GS++S+ G NP+  + REM IVGG+G FR  
Sbjct  98   AQGMYASADQNKVGLLMAFNFVFTKGEFSGSTISMYGRNPILSKVREMPIVGGTGAFRFG  157

Query  189  RGILTIKTMWWNVTTKLGDTVIECDVMLLH  100
            RG    KT  +N T+  G+ VI  +V + H
Sbjct  158  RGYAQAKTFVYNTTS--GNAVIVYNVYVWH  185



>gb|EYU31698.1| hypothetical protein MIMGU_mgv1a026952mg [Erythranthe guttata]
Length=150

 Score =   130 bits (326),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 96/152 (63%), Gaps = 4/152 (3%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++ L  +++    G NP  V V   N  A+    FGA+ V+D P+T+GP+  S  +G
Sbjct  3    KEKLSHLRMYWHDVVSGRNPTSVTVV--NPPARYANRFGAINVIDNPLTLGPDLRSEAVG  60

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QG YAL+S +E    M  NFVFT GKYNGS++SV+G N V  + REM +VGGSGLFR 
Sbjct  61   KAQGLYALASQEETGLLMTMNFVFTRGKYNGSTISVLGRNAVLDKVREMPVVGGSGLFRF  120

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
             RG    +T+ ++  TK GD  +E +V ++HY
Sbjct  121  GRGYAEARTIKFD--TKNGDATVEYNVYVMHY  150



>ref|XP_011080616.1| PREDICTED: dirigent protein 21-like [Sesamum indicum]
Length=186

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 8/151 (5%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            +K++ LHF+F+    G +P  + VA           FG  A++D P+T G +  S  +GR
Sbjct  44   EKMSHLHFYFHDIVSGKHPTAISVAGRK------NEFGGTAIIDDPLTEGVKHGSKVVGR  97

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG Y++SSLD  S  M+ NF FT GKYNGSSLSV+G NP     REM +VGGSGLFR A
Sbjct  98   AQGMYSMSSLDASSLLMVMNFEFTEGKYNGSSLSVLGRNPFLETVREMPVVGGSGLFRFA  157

Query  189  RGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            RG    KT+ +NV T  GD V+E +V ++H+
Sbjct  158  RGYALAKTVHYNVGT--GDAVVEYNVFVMHH  186



>ref|XP_003529182.1| PREDICTED: dirigent protein 19-like [Glycine max]
 gb|KHN12549.1| Disease resistance response protein 206 [Glycine soja]
Length=189

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 106/173 (61%), Gaps = 3/173 (2%)
 Frame = -1

Query  615  AHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFG  436
            AH T      + +    L   ++K++   F+++    G NP+ + V    +   S T FG
Sbjct  20   AHDTHDFVRTLDRKMLGLDEKQEKLSHFRFYWHDVVSGRNPSSIEVVPPPL-KNSTTSFG  78

Query  435  AMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGY  256
            ++ +++ P+T+ P+ NS  +G+ QGFYA +S  EI+  M  NF  T GKYNGS+++++G 
Sbjct  79   SVNMIENPLTLEPQLNSKLVGKAQGFYASTSQSEITLLMAMNFAITEGKYNGSTITILGR  138

Query  255  NPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            N VY + REM ++GGSGLFR ARG   ++T W++ TTK  D ++E ++ +LHY
Sbjct  139  NSVYDKEREMPVIGGSGLFRFARGYAQLRTHWFSPTTK--DAIVEYNIYVLHY  189



>gb|ABD52118.1| dirigent-like protein pDIR7 [Picea glauca]
Length=188

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 94/158 (59%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK+   R+K++ LHF+F+    G N   V VA +  T  S TLFG + VMD  +T GP  
Sbjct  33   AKVKLGREKISHLHFYFHDLVSGKNVTAVKVASAPTTNSSATLFGTVMVMDDWLTEGPAA  92

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +GR QG Y  SS ++    M   FVF  GKYNGS+L++VG N    + REM IVGG
Sbjct  93   TSKMVGRAQGIYVSSSQEKFHLLMASTFVFESGKYNGSTLAMVGKNAALEQVREMPIVGG  152

