BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8328_g2_i1 len=894 path=[1878:0-893]

Length=894
                                                                      Score     E

ref|XP_011101492.1|  PREDICTED: fructose-bisphosphate aldolase cy...    497   1e-173   
ref|XP_009617881.1|  PREDICTED: fructose-bisphosphate aldolase cy...    497   1e-173   
ref|XP_009789131.1|  PREDICTED: fructose-bisphosphate aldolase cy...    497   1e-173   
gb|EYU38615.1|  hypothetical protein MIMGU_mgv1a007931mg                498   2e-173   
ref|XP_011094409.1|  PREDICTED: fructose-bisphosphate aldolase cy...    493   7e-172   
ref|XP_004249455.1|  PREDICTED: fructose-bisphosphate aldolase cy...    491   2e-171   
ref|NP_001275267.1|  uncharacterized LOC102577842                       491   3e-171   
gb|ABB16974.1|  unknown                                                 489   1e-170   Solanum tuberosum [potatoes]
ref|XP_006481883.1|  PREDICTED: fructose-bisphosphate aldolase cy...    489   2e-170   
ref|XP_006430290.1|  hypothetical protein CICLE_v10012049mg             488   3e-170   
ref|XP_006430289.1|  hypothetical protein CICLE_v10012049mg             487   3e-170   
ref|XP_010089415.1|  Fructose-bisphosphate aldolase cytoplasmic i...    488   6e-170   
gb|KDO61040.1|  hypothetical protein CISIN_1g018326mg                   488   6e-170   
ref|XP_009778188.1|  PREDICTED: fructose-bisphosphate aldolase cy...    488   7e-170   
ref|XP_009621833.1|  PREDICTED: fructose-bisphosphate aldolase cy...    487   8e-170   
ref|XP_010243792.1|  PREDICTED: fructose-bisphosphate aldolase cy...    487   1e-169   
ref|XP_007202254.1|  hypothetical protein PRUPE_ppa007696mg             486   2e-169   
ref|XP_010036726.1|  PREDICTED: fructose-bisphosphate aldolase, c...    486   3e-169   
ref|XP_009352993.1|  PREDICTED: fructose-bisphosphate aldolase, c...    486   4e-169   
ref|XP_004246552.1|  PREDICTED: fructose-bisphosphate aldolase cy...    486   4e-169   
ref|XP_008391753.1|  PREDICTED: fructose-bisphosphate aldolase cy...    485   5e-169   
ref|XP_008241286.1|  PREDICTED: fructose-bisphosphate aldolase cy...    484   9e-169   
ref|NP_001275379.1|  fructose-bisphosphate aldolase-like protein        484   2e-168   
gb|KDP42683.1|  hypothetical protein JCGZ_23623                         484   2e-168   
gb|EPS71641.1|  fructose-bisphosphate aldolase                          483   6e-168   
ref|XP_009352992.1|  PREDICTED: fructose-bisphosphate aldolase cy...    482   9e-168   
ref|XP_008391754.1|  PREDICTED: fructose-bisphosphate aldolase cy...    482   1e-167   
ref|NP_001274769.1|  uncharacterized protein LOC102577667               482   1e-167   
emb|CDP15370.1|  unnamed protein product                                481   2e-167   
ref|XP_004143304.1|  PREDICTED: fructose-bisphosphate aldolase, c...    481   2e-167   
ref|XP_008386942.1|  PREDICTED: fructose-bisphosphate aldolase cy...    481   2e-167   
ref|XP_010278210.1|  PREDICTED: fructose-bisphosphate aldolase cy...    481   3e-167   
gb|AIX10949.1|  fructose-bisphosphate aldolase-like protein             480   7e-167   
ref|XP_009365338.1|  PREDICTED: fructose-bisphosphate aldolase cy...    479   2e-166   
ref|XP_008241287.1|  PREDICTED: fructose-bisphosphate aldolase, c...    479   2e-166   
ref|XP_008385438.1|  PREDICTED: fructose-bisphosphate aldolase cy...    478   5e-166   
gb|KFK24834.1|  hypothetical protein AALP_AA8G030900                    478   5e-166   
ref|XP_007202259.1|  hypothetical protein PRUPE_ppa007714mg             477   9e-166   
ref|XP_004137873.1|  PREDICTED: fructose-bisphosphate aldolase cy...    477   1e-165   
ref|XP_006398826.1|  hypothetical protein EUTSA_v10013921mg             476   2e-165   
ref|XP_010089414.1|  Fructose-bisphosphate aldolase, cytoplasmic ...    476   3e-165   
ref|XP_002528593.1|  fructose-bisphosphate aldolase, putative           475   5e-165   Ricinus communis
gb|KCW89239.1|  hypothetical protein EUGRSUZ_A01538                     473   5e-165   
ref|XP_009122681.1|  PREDICTED: fructose-bisphosphate aldolase, c...    474   1e-164   
ref|XP_010049816.1|  PREDICTED: fructose-bisphosphate aldolase cy...    474   2e-164   
dbj|BAE48790.1|  fructose-bisphosphate aldolase                         473   3e-164   Codonopsis lanceolata
ref|XP_008386943.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    473   3e-164   
dbj|BAL41455.1|  fructose-bisphosphate aldolase 1                       472   6e-164   
ref|XP_008442804.1|  PREDICTED: fructose-bisphosphate aldolase cy...    471   2e-163   
ref|XP_004303023.1|  PREDICTED: fructose-bisphosphate aldolase cy...    471   3e-163   
gb|AAG21429.1|AF308587_1  cytosolic aldolase                            471   3e-163   Fragaria x ananassa
ref|XP_004303022.1|  PREDICTED: fructose-bisphosphate aldolase cy...    471   3e-163   
ref|XP_009365337.1|  PREDICTED: fructose-bisphosphate aldolase, c...    470   5e-163   
ref|XP_010456383.1|  PREDICTED: fructose-bisphosphate aldolase, c...    467   7e-163   
ref|XP_011043938.1|  PREDICTED: fructose-bisphosphate aldolase cy...    469   8e-163   
ref|XP_010527812.1|  PREDICTED: fructose-bisphosphate aldolase, c...    468   2e-162   
gb|ABK96406.1|  unknown                                                 467   7e-162   Populus trichocarpa x Populus deltoides
ref|XP_003521445.1|  PREDICTED: fructose-bisphosphate aldolase, c...    466   2e-161   
gb|AGV08373.1|  fructose-bisphosphate aldolase                          465   3e-161   
ref|XP_010490860.1|  PREDICTED: fructose-bisphosphate aldolase, c...    465   4e-161   
ref|XP_010558953.1|  PREDICTED: fructose-bisphosphate aldolase, c...    465   4e-161   
gb|AAB61592.1|  fructose-biphosphate aldolase                           465   5e-161   Mesembryanthemum crystallinum
ref|XP_002283381.1|  PREDICTED: fructose-bisphosphate aldolase cy...    465   5e-161   Vitis vinifera
ref|XP_007027627.1|  Aldolase superfamily protein isoform 2             464   1e-160   
gb|KHG11048.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme     464   1e-160   
gb|KCW48359.1|  hypothetical protein EUGRSUZ_K02073                     463   2e-160   
ref|XP_002325037.1|  fructose-1 family protein                          463   2e-160   Populus trichocarpa [western balsam poplar]
gb|ABK93066.1|  unknown                                                 463   3e-160   Populus trichocarpa [western balsam poplar]
ref|XP_010543462.1|  PREDICTED: fructose-bisphosphate aldolase, c...    463   3e-160   
gb|AGB05599.1|  fructose-bisphosphate aldolase 2                        463   3e-160   
gb|KHN18736.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    463   3e-160   
gb|KHN46204.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme     463   3e-160   
emb|CAB77243.2|  fructose-bisphosphate aldolase                         463   3e-160   Persea americana
ref|XP_010912239.1|  PREDICTED: fructose-bisphosphate aldolase cy...    462   3e-160   
ref|XP_004171756.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    463   4e-160   
ref|XP_009412699.1|  PREDICTED: fructose-bisphosphate aldolase cy...    461   2e-159   
gb|KDP34381.1|  hypothetical protein JCGZ_11264                         461   2e-159   
ref|XP_002533605.1|  fructose-bisphosphate aldolase, putative           460   3e-159   Ricinus communis
emb|CDP05655.1|  unnamed protein product                                460   3e-159   
ref|XP_011048929.1|  PREDICTED: fructose-bisphosphate aldolase cy...    459   6e-159   
gb|KHN40026.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme     459   6e-159   
gb|EMT31985.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      459   6e-159   
gb|EMS60368.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      459   8e-159   
ref|XP_008442803.1|  PREDICTED: fructose-bisphosphate aldolase cy...    459   1e-158   
ref|XP_009411827.1|  PREDICTED: fructose-bisphosphate aldolase cy...    459   1e-158   
ref|XP_010552992.1|  PREDICTED: fructose-bisphosphate aldolase, c...    459   1e-158   
ref|XP_010045253.1|  PREDICTED: fructose-bisphosphate aldolase, c...    459   1e-158   
ref|XP_007141361.1|  hypothetical protein PHAVU_008G189200g             458   2e-158   
emb|CDM85268.1|  unnamed protein product                                458   2e-158   
ref|XP_010553342.1|  PREDICTED: fructose-bisphosphate aldolase, c...    458   2e-158   
ref|XP_006381780.1|  fructose-1 family protein                          458   2e-158   
ref|XP_003542562.1|  PREDICTED: fructose-bisphosphate aldolase, c...    457   4e-158   
ref|NP_001242086.1|  uncharacterized protein LOC100795446               457   4e-158   
dbj|BAJ87658.1|  predicted protein                                      457   5e-158   
ref|NP_001242367.1|  uncharacterized protein LOC100778363               457   5e-158   
gb|AFK43805.1|  unknown                                                 457   6e-158   
ref|XP_009402715.1|  PREDICTED: fructose-bisphosphate aldolase cy...    457   6e-158   
ref|XP_010927580.1|  PREDICTED: fructose-bisphosphate aldolase cy...    456   1e-157   
gb|EMS58841.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      456   1e-157   
ref|XP_010940458.1|  PREDICTED: fructose-bisphosphate aldolase cy...    456   1e-157   
gb|ACO44683.1|  fructose-bisphosphate aldolase                          456   1e-157   Secale cereale
gb|EMT05696.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      456   2e-157   
gb|AHY18973.1|  fructose-bisphosphate aldolase                          456   2e-157   
ref|XP_006291269.1|  hypothetical protein CARUB_v10017399mg             457   2e-157   
gb|EMT15181.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      456   2e-157   
ref|XP_010426925.1|  PREDICTED: fructose-bisphosphate aldolase, c...    455   3e-157   
ref|XP_002877893.1|  hypothetical protein ARALYDRAFT_906673             455   4e-157   
ref|XP_010683863.1|  PREDICTED: fructose-bisphosphate aldolase, c...    455   5e-157   
gb|KFK34541.1|  hypothetical protein AALP_AA5G159400                    455   5e-157   
ref|XP_009411974.1|  PREDICTED: fructose-bisphosphate aldolase cy...    454   5e-157   
ref|XP_006403749.1|  hypothetical protein EUTSA_v10010492mg             454   6e-157   
ref|XP_007145245.1|  hypothetical protein PHAVU_007G222900g             454   6e-157   
ref|XP_008775192.1|  PREDICTED: fructose-bisphosphate aldolase cy...    454   7e-157   
ref|XP_008797227.1|  PREDICTED: fructose-bisphosphate aldolase cy...    454   1e-156   
ref|XP_009141597.1|  PREDICTED: fructose-bisphosphate aldolase, c...    453   2e-156   
ref|XP_006410823.1|  hypothetical protein EUTSA_v10016856mg             453   2e-156   
emb|CDX78134.1|  BnaA09g33290D                                          453   2e-156   
gb|ACO44685.1|  fructose-bisphosphate aldolase                          453   3e-156   Hordeum vulgare [barley]
gb|ACO44684.1|  fructose-bisphosphate aldolase                          452   4e-156   Triticum aestivum [Canadian hard winter wheat]
emb|CDY66283.1|  BnaCnng50220D                                          452   5e-156   
gb|ACG68894.1|  fructose-biphosphate aldolase                           451   1e-155   Sesuvium portulacastrum [sea-purslane]
gb|ABK21911.1|  unknown                                                 451   1e-155   Picea sitchensis
ref|NP_181187.1|  fructose-bisphosphate aldolase 6                      451   1e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010932289.1|  PREDICTED: fructose-bisphosphate aldolase cy...    454   1e-155   
ref|XP_009115993.1|  PREDICTED: fructose-bisphosphate aldolase, c...    451   2e-155   
ref|XP_006293487.1|  hypothetical protein CARUB_v10023504mg             451   2e-155   
ref|XP_010509469.1|  PREDICTED: fructose-bisphosphate aldolase, c...    451   2e-155   
ref|NP_190861.1|  fructose-bisphosphate aldolase                        451   2e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516868.1|  PREDICTED: fructose-bisphosphate aldolase, c...    450   3e-155   
gb|KFK32724.1|  hypothetical protein AALP_AA6G280600                    450   3e-155   
ref|XP_010505193.1|  PREDICTED: fructose-bisphosphate aldolase, c...    450   4e-155   
ref|NP_850759.1|  fructose-bisphosphate aldolase 4                      449   5e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125243.1|  PREDICTED: fructose-bisphosphate aldolase, c...    449   6e-155   
gb|AGZ15378.1|  fructose-bisphosphate aldolase                          449   7e-155   
ref|XP_002881445.1|  hypothetical protein ARALYDRAFT_482625             449   8e-155   
ref|XP_007027626.1|  Aldolase superfamily protein isoform 1             450   8e-155   
gb|AAL32644.1|  fructose-bisphosphate aldolase-like protein             448   3e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288022.1|  hypothetical protein CARUB_v10001255mg             448   3e-154   
ref|NP_001045130.2|  Os01g0905800                                       447   3e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564871.1|  PREDICTED: fructose-bisphosphate aldolase cy...    447   3e-154   
gb|AAM62481.1|  fructose-bisphosphate aldolase-like protein             449   3e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006645191.1|  PREDICTED: fructose-bisphosphate aldolase cy...    447   4e-154   
gb|KEH42090.1|  fructose-bisphosphate aldolase                          447   4e-154   
ref|XP_008799938.1|  PREDICTED: fructose-bisphosphate aldolase cy...    447   6e-154   
ref|XP_002453822.1|  hypothetical protein SORBIDRAFT_04g019020          446   9e-154   Sorghum bicolor [broomcorn]
sp|P29356.1|ALF_SPIOL  RecName: Full=Fructose-bisphosphate aldola...    446   2e-153   Spinacia oleracea
sp|P17784.2|ALF_ORYSJ  RecName: Full=Fructose-bisphosphate aldola...    446   2e-153   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150049.1|  fructose-bisphosphate aldolase cytoplasmic i...    445   3e-153   Zea mays [maize]
ref|NP_001055494.1|  Os05g0402700                                       444   3e-153   Oryza sativa Japonica Group [Japonica rice]
gb|ACF79162.1|  unknown                                                 445   3e-153   Zea mays [maize]
gb|EEC79199.1|  hypothetical protein OsI_19907                          444   5e-153   Oryza sativa Indica Group [Indian rice]
ref|XP_003615520.1|  Fructose-bisphosphate aldolase                     457   6e-153   
emb|CAA37290.1|  unnamed protein product                                444   1e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002458944.1|  hypothetical protein SORBIDRAFT_03g043140          443   1e-152   Sorghum bicolor [broomcorn]
ref|NP_001105336.1|  fructose-bisphosphate aldolase, cytoplasmic ...    443   1e-152   Zea mays [maize]
dbj|BAI59774.1|  aldolase C-1                                           442   5e-152   Phyllostachys edulis [kikko-chiku]
ref|XP_004497605.1|  PREDICTED: fructose-bisphosphate aldolase, c...    442   6e-152   
ref|XP_004952502.1|  PREDICTED: fructose-bisphosphate aldolase cy...    441   1e-151   
ref|XP_004491539.1|  PREDICTED: fructose-bisphosphate aldolase, c...    441   2e-151   
gb|KCW87412.1|  hypothetical protein EUGRSUZ_B03891                     438   1e-150   
ref|XP_007142455.1|  hypothetical protein PHAVU_008G282000g             438   2e-150   
dbj|BAI59775.1|  aldolase C-2                                           437   4e-150   Phyllostachys edulis [kikko-chiku]
ref|XP_006654377.1|  PREDICTED: fructose-bisphosphate aldolase cy...    437   4e-150   
ref|NP_001237315.1|  fructose-bisphosphate aldolase                     437   6e-150   
sp|P46257.1|ALF2_PEA  RecName: Full=Fructose-bisphosphate aldolas...    437   7e-150   Pisum sativum [garden pea]
ref|XP_010545295.1|  PREDICTED: fructose-bisphosphate aldolase, c...    436   8e-150   
gb|KHG27282.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      436   8e-150   
ref|XP_003617895.1|  Fructose-bisphosphate aldolase                     436   9e-150   
ref|XP_004970966.1|  PREDICTED: fructose-bisphosphate aldolase cy...    436   2e-149   
ref|XP_003544567.1|  PREDICTED: fructose-bisphosphate aldolase, c...    435   3e-149   
gb|EAY94426.1|  hypothetical protein OsI_16195                          434   5e-149   Oryza sativa Indica Group [Indian rice]
ref|NP_001265896.1|  fructose-bisphosphate aldolase, cytoplasmic ...    434   6e-149   
ref|XP_006851631.1|  hypothetical protein AMTR_s00040p00201950          434   9e-149   
gb|ABK23585.1|  unknown                                                 434   9e-149   Picea sitchensis
sp|P46256.1|ALF1_PEA  RecName: Full=Fructose-bisphosphate aldolas...    432   2e-148   Pisum sativum [garden pea]
gb|KHN48186.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme     432   3e-148   
gb|AAR88661.1|  fructose-bisphosphate aldolase                          431   7e-148   Pandanus amaryllifolius [pandan rampeh]
gb|ABK22375.1|  unknown                                                 431   1e-147   Picea sitchensis
ref|NP_568127.1|  fructose-bisphosphate aldolase 4                      432   2e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006857683.1|  hypothetical protein AMTR_s00061p00163810          430   2e-147   
ref|XP_010448258.1|  PREDICTED: fructose-bisphosphate aldolase, c...    429   4e-147   
gb|AAR84667.1|  fructose 1,6, bisphosphate aldolase                     430   4e-147   Salicornia herbacea
gb|KFK29173.1|  hypothetical protein AALP_AA7G098900                    429   8e-147   
dbj|BAA02729.1|  cytoplasmic aldolase                                   429   9e-147   Oryza sativa Japonica Group [Japonica rice]
gb|ABG65931.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    429   9e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007020393.1|  Aldolase superfamily protein                       428   2e-146   
ref|XP_011095600.1|  PREDICTED: fructose-bisphosphate aldolase, c...    429   3e-146   
ref|XP_006474808.1|  PREDICTED: fructose-bisphosphate aldolase, c...    427   3e-146   
ref|XP_010246553.1|  PREDICTED: fructose-bisphosphate aldolase, c...    427   3e-146   
gb|AFK45996.1|  unknown                                                 425   5e-146   
ref|XP_010252855.1|  PREDICTED: fructose-bisphosphate aldolase, c...    427   5e-146   
ref|XP_009142435.1|  PREDICTED: fructose-bisphosphate aldolase, c...    427   6e-146   
ref|XP_010676114.1|  PREDICTED: fructose-bisphosphate aldolase, c...    426   1e-145   
ref|XP_002869605.1|  hypothetical protein ARALYDRAFT_492157             426   2e-145   
emb|CAN83666.1|  hypothetical protein VITISV_008795                     426   2e-145   Vitis vinifera
ref|XP_002263794.1|  PREDICTED: fructose-bisphosphate aldolase, c...    425   2e-145   Vitis vinifera
ref|XP_006284000.1|  hypothetical protein CARUB_v10005122mg             425   2e-145   
ref|XP_011037763.1|  PREDICTED: fructose-bisphosphate aldolase, c...    425   3e-145   
ref|XP_006346102.1|  PREDICTED: fructose-bisphosphate aldolase, c...    424   3e-145   
ref|XP_006661653.1|  PREDICTED: fructose-bisphosphate aldolase cy...    424   6e-145   
ref|XP_009799651.1|  PREDICTED: fructose-bisphosphate aldolase, c...    424   6e-145   
ref|XP_011000316.1|  PREDICTED: fructose-bisphosphate aldolase, c...    424   7e-145   
ref|XP_006656232.1|  PREDICTED: fructose-bisphosphate aldolase, c...    424   8e-145   
ref|XP_004139771.1|  PREDICTED: fructose-bisphosphate aldolase, c...    425   1e-144   
ref|XP_001768658.1|  predicted protein                                  423   1e-144   
ref|XP_010929015.1|  PREDICTED: fructose-bisphosphate aldolase, c...    423   1e-144   
ref|XP_004244020.1|  PREDICTED: fructose-bisphosphate aldolase, c...    423   1e-144   
ref|XP_006452682.1|  hypothetical protein CICLE_v10008762mg             423   2e-144   
ref|XP_008218850.1|  PREDICTED: fructose-bisphosphate aldolase, c...    422   3e-144   
gb|ACU16628.1|  unknown                                                 419   3e-144   Glycine max [soybeans]
ref|XP_008447787.1|  PREDICTED: fructose-bisphosphate aldolase, c...    422   3e-144   
ref|XP_007205428.1|  hypothetical protein PRUPE_ppa007744mg             422   4e-144   
ref|XP_006413170.1|  hypothetical protein EUTSA_v10025556mg             422   4e-144   
ref|XP_002299056.1|  fructose-1 family protein                          422   4e-144   Populus trichocarpa [western balsam poplar]
ref|NP_194383.1|  fructose-bisphosphate aldolase 5                      422   4e-144   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001058042.1|  Os06g0608700                                       422   5e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002519633.1|  fructose-bisphosphate aldolase, putative           422   5e-144   Ricinus communis
ref|XP_001767043.1|  predicted protein                                  421   7e-144   
ref|XP_010438739.1|  PREDICTED: fructose-bisphosphate aldolase, c...    421   7e-144   
ref|XP_008363363.1|  PREDICTED: fructose-bisphosphate aldolase, c...    421   9e-144   
emb|CDP13668.1|  unnamed protein product                                421   1e-143   
ref|XP_011039825.1|  PREDICTED: fructose-bisphosphate aldolase, c...    421   1e-143   
ref|XP_006377966.1|  fructose-1 family protein                          421   1e-143   
ref|XP_010433486.1|  PREDICTED: fructose-bisphosphate aldolase, c...    421   1e-143   
ref|XP_010103967.1|  Fructose-bisphosphate aldolase, cytoplasmic ...    421   1e-143   
ref|XP_010089412.1|  Fructose-bisphosphate aldolase cytoplasmic i...    419   2e-143   
ref|XP_008353167.1|  PREDICTED: fructose-bisphosphate aldolase, c...    420   2e-143   
ref|XP_010061415.1|  PREDICTED: fructose-bisphosphate aldolase, c...    420   2e-143   
ref|XP_004294907.1|  PREDICTED: fructose-bisphosphate aldolase, c...    420   3e-143   
emb|CDY43716.1|  BnaAnng07310D                                          419   3e-143   
ref|XP_001765506.1|  predicted protein                                  419   4e-143   
gb|ACN85267.1|  fructose-bisphosphate aldolase cytoplasmic isozyme      419   4e-143   Oryza alta
gb|EPS69505.1|  fructose-bisphosphate aldolase                          419   5e-143   
ref|XP_003563638.1|  PREDICTED: fructose-bisphosphate aldolase, c...    419   8e-143   
ref|XP_009620969.1|  PREDICTED: fructose-bisphosphate aldolase, c...    419   9e-143   
ref|XP_008355755.1|  PREDICTED: fructose-bisphosphate aldolase, c...    418   1e-142   
ref|XP_009141596.1|  PREDICTED: fructose-bisphosphate aldolase, c...    416   3e-142   
ref|XP_010424793.1|  PREDICTED: fructose-bisphosphate aldolase, c...    423   5e-142   
dbj|BAJ85287.1|  predicted protein                                      417   5e-142   
ref|XP_010942543.1|  PREDICTED: fructose-bisphosphate aldolase, c...    416   7e-142   
gb|KDP32624.1|  hypothetical protein JCGZ_13174                         416   7e-142   
emb|CBI30253.3|  unnamed protein product                                415   1e-141   
gb|ACU18090.1|  unknown                                                 412   1e-141   Glycine max [soybeans]
ref|XP_006659075.1|  PREDICTED: fructose-bisphosphate aldolase cy...    415   2e-141   
ref|XP_008782993.1|  PREDICTED: fructose-bisphosphate aldolase, c...    414   3e-141   
ref|XP_002970423.1|  hypothetical protein SELMODRAFT_267384             414   6e-141   
ref|XP_009391905.1|  PREDICTED: fructose-bisphosphate aldolase, c...    413   1e-140   
gb|EYU27475.1|  hypothetical protein MIMGU_mgv1a008862mg                412   2e-140   
ref|NP_001060880.1|  Os08g0120600                                       412   2e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004965915.1|  PREDICTED: fructose-bisphosphate aldolase, c...    411   8e-140   
ref|XP_002978503.1|  hypothetical protein SELMODRAFT_176914             410   2e-139   
emb|CDX94320.1|  BnaC01g18640D                                          425   1e-138   
gb|ACN85313.1|  fructose-bisphosphate aldolase cytoplasmic isozyme      408   1e-138   Oryza brachyantha
ref|XP_002969534.1|  hypothetical protein SELMODRAFT_231316             408   1e-138   
ref|XP_002986752.1|  hypothetical protein SELMODRAFT_425653             407   2e-138   
gb|KHN43919.1|  Uridine kinase-like protein 4                           422   4e-138   
ref|XP_001759800.1|  predicted protein                                  403   7e-137   
ref|XP_010438740.1|  PREDICTED: fructose-bisphosphate aldolase, c...    403   9e-137   
gb|EMT11738.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    403   1e-136   
gb|KHN23819.1|  Uridine kinase-like protein 4                           419   4e-136   
ref|XP_010448259.1|  PREDICTED: fructose-bisphosphate aldolase, c...    400   1e-135   
gb|AES98478.2|  fructose-bisphosphate aldolase                          400   3e-135   
ref|XP_002437265.1|  hypothetical protein SORBIDRAFT_10g023850          399   6e-135   Sorghum bicolor [broomcorn]
ref|XP_008360651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    415   1e-134   
gb|AFK34312.1|  unknown                                                 393   2e-134   
ref|XP_010089409.1|  Fructose-bisphosphate aldolase cytoplasmic i...    396   3e-134   
ref|XP_010433490.1|  PREDICTED: fructose-bisphosphate aldolase, c...    397   7e-134   
ref|XP_002869606.1|  fructose-bisphosphate aldolase, cytoplasmic        394   2e-133   
gb|ACG27929.1|  fructose-bisphosphate aldolase, cytoplasmic isozy...    394   7e-133   Zea mays [maize]
ref|NP_194382.1|  fructose-bisphosphate aldolase 7                      392   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285375.1|  hypothetical protein CARUB_v10006772mg             391   5e-132   
emb|CAA37226.1|  fructose 1,6-diphosphate aldolase                      390   1e-131   Arabidopsis thaliana [mouse-ear cress]
gb|AAM81205.1|AF521254_1  fructose-1,6-diphosphate aldolase             387   3e-131   Metasequoia glyptostroboides
gb|EEE65995.1|  hypothetical protein OsJ_21934                          392   2e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007207750.1|  hypothetical protein PRUPE_ppa1027146mg            383   1e-128   
gb|KDO37191.1|  hypothetical protein CISIN_1g016748mg                   376   8e-126   
gb|KDD75884.1|  class-I fructose-bisphosphate aldolase                  375   8e-126   
ref|XP_005649618.1|  cytosolic aldolase                                 367   2e-122   
ref|XP_005709261.1|  fructose-bisphosphate aldolase, class I            364   2e-121   
gb|KFM23457.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    361   6e-120   
ref|XP_005843070.1|  hypothetical protein CHLNCDRAFT_59826              357   1e-118   
ref|XP_643874.1|  fructose-bisphosphate aldolase                        357   1e-118   
gb|EMS50182.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    364   1e-117   
gb|AHK23669.1|  class I fructose-1,6-bisphosphate aldolase              354   2e-117   
ref|XP_668009.1|  fructose-1,6-bisphosphate aldolase                    352   8e-117   
ref|XP_002368990.1|  fructose-bisphosphate aldolase, putative           354   2e-116   
pdb|4D2J|A  Chain A, Crystal Structure Of F16bp Aldolase From Tox...    350   4e-116   
ref|XP_628118.1|  fructose-1,6-bisphosphate aldolase                    351   4e-116   
pdb|4TU1|A  Chain A, Structure Of Toxoplasma Gondii Fructose 1,6 ...    350   4e-116   
ref|XP_008885504.1|  fructose-bisphosphate aldolase, putative           353   5e-116   
gb|ESS30966.1|  putative fructose-bisphosphate aldolase                 353   6e-116   
gb|EPR60311.1|  putative fructose-bisphosphate aldolase                 353   7e-116   
gb|AAN75043.1|  fructose-1,6-bisphosphate aldolase                      350   1e-115   
gb|EPZ31990.1|  Fructose-bisphosphate aldolase A                        350   1e-115   
ref|XP_002771038.1|  fructose-1,6-bisphosphate aldolase, putative       347   3e-115   
ref|XP_002368989.1|  fructose-1,6-bisphosphate aldolase                 350   4e-115   
ref|XP_003884639.1|  unnamed protein product                            348   7e-115   
ref|XP_002784645.1|  fructose-1,6-bisphosphate aldolase, putative       347   9e-115   
gb|AFW87253.1|  hypothetical protein ZEAMMB73_254795                    347   5e-114   
ref|XP_005833999.1|  hypothetical protein GUITHDRAFT_86602              344   2e-113   
dbj|BAA21101.1|  aldolase                                               344   2e-113   
ref|XP_001609245.1|  fructose-1,6-bisphosphate aldolase                 343   2e-113   
pdb|3KX6|A  Chain A, Crystal Structure Of Fructose-1,6-Bisphospha...    343   4e-113   
ref|XP_003391366.1|  PREDICTED: fructose-bisphosphate aldolase-like     343   5e-113   
ref|XP_002766649.1|  fructose-1,6-bisphosphate aldolase, putative       342   6e-113   
ref|XP_003385191.1|  PREDICTED: fructose-bisphosphate aldolase-like     342   7e-113   
gb|EFA78442.1|  fructose-bisphosphate aldolase                          342   1e-112   
ref|XP_002504686.1|  fructose bisphosphate aldolase class i             341   2e-112   
emb|CDI87732.1|  fructose-1,6-bisphosphate aldolase, putative           339   2e-111   
emb|CDJ89983.1|  Fructose-bisphosphate aldolase domain containing...    341   3e-111   
emb|CDJ61342.1|  fructose-1,6-bisphosphate aldolase, putative           338   3e-111   
ref|XP_002765539.1|  fructose-1,6-bisphosphate aldolase, putative       338   3e-111   
emb|CCQ42777.1|  aldolase homolog B                                     337   9e-111   
dbj|GAM21360.1|  hypothetical protein SAMD00019534_045350               337   1e-110   
ref|XP_002142255.1|  fructose-1,6-bisphosphate aldolase                 336   1e-110   
gb|ADV40150.1|  putative fructose 1,6-bisphosphate aldolase             334   2e-110   
ref|XP_002787708.1|  fructose-1,6-bisphosphate aldolase, putative       336   2e-110   
ref|XP_002775293.1|  fructose-1,6-bisphosphate aldolase, putative       336   2e-110   
emb|CDI83988.1|  fructose-1,6-bisphosphate aldolase, putative           336   3e-110   
ref|XP_002779280.1|  fructose-1,6-bisphosphate aldolase, putative       336   3e-110   
gb|AAF27640.1|AF217804_1  fructose-1,6-biphosphate aldolase             335   3e-110   
sp|Q9GP32.1|ALF_ECHMU  RecName: Full=Fructose-bisphosphate aldolase     335   3e-110   
ref|XP_002768822.1|  fructose-1,6-bisphosphate aldolase, putative       335   3e-110   
emb|CDR97813.1|  fructose-1,6-bisphosphate aldolase, putative           335   4e-110   
emb|CCQ42786.1|  aldolase homolog B                                     336   4e-110   
ref|XP_002785910.1|  fructose-1,6-bisphosphate aldolase, putative       335   5e-110   
ref|XP_008462541.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    334   7e-110   
emb|CDJ04126.1|  fructose 1,6 bisphosphate aldolase                     335   8e-110   
dbj|BAN65518.1|  fructose-1,6-bisphosphate aldolase                     337   8e-110   
ref|XP_002771316.1|  fructose-1,6-bisphosphate aldolase, putative       334   1e-109   
gb|EUB64508.1|  Fructose-bisphosphate aldolase                          333   2e-109   
gb|ABV22146.1|  fructose-1,6-bisphosphate aldolase                      333   3e-109   
gb|AFY09913.1|  aldolase                                                333   4e-109   
ref|XP_004830184.1|  fructose-bisphosphate aldolase, putative           333   4e-109   
emb|CDS26447.1|  fructose 1,6 bisphosphate aldolase                     333   4e-109   
ref|XP_003884640.1|  unnamed protein product                            332   6e-109   
gb|AFK34348.1|  unknown                                                 328   9e-109   
gb|EJY75265.1|  Fructose-bisphosphate aldolase                          332   1e-108   
emb|CDJ65822.1|  fructose-1,6-bisphosphate aldolase, putative           332   1e-108   
ref|XP_002765540.1|  fructose-1,6-bisphosphate aldolase, putative       331   2e-108   
ref|XP_010975746.1|  PREDICTED: fructose-bisphosphate aldolase B        331   2e-108   
ref|XP_002433009.1|  Fructose-bisphosphate aldolase, putative           331   2e-108   
ref|XP_009509358.1|  PREDICTED: fructose-bisphosphate aldolase B        330   4e-108   
gb|KFM60571.1|  Fructose-bisphosphate aldolase                          330   4e-108   
ref|XP_006185294.1|  PREDICTED: fructose-bisphosphate aldolase B        330   7e-108   
ref|XP_005237027.1|  PREDICTED: fructose-bisphosphate aldolase B        330   8e-108   
ref|NP_001116978.1|  fructose-bisphosphate aldolase                     330   9e-108   
emb|CAG06274.1|  unnamed protein product                                329   1e-107   
ref|XP_797465.1|  PREDICTED: fructose-bisphosphate aldolase-like        329   1e-107   
ref|XP_010149115.1|  PREDICTED: fructose-bisphosphate aldolase B        329   1e-107   
emb|CDJ40769.1|  fructose-1,6-bisphosphate aldolase, putative           329   1e-107   
ref|XP_003290851.1|  hypothetical protein DICPUDRAFT_49487              329   1e-107   
ref|XP_006204103.1|  PREDICTED: fructose-bisphosphate aldolase B        329   1e-107   
ref|XP_005535646.1|  fructose-1,6-biphosphate aldolase                  328   4e-107   
gb|EFN84597.1|  Fructose-bisphosphate aldolase                          328   5e-107   
ref|XP_009820318.1|  PREDICTED: fructose-bisphosphate aldolase B        327   5e-107   
ref|XP_006679107.1|  hypothetical protein BATDEDRAFT_35107              327   6e-107   
ref|XP_008291370.1|  PREDICTED: fructose-bisphosphate aldolase B        327   8e-107   
ref|XP_008115351.1|  PREDICTED: fructose-bisphosphate aldolase A        327   1e-106   
ref|XP_005495448.1|  PREDICTED: fructose-bisphosphate aldolase B        327   1e-106   
ref|NP_001167391.1|  fructose-bisphosphate aldolase A                   327   1e-106   
ref|XP_010411427.1|  PREDICTED: fructose-bisphosphate aldolase B        327   1e-106   
gb|AEB69935.1|  fructose-1,6-bisphosphate aldolase                      326   1e-106   
ref|XP_009972687.1|  PREDICTED: fructose-bisphosphate aldolase B        327   1e-106   
ref|XP_005534223.1|  PREDICTED: fructose-bisphosphate aldolase B        326   1e-106   
ref|XP_005062156.1|  PREDICTED: fructose-bisphosphate aldolase B        326   2e-106   
ref|XP_009877451.1|  PREDICTED: fructose-bisphosphate aldolase B        326   2e-106   
gb|EFN70147.1|  Fructose-bisphosphate aldolase                          326   2e-106   
ref|XP_009577597.1|  PREDICTED: fructose-bisphosphate aldolase B        326   2e-106   
ref|XP_001700659.1|  fructose-1,6-bisphosphate aldolase                 326   2e-106   
ref|XP_008552364.1|  PREDICTED: fructose-bisphosphate aldolase-like     326   3e-106   
ref|XP_008921944.1|  PREDICTED: fructose-bisphosphate aldolase B        326   3e-106   
ref|XP_008325304.1|  PREDICTED: fructose-bisphosphate aldolase B        326   3e-106   
ref|XP_007107408.1|  PREDICTED: fructose-bisphosphate aldolase A ...    326   3e-106   
ref|XP_010298720.1|  PREDICTED: fructose-bisphosphate aldolase B        326   3e-106   
ref|XP_005292200.1|  PREDICTED: fructose-bisphosphate aldolase B        325   4e-106   
ref|XP_010138894.1|  PREDICTED: fructose-bisphosphate aldolase B        325   4e-106   
gb|KFO92510.1|  Fructose-bisphosphate aldolase B                        325   4e-106   
ref|XP_010791816.1|  PREDICTED: fructose-bisphosphate aldolase C-B      325   5e-106   
ref|XP_007452833.1|  PREDICTED: fructose-bisphosphate aldolase A ...    325   7e-106   
emb|CDQ76804.1|  unnamed protein product                                325   8e-106   
emb|CDJ53561.1|  fructose-1,6-bisphosphate aldolase, putative           324   8e-106   
emb|CEF67409.1|  Fructose-bisphosphate aldolase, class-I family a...    325   8e-106   
ref|XP_010176527.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    324   8e-106   
gb|ETE67078.1|  Fructose-bisphosphate aldolase A                        324   1e-105   
ref|XP_010902552.1|  PREDICTED: fructose-bisphosphate aldolase A        324   1e-105   
ref|XP_010197666.1|  PREDICTED: fructose-bisphosphate aldolase B        324   1e-105   
gb|AHB50480.1|  fructose-bisphosphate aldolase                          324   1e-105   
ref|XP_623342.2|  PREDICTED: fructose-bisphosphate aldolase-like ...    324   1e-105   
ref|XP_006610551.1|  PREDICTED: fructose-bisphosphate aldolase-li...    324   1e-105   
ref|XP_005703720.1|  fructose-bisphosphate aldolase, class I            326   1e-105   
ref|XP_003690678.1|  PREDICTED: fructose-bisphosphate aldolase-like     324   1e-105   
ref|XP_009903882.1|  PREDICTED: fructose-bisphosphate aldolase B        324   1e-105   
ref|XP_009094581.1|  PREDICTED: fructose-bisphosphate aldolase B        324   1e-105   
gb|AAF27641.1|AF217805_1  fructose-1,6-biphosphate aldolase precu...    326   1e-105   
ref|XP_005882049.1|  PREDICTED: fructose-bisphosphate aldolase A ...    324   1e-105   
ref|XP_004268696.1|  PREDICTED: fructose-bisphosphate aldolase A ...    324   1e-105   
ref|XP_006268814.1|  PREDICTED: fructose-bisphosphate aldolase B ...    324   1e-105   
ref|XP_008140068.1|  PREDICTED: fructose-bisphosphate aldolase B        324   1e-105   
ref|XP_006757826.1|  PREDICTED: fructose-bisphosphate aldolase A ...    324   1e-105   
ref|XP_004461535.1|  PREDICTED: fructose-bisphosphate aldolase A ...    325   2e-105   
ref|XP_010217651.1|  PREDICTED: fructose-bisphosphate aldolase B        324   2e-105   
ref|NP_036627.1|  fructose-bisphosphate aldolase A                      323   2e-105   
ref|XP_009289226.1|  PREDICTED: fructose-bisphosphate aldolase B        323   2e-105   
ref|XP_009916853.1|  PREDICTED: fructose-bisphosphate aldolase B        323   2e-105   
ref|XP_005323880.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   2e-105   
ref|XP_005882048.1|  PREDICTED: fructose-bisphosphate aldolase A ...    324   2e-105   
ref|XP_006067930.1|  PREDICTED: fructose-bisphosphate aldolase B        323   2e-105   
ref|XP_006977158.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   3e-105   
ref|XP_004692069.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   3e-105   
ref|XP_005702493.1|  fructose-bisphosphate aldolase, class I            325   3e-105   
ref|XP_003494157.1|  PREDICTED: fructose-bisphosphate aldolase-like     323   3e-105   
gb|AAI42386.1|  ALDOB protein                                           323   3e-105   
ref|XP_009993133.1|  PREDICTED: fructose-bisphosphate aldolase B        323   3e-105   
ref|XP_004350667.1|  fructose-bisphosphate aldolase                     323   3e-105   
ref|XP_004461536.1|  PREDICTED: fructose-bisphosphate aldolase A ...    324   3e-105   
ref|XP_005684307.1|  PREDICTED: fructose-bisphosphate aldolase B ...    323   3e-105   
ref|XP_010008428.1|  PREDICTED: fructose-bisphosphate aldolase B        323   4e-105   
ref|XP_005154921.1|  PREDICTED: fructose-bisphosphate aldolase B        323   4e-105   
ref|XP_005064462.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   4e-105   
ref|XP_007259662.1|  PREDICTED: fructose-bisphosphate aldolase C-...    323   4e-105   
ref|XP_003970405.1|  PREDICTED: fructose-bisphosphate aldolase B-...    323   4e-105   
ref|NP_001029657.1|  fructose-bisphosphate aldolase B                   323   4e-105   
ref|NP_001164327.1|  fructose-bisphosphate aldolase isoform B           323   4e-105   
ref|XP_008590993.1|  PREDICTED: fructose-bisphosphate aldolase B        323   4e-105   
ref|XP_006015539.1|  PREDICTED: fructose-bisphosphate aldolase B ...    323   4e-105   
ref|NP_001007978.1|  fructose-bisphosphate aldolase B                   323   5e-105   
ref|XP_006103382.1|  PREDICTED: fructose-bisphosphate aldolase A ...    324   5e-105   
gb|AER42679.1|  fructose-bisphosphate aldolase B                        323   5e-105   
gb|EZA60106.1|  Fructose-bisphosphate aldolase                          323   5e-105   
ref|NP_001095385.1|  fructose-bisphosphate aldolase A                   322   5e-105   
ref|XP_009007647.1|  PREDICTED: fructose-bisphosphate aldolase A ...    322   5e-105   
ref|XP_006103383.1|  PREDICTED: fructose-bisphosphate aldolase A ...    324   5e-105   
gb|ELR50287.1|  Fructose-bisphosphate aldolase B                        323   5e-105   
ref|XP_008822133.1|  PREDICTED: fructose-bisphosphate aldolase A        322   6e-105   
ref|XP_006181597.1|  PREDICTED: fructose-bisphosphate aldolase A ...    322   6e-105   
ref|XP_003738517.1|  PREDICTED: fructose-bisphosphate aldolase A-...    322   6e-105   
ref|XP_002186732.1|  PREDICTED: fructose-bisphosphate aldolase B ...    322   6e-105   
gb|ELK34757.1|  Fructose-bisphosphate aldolase A                        324   6e-105   
ref|NP_001164328.1|  fructose-bisphosphate aldolase isoform A           322   6e-105   
ref|XP_006201325.1|  PREDICTED: fructose-bisphosphate aldolase A        322   6e-105   
ref|XP_006230271.1|  PREDICTED: fructose-bisphosphate aldolase A ...    324   6e-105   
ref|XP_007248760.1|  PREDICTED: fructose-bisphosphate aldolase A-...    322   7e-105   
ref|XP_008151082.1|  PREDICTED: fructose-bisphosphate aldolase A ...    322   7e-105   
ref|XP_004020929.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   7e-105   
ref|XP_010754362.1|  PREDICTED: fructose-bisphosphate aldolase B        322   7e-105   
ref|NP_001171728.1|  fructose-bisphosphate aldolase                     322   7e-105   
ref|XP_004322124.1|  PREDICTED: fructose-bisphosphate aldolase A ...    324   7e-105   
ref|XP_007186435.1|  PREDICTED: fructose-bisphosphate aldolase A ...    322   8e-105   
dbj|BAD82730.1|  putative fructose-bisphosphate aldolase isoenzym...    316   8e-105   
ref|XP_004268695.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   8e-105   
ref|XP_006640977.1|  PREDICTED: fructose-bisphosphate aldolase C-...    322   8e-105   
ref|XP_004692068.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   9e-105   
ref|XP_011060775.1|  PREDICTED: fructose-bisphosphate aldolase is...    322   9e-105   
ref|XP_003227321.1|  PREDICTED: fructose-bisphosphate aldolase C        322   9e-105   
ref|XP_002947186.1|  hypothetical protein VOLCADRAFT_79447              322   9e-105   
ref|XP_005064460.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   1e-104   
ref|XP_005064461.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   1e-104   
ref|XP_007548330.1|  PREDICTED: fructose-bisphosphate aldolase B        322   1e-104   
ref|XP_009016674.1|  hypothetical protein HELRODRAFT_186957             322   1e-104   
ref|NP_919365.1|  fructose-bisphosphate aldolase C-B                    322   1e-104   
ref|XP_009007646.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   1e-104   
ref|NP_001013965.1|  fructose-bisphosphate aldolase                     321   2e-104   
ref|NP_001021240.1|  Protein ALDO-2, isoform a                          321   2e-104   
ref|XP_010724415.1|  PREDICTED: fructose-bisphosphate aldolase B        321   2e-104   
ref|XP_004670308.1|  PREDICTED: fructose-bisphosphate aldolase A-...    323   2e-104   
ref|XP_002116437.1|  expressed hypothetical protein                     321   2e-104   
ref|NP_998380.1|  aldolase a, fructose-bisphosphate, b                  321   2e-104   
ref|XP_009471459.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    321   2e-104   
ref|XP_005323882.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   2e-104   
ref|XP_008151081.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   2e-104   
ref|XP_011060776.1|  PREDICTED: fructose-bisphosphate aldolase is...    321   2e-104   
ref|XP_011060777.1|  PREDICTED: fructose-bisphosphate aldolase is...    321   2e-104   
ref|XP_009566517.1|  PREDICTED: fructose-bisphosphate aldolase B        321   2e-104   
ref|XP_005224933.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   2e-104   
ref|XP_008151080.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   2e-104   
ref|XP_005080565.1|  PREDICTED: fructose-bisphosphate aldolase A-...    321   2e-104   
ref|XP_006757825.1|  PREDICTED: fructose-bisphosphate aldolase A ...    323   2e-104   
ref|XP_004717606.1|  PREDICTED: fructose-bisphosphate aldolase A-...    320   2e-104   
ref|XP_005859877.1|  PREDICTED: fructose-bisphosphate aldolase B        321   3e-104   
ref|XP_003998733.1|  PREDICTED: fructose-bisphosphate aldolase A ...    321   3e-104   
ref|XP_003240405.1|  PREDICTED: fructose-bisphosphate aldolase          321   3e-104   
gb|ABK24568.1|  unknown                                                 322   3e-104   
ref|XP_006758475.1|  PREDICTED: fructose-bisphosphate aldolase B        320   3e-104   
ref|XP_004397239.1|  PREDICTED: fructose-bisphosphate aldolase A ...    320   3e-104   
ref|XP_849434.1|  PREDICTED: fructose-bisphosphate aldolase A iso...    320   3e-104   
ref|XP_005697728.1|  PREDICTED: fructose-bisphosphate aldolase A ...    322   3e-104   
ref|XP_008633774.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    320   3e-104   
ref|XP_011060774.1|  PREDICTED: fructose-bisphosphate aldolase is...    321   3e-104   
ref|XP_007534724.1|  PREDICTED: fructose-bisphosphate aldolase A        322   3e-104   
emb|CAX62602.1|  aldolase A                                             320   3e-104   
ref|XP_003762120.1|  PREDICTED: fructose-bisphosphate aldolase A        321   3e-104   
gb|ACQ58540.1|  Fructose-bisphosphate aldolase B                        320   3e-104   
ref|XP_004747767.1|  PREDICTED: fructose-bisphosphate aldolase B        320   3e-104   
gb|EGT52826.1|  CBN-ALDO-2 protein                                      320   4e-104   
ref|XP_003110723.1|  CRE-ALDO-2 protein                                 320   4e-104   
ref|XP_010201864.1|  PREDICTED: fructose-bisphosphate aldolase C        318   4e-104   
ref|XP_005626932.1|  PREDICTED: fructose-bisphosphate aldolase B ...    320   4e-104   
ref|XP_004397238.1|  PREDICTED: fructose-bisphosphate aldolase A ...    320   4e-104   
ref|XP_004773998.1|  PREDICTED: fructose-bisphosphate aldolase A ...    320   4e-104   