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFRLARG    +T    + T  G+ V+E +V +LHY
Sbjct  153  SGLFRLARGYALARTHSLELNT--GNAVVEYNVTVLHY  188



>ref|NP_850009.1| dirigent protein 23 [Arabidopsis thaliana]
 sp|Q84TH6.1|DIR23_ARATH RecName: Full=Dirigent protein 23; Short=AtDIR23; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAO64191.1| putative disease resistance response protein/dirigent protein 
[Arabidopsis thaliana]
 gb|AAT71988.1| At2g21100 [Arabidopsis thaliana]
 dbj|BAF00324.1| putative disease resistance response protein [Arabidopsis thaliana]
 gb|AEC07123.1| disease resistance-responsive, dirigent domain-containing protein 
[Arabidopsis thaliana]
Length=187

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 110/194 (57%), Gaps = 8/194 (4%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLP-TLRQKVTDLHFFFYTTTVG  502
            M K  Y + ++V LI+    +A G+      +  W  +L  T + KVT+L F+F+ T  G
Sbjct  1    MAKEEYVSRMLVMLIMIMPLVAQGS-----RLHSWANRLEETGKDKVTNLQFYFHDTLSG  55

Query  501  ANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFT  322
             NP  V VAQ   T KSPTLFGA+ ++D  +T   +  S  +GR QG Y  S  +E+   
Sbjct  56   KNPTAVKVAQGTDTEKSPTLFGAVFMVDDALTETADPKSKLVGRAQGLYGSSCKEEVGLI  115

Query  321  MLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTK  142
            M  +F F  G Y  S++S++G N   +  REM IVGG+G+FR+ARG    +T W++   K
Sbjct  116  MAMSFCFEDGPYKDSTISMIGKNSAMNPIREMPIVGGTGMFRMARGYAIARTNWFD--PK  173

Query  141  LGDTVIECDVMLLH  100
             GD ++  +V ++H
Sbjct  174  TGDAIVGYNVTIMH  187



>ref|XP_004514253.1| PREDICTED: disease resistance response protein 206-like [Cicer 
arietinum]
Length=199

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 96/152 (63%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            +++++   F+++    G NP  + V        S + FG + + D P+T+GPE +S  +G
Sbjct  50   KEQLSHFRFYWHDILSGKNPTSIAVVPPTSKLNSTSAFGLVDMFDNPLTLGPELSSKVVG  109

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QGFYA +S DE+   M  NF F   +YNGS++S++G N V+H+ REM I+GGSG+FR 
Sbjct  110  KSQGFYASASQDEVGLFMAMNFAFIERQYNGSTISILGRNCVFHKVREMPIIGGSGIFRF  169

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG +  KT W+++  K GD V+E +V + HY
Sbjct  170  ARGYVEAKTHWFDL--KSGDAVVEYNVYVFHY  199



>gb|ABD52114.1| dirigent-like protein pDIR3 [Picea engelmannii x Picea glauca]
Length=188

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 94/158 (59%), Gaps = 2/158 (1%)
 Frame = -1

Query  570  AKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPER  391
            AK+   R+K++ LHF+F+    G N   V VA +  T  S TLFG + VMD  +T GP  
Sbjct  33   AKVKLGREKISHLHFYFHDLVSGKNVTAVKVASAPTTNSSATLFGTVMVMDDWLTEGPAA  92

Query  390  NSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGG  211
             S  +GR QG Y  SS ++    M   FVF  GKYNGS+L++VG N    + REM IVGG
Sbjct  93   TSKMVGRAQGIYVSSSQEKFHLLMASTFVFESGKYNGSTLAMVGKNAALEQVREMPIVGG  152

Query  210  SGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            SGLFRLARG    +T    + T  G+ V+E +V +LHY
Sbjct  153  SGLFRLARGYALARTHSLELNT--GNAVVEYNVTVLHY  188



>gb|AFK45947.1| unknown [Medicago truncatula]
Length=196

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 93/152 (61%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++    +++    G NP  V +   +    S T FG ++++D P+T+GPE +S  +G
Sbjct  47   KEKLSHFKLYWHDIVSGKNPTSVAIVPPSSKVNSTTFFGLVSMIDNPLTLGPELSSKLVG  106