>ref|XP_011101492.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Sesamum indicum]
Length=358

 Score =   497 bits (1279),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 241/269 (90%), Positives = 251/269 (93%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPG LQYLSGVILFEETLYQ T++GK FVD+MKEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGVLQYLSGVILFEETLYQKTAAGKPFVDVMKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD LAQRCQKYY AGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDDLAQRCQKYYSAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEHTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_009617881.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Nicotiana tomentosiformis]
Length=358

 Score =   497 bits (1279),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 239/269 (89%), Positives = 250/269 (93%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYADELIANAAYIGTPGKGILAADESTGTIGKRFSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGA+QYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VELPGTNGETTT
Sbjct  61   TTPGAVQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYYEAGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYEAGARFAKWRAVLKIGANEPSQLAINENANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYT+RALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTIRALQRTMPAAVPAVVFLSGG  268



>ref|XP_009789131.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Nicotiana sylvestris]
Length=358

 Score =   497 bits (1279),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 239/269 (89%), Positives = 250/269 (93%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYADELIANAKYIGTPGKGILAADESTGTIGKRFSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGA+QYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VELPGTNGETTT
Sbjct  61   TTPGAVQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYYEAGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYEAGARFAKWRAVLKIGANEPSQLAINENANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYT+RALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTIRALQRTMPAAVPAVVFLSGG  268



>gb|EYU38615.1| hypothetical protein MIMGU_mgv1a007931mg [Erythranthe guttata]
Length=390

 Score =   498 bits (1282),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 239/276 (87%), Positives = 255/276 (92%), Gaps = 1/276 (0%)
 Frame = +3

Query  66   SNNNLITMSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRR  245
            S+   +TMSCYKGKYADELIANA YIGTPGKGILAADESTGTIGKR +SIN EN E+NRR
Sbjct  26   SHQASVTMSCYKGKYADELIANAAYIGTPGKGILAADESTGTIGKRFESINVENVESNRR  85

Query  246  TLRELLFTTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPG  425
             LRELLFTTPGALQ+LSGVILFEETLYQ T++GK FVD+MKEG VLPGIKVD G VEL G
Sbjct  86   ALRELLFTTPGALQHLSGVILFEETLYQKTAAGKPFVDVMKEGGVLPGIKVDKGTVELAG  145

Query  426  TNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIIC  605
            TNGETTTQGLDGLAQRCQ+YY+AGARFAKWRAVLKIG NEP+QL+INENANGLARYAIIC
Sbjct  146  TNGETTTQGLDGLAQRCQQYYKAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIIC  205

Query  606  QQNGLVPIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS  785
            Q+NGLVPIVEPEILVDG HDI++CADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS
Sbjct  206  QENGLVPIVEPEILVDGSHDIDRCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS  265

Query  786  DCKNRVKAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            D K +V  EVIAEYTVRALQRTMP AVPAVVFLSGG
Sbjct  266  DAK-KVAPEVIAEYTVRALQRTMPPAVPAVVFLSGG  300



>ref|XP_011094409.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Sesamum indicum]
Length=358

 Score =   493 bits (1268),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 238/269 (88%), Positives = 250/269 (93%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCY+GKYADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ T++GK FVD+MKEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQKTAAGKPFVDVMKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY AGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQQYYAAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHSIDKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_004249455.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Solanum lycopersicum]
Length=358

 Score =   491 bits (1264),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 237/269 (88%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYADELIKNAAYIATPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSG+ILFEETLYQ T++GK FVD+MKEG VLPGIKVD G VELPGTNGETTT
Sbjct  61   CAPGALQYLSGIILFEETLYQKTAAGKPFVDVMKEGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYYEAGARFAKWRAVLKIG NEP+QL+IN+NANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYEAGARFAKWRAVLKIGANEPSQLAINDNANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|NP_001275267.1| uncharacterized LOC102577842 [Solanum tuberosum]
 gb|ABB29926.1| fructose-bisphosphate aldolase-like [Solanum tuberosum]
Length=358

 Score =   491 bits (1264),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 237/269 (88%), Positives = 248/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYADELIKNAAYIATPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSG+ILFEETLYQ T++GK FVD+MKEG VLPGIKVD G VELPGTNGETTT
Sbjct  61   CAPGALQYLSGIILFEETLYQKTAAGKPFVDVMKEGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYYEAGARFAKWRAVLKIG NEP+QL+IN+NANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYEAGARFAKWRAVLKIGANEPSQLAINDNANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAP-KVV  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPAAVPAVVFLSGG  268



>gb|ABB16974.1| unknown [Solanum tuberosum]
Length=358

 Score =   489 bits (1260),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYADELIKNAAYIATPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSG+ILFEETLYQ T++GK FVD+MKEG VLPGIKVD G VELPGTNGETTT
Sbjct  61   CAPGALQYLSGIILFEETLYQKTAAGKPFVDVMKEGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYY AGARFAKWRAVLKIG NEP+QL+IN+NANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYAAGARFAKWRAVLKIGANEPSQLAINDNANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_006481883.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Citrus sinensis]
Length=358

 Score =   489 bits (1258),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 237/269 (88%), Positives = 249/269 (93%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN EANRR LRELLF
Sbjct  1    MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAE+TVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PDVIAEHTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_006430290.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
 gb|ESR43530.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
Length=358

 Score =   488 bits (1257),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 250/269 (93%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAE+TVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PDVIAEHTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_006430289.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
 gb|ESR43529.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
Length=337

 Score =   487 bits (1254),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 250/269 (93%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAE+TVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PDVIAEHTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_010089415.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Morus notabilis]
 gb|EXB37768.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Morus notabilis]
Length=358

 Score =   488 bits (1255),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 249/269 (93%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS YKGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSAYKGKYYDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQST++GK FV+++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALQYLSGVILFEETLYQSTAAGKPFVEVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVL IG+NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLNIGSNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA+VTERVLAA YKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDISKCAEVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVVAEYTVRALQRTMPAAVPAVVFLSGG  268



>gb|KDO61040.1| hypothetical protein CISIN_1g018326mg [Citrus sinensis]
Length=358

 Score =   488 bits (1255),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 249/269 (93%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAE+TVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PDVIAEHTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_009778188.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Nicotiana sylvestris]
Length=358

 Score =   488 bits (1255),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 237/269 (88%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELIANA YI TPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCYKGKYADELIANAAYIATPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VELPGT+GETTT
Sbjct  61   LTPGALQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELPGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYY AGARFAKWRAVLKIG NEP+QL+IN+NANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYAAGARFAKWRAVLKIGANEPSQLAINDNANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGGHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_009621833.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Nicotiana tomentosiformis]
Length=358

 Score =   487 bits (1254),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 237/269 (88%), Positives = 248/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELIANA+YI TPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCYKGKYADELIANASYIATPGKGILAADESTGTIGKRLSSINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VELPGT+GETTT
Sbjct  61   LTPGALQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELPGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYY AGARFAKWRAVLKIG NEP+QL+IN+NANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYAAGARFAKWRAVLKIGANEPSQLAINDNANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGGHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_010243792.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Nelumbo nucifera]
Length=358

 Score =   487 bits (1253),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKY DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCFKGKYHDELITNAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VELPGTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRC  YY+AGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCSDYYKAGARFAKWRAVLKIGPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIEKCADVTERVLAA YKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIEKCADVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVVAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_007202254.1| hypothetical protein PRUPE_ppa007696mg [Prunus persica]
 gb|EMJ03453.1| hypothetical protein PRUPE_ppa007696mg [Prunus persica]
Length=358

 Score =   486 bits (1252),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 245/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS ++GKYADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSAFRGKYADELIANAAYIGTPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P  LQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPDVLQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +  
Sbjct  181  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KAS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRAL RT PAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALLRTTPAAVPAVVFLSGG  268



>ref|XP_010036726.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Eucalyptus grandis]
 gb|KCW48360.1| hypothetical protein EUGRSUZ_K02073 [Eucalyptus grandis]
Length=358

 Score =   486 bits (1250),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 236/269 (88%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQ T++GK FV+++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALQYLSGVILFEETLYQKTAAGKPFVEVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMP AVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPPAVPAVVFLSGG  268



>ref|XP_009352993.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Pyrus x bretschneideri]
Length=358

 Score =   486 bits (1250),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANATYIGTPGKGILAADESTGTIGKR  SI  EN E NRR LRELLF
Sbjct  1    MSAFKGKYHDELIANATYIGTPGKGILAADESTGTIGKRFSSIGVENTETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGA+QYLSGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGAVQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGSHDIQKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E+IAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEMIAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_004246552.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Solanum lycopersicum]
Length=358

 Score =   486 bits (1250),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 235/269 (87%), Positives = 248/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELI NATYIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYADELIKNATYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPG LQYLSGVILFEETLYQ T++GK FV++MKE  VLPGIKVD G VELPGT+GETTT
Sbjct  61   CTPGCLQYLSGVILFEETLYQKTAAGKPFVEVMKEAGVLPGIKVDKGTVELPGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYYEAGARFAKWRAVLKIG NEP+QL+IN+NANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYEAGARFAKWRAVLKIGANEPSQLAINDNANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGAHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMP AVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPPAVPAVVFLSGG  268



>ref|XP_008391753.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Malus domestica]
Length=358

 Score =   485 bits (1249),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANATYIGTPGKGILAADESTGTIGKR  SI  EN E NRR LRELLF
Sbjct  1    MSAFKGKYHDELIANATYIGTPGKGILAADESTGTIGKRFSSIGVENTETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGA+QYLSGVILFEETLYQ T +GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGAVQYLSGVILFEETLYQKTXAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGSHDIQKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KVX  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E+IAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEMIAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_008241286.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Prunus mume]
Length=358

 Score =   484 bits (1247),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 235/269 (87%), Positives = 245/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS ++GKYADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSAFRGKYADELIANAAYIGTPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P  LQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPDVLQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +  
Sbjct  181  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KAS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E+IAEYTVRAL RT PAAVPAVVFLSGG
Sbjct  240  PELIAEYTVRALLRTTPAAVPAVVFLSGG  268



>ref|NP_001275379.1| fructose-bisphosphate aldolase-like protein [Solanum tuberosum]
 ref|XP_006341152.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Solanum tuberosum]
 gb|ABC01905.1| fructose-bisphosphate aldolase-like protein [Solanum tuberosum]
Length=358

 Score =   484 bits (1245),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 233/269 (87%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPG LQYLSGVILFEETLYQ T++GK FV++MKE  VLPGIKVD G VELPGT+GETTT
Sbjct  61   CTPGCLQYLSGVILFEETLYQKTAAGKPFVEVMKEAGVLPGIKVDKGTVELPGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYYEAGARFAKWRAVLKIG NEP+QL+IN+NANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYEAGARFAKWRAVLKIGANEPSQLAINDNANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGAHDIQKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYT+RALQRTMP AVPAVVFLSGG
Sbjct  240  PEVIAEYTIRALQRTMPPAVPAVVFLSGG  268



>gb|KDP42683.1| hypothetical protein JCGZ_23623 [Jatropha curcas]
Length=358

 Score =   484 bits (1245),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 237/269 (88%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYTGKYADELIRNAAYIGTPGKGILAADESTGTIGKRLASINVENVEENRRDLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ + SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQKSKSGKPFVDILKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQ T+PAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQCTVPAAVPAVVFLSGG  268



>gb|EPS71641.1| fructose-bisphosphate aldolase [Genlisea aurea]
Length=358

 Score =   483 bits (1242),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 233/269 (87%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y+GKYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYRGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ T++GK FVD++ EG VLPGIKVD G VEL GT+GETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQKTAAGKPFVDVLNEGGVLPGIKVDKGTVELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY AGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQQYYNAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH IEKCADVTERVLAA YKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHSIEKCADVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDAK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AE+TVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVVAEHTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_009352992.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Pyrus x bretschneideri]
Length=358

 Score =   482 bits (1240),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y+GKYADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSAYRGKYADELIANAAYIGTPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P  LQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPNVLQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QLSI ENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSIQENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +  
Sbjct  181  IVEPEILVDGPHSIDKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KAS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRAL RT PAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALLRTTPAAVPAVVFLSGG  268



>ref|XP_008391754.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Malus domestica]
 ref|XP_008351441.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Malus domestica]
Length=358