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QGFYA +S +EI F M  NF F  GKYNGS+++++G N   ++ REM +VGGSGLFR 
Sbjct  107  RAQGFYASASQEEIGFLMTMNFAFIEGKYNGSTITILGRNHACNKVREMPVVGGSGLFRF  166

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG     T W  +  K GD  +E +V + HY
Sbjct  167  ARGYAEATTHW--IDAKAGDACVEYNVHVFHY  196



>ref|XP_009364104.1| PREDICTED: dirigent protein 22-like [Pyrus x bretschneideri]
Length=193

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 115/192 (60%), Gaps = 7/192 (4%)
 Frame = -1

Query  669  LTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLR-QKVTDLHFFFYTTTVGANP  493
            L  + I++  L  FA  L  G  Q  + V+    KL  L+ +K +    +++    G NP
Sbjct  8    LATQFIILSLLFSFALILVQGEDQ--DFVRALDRKLLGLKKEKFSHFKMYWHDIYSGKNP  65

Query  492  NDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLF  313
            + V V   N    S TLFG+++++D P+T GPE +S  LG+ QGFYA +S  E+   M  
Sbjct  66   SAVGVV--NPPINSSTLFGSVSMIDDPLTEGPESSSKLLGKAQGFYASASQKEVGLLMAM  123

Query  312  NFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGD  133
            NF F  GKYNGS+++++G N V+++ REM ++GGSGLFR ARG +   T  +N TT  GD
Sbjct  124  NFHFNQGKYNGSTITILGRNQVFNKVREMPVIGGSGLFRFARGYVQASTHTFNPTT--GD  181

Query  132  TVIECDVMLLHY  97
             V+E ++ +LHY
Sbjct  182  AVVEYNIYVLHY  193



>gb|KEH28829.1| disease resistance response protein [Medicago truncatula]
Length=196

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 93/152 (61%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            ++K++    +++    G NP  V +   +    S T FG ++++D P+T+GPE +S  +G
Sbjct  47   KEKLSHFKLYWHDIVSGKNPTSVAIVPPSSKVNSTTFFGLVSMIDNPLTLGPELSSKLVG  106

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            R QGFYA +S +EI F M  NF F  GKYNGS+++++G N   ++ REM +VGGSGLFR 
Sbjct  107  RAQGFYASASQEEIGFLMTMNFAFIEGKYNGSTITILGRNHARNKVREMPVVGGSGLFRF  166

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG     T W  +  K GD  +E +V + HY
Sbjct  167  ARGYAEATTHW--IDAKAGDACVEYNVHVFHY  196



>ref|XP_004153955.1| PREDICTED: disease resistance response protein 206-like [Cucumis 
sativus]
 gb|KGN59273.1| hypothetical protein Csa_3G798110 [Cucumis sativus]
Length=193

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 91/152 (60%), Gaps = 2/152 (1%)
 Frame = -1

Query  552  RQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLG  373
            R+K++ LHF+F+    G NP  ++V     +  S TLFGA+ + D P+T  PE  S  LG
Sbjct  44   REKLSHLHFYFHDIVSGRNPTALIVVPPPSSNASRTLFGAVVMTDDPLTERPEIGSKLLG  103

Query  372  RFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
            + QGFYA +S  E    M+ NF F  GKYNGS LS++G N +    REM +VGG GLFR 
Sbjct  104  KAQGFYAGASKTEFGLLMVMNFAFVEGKYNGSYLSILGRNTIMSAVREMPVVGGGGLFRF  163

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT   N ++  GD V+E +V + HY
Sbjct  164  ARGYALAKTHALNFSS--GDAVVEYNVYVFHY  193



>ref|XP_010030689.1| PREDICTED: dirigent protein 23-like [Eucalyptus grandis]
 gb|KCW55493.1| hypothetical protein EUGRSUZ_I01391 [Eucalyptus grandis]
Length=186

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 101/176 (57%), Gaps = 10/176 (6%)
 Frame = -1

Query  624  TKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPT  445
            T LA   A  PE+V  WF++L   + K T L F+F+ T  G +P  V VA++ +T KS  
Sbjct  21   TTLARAEADNPEKVDAWFSRLTHTKLKTTRLRFYFHDTLSGKSPTAVCVAKAAMTKKSWM  80

Query  444  LFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSV  265
            LF A+ ++D P+T G E  S  +G  QGFY  + L+ +   M  N VFT   YN S+LS+
Sbjct  81   LFRAINIIDDPLTEGLEPESPLVGSAQGFYGSTRLESVPPLMDMNLVFTSPNYNSSTLSI  140

Query  264  VGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            +G N     +RE+ IVGG+G+FRLA GI T K  +          V+E +V+ +HY
Sbjct  141  LGRNLALETYRELPIVGGTGIFRLASGIATAKKYF----------VVEYNVIAMHY  186



>ref|XP_010024289.1| PREDICTED: dirigent protein 21-like [Eucalyptus grandis]
 gb|KCW90341.1| hypothetical protein EUGRSUZ_A02487 [Eucalyptus grandis]
Length=192

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            +K+T L F+ +      +P  V VAQ+  T  S T FG + V+D P+T+GP+ NS+ +GR
Sbjct  44   EKMTHLRFYLHDIVTAQHPTAVPVAQAATTNTSSTSFGLVLVIDDPLTVGPDLNSTLVGR  103

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG + +SS  E+S TM+ N VFT G Y GS+LSV+  N V    RE+ IVGG+G+FR A
Sbjct  104  AQGMFVMSSQSEVSLTMMMNLVFTEGAYKGSTLSVLAQNLVLKNPRELAIVGGTGVFRFA  163

Query  189  RGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            RG + ++T   N+TT   + +++ D   LHY
Sbjct  164  RGYIQLRTHTINMTTL--NAIVKYDAYALHY  192



>ref|XP_009377686.1| PREDICTED: dirigent protein 22-like [Pyrus x bretschneideri]
Length=183

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 106/187 (57%), Gaps = 17/187 (9%)
 Frame = -1

Query  618  LAHGTAQGPEE-VKQWFAKLPTLRQKVTDLHFFFYTTTVGANPNDVLVAQ----------  472
            +   T + P + + QWF  LP ++QK+T LHF+F+   +G +P  V   +          
Sbjct  1    MVQSTIENPRDNIDQWFQNLPRVKQKLTRLHFYFHDVVLGPHPTVVAGGEGTXXXXXXXX  60

Query  471  --SNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTMLFNFVFT  298
              ++ T  SPT FG + + D P+T GPE  S  +GR QG Y  +S +E+S  M  NFVF 
Sbjct  61   XNASNTFTSPTFFGRVNIFDNPLTQGPEPGSKLVGRAQGLYGFTSQEEVSLLMAMNFVFR  120

Query  297  HGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKLGDTVIEC  118
              K++ SSL+V+G N V    RE+ IVGG+G+FRLARG    K+ ++N +       +E 
Sbjct  121  SWKHSCSSLTVLGRNRVGQSVRELPIVGGTGVFRLARGFALAKSYFFNASV----ATVEY  176

Query  117  DVMLLHY  97
            +V +LHY
Sbjct  177  NVAVLHY  183



>ref|XP_009394038.1| PREDICTED: dirigent protein 23-like [Musa acuminata subsp. malaccensis]
Length=191

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            +  T LHFFF+    G NP  V +AQ++VT  SP  FGA+ +MD  +T GP+  S  LGR
Sbjct  37   ETTTHLHFFFHDIVTGPNPTAVRIAQASVTNNSPAAFGALVMMDDLLTEGPDSGSKLLGR  96

Query  369  FQGFYALSSLDEISFTML-FNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRL  193
             QG Y L+S DE    ++     F  G+YNGS+L+V+G N V    REM +VGGSG FRL
Sbjct  97   AQGVYGLASRDEPGHLLVAMTLAFVDGEYNGSTLAVLGRNSVLSAVREMPVVGGSGRFRL  156

Query  192  ARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
            ARG    KT   +V T  G+ V+E DV ++H+
Sbjct  157  ARGYALAKTHELDVAT--GNAVVEYDVYVMHH  186