 Score =   482 bits (1240),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y+GKYADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSAYRGKYADELIANAAYIGTPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P  LQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPDVLQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QLSI ENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSIQENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +  
Sbjct  181  IVEPEILVDGPHSIDKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KAS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRAL RT PAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALLRTTPAAVPAVVFLSGG  268



>ref|NP_001274769.1| uncharacterized protein LOC102577667 [Solanum tuberosum]
 gb|ABB02618.1| unknown [Solanum tuberosum]
Length=363

 Score =   482 bits (1240),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 233/269 (87%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPG LQYLSGVILFEETLYQ T++GK FV++MKE  VLPGIKVD G VELPGT+GETTT
Sbjct  61   CTPGCLQYLSGVILFEETLYQKTAAGKPFVEVMKEAGVLPGIKVDKGTVELPGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA+RCQKYYEAGARFAKWRAVLKIG NEP+QL+IN+NANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAERCQKYYEAGARFAKWRAVLKIGANEPSQLAINDNANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGAHDIQKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSE-SPKVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYT+RALQRTMP AVPAVVFLSGG
Sbjct  240  PEVIAEYTIRALQRTMPPAVPAVVFLSGG  268



>emb|CDP15370.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   481 bits (1238),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKY DELIA A YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYTDELIATANYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL+ LSGVILFEETLYQ +++GK FVD++KEG V+PGIKVD G VELPGTNGETTT
Sbjct  61   TTPGALECLSGVILFEETLYQKSAAGKPFVDVLKEGGVIPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY AGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAQRCQQYYTAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCADVTERVLAA YKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIEKCADVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_004143304.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Cucumis sativus]
 ref|XP_004166910.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Cucumis sativus]
 gb|KGN48236.1| hypothetical protein Csa_6G450410 [Cucumis sativus]
Length=358

 Score =   481 bits (1238),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCY+GKYADELIANA YIGTPGKGILAADESTGTIGKRL SI+ EN E NRR LRELLF
Sbjct  1    MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIGKRLSSISVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P  LQYLSGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPNVLQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS    +V 
Sbjct  181  IVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSQSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TV ALQRT+PAAVPAVVFLSGG
Sbjct  240  PEVIAEHTVLALQRTVPAAVPAVVFLSGG  268



>ref|XP_008386942.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Malus domestica]
Length=358

 Score =   481 bits (1238),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 234/269 (87%), Positives = 244/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y+GKYADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSAYRGKYADELIANAAYIGTPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P  LQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPDVLQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QLSI ENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSIQENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHSIDKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA+YTVRAL RT PAAVPAVVFLSGG
Sbjct  240  PEVIAKYTVRALLRTTPAAVPAVVFLSGG  268



>ref|XP_010278210.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Nelumbo nucifera]
Length=358

 Score =   481 bits (1237),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 232/269 (86%), Positives = 247/269 (92%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY AGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQQYYAAGARFAKWRAVLKIGPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CADVTERVLAA YKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIQRCADVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDAK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PQVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>gb|AIX10949.1| fructose-bisphosphate aldolase-like protein [Gardenia jasminoides]
Length=358

 Score =   480 bits (1235),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 233/269 (87%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKY DELIA A YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCYKGKYTDELIATANYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL+ LSGVI FEETLYQ T+ GK FVD++KEG V+PGIKVD G VELPGTNGETTT
Sbjct  61   TTPGALECLSGVIFFEETLYQKTADGKPFVDVLKEGGVIPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY AGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQQNGLVP
Sbjct  121  QGLDGLAQRCQQYYTAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQQNGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH+I+KCADVTERVLAA YKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHNIDKCADVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSESP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTMPAAVPAVVFLSGG  268



>ref|XP_009365338.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Pyrus x bretschneideri]
Length=358

 Score =   479 bits (1232),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 233/269 (87%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y+GKYADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSAYRGKYADELIANAAYIGTPGKGILAADESTGTIGKRFASINVENVESNRRCLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P  LQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPDVLQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QLSI ENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSIQENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +  
Sbjct  181  IVEPEILVDGPHSIDKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KAS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAEYTVRAL RT PAAVPAVVFLSGG
Sbjct  240  PKVIAEYTVRALLRTTPAAVPAVVFLSGG  268



>ref|XP_008241287.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Prunus mume]
Length=358

 Score =   479 bits (1232),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 232/269 (86%), Positives = 244/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFKGKYHDELIANATYIGTPGKGILAADESTGTIGKRLSSINVENTETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ T++GK FVD++ EG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQKTAAGKPFVDVLNEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVR LQRTMP AVPAVVFLSGG
Sbjct  240  PEVIAEHTVRTLQRTMPVAVPAVVFLSGG  268



>ref|XP_008385438.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Malus domestica]
Length=358

 Score =   478 bits (1229),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKY DEL+ANATYIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKGKYQDELVANATYIGTPGKGILAADESTGTIGKRLSSINVENTENNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T+ GK FVD++K+G VLPGIKVD G VEL GTNGETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTAGGKPFVDILKDGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YYEAGARFAKWRAVLKIG NEPTQL+I+ENANGLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLAQRCQQYYEAGARFAKWRAVLKIGPNEPTQLAIHENANGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIE+CADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGSHDIERCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV++ +T+RALQRTMP AVPAVVFLSGG
Sbjct  240  PEVVSYHTLRALQRTMPPAVPAVVFLSGG  268



>gb|KFK24834.1| hypothetical protein AALP_AA8G030900 [Arabis alpina]
Length=359

 Score =   478 bits (1229),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 247/269 (92%), Gaps = 0/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K K+ADELIANA YIG+PGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCFKSKFADELIANAAYIGSPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQ++SG+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQFISGIILFEETLYQKTASGKLFVDVMKEAKVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  IGLDGLGERCKKYYEAGARFAKWRAVLKIGANEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGSDCK++ K
Sbjct  181  IVEPEILVDGSHDIEKCAYVTERVLAACYKALNDHHVILEGTLLKPNMVTPGSDCKSKAK  240

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  241  PEVIAEHTVRALQRTVPAAVPAVVFLSGG  269



>ref|XP_007202259.1| hypothetical protein PRUPE_ppa007714mg [Prunus persica]
 gb|EMJ03458.1| hypothetical protein PRUPE_ppa007714mg [Prunus persica]
Length=358

 Score =   477 bits (1227),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 230/269 (86%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANATYIGTPGKGILAADESTGTIGKRL SIN EN+E NRR LRELLF
Sbjct  1    MSAFKGKYHDELIANATYIGTPGKGILAADESTGTIGKRLSSINVENSETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ T++GK FVD+++EG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQKTAAGKPFVDVLREGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVL IG +EP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLNIGPSEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVR+LQRTMP AVPAVVFLSGG
Sbjct  240  PEVIAEHTVRSLQRTMPVAVPAVVFLSGG  268



>ref|XP_004137873.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Cucumis sativus]
 gb|KGN59066.1| Fructose-bisphosphate aldolase [Cucumis sativus]
Length=358

 Score =   477 bits (1227),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/269 (86%), Positives = 245/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSSFKSKYQDELIANATYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   LTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG  EP+QLSINENA GLARYA ICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPTEPSQLSINENAYGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH IEKCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHSIEKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYT+RALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTIRALQRTVPAAVPAIVFLSGG  268



>ref|XP_006398826.1| hypothetical protein EUTSA_v10013921mg [Eutrema salsugineum]
 gb|ESQ40279.1| hypothetical protein EUTSA_v10013921mg [Eutrema salsugineum]
Length=359

 Score =   476 bits (1226),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 245/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K K+ADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+SG+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VE+ GT+GETTT
Sbjct  61   TTPGALQYISGIILFEETLYQKTASGKPFVDVMKEAGVLPGIKVDKGTVEIAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  IGLDGLGDRCKKYYEAGARFAKWRAVLKIGANEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGSDC +R K
Sbjct  181  IVEPEILVDGSHDIEKCAYVTERVLAACYKALNDHHVILEGTLLKPNMVTPGSDCSSRAK  240

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  241  PEVIAEHTVRALQRTVPAAVPAVVFLSGG  269



>ref|XP_010089414.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Morus notabilis]
 gb|EXB37767.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Morus notabilis]
Length=358

 Score =   476 bits (1224),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 246/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSAFKSKYQDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQST++GK FV+++K G VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQSTAAGKPFVEVLKAGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVL IG NEP+QL+INENANGLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCHKYYEAGARFAKWRAVLNIGPNEPSQLAINENANGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIEKCA+VTERVLAA YKALNDHHVLLEGTLLKPNMVTPGS+ K +V 
Sbjct  181  IVEPEILVDGPHDIEKCAEVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSEAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_002528593.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
 gb|EEF33801.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
Length=358

 Score =   475 bits (1223),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 232/269 (86%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ YKGKYADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MTAYKGKYADELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQ T SGK F +L+KE  VLPGIKVD G VE+ GT+GETTT
Sbjct  61   TAPGALQYLSGVILFEETLYQKTKSGKPFAELLKENGVLPGIKVDKGTVEIAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG DGLAQRCQKYYEAGARFAKWRAVLKIG NEP+QLSIN NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLSINLNAEGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDINKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVVAEYTVRALQRTMPAAVPAVVFLSGG  268



>gb|KCW89239.1| hypothetical protein EUGRSUZ_A01538 [Eucalyptus grandis]
Length=301

 Score =   473 bits (1217),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 231/269 (86%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCYKGKYTDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRILRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY+AGARFAKWRAVLKI   EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQQYYKAGARFAKWRAVLKISPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHSIDKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+P AVPA+VFLSGG
Sbjct  240  PEVIAEYTVRALQRTVPPAVPAIVFLSGG  268



>ref|XP_009122681.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Brassica rapa]
Length=359

 Score =   474 bits (1219),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 245/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K KYADELIANA YIG+PGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCFKSKYADELIANAAYIGSPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+SG+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYISGIILFEETLYQKTASGKPFVDVMKEAKVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  IGLDGLGDRCKKYYEAGARFAKWRAVLKIGANEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGSD K+R +
Sbjct  181  IVEPEILVDGSHDIEKCAYVTERVLAACYKALNDHHVILEGTLLKPNMVTPGSDSKSRAE  240

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  241  PKVIAEHTVRALQRTVPAAVPAVVFLSGG  269



>ref|XP_010049816.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Eucalyptus grandis]
 gb|KCW89240.1| hypothetical protein EUGRSUZ_A01538 [Eucalyptus grandis]
Length=358

 Score =   474 bits (1219),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 231/269 (86%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCYKGKYTDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRILRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY+AGARFAKWRAVLKI   EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQQYYKAGARFAKWRAVLKISPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHSIDKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+P AVPA+VFLSGG
Sbjct  240  PEVIAEYTVRALQRTVPPAVPAIVFLSGG  268



>dbj|BAE48790.1| fructose-bisphosphate aldolase [Codonopsis lanceolata]
Length=358

 Score =   473 bits (1218),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 230/269 (86%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E+NR  LRELLF
Sbjct  1    MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLSSINVENIESNRWALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T++GK FVD++KE  VLPGIKVD G V L GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKENGVLPGIKVDKGTVVLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC +YY AGARFAKWRAVL IG NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGARCAQYYAAGARFAKWRAVLNIGPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGAHDIAKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYT+RALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVVAEYTIRALQRTMPAAVPAVVFLSGG  268



>ref|XP_008386943.1| PREDICTED: LOW QUALITY PROTEIN: fructose-bisphosphate aldolase, 
cytoplasmic isozyme-like [Malus domestica]
Length=358

 Score =   473 bits (1218),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SI  EN E NRR LRELLF
Sbjct  1    MSAFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSIGVENTETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL YLSGVILFEETLYQ T++GK FVD++KEG VL GIKVD G VEL GTNGETTT
Sbjct  61   TTPGALXYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLAGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGSHDIQKCAXVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AE+TVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVVAEHTVRALQRTMPAAVPAVVFLSGG  268



>dbj|BAL41455.1| fructose-bisphosphate aldolase 1, partial [Linum grandiflorum]
Length=349

 Score =   472 bits (1214),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 231/260 (89%), Positives = 236/260 (91%), Gaps = 1/260 (0%)
 Frame = +3

Query  114  DELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQYL  293
            DEL ANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLFTTPGALQYL
Sbjct  1    DELAANAAYIGTPGKGILAADESTGTIGKRLASINVENVEENRRGLRELLFTTPGALQYL  60

Query  294  SGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQR  473
            SGVILFEETLYQ T SGK FVDL+KE  VLPGIKVD G VEL GTNGETTTQGLDGL  R
Sbjct  61   SGVILFEETLYQKTKSGKPFVDLLKENGVLPGIKVDKGTVELAGTNGETTTQGLDGLGAR  120

Query  474  CQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVD  653
            C KYYEAGARFAKWRAVLKIG NEP+QL+INENANGLARYAIICQ+NGLVPIVEPEILVD
Sbjct  121  CAKYYEAGARFAKWRAVLKIGANEPSQLAINENANGLARYAIICQENGLVPIVEPEILVD  180

Query  654  GPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTV  833
            GPHDIEKCADVTERVLAACYKALNDHHV LEGTLLKPNMVTPGSD K +V  EVIAEYTV
Sbjct  181  GPHDIEKCADVTERVLAACYKALNDHHVFLEGTLLKPNMVTPGSDAK-KVSPEVIAEYTV  239

Query  834  RALQRTMPAAVPAVVFLSGG  893
            RALQRTMPAAVPAVVFLSGG
Sbjct  240  RALQRTMPAAVPAVVFLSGG  259



>ref|XP_008442804.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
isoform X2 [Cucumis melo]
Length=358

 Score =   471 bits (1212),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSSFKSKYQDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   LTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG  EP+QLSINENA GLARYA ICQ+NGLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPTEPSQLSINENAYGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG H I+KCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHSIDKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_004303023.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Fragaria vesca subsp. vesca]
Length=358

 Score =   471 bits (1211),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 229/269 (85%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ YKGKY DELI NA YIGTPGKGILAADESTGTIGKR  SI  EN E NRR LRELLF
Sbjct  1    MTAYKGKYHDELIKNAAYIGTPGKGILAADESTGTIGKRFDSIKVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG LQYLSGVILFEETLYQ T+ GK FV+++KEG VLPGIKVD GVVEL GTN ETTT
Sbjct  61   TAPGVLQYLSGVILFEETLYQKTAEGKPFVEVLKEGGVLPGIKVDKGVVELAGTNSETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC KYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+ K +  
Sbjct  181  IVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAK-KAS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT PAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTTPAAVPAVVFLSGG  268



>gb|AAG21429.1|AF308587_1 cytosolic aldolase [Fragaria x ananassa]
Length=358

 Score =   471 bits (1211),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ Y+GKYADELI NA YIGTPGKGILAADESTGTIGKR  SI  EN E NRR LRELLF
Sbjct  1    MTAYRGKYADELIKNAAYIGTPGKGILAADESTGTIGKRFDSIKVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG LQYLSGVILFEETLYQ T+ GK FVD++ EG VLPGIKVD GVVEL GT+GETTT
Sbjct  61   TAPGVLQYLSGVILFEETLYQKTAEGKPFVDVLNEGGVLPGIKVDKGVVELKGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC KYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+ K +  
Sbjct  181  IVEPEILVDGPHSIDKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAK-KAS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT PAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTTPAAVPAVVFLSGG  268



>ref|XP_004303022.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Fragaria vesca subsp. vesca]
Length=358

 Score =   471 bits (1211),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ Y+GKYADELI NA YIGTPGKGILAADESTGTIGKR  SI  EN E NRR LRELLF
Sbjct  1    MTAYRGKYADELIKNAAYIGTPGKGILAADESTGTIGKRFDSIKVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG LQYLSGVILFEETLYQ T+ GK FVD++ EG VLPGIKVD GVVEL GT+GETTT
Sbjct  61   TAPGVLQYLSGVILFEETLYQKTAEGKPFVDVLNEGGVLPGIKVDKGVVELKGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC KYYEAGARFAKWRAVLKIG NEP+QLSINENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSQLSINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+ K +  
Sbjct  181  IVEPEILVDGPHSIDKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAK-KAS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT PAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRALQRTTPAAVPAVVFLSGG  268



>ref|XP_009365337.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Pyrus x bretschneideri]
Length=358

 Score =   470 bits (1209),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 245/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SI+ EN E NRR LRELLF
Sbjct  1    MSAFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSISVENTETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTN ETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNCETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCADVTERVLAACYKALNDHHVLLEG+LLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGSHDIQKCADVTERVLAACYKALNDHHVLLEGSLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA++TV ALQRT+PAAVPAVVFLSGG
Sbjct  240  PEVIAKHTVCALQRTVPAAVPAVVFLSGG  268



>ref|XP_010456383.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
2 [Camelina sativa]
Length=301

 Score =   467 bits (1202),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 243/269 (90%), Gaps = 0/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K K+ADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESTGTIGKRFVSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+SG+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYISGIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKIG  EP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  IGLDGLGDRCKKYYEAGARFAKWRAVLKIGKEEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKAL+DHHV+LEGTLLKPNMVTPGSD  ++VK
Sbjct  181  IVEPEILVDGSHDIEKCASVTERVLAACYKALSDHHVILEGTLLKPNMVTPGSDSGSKVK  240

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA +TVRALQRT+PAAVPAVVFLSGG
Sbjct  241  PEVIAAHTVRALQRTVPAAVPAVVFLSGG  269



>ref|XP_011043938.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Populus euphratica]
Length=358

 Score =   469 bits (1208),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 227/269 (84%), Positives = 241/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K KYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKSKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGANEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIEKCA VTERVLAACYKALNDHH +LEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDIEKCAAVTERVLAACYKALNDHHAILEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+P AVPA+VFLSGG
Sbjct  240  HEVIAEYTVRALQRTVPPAVPAIVFLSGG  268



>ref|XP_010527812.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Tarenaya hassleriana]
Length=358

 Score =   468 bits (1205),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/269 (84%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KYADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSAFKSKYADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL YLSGVILFEETLYQ TS GK FVDL+KEG VLPGIKVD G V LPGTNGETTT
Sbjct  61   TAPGALHYLSGVILFEETLYQKTSDGKPFVDLLKEGGVLPGIKVDKGTVVLPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGDRCKKYYEAGARFAKWRAVLKIGPNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+  ++V 
Sbjct  181  IVEPEILVDGPHDIRKCAAVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSES-SKVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>gb|ABK96406.1| unknown [Populus trichocarpa x Populus deltoides]
Length=358

 Score =   467 bits (1201),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K KYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKSKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGANEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKALNDHH +LEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIEKCAAVTERVLAACYKALNDHHAILEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+P AVPA+VFLSGG
Sbjct  240  HEVIAEYTVRALQRTVPPAVPAIVFLSGG  268



>ref|XP_003521445.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Glycine max]
Length=358

 Score =   466 bits (1199),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 227/269 (84%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN EANRR LRELLF
Sbjct  1    MSSFKSKYQDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEANRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGA + LSGVILFEETLYQ T+SGK FV+LMKEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGAFECLSGVILFEETLYQKTASGKPFVELMKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RCQKYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGARCQKYYEAGARFAKWRAVLKIGPNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+ K +V 
Sbjct  181  IVEPEILVDGPHDINKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA+YTV ALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAQYTVTALQRTVPAAVPAIVFLSGG  268



>gb|AGV08373.1| fructose-bisphosphate aldolase [Arachis hypogaea]
Length=358

 Score =   465 bits (1197),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQST++GK FV+++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQSTAAGKPFVEVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG  EP++L+I+ENA GLARYA ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGPTEPSELAIHENAYGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDIHKCAAVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AE+TVRALQRT+P+AVPAVVFLSGG
Sbjct  240  PEVVAEHTVRALQRTVPSAVPAVVFLSGG  268



>ref|XP_010490860.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=359

 Score =   465 bits (1197),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 242/269 (90%), Gaps = 0/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K K+ DELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCFKSKFTDELIANAAYIGTPGKGILAADESTGTIGKRFVSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+SG+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYISGIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKIG  EP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  IGLDGLGDRCKKYYEAGARFAKWRAVLKIGKEEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKAL+DHHV+LEGTLLKPNMVTPGSD  ++VK
Sbjct  181  IVEPEILVDGSHDIEKCAYVTERVLAACYKALSDHHVILEGTLLKPNMVTPGSDSGSKVK  240

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA +TVRALQRT+PAAVPAVVFLSGG
Sbjct  241  PEVIAAHTVRALQRTVPAAVPAVVFLSGG  269



>ref|XP_010558953.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Tarenaya hassleriana]
Length=358

 Score =   465 bits (1197),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 241/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  KYADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKYADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ  S+GK FVD++KEG VLPGIKVD G VELPGTNGETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQKASTGKPFVDILKEGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA ICQ+NGLVP
Sbjct  121  QGLDGLGDRCKKYYEAGARFAKWRAVLKIGPNEPSELAIHENAYGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDIHKCAAVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV AE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVAAEHTVRALQRTVPAAVPAIVFLSGG  268



>gb|AAB61592.1| fructose-biphosphate aldolase [Mesembryanthemum crystallinum]
Length=357

 Score =   465 bits (1196),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 244/269 (91%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ Y+GKYADELIANA YIGTPGKGILAADESTGTIGKR   IN EN E+NRR LRELLF
Sbjct  1    MTAYRGKYADELIANAAYIGTPGKGILAADESTGTIGKRFAGINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGA+QYLSGVILFEETLYQ T++GK FV+++KEGNVLPGIKVD GVVEL GTNGETTT
Sbjct  61   TTPGAVQYLSGVILFEETLYQKTAAGKPFVEVLKEGNVLPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC +YY AGARFAKWRAVLKIG  EP+ L+I ENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGARCAQYYAAGARFAKWRAVLKIGPTEPSPLAILENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+ K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+P AVPAV+FLSGG
Sbjct  240  PEVIAEYTVRALQRTVPPAVPAVMFLSGG  268



>ref|XP_002283381.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Vitis vinifera]
 emb|CAN71905.1| hypothetical protein VITISV_035583 [Vitis vinifera]
Length=358

 Score =   465 bits (1196),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+CYKGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MTCYKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEGNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T+SGK FVD+MKEG VLPGIKVD G V L GT+GETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTASGKPFVDVMKEGGVLPGIKVDKGTVVLTGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC KYY AGARFAKWRAVLKIG  EP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCAKYYAAGARFAKWRAVLKIGPTEPSELAIHENAYGLARYAMICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIEKCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+ K +V 
Sbjct  181  IVEPEILVDGPHDIEKCAYVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVVAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_007027627.1| Aldolase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY08129.1| Aldolase superfamily protein isoform 2 [Theobroma cacao]
Length=358

 Score =   464 bits (1194),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+  KYA+EL  NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFISKYAEELAKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ  SSGK FV+++KEG VLPGIKVD G VEL GTNGET T
Sbjct  61   TTPGALQYLSGVILFEETLYQKASSGKPFVEILKEGGVLPGIKVDKGTVELNGTNGETFT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKI  NEPT+L+I ENANGLA YA ICQQ GLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKIAVNEPTELAIQENANGLAMYAAICQQCGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+KCA+VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDIKKCAEVTERVLAACYKALNDHHVMLEGTLLKPNMVTPGSESP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRALQRTVPAAVPAIVFLSGG  268



>gb|KHG11048.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Gossypium 
arboreum]
Length=358

 Score =   464 bits (1194),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 227/269 (84%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+  KYADEL  NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFISKYADELAKNAAYIGTPGKGILAADESTGTIGKRLSSINVENIEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGET T
Sbjct  61   TAPGALQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELNGTNGETFT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKI  NEPT+L+I ENANGLA YA ICQQ GLVP
Sbjct  121  QGLDGLAQRCQKYYEAGARFAKWRAVLKISANEPTELAIQENANGLAMYAAICQQCGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCA VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIQKCAAVTERVLAACYKALNDHHVMLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRALQRTVPAAVPAIVFLSGG  268



>gb|KCW48359.1| hypothetical protein EUGRSUZ_K02073 [Eucalyptus grandis]
Length=349

 Score =   463 bits (1192),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 228/269 (85%), Positives = 239/269 (89%), Gaps = 10/269 (4%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQ T++GK FV+++KEG VLPGIKVD G          TTT
Sbjct  61   TAPGALQYLSGVILFEETLYQKTAAGKPFVEVLKEGGVLPGIKVDKGT---------TTT  111

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQKYYEAGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  112  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPTEPSQLAINENANGLARYAIICQENGLVP  171

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  172  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVA  230

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRTMP AVPAVVFLSGG
Sbjct  231  PEVIAEYTVRALQRTMPPAVPAVVFLSGG  259



>ref|XP_002325037.1| fructose-1 family protein [Populus trichocarpa]
 gb|ABK95754.1| unknown [Populus trichocarpa]
 gb|EEF03602.1| fructose-1 family protein [Populus trichocarpa]
Length=358

 Score =   463 bits (1192),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K KYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKSKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVL IG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLNIGANEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKALNDHH +LEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIEKCAAVTERVLAACYKALNDHHAILEGTLLKPNMVTPGSEAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+P AVPA+VFLSGG
Sbjct  240  HEVIAEYTVRALQRTVPPAVPAIVFLSGG  268



>gb|ABK93066.1| unknown [Populus trichocarpa]
Length=358

 Score =   463 bits (1191),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K KYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKSKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T+SGK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTASGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVL IG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLNIGANEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKALNDHH +LEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIEKCAAVTERVLAACYKALNDHHAILEGTLLKPNMVTPGSEAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+P AVPA+VFLSGG
Sbjct  240  HEVIAEYTVRALQRTVPPAVPAIVFLSGG  268



>ref|XP_010543462.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Tarenaya hassleriana]
Length=358

 Score =   463 bits (1191),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K KY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKSKYTDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVIL+EETLYQ T++GK FV+L+KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYLSGVILYEETLYQKTAAGKPFVELLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKI  NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  IGLDGLGDRCKKYYEAGARFAKWRAVLKISANEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIEKCAYVTERVLAACYKALNDHHVILEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>gb|AGB05599.1| fructose-bisphosphate aldolase 2 [Camellia oleifera]
Length=358

 Score =   463 bits (1191),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKY DELIA A+YIGTPGKGILAADESTGT+GKRL SIN EN E+NR+  RELLF
Sbjct  1    MSCYKGKYHDELIATASYIGTPGKGILAADESTGTMGKRLSSINVENVESNRQAFRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+ GVILFEETLYQ T++GK FV+++KEG V+PGIKVD GVVEL GTNGETTT
Sbjct  61   TTPGALQYICGVILFEETLYQKTAAGKPFVEVLKEGGVVPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG  EP+ L+I ENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGPTEPSPLAIMENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCADVTERVLAA YKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDINKCADVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AE TVRALQRTMPAAVPAVVFLSGG
Sbjct  240  PEVVAECTVRALQRTMPAAVPAVVFLSGG  268



>gb|KHN18736.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 [Glycine 
soja]
Length=358

 Score =   463 bits (1191),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN EANRR LRELLF
Sbjct  1    MSSFKSKYQDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEANRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TT GA + LSGVILFEETLYQ T+SGK FV+LMKEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTSGAFECLSGVILFEETLYQKTASGKPFVELMKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RCQKYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGARCQKYYEAGARFAKWRAVLKIGPNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+ K +V 
Sbjct  181  IVEPEILVDGPHDINKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA+YTV ALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAQYTVTALQRTVPAAVPAIVFLSGG  268



>gb|KHN46204.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Glycine 
soja]
Length=358

 Score =   463 bits (1191),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SI+ EN E+NRR LRELLF
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASISVENIESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG LQYLSGVILFEETLYQST++GK FV+++KE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGVLQYLSGVILFEETLYQSTAAGKPFVNVLKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGPNEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA +TERVLAACYKALNDHHVLLEGTLLKPNMVTPGS    +V 
Sbjct  181  IVEPEILVDGPHDIHKCAAITERVLAACYKALNDHHVLLEGTLLKPNMVTPGSQSA-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +V+AE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  240  PQVVAEHTVRALQRTVPAAVPAVVFLSGG  268



>emb|CAB77243.2| fructose-bisphosphate aldolase [Persea americana]
Length=358

 Score =   463 bits (1191),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 226/269 (84%), Positives = 241/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFCGKYQDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGAL+ LSGVILFEETLYQ T+SGK FVD++ E  VLPGIKVD G VEL GTNGE TT
Sbjct  61   CTPGALECLSGVILFEETLYQKTASGKPFVDVLXERGVLPGIKVDKGTVELAGTNGENTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY AGARFAKWRAVLKI  NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQQYYSAGARFAKWRAVLKISPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI++CADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGSHDIDRCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRALQRTTPAAVPAIVFLSGG  268



>ref|XP_010912239.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Elaeis guineensis]
Length=358

 Score =   462 bits (1190),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 241/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN EANRR LRELLF
Sbjct  1    MSAYCGKYRDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEANRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T++GK FV+++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTAAGKPFVEVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI +CA+VTERVLAACYKALNDHHVLLEG+LLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDINRCAEVTERVLAACYKALNDHHVLLEGSLLKPNMVTPGSDSK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVR L RT+PAAVPA+VFLSGG
Sbjct  240  PEVVAEYTVRTLLRTVPAAVPAIVFLSGG  268



>ref|XP_004171756.1| PREDICTED: LOW QUALITY PROTEIN: fructose-bisphosphate aldolase 
cytoplasmic isozyme-like [Cucumis sativus]
Length=371

 Score =   463 bits (1191),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 225/260 (87%), Positives = 238/260 (92%), Gaps = 1/260 (0%)
 Frame = +3

Query  114  DELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQYL  293
            DELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF TPGALQYL
Sbjct  23   DELIANATYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLFLTPGALQYL  82

Query  294  SGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQR  473
            SGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTTQGLDGLAQR
Sbjct  83   SGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQR  142

Query  474  CQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVD  653
            CQKYYEAGARFAKWRAVLKIG  EP+QLSINENA GLARYA ICQ+NGLVPIVEPEILVD
Sbjct  143  CQKYYEAGARFAKWRAVLKIGPTEPSQLSINENAYGLARYAAICQENGLVPIVEPEILVD  202

Query  654  GPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTV  833
            GPH IEKCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V  EVIAEYT+
Sbjct  203  GPHSIEKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAA-KVAPEVIAEYTI  261

Query  834  RALQRTMPAAVPAVVFLSGG  893
            RALQRT+PAAVPA+ FLSGG
Sbjct  262  RALQRTVPAAVPAIXFLSGG  281



>ref|XP_009412699.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   461 bits (1186),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y G+Y DELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E NRR+LRELLF
Sbjct  1    MSAYCGQYHDELIANATYIGTPGKGILAADESTGTIGKRLASINVENVEENRRSLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T+SGK FV+++KEG VLPGIKVD G +EL GTNGETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTASGKPFVEVLKEGGVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC+KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA+GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCKKYYEAGARFAKWRAVLKIGPNEPSQLAIDVNADGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCADVTERVLAACYKALNDHHVLLEG+LLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDIAKCADVTERVLAACYKALNDHHVLLEGSLLKPNMVTPGSESA-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRALQRTVPAAVPAIVFLSGG  268



>gb|KDP34381.1| hypothetical protein JCGZ_11264 [Jatropha curcas]
Length=358

 Score =   461 bits (1185),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKY DELIANA YIGTPGKGILAADESTGTIGKRL +IN ENNE NRR  RELLF
Sbjct  1    MSCFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLAAINVENNEPNRRAYRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              P  LQYLSGVILFEETLYQ  + GK FVD++K+G VLPGIKVD G+VEL GT GET+T
Sbjct  61   CAPDVLQYLSGVILFEETLYQKCADGKSFVDVLKKGGVLPGIKVDKGIVELAGTKGETST  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGLA+RCQKYYEAGARFAKWRAVLKIG  EP+QLSINENANGLARYA ICQ+NGLVP
Sbjct  121  LGLDGLAERCQKYYEAGARFAKWRAVLKIGPTEPSQLSINENANGLARYASICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG H+I+ CADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDC  +V 
Sbjct  181  IVEPEILVDGSHNIDCCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCA-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E++AEYTVRALQRT+P AVPAVVFLSGG
Sbjct  240  HEMVAEYTVRALQRTVPPAVPAVVFLSGG  268



>ref|XP_002533605.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
 gb|EEF28774.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
Length=358

 Score =   460 bits (1184),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+KGKY DELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E NRR  RELLF
Sbjct  1    MSCFKGKYHDELIANATYIGTPGKGILAADESTGTIGKRLASINVENIEPNRRAFRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGAL+ LSGVILFEETLYQ T+ GK FVD++K+  VLPGIKVD G+V+L GTN ET+T
Sbjct  61   CTPGALECLSGVILFEETLYQKTADGKLFVDILKKNGVLPGIKVDKGIVQLAGTNAETST  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGLA+RCQKYYEAGARFAKWRAVLKI + EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  LGLDGLAERCQKYYEAGARFAKWRAVLKISSTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+ CADVTERVLA+CYKALNDHHVLLEGTLLKPNMVTPGSD  ++VK
Sbjct  181  IVEPEILVDGSHDIDCCADVTERVLASCYKALNDHHVLLEGTLLKPNMVTPGSD-NSKVK  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA+YTVRALQRT+P AVPA+VFLSGG
Sbjct  240  PEVIADYTVRALQRTVPPAVPAIVFLSGG  268



>emb|CDP05655.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   460 bits (1184),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 228/277 (82%), Positives = 246/277 (89%), Gaps = 7/277 (3%)
 Frame = +3

Query  63   LSNNNLITMSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANR  242
            +S ++ I++  Y      ELIA A YIGTPGKGILAADESTGTIGKRL SIN EN E+NR
Sbjct  1    MSYSSAISLFIY------ELIATANYIGTPGKGILAADESTGTIGKRLSSINVENVESNR  54

Query  243  RTLRELLFTTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELP  422
            R LRELLFTTPGAL+ LSGVILFEETLYQ +++GK FVD++KEG V+PGIKVD G VELP
Sbjct  55   RALRELLFTTPGALECLSGVILFEETLYQKSAAGKPFVDVLKEGGVIPGIKVDKGTVELP  114

Query  423  GTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAII  602
            GTNGETTTQGLDGLAQRCQ+YY AGARFAKWRAVLKIG NEP+QL+INENANGLARYAII
Sbjct  115  GTNGETTTQGLDGLAQRCQQYYTAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAII  174

Query  603  CQQNGLVPIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPG  782
            CQQNGLVPIVEPEILVDG HDIEKCADVTERVLAA YKALNDHHVLLEGTLLKPNMVTPG
Sbjct  175  CQQNGLVPIVEPEILVDGSHDIEKCADVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPG  234

Query  783  SDCKNRVKAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            S+   +V  EVIAEYTVRALQRTMPAAVPAVVFLSGG
Sbjct  235  SEAP-KVAPEVIAEYTVRALQRTMPAAVPAVVFLSGG  270



>ref|XP_011048929.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Populus euphratica]
Length=358

 Score =   459 bits (1182),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K KYADEL+ NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKNKYADELVKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQ+LSGVILFEETLYQ T+SGK FVD++K+G VLPGIKVD G VELPGTNGETTT
Sbjct  61   CTPGALQHLSGVILFEETLYQKTASGKPFVDVLKKGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG  EP++L+I+ENA GLARYA ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGLTEPSELAIHENAYGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG H IEKCA VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHSIEKCAAVTERVLAACYKALNDHHVMLEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA+ TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  NEVIAKCTVRALQRTVPAAVPAIVFLSGG  268



>gb|KHN40026.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Glycine 
soja]
Length=358

 Score =   459 bits (1182),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 243/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SI+ EN E+NRR LRELLF
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASISVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL+YLSGVILFEETLYQST++GK FV+++KE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALKYLSGVILFEETLYQSTAAGKPFVEVLKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGPNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSNSA-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +V+AE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PQVVAEHTVRALQRTVPAAVPAIVFLSGG  268



>gb|EMT31985.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Aegilops 
tauschii]
Length=358

 Score =   459 bits (1182),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 236/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK FVD++KEGNVLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QLSIN+NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGPTEPSQLSINQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEMVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>gb|EMS60368.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Triticum 
urartu]
Length=358

 Score =   459 bits (1182),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 225/269 (84%), Positives = 236/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK FVD++KEGNVLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QLSIN+NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGPTEPSQLSINQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEMVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_008442803.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
isoform X1 [Cucumis melo]
Length=370

 Score =   459 bits (1182),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 224/260 (86%), Positives = 237/260 (91%), Gaps = 1/260 (0%)
 Frame = +3

Query  114  DELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQYL  293
            DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF TPGALQYL
Sbjct  22   DELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLFLTPGALQYL  81

Query  294  SGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQR  473
            SGVILFEETLYQ T++GK FVD++KEG VLPGIKVD G VEL GTNGETTTQGLDGLAQR
Sbjct  82   SGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQR  141

Query  474  CQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVD  653
            CQKYYEAGARFAKWRAVLKIG  EP+QLSINENA GLARYA ICQ+NGLVPIVEPEILVD
Sbjct  142  CQKYYEAGARFAKWRAVLKIGPTEPSQLSINENAYGLARYAAICQENGLVPIVEPEILVD  201

Query  654  GPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTV  833
            G H I+KCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V  EVIAEYTV
Sbjct  202  GSHSIDKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAA-KVAPEVIAEYTV  260

Query  834  RALQRTMPAAVPAVVFLSGG  893
            RALQRT+PAAVPA+VFLSGG
Sbjct  261  RALQRTVPAAVPAIVFLSGG  280



>ref|XP_009411827.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   459 bits (1181),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y G+Y DELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGQYHDELIANATYIGTPGKGILAADESTGTIGKRLASINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSG ILFEETLYQ T++GK FV+++KEG VLPGIKVD G +EL GTNGETTT
Sbjct  61   CTPGALQYLSGAILFEETLYQKTANGKPFVEVLKEGGVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC+KYYEAGARFAKWRAVLKIG NEP+QLSIN NA+GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCKKYYEAGARFAKWRAVLKIGPNEPSQLSINANADGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AE+TVRALQRT+P AVPA+VFLSGG
Sbjct  240  PEVVAEHTVRALQRTVPPAVPAIVFLSGG  268



>ref|XP_010552992.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
2-like [Tarenaya hassleriana]
Length=358

 Score =   459 bits (1180),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 241/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KYADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSRFKSKYADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVIL+EETLYQ T++GK FV+L+KEG VL GIKVD G VEL GTN ETTT
Sbjct  61   TTPGALQYLSGVILYEETLYQKTAAGKPFVELLKEGGVLTGIKVDKGTVELAGTNSETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  IGLDGLGDRCKKYYEAGARFAKWRAVLKIGANEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIEKCA VTERVLAACYKALNDHH +LEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDIEKCAYVTERVLAACYKALNDHHAILEGTLLKPNMVTPGSDSA-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E IAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEAIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_010045253.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Eucalyptus grandis]
Length=358

 Score =   459 bits (1180),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSCYKGKY DELIANA YIGTPGKGILAADESTGTIGKR  +IN EN E NRRT RELLF
Sbjct  1    MSCYKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRFAAINVENVETNRRTYRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQ LSG ILFEETL+Q T+ GK FV++++EG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQCLSGAILFEETLFQKTADGKPFVEVLQEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY AGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQQYYAAGARFAKWRAVLKIGAAEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI++ ADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGDHDIDRSADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSA-KVP  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVRALQRT+P AVP +VFLSGG
Sbjct  240  PEVVAEYTVRALQRTVPPAVPGIVFLSGG  268



>ref|XP_007141361.1| hypothetical protein PHAVU_008G189200g [Phaseolus vulgaris]
 gb|ESW13355.1| hypothetical protein PHAVU_008G189200g [Phaseolus vulgaris]
Length=358

 Score =   458 bits (1179),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQST+SGK FV+L+KE  VL GIKVD G VEL GT+ ETTT
Sbjct  61   TAPGALQYLSGVILFEETLYQSTASGKPFVELLKENGVLTGIKVDKGTVELAGTDQETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGPNEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS    +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSKSA-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +V+AE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  240  PQVVAEHTVRALQRTVPAAVPAVVFLSGG  268



>emb|CDM85268.1| unnamed protein product [Triticum aestivum]
Length=358

 Score =   458 bits (1179),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 236/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK FVD++KEGNVLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QLSI++NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGLTEPSQLSIDQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEMVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_010553342.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Tarenaya hassleriana]
Length=358

 Score =   458 bits (1179),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 241/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  KYADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSAFTSKYADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ  S+GK FVD++KEG VLPGIKVD G VELPGTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKASNGKPFVDILKEGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC+KYYEAGARFAKWR+VLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGDRCKKYYEAGARFAKWRSVLKIGQNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDINKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_006381780.1| fructose-1 family protein [Populus trichocarpa]
 gb|ABK93144.1| unknown [Populus trichocarpa]
 gb|ERP59577.1| fructose-1 family protein [Populus trichocarpa]
Length=358