>ref|XP_009404870.1| PREDICTED: dirigent protein 22-like [Musa acuminata subsp. malaccensis]
Length=178

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 95/153 (62%), Gaps = 3/153 (2%)
 Frame = -1

Query  555  LRQKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQL  376
            L++KV+ LHF+F+    G+N   V VA+    A+ PT FG + VMD  +T GPE  S  +
Sbjct  29   LKEKVSHLHFYFHDVVSGSNVTAVAVARPP-NAQPPTSFGLVMVMDDLLTEGPEPTSRPV  87

Query  375  GRFQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFR  196
            GR QG YA + L E+ F    N VF  GKY+GS L+V+G N   H  REM +VGGSGLFR
Sbjct  88   GRAQGLYAAAGLQEMGFLQAMNLVFVGGKYDGSVLTVLGRNAPLHAVREMPVVGGSGLFR  147

Query  195  LARGILTIKTMWWNVTTKLGDTVIECDVMLLHY  97
             ARG    +T   +++T  G+ ++E DV ++HY
Sbjct  148  FARGYAVARTHRLDMST--GNAIVEYDVYVMHY  178



>ref|XP_009610660.1| PREDICTED: dirigent protein 23-like [Nicotiana tomentosiformis]
Length=183

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 111/194 (57%), Gaps = 12/194 (6%)
 Frame = -1

Query  678  MEKLTYKTILVVSLIVFATKLAHGTAQGPEEVKQWFAKLPTLRQKVTDLHFFFYTTTVGA  499
            ME++    IL+V++  +A           ++ + W  ++ + ++ VT L F+F+    G+
Sbjct  1    MERIALLVILLVTIFAWAEG---------QDKESWAKRVESGKEVVTTLQFYFHDKLSGS  51

Query  498  NPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGRFQGFYALSSLDEISFTM  319
            NP+ V +AQ+  T  S T+FGA+ ++D P+TIGP+  S  LGR +G Y  +   ++   M
Sbjct  52   NPSAVRIAQAAETNNSATIFGALMMIDDPLTIGPDPTSKLLGRARGLYGSAGQTDLGLIM  111

Query  318  LFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLARGILTIKTMWWNVTTKL  139
            + N+ FT G Y GSS S++  NP  +  REM IVGG+GLFRLARG    +T   N     
Sbjct  112  VINYGFTDGIYQGSSFSLLSLNPAMNPVREMAIVGGTGLFRLARGYAIAQTYSANPN---  168

Query  138  GDTVIECDVMLLHY  97
            GD ++  +V ++ Y
Sbjct  169  GDAIVGYNVTIVTY  182



>ref|XP_007201657.1| hypothetical protein PRUPE_ppa022063mg, partial [Prunus persica]
 gb|EMJ02856.1| hypothetical protein PRUPE_ppa022063mg, partial [Prunus persica]
Length=189

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 90/146 (62%), Gaps = 2/146 (1%)
 Frame = -1

Query  549  QKVTDLHFFFYTTTVGANPNDVLVAQSNVTAKSPTLFGAMAVMDGPVTIGPERNSSQLGR  370
            + VT+L F+F+ T  G  P+ V VAQ+  T KSPTLFGA+ + D P+T  P+ NS  +GR
Sbjct  45   ETVTNLQFYFHDTLSGKTPSAVRVAQATDTEKSPTLFGALLMADDPLTETPDPNSKLVGR  104

Query  369  FQGFYALSSLDEISFTMLFNFVFTHGKYNGSSLSVVGYNPVYHEHREMVIVGGSGLFRLA  190
             QG Y  S   E+   M  NF FT G YNGSS+S++G N   +  REM +V G+G+FRL 
Sbjct  105  AQGLYGSSCQQELGLIMAMNFGFTDGMYNGSSISILGKNSAMNPVREMPVVAGTGVFRLG  164

Query  189  RGILTIKTMWWNVTTKLGDTVIECDV  112
            RG    KT W + TT  GD ++  +V
Sbjct  165  RGYAIAKTHWIDFTT--GDAIVGYNV  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1154079434412