 Score =   458 bits (1178),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K KYADEL+ NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKNKYADELVKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQ+LSGVI +EETLYQ T+SGK FVD++K+G VLPGIKVD G VELPGTNGETTT
Sbjct  61   CTPGALQHLSGVIFYEETLYQKTASGKPFVDVLKKGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG  EP++L+I+ENA GLARYA ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGLTEPSELAIHENAYGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL+DG H IEKCA VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILIDGSHSIEKCAAVTERVLAACYKALNDHHVMLEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA++TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  NEVIAKFTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_003542562.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Glycine max]
Length=358

 Score =   457 bits (1177),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSSFKSKYQDELIANATYIGTPGKGILAADESTGTIGKRLASINVENVETNRRILRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG L+ LSGVILFEETLYQ +++G  FVD++K+G VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGCLECLSGVILFEETLYQKSAAGVPFVDILKKGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD LAQRC+KYYEAGARFAKWRAVLKIG NEP+ LSI+ENANGLARYA ICQ+NGLVP
Sbjct  121  QGLDDLAQRCKKYYEAGARFAKWRAVLKIGPNEPSPLSIHENANGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DGPHDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   RV 
Sbjct  181  IVEPEILSDGPHDIAKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAA-RVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAE+TVRALQRT+P AVPA+VFLSGG
Sbjct  240  AEVIAEHTVRALQRTVPPAVPAIVFLSGG  268



>ref|NP_001242086.1| uncharacterized protein LOC100795446 [Glycine max]
 gb|ACU23111.1| unknown [Glycine max]
Length=358

 Score =   457 bits (1177),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 241/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K K+ DELIANA+YIGTPGKGILAADESTGTIGKRL SIN EN E NRRTLRELLF
Sbjct  1    MSSFKSKFQDELIANASYIGTPGKGILAADESTGTIGKRLASINVENVETNRRTLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG L+ LSGVILFEETLYQ +++G  FVD++K+G VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGCLERLSGVILFEETLYQKSAAGVPFVDILKKGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD LAQRC+KYYEAGARFAKWRAVLKIG NEP+ L I+ENANGLARYA ICQ+NGLVP
Sbjct  121  QGLDDLAQRCKKYYEAGARFAKWRAVLKIGPNEPSPLCIHENANGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DGPHDI KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   RVK
Sbjct  181  IVEPEILSDGPHDIAKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESA-RVK  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAE+TVRALQRT+P AVPA+VFLSGG
Sbjct  240  AEVIAEHTVRALQRTVPPAVPAIVFLSGG  268



>dbj|BAJ87658.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   457 bits (1176),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 236/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK FVD++KEGNVLPGIKVD G +EL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QLSI++NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGATEPSQLSIDQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEIVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|NP_001242367.1| uncharacterized protein LOC100778363 [Glycine max]
 gb|ACU24103.1| unknown [Glycine max]
Length=358

 Score =   457 bits (1176),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 219/269 (81%), Positives = 242/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELI NA YIGTPGKGILAADESTGTIGKRL SI+ EN E+NRR LRELLF
Sbjct  1    MSHFKGKYHDELIVNAAYIGTPGKGILAADESTGTIGKRLASISVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL+YLSGVILFEETLYQST++GK FV+++KE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALKYLSGVILFEETLYQSTAAGKPFVEVLKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG NEP++L+++ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGPNEPSELAVHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSNSA-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +V+AE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PQVVAEHTVRALQRTVPAAVPAIVFLSGG  268



>gb|AFK43805.1| unknown [Medicago truncatula]
 gb|KEH28149.1| fructose-bisphosphate aldolase [Medicago truncatula]
Length=358

 Score =   457 bits (1176),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SI+ EN E+NRR LRELLF
Sbjct  1    MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSISVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG LQYLSGVILFEETLYQST++GK FVD++ E  VLPGIKVD G VEL GT+GETTT
Sbjct  61   TAPGVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC KYYEAGARFAKWRAVLKIG NEP++ SI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSEHSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+KCA VTE+VLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDIQKCAAVTEKVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  240  PEVVAEHTVRALQRTVPAAVPAVVFLSGG  268



>ref|XP_009402715.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   457 bits (1176),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y G++ DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGQFHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEENRRDLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T  GK FV+++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTVDGKLFVEVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC+KYYEAGARFAKWRAVLKI  NEP+QLSI+ NANGLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCKKYYEAGARFAKWRAVLKISPNEPSQLSIDANANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA+VTERVLAACYKALNDHHVLLEG+LLKPNMVTPGS+ K +V 
Sbjct  181  IVEPEILVDGPHDIAKCAEVTERVLAACYKALNDHHVLLEGSLLKPNMVTPGSESK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVVAEYTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_010927580.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Elaeis guineensis]
Length=358

 Score =   456 bits (1174),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYHDELIKNAAYIGTPGKGILAADESTGTIGKRLASINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T  GK FV+++KEG VLPGIKVD G +EL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTKDGKPFVEVLKEGGVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D LA+RCQKYYEAGARFAKWRAVLKIG  EP+QL+I+ NA+GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLAKRCQKYYEAGARFAKWRAVLKIGPTEPSQLAIDLNAHGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHDIKRCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEY VRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVVAEYAVRALQRTVPAAVPAIVFLSGG  268



>gb|EMS58841.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Triticum 
urartu]
Length=358

 Score =   456 bits (1174),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 235/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK FVD++K GNVLPGIKVD G +EL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKAGNVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QLSI++NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGATEPSQLSIDQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTESVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_010940458.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Elaeis guineensis]
Length=358

 Score =   456 bits (1173),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELIANA YI TPGKGILAADESTGTIGKRL SIN EN EANRR LRELLF
Sbjct  1    MSAYCGKYRDELIANAAYIATPGKGILAADESTGTIGKRLASINVENVEANRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T+ GK FV+++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTADGKPFVEVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI +CA+VTERVLAACYKALNDHHVLLEG+LLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDINRCAEVTERVLAACYKALNDHHVLLEGSLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +V+AE TVRAL RT+PAAVPA+VFLSGG
Sbjct  240  PKVVAECTVRALLRTVPAAVPAIVFLSGG  268



>gb|ACO44683.1| fructose-bisphosphate aldolase [Secale cereale]
Length=358

 Score =   456 bits (1173),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 236/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK FVD++KEGNVLPGIKVD G +EL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKEGNVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGAR+AKWRAVLKIG  EP+QLSI++NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARYAKWRAVLKIGATEPSQLSIDQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEIVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>gb|EMT05696.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Aegilops 
tauschii]
Length=358

 Score =   456 bits (1173),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 235/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK FVD++K GNVLPGIKVD G +EL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKAGNVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QLSI++NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGATEPSQLSIDQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEVVLAACYKALNDQHVLLEGTLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>gb|AHY18973.1| fructose-bisphosphate aldolase [Brassica rapa subsp. chinensis]
 emb|CDY13330.1| BnaC06g14270D [Brassica napus]
 emb|CDX67550.1| BnaA07g15900D [Brassica napus]
Length=358

 Score =   456 bits (1173),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_006291269.1| hypothetical protein CARUB_v10017399mg, partial [Capsella rubella]
 gb|EOA24167.1| hypothetical protein CARUB_v10017399mg, partial [Capsella rubella]
Length=396

 Score =   457 bits (1175),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 223/270 (83%), Positives = 240/270 (89%), Gaps = 1/270 (0%)
 Frame = +3

Query  84   TMSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELL  263
            TMS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELL
Sbjct  38   TMSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRNLRELL  97

Query  264  FTTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETT  443
            FT PGAL  LSGVILFEETLYQ +S GK FVD++KEG VLPGIKVD G VEL GTNGETT
Sbjct  98   FTAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETT  157

Query  444  TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLV  623
            TQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLV
Sbjct  158  TQGLDGLGDRCRKYYEAGARFAKWRAVLKIGENEPSELSIHENAYGLARYAVICQENGLV  217

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEILVDG HDI+KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V
Sbjct  218  PIVEPEILVDGSHDIQKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSP-KV  276

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
              EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  277  SPEVIAEHTVRALQRTVPAAVPAIVFLSGG  306



>gb|EMT15181.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Aegilops 
tauschii]
 emb|CDM85265.1| unnamed protein product [Triticum aestivum]
Length=358

 Score =   456 bits (1172),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 235/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK FVD++K GNVLPGIKVD G +EL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKAGNVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QLSI++NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGATEPSQLSIDQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEIVLAACYKALNDQHVLLEGTLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_010426925.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   455 bits (1171),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRNLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGDRCKKYYEAGARFAKWRAVLKIGENEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIQKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_002877893.1| hypothetical protein ARALYDRAFT_906673 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010504045.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
 ref|XP_010515772.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
 gb|EFH54152.1| hypothetical protein ARALYDRAFT_906673 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   455 bits (1171),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRNLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGDRCKKYYEAGARFAKWRAVLKIGENEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIQKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_010683863.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Beta vulgaris subsp. vulgaris]
Length=357

 Score =   455 bits (1170),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ Y+GKYADELIANA YI TPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MTAYRGKYADELIANAAYIATPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ T++GK FVD+MKEG VLPGIKVD G +EL GTNGETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQKTAAGKLFVDVMKEGGVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L +RC +YY AGARFAKWRAVLKIG NEP+ L+I ENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDNLGKRCAEYYAAGARFAKWRAVLKIGPNEPSPLAILENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI++CA+V+ERVLAACYK+LNDHHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGSHDIDRCAEVSERVLAACYKSLNDHHVLLEGTLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAEYTVR LQRT+P AVP ++FLSGG
Sbjct  240  NDVIAEYTVRTLQRTVPPAVPGIMFLSGG  268



>gb|KFK34541.1| hypothetical protein AALP_AA5G159400 [Arabis alpina]
Length=358

 Score =   455 bits (1170),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN ENNE NRR LRELLF
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENNETNRRNLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG VLPGIKVD G VEL GT+GETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++ SI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG H IEKCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHSIEKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_009411974.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009411977.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   454 bits (1169),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 237/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN EANRR LRELLF
Sbjct  1    MSAYCGKYHDELIKNAAYIGTPGKGILAADESTGTIGKRLASINVENVEANRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQ LSGVILFEETLYQ T+ GK FV+++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQCLSGVILFEETLYQKTADGKPFVEVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKI  NEP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIAPNEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI +CA VTERVLAACYKALNDHHVLLEG+LLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDINRCAQVTERVLAACYKALNDHHVLLEGSLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVRAL RT+PAAVPA+VFLSGG
Sbjct  240  PEVVAEYTVRALLRTVPAAVPAIVFLSGG  268



>ref|XP_006403749.1| hypothetical protein EUTSA_v10010492mg [Eutrema salsugineum]
 gb|ESQ45202.1| hypothetical protein EUTSA_v10010492mg [Eutrema salsugineum]
Length=358

 Score =   454 bits (1169),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGDRCKKYYEAGARFAKWRAVLKIGENEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_007145245.1| hypothetical protein PHAVU_007G222900g [Phaseolus vulgaris]
 gb|ESW17239.1| hypothetical protein PHAVU_007G222900g [Phaseolus vulgaris]
Length=357

 Score =   454 bits (1169),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K KY DELIANA +IG+PGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSCFKSKYQDELIANAAHIGSPGKGILAADESTGTIGKRLASINVENVETNRRILRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG ++ LSG+ILFEETLYQ T++G  FVD+MK+G VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGCIECLSGIILFEETLYQKTAAGVPFVDVMKKGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD LAQRC+KYYEAGARFAKWRAVLKIG NEP+ LSI+ENANGLARYA ICQ+NGLVP
Sbjct  121  QGLDDLAQRCKKYYEAGARFAKWRAVLKIGPNEPSPLSIHENANGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DGPHDI+KCADVTERVLAACYKALNDHHV+LEGTLLKPNMVTPGS+ K RV 
Sbjct  181  IVEPEILSDGPHDIQKCADVTERVLAACYKALNDHHVMLEGTLLKPNMVTPGSESK-RVG  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAE+TVR L RT+P AVPA+VFLSGG
Sbjct  240  AEVIAEHTVRTLLRTVPPAVPAIVFLSGG  268



>ref|XP_008775192.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Phoenix dactylifera]
Length=358

 Score =   454 bits (1169),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 222/269 (83%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELIANA YI TPGKGILAADESTGTIGKRL SIN EN EANRR LRELLF
Sbjct  1    MSAYCGKYRDELIANAAYIATPGKGILAADESTGTIGKRLASINVENVEANRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYL GVILFEETLYQ T+ GK FV+++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   CTPGALQYLCGVILFEETLYQKTADGKPFVEVLKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPTEPSQLAINENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI +CA+VTERVLAACYKALNDHHVLLEG+LLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDINRCAEVTERVLAACYKALNDHHVLLEGSLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E++AE TVRAL RT+PAAVPA+VFLSGG
Sbjct  240  PEIVAECTVRALLRTVPAAVPAIVFLSGG  268



>ref|XP_008797227.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Phoenix dactylifera]
Length=358

 Score =   454 bits (1168),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY+DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN EANR+ LRELLF
Sbjct  1    MSAYCGKYSDELIKNAAYIGTPGKGILAADESTGTIGKRLASINVENVEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T  GK FV+++ EG VLPGIKVD G +EL GTNGETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTKDGKPFVEVLNEGGVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RCQKYYEAGARFAKWRAVLKIG  EP+QL+I+ NA+GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCQKYYEAGARFAKWRAVLKIGPTEPSQLAIDLNADGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI +CADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDINRCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVVAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_009141597.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=358

 Score =   453 bits (1166),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 219/269 (81%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ +  KYADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MASFTSKYADELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL  LSGVILFEETLYQ +S G  FVD++KEG VLPGIKVD G V LPGTNGETTT
Sbjct  61   TTPGALPCLSGVILFEETLYQKSSKGTPFVDILKEGGVLPGIKVDKGTVSLPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG  EP++L+I ENA GLARYA ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGPTEPSELAIRENAYGLARYAAICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCA+VTERVLAACYKAL+DHHV+LEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIQKCAEVTERVLAACYKALSDHHVMLEGTLLKPNMVTPGSES-GKVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVRALQRT+PAAVPAVVFLSGG
Sbjct  240  PEVVAEYTVRALQRTVPAAVPAVVFLSGG  268



>ref|XP_006410823.1| hypothetical protein EUTSA_v10016856mg [Eutrema salsugineum]
 gb|ESQ52276.1| hypothetical protein EUTSA_v10016856mg [Eutrema salsugineum]
Length=358

 Score =   453 bits (1166),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 241/269 (90%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  KYADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSSFTSKYADELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL  LSGVILFEETLYQ +S+G  FVD++K+G VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALPCLSGVILFEETLYQKSSNGTPFVDILKKGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGQNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>emb|CDX78134.1| BnaA09g33290D [Brassica napus]
 emb|CDX73593.1| BnaC08g24100D [Brassica napus]
Length=358

 Score =   453 bits (1166),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++ SI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>gb|ACO44685.1| fructose-bisphosphate aldolase [Hordeum vulgare]
Length=358

 Score =   453 bits (1165),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 234/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELL 
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLL  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK F D++KEGNVLPGIKVD G +EL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFADILKEGNVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP+QLSI++NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGATEPSQLSIDQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEIVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>gb|ACO44684.1| fructose-bisphosphate aldolase [Triticum aestivum]
Length=358

 Score =   452 bits (1164),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 233/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQST  GK FVD++K GNVLPGIKVD G +EL GTNGETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQSTKGGKPFVDILKAGNVLPGIKVDKGTIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG  EP QLSI++NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLGKRCAKYYEAGARFAKWRAVLKIGATEPPQLSIDQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEIVLAACYKALNDQHVLLEGTLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYT R LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTARTLQRTVPAAVPAIVFLSGG  268



>emb|CDY66283.1| BnaCnng50220D [Brassica napus]
 emb|CDX76248.1| BnaA04g05120D [Brassica napus]
Length=358

 Score =   452 bits (1163),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 237/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  KYADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKYADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++ SI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+P AVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPPAVPAIVFLSGG  268



>gb|ACG68894.1| fructose-biphosphate aldolase [Sesuvium portulacastrum]
Length=357

 Score =   451 bits (1161),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 239/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+  +GK+ADELIANA YI TPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MTAVRGKFADELIANAAYIATPGKGILAADESTGTIGKRFASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQ T++GK FV++MKEG+VLPGIKVD GVVEL GTNGETTT
Sbjct  61   TAPGALQYLSGVILFEETLYQKTAAGKPFVEVMKEGDVLPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC +YY AGARFAKWRAVLKIG NEP+ LSI ENANGLARYAIICQ+N LVP
Sbjct  121  QGLDGLGQRCAQYYTAGARFAKWRAVLKIGPNEPSPLSILENANGLARYAIICQENRLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA+V+ERVLAA YKALNDHHVLLEGTLLKPNMVTPGS+ K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAEVSERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSESK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+ EYTVR LQRT+P AVP ++FLSGG
Sbjct  240  PEVVVEYTVRTLQRTVPPAVPGIMFLSGG  268



>gb|ABK21911.1| unknown [Picea sitchensis]
 gb|ACN40269.1| unknown [Picea sitchensis]
Length=358

 Score =   451 bits (1160),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 216/269 (80%), Positives = 235/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC++GKY DELIANA YI TPGKGILAADESTGTIGKRL SIN EN E NRR LRE LF
Sbjct  1    MSCFEGKYRDELIANAAYIATPGKGILAADESTGTIGKRLASINVENIETNRRQLREFLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P A+QYL G ILFEETLYQ +++GK FVD++ EG VLPGIKVD G V+L GT GETTT
Sbjct  61   TAPNAVQYLCGAILFEETLYQKSAAGKPFVDILNEGGVLPGIKVDKGTVDLAGTKGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRCQ+YY AGARFAKWRAVLKIGT EP+ L+I ENANGLARYAIICQ+NGLVP
Sbjct  121  QGLDGLAQRCQQYYNAGARFAKWRAVLKIGTTEPSPLAIQENANGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+ CA +TERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDIKTCAAITERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+P AVP ++FLSGG
Sbjct  240  PEVIAEYTVRALQRTVPPAVPGIMFLSGG  268



>ref|NP_181187.1| fructose-bisphosphate aldolase 6 [Arabidopsis thaliana]
 gb|AAD24630.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AAK59404.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AAL34218.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AAM61668.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 dbj|BAE98935.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AEC09256.1| fructose-bisphosphate aldolase 6 [Arabidopsis thaliana]
Length=358

 Score =   451 bits (1160),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 219/269 (81%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSSFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL  LSGVILFEETLYQ +S G  FVD++K   VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALPCLSGVILFEETLYQKSSDGTPFVDMLKSAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP+QL+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGDRCKKYYEAGARFAKWRAVLKIGVNEPSQLAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIQKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_010932289.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Elaeis guineensis]
Length=425

 Score =   454 bits (1167),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 222/276 (80%), Positives = 239/276 (87%), Gaps = 1/276 (0%)
 Frame = +3

Query  66   SNNNLITMSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRR  245
            S N    MS Y GKY+DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR
Sbjct  61   SRNRRSKMSAYCGKYSDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRR  120

Query  246  TLRELLFTTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPG  425
             LRELLF  PGALQYLSGVILFEETLYQ T  GK FV+++ EG VLPGIKVD G +EL G
Sbjct  121  ALRELLFCAPGALQYLSGVILFEETLYQKTKDGKPFVEVLNEGGVLPGIKVDKGTIELAG  180

Query  426  TNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIIC  605
            TNGETTTQG D LA+RC+KYYEAGARFAKWRAVLKIG  EP+QL+I+ NA GLARYAIIC
Sbjct  181  TNGETTTQGHDDLAKRCKKYYEAGARFAKWRAVLKIGPTEPSQLAIDLNAQGLARYAIIC  240

Query  606  QQNGLVPIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS  785
            Q+NGLVPIVEPEILVDGPH I+KCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS
Sbjct  241  QENGLVPIVEPEILVDGPHCIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS  300

Query  786  DCKNRVKAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            +   +V  EV+AEYTVRALQRT+PAAVPA+VFLSGG
Sbjct  301  ESA-KVAPEVVAEYTVRALQRTVPAAVPAIVFLSGG  335



>ref|XP_009115993.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=358

 Score =   451 bits (1160),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 237/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG VL GIKVD G VEL GTNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLQGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++ SI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_006293487.1| hypothetical protein CARUB_v10023504mg [Capsella rubella]
 gb|EOA26385.1| hypothetical protein CARUB_v10023504mg [Capsella rubella]
Length=358

 Score =   451 bits (1160),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCFTTKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL  LSGVILFEETLYQ +S+G  FV+++K   VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALPCLSGVILFEETLYQKSSNGTPFVEMLKSAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGKNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_010509469.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   451 bits (1159),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL  LSGVILFEETLYQ +S+G  FV+++K   VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALPCLSGVILFEETLYQKSSNGTPFVEILKSAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGQNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|NP_190861.1| fructose-bisphosphate aldolase [Arabidopsis thaliana]
 emb|CAB86897.1| fructose bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAK96613.1| AT3g52930/F8J2_100 [Arabidopsis thaliana]
 gb|AAL15287.1| AT3g52930/F8J2_100 [Arabidopsis thaliana]
 gb|AAL36068.1| AT3g52930/F8J2_100 [Arabidopsis thaliana]
 gb|AAM64896.1| fructose bisphosphate aldolase-like protein [Arabidopsis thaliana]
 dbj|BAH20051.1| AT3G52930 [Arabidopsis thaliana]
 gb|AEE79012.1| fructose-bisphosphate aldolase [Arabidopsis thaliana]
Length=358

 Score =   451 bits (1159),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRNLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG VLPGIKVD G VEL GT+GETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++ SI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGDRCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIQKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_010516868.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   450 bits (1158),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCFTTKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL  LSGVILFEETLYQ +S+G  FV+++K   VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALPCLSGVILFEETLYQKSSNGTPFVEMLKSAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGQNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>gb|KFK32724.1| hypothetical protein AALP_AA6G280600 [Arabis alpina]
Length=358

 Score =   450 bits (1158),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN ENNE NRR LRELLF
Sbjct  1    MSSFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENNETNRRNLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPG+L  LSGVILFEETLYQ +S+G  FV+++KEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGSLPCLSGVILFEETLYQKSSNGTPFVEILKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKI  NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIDENEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_010505193.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Camelina sativa]
Length=358

 Score =   450 bits (1157),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCFTTKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL  LSGVILFEETLYQ +S+G  FV+++K   VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALPCLSGVILFEETLYQKSSNGTPFVEMLKSAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGLNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|NP_850759.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
 emb|CAB82934.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AED90643.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
Length=359

 Score =   449 bits (1156),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 224/269 (83%), Positives = 245/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K K+ADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESTGTIGKRFVSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+SG+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYISGIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  TGLDGLGDRCKKYYEAGARFAKWRAVLKIGNNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKAL+DHHV+LEGTLLKPNMVTPGSD  ++VK
Sbjct  181  IVEPEILVDGSHDIEKCAYVTERVLAACYKALSDHHVILEGTLLKPNMVTPGSDSGSKVK  240

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA++TVRALQRT+PAAVPAVVFLSGG
Sbjct  241  PEVIAKHTVRALQRTVPAAVPAVVFLSGG  269



>ref|XP_009125243.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=358

 Score =   449 bits (1156),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 219/269 (81%), Positives = 237/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQ +S GK FVD++KEG  LPGIK+D G VEL  TNGETTT
Sbjct  61   TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGALPGIKLDKGTVELAVTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC+KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGERCKKYYEAGARFAKWRAVLKIGENEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>gb|AGZ15378.1| fructose-bisphosphate aldolase [Phaseolus vulgaris]
Length=358

 Score =   449 bits (1156),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 220/269 (82%), Positives = 236/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQST+SGK FV+L+KE  VL GIKVD G VEL GT+ ETTT
Sbjct  61   TAPGALQYLSGVILFEETLYQSTASGKPFVELLKENGVLTGIKVDKGTVELAGTDQETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGPNEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKALNDHHV LEGT LKPNMVTPG     +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALNDHHVFLEGTFLKPNMVTPGFKFA-KVF  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +V+AE+TVRALQRT+PAAVPAVVFL GG
Sbjct  240  PQVVAEHTVRALQRTVPAAVPAVVFLFGG  268



>ref|XP_002881445.1| hypothetical protein ARALYDRAFT_482625 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57704.1| hypothetical protein ARALYDRAFT_482625 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   449 bits (1155),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+  K+ADELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSCFTTKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL  LSGVILFEETLYQ +S+G  FVD++K   VLPGIKVD G VEL GTN ETTT
Sbjct  61   TTPGALPCLSGVILFEETLYQKSSNGTPFVDMLKSAGVLPGIKVDKGTVELAGTNAETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGDRCKKYYEAGARFAKWRAVLKIGQNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI KCA VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGSHDIHKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_007027626.1| Aldolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY08128.1| Aldolase superfamily protein isoform 1 [Theobroma cacao]
Length=377

 Score =   450 bits (1157),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 220/260 (85%), Positives = 233/260 (90%), Gaps = 1/260 (0%)
 Frame = +3

Query  114  DELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQYL  293
            +EL  NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLFTTPGALQYL
Sbjct  29   EELAKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEDNRRALRELLFTTPGALQYL  88

Query  294  SGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQR  473
            SGVILFEETLYQ  SSGK FV+++KEG VLPGIKVD G VEL GTNGET TQGLDGLAQR
Sbjct  89   SGVILFEETLYQKASSGKPFVEILKEGGVLPGIKVDKGTVELNGTNGETFTQGLDGLAQR  148

Query  474  CQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVD  653
            CQKYYEAGARFAKWRAVLKI  NEPT+L+I ENANGLA YA ICQQ GLVPIVEPEILVD
Sbjct  149  CQKYYEAGARFAKWRAVLKIAVNEPTELAIQENANGLAMYAAICQQCGLVPIVEPEILVD  208

Query  654  GPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTV  833
            GPHDI+KCA+VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGS+   +V  EVIAEYTV
Sbjct  209  GPHDIKKCAEVTERVLAACYKALNDHHVMLEGTLLKPNMVTPGSESP-KVAPEVIAEYTV  267

Query  834  RALQRTMPAAVPAVVFLSGG  893
            RALQRT+PAAVPA+VFLSGG
Sbjct  268  RALQRTVPAAVPAIVFLSGG  287



>gb|AAL32644.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAM13358.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
Length=359

 Score =   448 bits (1152),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 245/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K K+ADELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESTGTIGKRFVSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+SG+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYISGIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  TGLDGLGDRCKKYYEAGARFAKWRAVLKIGNNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKAL+DHHV+LEGTLLKPNMVTPGSD  ++VK
Sbjct  181  IVEPEILVDGSHDIEKCAYVTERVLAACYKALSDHHVILEGTLLKPNMVTPGSDSGSKVK  240

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA++TVRAL+RT+PAAVPAVVFLSGG
Sbjct  241  PEVIAKHTVRALRRTVPAAVPAVVFLSGG  269



>ref|XP_006288022.1| hypothetical protein CARUB_v10001255mg [Capsella rubella]
 gb|EOA20920.1| hypothetical protein CARUB_v10001255mg [Capsella rubella]
Length=359

 Score =   448 bits (1152),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 244/269 (91%), Gaps = 0/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K K++DELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCFKSKFSDELIANAAYIGTPGKGILAADESTGTIGKRFVSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+SG+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYISGIILFEETLYQKTASGKPFVDVMKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKIG  EP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  TGLDGLGDRCKKYYEAGARFAKWRAVLKIGNEEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKAL+DHHV+LEGTLLKPNMVTPGSD  ++VK
Sbjct  181  IVEPEILVDGSHDIEKCAYVTERVLAACYKALSDHHVILEGTLLKPNMVTPGSDSGSKVK  240

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  241  PEVIAEHTVRALQRTVPAAVPAVVFLSGG  269



>ref|NP_001045130.2| Os01g0905800 [Oryza sativa Japonica Group]
 dbj|BAA08845.1| aldolase C-1 [Oryza sativa]
 dbj|BAA08830.1| aldolase C-1 [Oryza sativa]
 dbj|BAD82731.1| fructose-bisphosphate aldolase isoenzyme C-1 [Oryza sativa Japonica 
Group]
 gb|ABL74560.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
 dbj|BAG96902.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07044.2| Os01g0905800 [Oryza sativa Japonica Group]
 gb|ADM86841.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
 gb|AEV58398.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
Length=358

 Score =   447 bits (1151),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 237/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR+LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQ+LSGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G VE+ GTN ETTT
Sbjct  61   TTPGALQHLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTVEVAGTNKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QLSI+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLSIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIE+CA VTE+VLAACYKALN+HHVLLEG+LLKPNMVTPGS+ K +V 
Sbjct  181  IVEPEILVDGSHDIERCAYVTEKVLAACYKALNEHHVLLEGSLLKPNMVTPGSESK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             ++IAEYTVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PQLIAEYTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_003564871.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Brachypodium distachyon]
Length=358

 Score =   447 bits (1151),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 235/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQY+SGVILFEETLYQST +GK FVD++KE NVLPGIKVD G +E+ GT+ ETTT
Sbjct  61   CTPGALQYISGVILFEETLYQSTKAGKPFVDVLKENNVLPGIKVDKGTIEIAGTDKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QLSI+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLSIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAHVTEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+P AVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPPAVPAIVFLSGG  268



>gb|AAM62481.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
Length=393

 Score =   449 bits (1155),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 216/259 (83%), Positives = 235/259 (91%), Gaps = 0/259 (0%)
 Frame = +3

Query  117  ELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQYLS  296
            ELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLFTTPGALQY+S
Sbjct  45   ELIANAAYIGTPGKGILAADESTGTIGKRFVSINVENVESNRRALRELLFTTPGALQYIS  104

Query  297  GVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQRC  476
            G+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT GLDGL  RC
Sbjct  105  GIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTTIGLDGLGDRC  164

Query  477  QKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVDG  656
            +KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+N LVPIVEPEILVDG
Sbjct  165  KKYYEAGARFAKWRAVLKIGNNEPSELAIHENAYGLARYAVICQENRLVPIVEPEILVDG  224

Query  657  PHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTVR  836
             HDIEKCA VTERVLAACYKAL+DHHV+LEGTLLKPNMVTPGSD  ++VK EVIA++TVR
Sbjct  225  SHDIEKCAYVTERVLAACYKALSDHHVILEGTLLKPNMVTPGSDSGSKVKPEVIAKHTVR  284

Query  837  ALQRTMPAAVPAVVFLSGG  893
            ALQRT+PAAVPAVVFLSGG
Sbjct  285  ALQRTVPAAVPAVVFLSGG  303



>ref|XP_006645191.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=358

 Score =   447 bits (1151),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 236/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR+LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENIEENRRSLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSGVILFEETLYQ T  G  FVD++KEG VLPGIKVD G VE+ GTN ETTT
Sbjct  61   TTPGALQYLSGVILFEETLYQKTKDGTPFVDVLKEGGVLPGIKVDKGTVEVAGTNKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAI+CQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIVCQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE+VLAACYKALN+HHVLLEG+LLKPNMVTPGS+ K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAQVTEQVLAACYKALNEHHVLLEGSLLKPNMVTPGSESK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
              VIAEYTVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PTVIAEYTVRALQRTVPAAVPAIVFLSGG  268



>gb|KEH42090.1| fructose-bisphosphate aldolase [Medicago truncatula]
Length=358

 Score =   447 bits (1151),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 219/269 (81%), Positives = 237/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIG+PGKGILAADESTGTIGKR  SIN EN EANRRTLRELLF
Sbjct  1    MSSFKSKYEDELIANAAYIGSPGKGILAADESTGTIGKRFASINVENVEANRRTLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG L  LSGVILFEETLYQ T++G  FVD++K+  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGCLDCLSGVILFEETLYQKTAAGVPFVDVLKKAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L QRC+KYYEAGARFAKWRAVLKIG NEP+ LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDDLGQRCKKYYEAGARFAKWRAVLKIGPNEPSPLSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCADVTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDIAKCADVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA++TVRAL RT+PAAVPA+VFLSGG
Sbjct  240  PEVIAQHTVRALLRTVPAAVPAIVFLSGG  268



>ref|XP_008799938.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Phoenix dactylifera]
Length=358

 Score =   447 bits (1149),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 237/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY+DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYSDELIRNAAYIGTPGKGILAADESTGTIGKRLASINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T  GK FV++++EG VLPGIKVD G +EL GT+GETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTKDGKPFVEVLREGGVLPGIKVDKGTIELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D LA+RCQKYYEAGARFAKWRAVLKIG  EP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLAKRCQKYYEAGARFAKWRAVLKIGPTEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPH I+KCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILVDGPHCIKKCAAVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSE-SAKVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AE+TVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVVAEHTVRALQRTVPAAVPAIVFLSGG  268



>ref|XP_002453822.1| hypothetical protein SORBIDRAFT_04g019020 [Sorghum bicolor]
 gb|EES06798.1| hypothetical protein SORBIDRAFT_04g019020 [Sorghum bicolor]
Length=358

 Score =   446 bits (1148),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 219/269 (81%), Positives = 233/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENIEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T  GK FVD++ EG VLPGIKVD G +E+ GTN ETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTKDGKPFVDVLNEGGVLPGIKVDKGTIEVAGTNKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVL IG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLNIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDIE+CA VTE VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIERCAYVTEMVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRALQRTVPAAVPAIVFLSGG  268



>sp|P29356.1|ALF_SPIOL RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Spinacia oleracea]
 emb|CAA46649.1| fructose-bisphosphate aldolase [Spinacia oleracea]
Length=357

 Score =   446 bits (1146),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 236/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ Y+GKYADELIANA+YI TPGK ILAADESTGTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MTAYRGKYADELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGAL YLSGVILFEETLYQ T+ GK FVD MK+G VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALPYLSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLAQRC +YY AGARFAKWRAVLKIG  EP+ L+I ENANGLARY IICQ+NGLVP
Sbjct  121  QGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI++CA+V+ERVLAACYKALNDHHVLLEGT LKPN+VTPGS+ K +V 
Sbjct  181  IVEPEILVDGTHDIDRCAEVSERVLAACYKALNDHHVLLEGTSLKPNIVTPGSESK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+P AVP V+FLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPQAVPGVMFLSGG  268



>sp|P17784.2|ALF_ORYSJ RecName: Full=Fructose-bisphosphate aldolase cytoplasmic isozyme; 
AltName: Full=Gravity-specific protein GSC 233 [Oryza sativa 
Japonica Group]
 gb|AAS05825.1| fructose 1,6-bisphosphate aldolase [Oryza sativa Japonica Group]
 gb|AAT85154.1| putative fructose-bisphosphate aldolase [Oryza sativa Japonica 
Group]
 gb|AAT85207.1| putative fructose-bisphosphate aldolase [Oryza sativa Japonica 
Group]
 gb|ACA50482.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
 gb|ADM86851.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
Length=358

 Score =   446 bits (1146),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 234/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR+LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT  ETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|NP_001150049.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Zea mays]
 ref|XP_008654550.1| PREDICTED: uncharacterized protein LOC100272913 isoform X1 [Zea 
mays]
 gb|ACF86533.1| unknown [Zea mays]
 gb|ACG37623.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Zea mays]
 gb|AFW84242.1| fructose-bisphosphate aldolase [Zea mays]
Length=355

 Score =   445 bits (1145),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 235/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKYADELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQY+SGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT+ ETTT
Sbjct  61   CCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA+YTVR LQRT+PAAVPAVVFLSGG
Sbjct  240  PEVIAQYTVRTLQRTVPAAVPAVVFLSGG  268



>ref|NP_001055494.1| Os05g0402700 [Oryza sativa Japonica Group]
 dbj|BAF17408.1| Os05g0402700 [Oryza sativa Japonica Group]
 gb|EEE63668.1| hypothetical protein OsJ_18486 [Oryza sativa Japonica Group]
Length=333

 Score =   444 bits (1142),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 234/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR+LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT  ETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>gb|ACF79162.1| unknown [Zea mays]
 gb|ACF85907.1| unknown [Zea mays]
 tpg|DAA56269.1| TPA: aldolase1 [Zea mays]
Length=355

 Score =   445 bits (1144),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 234/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQY+SGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT+ ETTT
Sbjct  61   CCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPAVVFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAVVFLSGG  268



>gb|EEC79199.1| hypothetical protein OsI_19907 [Oryza sativa Indica Group]
Length=333

 Score =   444 bits (1141),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 234/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR+LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT  ETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTKDGKLFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_003615520.1| Fructose-bisphosphate aldolase [Medicago truncatula]
Length=737

 Score =   457 bits (1177),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 221/269 (82%), Positives = 240/269 (89%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SI+ EN E+NRR LRELLF
Sbjct  1    MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSISVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG LQYLSGVILFEETLYQST++GK FVD++ E  VLPGIKVD G VEL GT+GETTT
Sbjct  61   TAPGVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC KYYEAGARFAKWRAVLKIG NEP++ SI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSEHSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+KCA VTE+VLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDIQKCAAVTEKVLAACYKALNDHHVLLEGTLLKPNMVTPGSDAP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  240  PEVVAEHTVRALQRTVPAAVPAVVFLSGG  268


 Score =   404 bits (1037),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 203/277 (73%), Positives = 225/277 (81%), Gaps = 24/277 (9%)
 Frame = +3

Query  60   HLSNNNLITMSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEAN  239
            HLS++ +        ++ADELIANA YIGTPGKGILAADESTGTIGKRL SI  EN E+N
Sbjct  394  HLSSDTV--------EFADELIANAAYIGTPGKGILAADESTGTIGKRLASIGVENVESN  445

Query  240  RRTLRELLFTTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVEL  419
            RR LRELLFT PG LQYLSGVIL EETLYQST++GK FVD++ E  VLPGIKVD G VEL
Sbjct  446  RRALRELLFTAPGVLQYLSGVILSEETLYQSTTAGKPFVDVLNEAGVLPGIKVDKGTVEL  505

Query  420  PGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAI  599
             GT+GETTTQGLDGL  RC KYYEAGARFAKWRAVLKIG NEP++ SI+ENA GLARYA+
Sbjct  506  AGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSEHSIHENAYGLARYAV  565

Query  600  ICQQNGLVPIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTP  779
            ICQ+NGLVPIVEPEILVDGPHDI+KCA VTE+VLAACY               KPNMVTP
Sbjct  566  ICQENGLVPIVEPEILVDGPHDIQKCAAVTEKVLAACY---------------KPNMVTP  610

Query  780  GSDCKNRVKAEVIAEYTVRALQRTMPAAVPAVVFLSG  890
            GSD   +V  EV+AE+TVRALQRT+PAAVPAVVFLSG
Sbjct  611  GSDAP-KVAPEVVAEHTVRALQRTVPAAVPAVVFLSG  646



>emb|CAA37290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   444 bits (1141),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 233/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR+LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT  ETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIHLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI+ CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDPCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_002458944.1| hypothetical protein SORBIDRAFT_03g043140 [Sorghum bicolor]
 gb|EES04064.1| hypothetical protein SORBIDRAFT_03g043140 [Sorghum bicolor]
Length=355

 Score =   443 bits (1140),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 234/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQY+SGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT+ ETTT
Sbjct  61   CCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTDKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E+IAEYTVR LQRT+PAAVPAVVFLSGG
Sbjct  240  PELIAEYTVRTLQRTVPAAVPAVVFLSGG  268



>ref|NP_001105336.1| fructose-bisphosphate aldolase, cytoplasmic isozyme [Zea mays]
 sp|P08440.1|ALF_MAIZE RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Zea mays]
 gb|AAA33435.1| aldolase [Zea mays]
 emb|CAA31366.1| fructose bisphosphate aldolase [Zea mays]
 prf||1307278A cytoplasmic aldolase
Length=355

 Score =   443 bits (1140),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 217/269 (81%), Positives = 234/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQY+SGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT+ ETTT
Sbjct  61   CCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPAV+FLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAVLFLSGG  268



>dbj|BAI59774.1| aldolase C-1 [Phyllostachys edulis]
Length=358

 Score =   442 bits (1136),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 215/269 (80%), Positives = 234/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA +IGTPGKGILAADESTGTIGKR  SIN EN E NRR+LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAHIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQ+LSGVILFEETLYQ T  GK FVD++ EG VLPGIKVD G +E+ GTN ETTT
Sbjct  61   CTPGALQHLSGVILFEETLYQKTKDGKPFVDVLNEGGVLPGIKVDKGTIEVAGTNKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVLLEG+LLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGSLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_004497605.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Cicer arietinum]
Length=358

 Score =   442 bits (1136),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 214/269 (80%), Positives = 238/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K  + DELIANA YIG+PGKGILAADESTGTIGKR  SI+ +N EANRR LRELLF
Sbjct  1    MSSFKSNFEDELIANAAYIGSPGKGILAADESTGTIGKRFASISVDNVEANRRILRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG L+ LSGVILFEETLYQ T++G+ FV+++K+G VLPGIKVD G VELPGTNGETTT
Sbjct  61   TAPGCLECLSGVILFEETLYQKTAAGEPFVEVLKKGGVLPGIKVDKGTVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L QRC+KYYEAGARFAKWRAVLKIG NEP+ LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDDLGQRCKKYYEAGARFAKWRAVLKIGPNEPSPLSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDI+ CADVTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGSHDIQTCADVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TVRAL RT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEHTVRALLRTVPAAVPAIVFLSGG  268



>ref|XP_004952502.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Setaria italica]
Length=358

 Score =   441 bits (1134),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 216/269 (80%), Positives = 232/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENIEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGALQYLSGVILFEETLYQ T  GK FVD++ EG VLPGIKVD G +E+ GTN ETTT
Sbjct  61   CAPGALQYLSGVILFEETLYQKTKDGKPFVDVLNEGGVLPGIKVDKGTIEVAGTNKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVL IG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLNIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIE+CA +TE VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGSHDIERCAYITEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR+LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRSLQRTVPAAVPAIVFLSGG  268



>ref|XP_004491539.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Cicer arietinum]
Length=357

 Score =   441 bits (1133),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 214/269 (80%), Positives = 234/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN EANR+ LRELLF
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P ALQYLSGVILFEETLYQ++S GK FV++++E NV+PGIKVD GVVEL GTNGETTT
Sbjct  61   TSPNALQYLSGVILFEETLYQNSSEGKPFVEILQENNVIPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG NEP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HD+ KCA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGAHDVAKCAAVTETVLAACYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+PAAVP VVFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPAAVPGVVFLSGG  268



>gb|KCW87412.1| hypothetical protein EUGRSUZ_B03891, partial [Eucalyptus grandis]
Length=348

 Score =   438 bits (1127),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 213/259 (82%), Positives = 230/259 (89%), Gaps = 1/259 (0%)
 Frame = +3

Query  117  ELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQYLS  296
            ELIANA YIGTPGKGILAADESTGTIGKR  +IN EN E NRRT RELLF TPGALQ LS
Sbjct  1    ELIANAAYIGTPGKGILAADESTGTIGKRFAAINVENVETNRRTYRELLFCTPGALQCLS  60

Query  297  GVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQRC  476
            G ILFEETL+Q T+ GK FV++++EG VLPGIKVD G VEL GTNGETTTQGLDGLAQRC
Sbjct  61   GAILFEETLFQKTADGKPFVEVLQEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRC  120

Query  477  QKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVDG  656
            Q+YY AGARFAKWRAVLKIG  EP+QL+INENANGLARYAIICQ+NGLVPIVEPEILVDG
Sbjct  121  QQYYAAGARFAKWRAVLKIGAAEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDG  180

Query  657  PHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTVR  836
             HDI++ ADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V  EV+AEYTVR
Sbjct  181  DHDIDRSADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSA-KVPPEVVAEYTVR  239

Query  837  ALQRTMPAAVPAVVFLSGG  893
            ALQRT+P AVP +VFLSGG
Sbjct  240  ALQRTVPPAVPGIVFLSGG  258



>ref|XP_007142455.1| hypothetical protein PHAVU_008G282000g [Phaseolus vulgaris]
 gb|ESW14449.1| hypothetical protein PHAVU_008G282000g [Phaseolus vulgaris]
Length=357

 Score =   438 bits (1127),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 214/269 (80%), Positives = 231/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN EANR+ LRELLF
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P ALQYLSGVILFEETLYQ TS GK FV+++ E NV+PGIKVD GVVEL  TNGETTT
Sbjct  61   TAPNALQYLSGVILFEETLYQKTSDGKPFVEVLNENNVIPGIKVDKGVVELAATNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG NEP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGAHDIAKCAAVTEIVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV+AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAEYTVQALRRTVPAAVPGIVFLSGG  268



>dbj|BAI59775.1| aldolase C-2 [Phyllostachys edulis]
Length=358

 Score =   437 bits (1124),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 213/269 (79%), Positives = 231/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GK+ DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKFKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQ LSGVILFEETLYQ T  GK FVD++ EG VLPGIKVD G +E+ GTN ETTT
Sbjct  61   CTPGALQCLSGVILFEETLYQKTKDGKPFVDVLNEGGVLPGIKVDKGTIEIAGTNKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVL IG NEP+QL+I+ NA GLARYAI+CQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLNIGPNEPSQLAIDLNAQGLARYAIVCQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVLLEG+LLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGSLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_006654377.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=358

 Score =   437 bits (1124),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 214/269 (80%), Positives = 232/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT  ETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L ++C +YYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKQCARYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV  LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVCTLQRTVPAAVPAIVFLSGG  268



>ref|NP_001237315.1| fructose-bisphosphate aldolase [Glycine max]
 gb|AAR86689.1| fructose-bisphosphate aldolase [Glycine max]
Length=357

 Score =   437 bits (1123),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 214/269 (80%), Positives = 231/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN EANR+ LRELLF
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P ALQYLSGVILFEETLYQ TS GK FV++++E NV+PGIKVD GVVEL GTNGETTT
Sbjct  61   TAPNALQYLSGVILFEETLYQKTSDGKPFVEVLQENNVIPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI KCA VTE VLAACYKALN+ HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGAHDIAKCAAVTETVLAACYKALNEQHVLLEGTLLKPNMVTPGSDSP-KVP  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+PAAVP VVFLSGG
Sbjct  240  PEVIAEYTVNALRRTVPAAVPGVVFLSGG  268



>sp|P46257.1|ALF2_PEA RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
2 [Pisum sativum]
 emb|CAA61947.1| fructose-1,6-bisphosphate aldolase [Pisum sativum]
Length=359

 Score =   437 bits (1123),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 215/270 (80%), Positives = 235/270 (87%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSHFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLF  60

Query  267  TTPGA-LQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETT  443
            T     LQYLSGVILFEETLYQ T++GK FVD++ E  VLPGIKVD G VEL GT+GETT
Sbjct  61   TASWLFLQYLSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETT  120

Query  444  TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLV  623
            TQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEP++ SI+ENA GLARYA+ICQ+NGLV
Sbjct  121  TQGLDGLGARCRKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEILVDG HDI KCA +TERVLAA YKAL+DHHV+LEGTLLKPNMVTPGSD   +V
Sbjct  181  PIVEPEILVDGSHDILKCAAITERVLAATYKALSDHHVILEGTLLKPNMVTPGSDAP-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
              EVIAE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  240  APEVIAEHTVRALQRTVPAAVPAVVFLSGG  269



>ref|XP_010545295.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Tarenaya hassleriana]
Length=359

 Score =   436 bits (1122),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 213/269 (79%), Positives = 233/269 (87%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR++LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENIESNRQSLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PGAL Y+SGVILFEETLYQ TS GK FVD+++E  V+PGIKVD GVVEL GTNGETTT
Sbjct  61   TSPGALSYISGVILFEETLYQKTSDGKPFVDVLEENGVIPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L QRCQ+YY+AGARFAKWRAVLKIG  EP++LSI ENA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGQRCQQYYKAGARFAKWRAVLKIGPTEPSELSIQENAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGNHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVG  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP VVFLSGG
Sbjct  240  PEVIAEYTVAALRRTVPPAVPGVVFLSGG  268



>gb|KHG27282.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Gossypium 
arboreum]
Length=353

 Score =   436 bits (1122),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 215/260 (83%), Positives = 228/260 (88%), Gaps = 1/260 (0%)
 Frame = +3

Query  114  DELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQYL  293
            DEL  NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLFT PGALQ++
Sbjct  5    DELAKNAAYIGTPGKGILAADESTGTIGKRLASINVENVEENRRALRELLFTAPGALQFI  64

Query  294  SGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQR  473
            SGVI FEETLYQ T+SGK FVD++KE  VLPGIKVD+G V L GTN ET TQGLDGLAQR
Sbjct  65   SGVIFFEETLYQKTASGKLFVDVLKESGVLPGIKVDTGTVVLNGTNDETFTQGLDGLAQR  124

Query  474  CQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVD  653
            CQKYYEAGARFAKWRAVLKIGT EPT+L+I ENANGLA Y+ ICQQ GLVPIVEPEILVD
Sbjct  125  CQKYYEAGARFAKWRAVLKIGTIEPTELAIQENANGLAMYSAICQQCGLVPIVEPEILVD  184

Query  654  GPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTV  833
            GPHDI KCA VTERVLAACYKALNDHHV+LEGTLLKPNMVTPGSD   +V  EVIAE+TV
Sbjct  185  GPHDINKCAAVTERVLAACYKALNDHHVMLEGTLLKPNMVTPGSDSP-KVAPEVIAEHTV  243

Query  834  RALQRTMPAAVPAVVFLSGG  893
            RALQRT+P AVPAVVFLSGG
Sbjct  244  RALQRTVPPAVPAVVFLSGG  263



>ref|XP_003617895.1| Fructose-bisphosphate aldolase [Medicago truncatula]
 gb|AET00854.1| fructose-bisphosphate aldolase [Medicago truncatula]
 gb|AFK40688.1| unknown [Medicago truncatula]
Length=357

 Score =   436 bits (1122),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 212/269 (79%), Positives = 232/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN EANR+ LRELLF
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P ALQYLSGVILFEETLYQ++S GK FV++++E NV+PGIKVD GV+EL GTNGETTT
Sbjct  61   TSPNALQYLSGVILFEETLYQNSSEGKPFVEILQENNVIPGIKVDKGVIELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG NEP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI KCA VTE VLAA YKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGSHDIAKCAAVTETVLAAVYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVI EYTV AL+RT+PAAVP VVFLSGG
Sbjct  240  PEVIGEYTVTALRRTVPAAVPGVVFLSGG  268



>ref|XP_004970966.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Setaria italica]
Length=358

 Score =   436 bits (1120),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 215/269 (80%), Positives = 231/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENIEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
              PGAL  LSGVILFEETLYQ T  GK FVD++KEG VLPGIKVD G +E+ GT+ ETTT
Sbjct  61   CCPGALPCLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTDKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC KYYEAGARFAKWRAVLKIG NEP+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIE+CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGSHDIERCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSK-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPAAVPAIVFLSGG  268



>ref|XP_003544567.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Glycine max]
Length=357

 Score =   435 bits (1118),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 213/269 (79%), Positives = 231/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN EANR+ LRELLF
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLSSINVENIEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P ALQYLSGVILFEETLYQ TS GK FV++++E NV+PGIKVD GVVEL GTNGETTT
Sbjct  61   TAPDALQYLSGVILFEETLYQKTSDGKPFVEVLQENNVIPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI KCA VTE VLAA YKALN+ HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGAHDIAKCAAVTETVLAAVYKALNEQHVLLEGTLLKPNMVTPGSDSP-KVP  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV+AL+RT+PAAVP VVFLSGG
Sbjct  240  PEVIAEYTVQALRRTVPAAVPGVVFLSGG  268



>gb|EAY94426.1| hypothetical protein OsI_16195 [Oryza sativa Indica Group]
Length=358

 Score =   434 bits (1117),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 210/269 (78%), Positives = 231/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQY+SGVILF+ETLYQ T  GK FVD++KE   LPGIKVD G +E+ GT+ ETTT
Sbjct  61   CTPGALQYISGVILFDETLYQKTKDGKPFVDVLKEAGALPGIKVDKGTIEVAGTDKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L ++C KYYEAGARFAKWRAVLKIG N+P+QL+I+ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDDLGKQCAKYYEAGARFAKWRAVLKIGPNQPSQLAIDLNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+P AVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPPAVPAIVFLSGG  268



>ref|NP_001265896.1| fructose-bisphosphate aldolase, cytoplasmic isozyme [Cicer arietinum]
 sp|O65735.1|ALF_CICAR RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Cicer arietinum]
 emb|CAA06308.1| cytosolic fructose-1,6-bisphosphate aldolase [Cicer arietinum]
Length=359

 Score =   434 bits (1116),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 218/271 (80%), Positives = 233/271 (86%), Gaps = 4/271 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P  LQYLSGVILFEETLYQST++GK FVD++ E  VLPGIKVD G VEL GT+GETTT
Sbjct  61   TAPNVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQ--LSINENANGLARYAIICQQNGL  620
            QGLDGL  RC KYYEAGARFAKWRAVLKIG NEP+   LSI ENA GLARYA+ICQ+NGL
Sbjct  121  QGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSLSILSI-ENAYGLARYAVICQENGL  179

Query  621  VPIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNR  800
            VPIVE EILVDG HDI KCA +TERVLAA YKAL+DHHVLLEGTLLKPNMVTPGSD   +
Sbjct  180  VPIVELEILVDGSHDIHKCAAITERVLAATYKALSDHHVLLEGTLLKPNMVTPGSDSP-K  238

Query  801  VKAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            V  EV+AE+TVRALQRT+PAAVPAVVFLSGG
Sbjct  239  VAPEVVAEHTVRALQRTVPAAVPAVVFLSGG  269



>ref|XP_006851631.1| hypothetical protein AMTR_s00040p00201950 [Amborella trichopoda]
 gb|ERN13161.1| hypothetical protein AMTR_s00040p00201950 [Amborella trichopoda]
Length=357

 Score =   434 bits (1115),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 214/260 (82%), Positives = 229/260 (88%), Gaps = 1/260 (0%)
 Frame = +3

Query  114  DELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQYL  293
            DELI NA YIGTPG+GILAADESTGTIGKRL SIN EN E+NRR LRELLF TPGALQ L
Sbjct  9    DELIKNAAYIGTPGRGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQCL  68

Query  294  SGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQR  473
            SGVILFEETLYQ +SSGK FV+++KEG VLPGIKVD G VEL GTNGETTTQGLDGLA R
Sbjct  69   SGVILFEETLYQKSSSGKPFVEILKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAAR  128

Query  474  CQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVD  653
            CQ+YY AGARFAKWRAVLKIG  EP+ LSI ENANGLARYAIICQ+NGLVPIVEPEILVD
Sbjct  129  CQQYYAAGARFAKWRAVLKIGPTEPSPLSILENANGLARYAIICQENGLVPIVEPEILVD  188

Query  654  GPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTV  833
            G H IE CA  TERVLAA YK+LNDHHVLLEGTLLKPNMVTPGSD   +V  EVIAE+T+
Sbjct  189  GSHSIEVCAAATERVLAAVYKSLNDHHVLLEGTLLKPNMVTPGSDAP-KVAPEVIAEHTI  247

Query  834  RALQRTMPAAVPAVVFLSGG  893
            RALQRT+PAAVPA+VFLSGG
Sbjct  248  RALQRTVPAAVPAIVFLSGG  267



>gb|ABK23585.1| unknown [Picea sitchensis]
Length=364

 Score =   434 bits (1116),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 210/271 (77%), Positives = 236/271 (87%), Gaps = 1/271 (0%)
 Frame = +3

Query  81   ITMSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLREL  260
            ++ + Y GKY++ELIA A YI TPGKGILAADESTGTIGKRL SIN EN E NRR+LREL
Sbjct  6    LSGNSYYGKYSEELIATANYIATPGKGILAADESTGTIGKRLSSINVENVEVNRRSLREL  65

Query  261  LFTTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGET  440
            LFTTPGALQYLSGVI FEETLYQST+SGK FV++++E  V+PGIKVD G V+L  TNGET
Sbjct  66   LFTTPGALQYLSGVIFFEETLYQSTASGKPFVEVLQEAGVVPGIKVDKGTVDLAATNGET  125

Query  441  TTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGL  620
            TTQGLDGLAQRCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGL
Sbjct  126  TTQGLDGLAQRCQQYYKAGARFAKWRAVLKIGPTEPSELSIEQNAQGLARYAIICQENGL  185

Query  621  VPIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNR  800
            VPIVEPEIL DG HDI KCA VTE V+AA YKALNDHHVLLEGTLLKPNMV+PG+D   +
Sbjct  186  VPIVEPEILTDGSHDIHKCAAVTENVVAAVYKALNDHHVLLEGTLLKPNMVSPGTDGP-K  244

Query  801  VKAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            V  E IAE+TVRALQRT+PAAVP +VFLSGG
Sbjct  245  VPPEEIAEHTVRALQRTVPAAVPGIVFLSGG  275



>sp|P46256.1|ALF1_PEA RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Pisum sativum]
 emb|CAA61946.1| fructose-1,6-bisphosphate aldolase [Pisum sativum]
Length=357

 Score =   432 bits (1112),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 210/269 (78%), Positives = 230/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN EANR+ LRELLF
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P ALQYLSGVILFEETLYQ +S GK FV++++E NV+PGIKVD GVVEL GT+GETTT
Sbjct  61   TSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG NEP++LSI +NA GLARYAIICQ+NGLV 
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVL  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
             VEPEIL DG HDI KCA VTE VLAACYKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  FVEPEILTDGSHDIAKCAAVTETVLAACYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVI EYTV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIGEYTVNALRRTVPAAVPGIVFLSGG  268



>gb|KHN48186.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Glycine 
soja]
Length=346

 Score =   432 bits (1110),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/261 (82%), Positives = 228/261 (87%), Gaps = 8/261 (3%)
 Frame = +3

Query  111  ADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQY  290
            ADELIANATYIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLFT PG L+ 
Sbjct  4    ADELIANATYIGTPGKGILAADESTGTIGKRLASINVENVETNRRILRELLFTAPGCLEC  63

Query  291  LSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQ  470
            LSGVILFEETLYQ +++G  FVD++K+G VLPGIKVD G VEL GTNGETTTQGLD LAQ
Sbjct  64   LSGVILFEETLYQKSAAGVPFVDILKKGGVLPGIKVDKGTVELAGTNGETTTQGLDDLAQ  123

Query  471  RCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILV  650
            RC+KYYEAGARFAKWRAVLKIG NEP+ LSI+ENANGLARYA ICQ+NGLVPIVEPEIL 
Sbjct  124  RCKKYYEAGARFAKWRAVLKIGPNEPSPLSIHENANGLARYAAICQENGLVPIVEPEILS  183

Query  651  DGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYT  830
            DGPHDI KCADVTERVLAACYKALNDHHVLLEGTLLKPN          RV AEVIAE+T
Sbjct  184  DGPHDIAKCADVTERVLAACYKALNDHHVLLEGTLLKPNAA--------RVTAEVIAEHT  235

Query  831  VRALQRTMPAAVPAVVFLSGG  893
            VRALQRT+P AVPA+VFLSGG
Sbjct  236  VRALQRTVPPAVPAIVFLSGG  256



>gb|AAR88661.1| fructose-bisphosphate aldolase [Pandanus amaryllifolius]
Length=358

 Score =   431 bits (1109),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 210/269 (78%), Positives = 230/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+ GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSCFIGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PGAL+YLSGVILFEETLYQ T  GK FVD++ E NV+PGIKVD G+VEL GTNGETTT
Sbjct  61   TSPGALEYLSGVILFEETLYQKTRDGKPFVDVLTENNVIPGIKVDKGIVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCQQYYKAGARFAKWRAVLKIGATEPSELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI KCA  TE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGTHDINKCAAATETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE TV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAECTVTALRRTVPAAVPGIVFLSGG  268



>gb|ABK22375.1| unknown [Picea sitchensis]
Length=364

 Score =   431 bits (1108),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 209/271 (77%), Positives = 234/271 (86%), Gaps = 1/271 (0%)
 Frame = +3

Query  81   ITMSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLREL  260
            ++ + Y GKY++ELIA A YI TPGKGILAADESTGTIGKRL SIN EN E NRR+LREL
Sbjct  6    LSGNSYYGKYSEELIATANYIATPGKGILAADESTGTIGKRLSSINVENVEVNRRSLREL  65

Query  261  LFTTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGET  440
            LFTTPGALQYLSGVI FEETLYQST+SGK FV++++E  V+PGIKVD G V+L  TNGET
Sbjct  66   LFTTPGALQYLSGVIFFEETLYQSTASGKPFVEVLQEAGVVPGIKVDKGTVDLAATNGET  125

Query  441  TTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGL  620
            TTQGLDGLAQRCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGL
Sbjct  126  TTQGLDGLAQRCQQYYKAGARFAKWRAVLKIGPTEPSELSIEQNAQGLARYAIICQENGL  185

Query  621  VPIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNR  800
            VPIVEPEIL DG HDI KCA VTE V+AA YKALNDHHVLLEGTLLKPNMV PG+D   +
Sbjct  186  VPIVEPEILTDGSHDIHKCAAVTENVVAAVYKALNDHHVLLEGTLLKPNMVLPGTDGP-K  244

Query  801  VKAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
               E IAE+TVRALQRT+PAAVP +VFLSGG
Sbjct  245  APPEEIAEHTVRALQRTVPAAVPGIVFLSGG  275



>ref|NP_568127.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
 gb|AED90642.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
Length=393

 Score =   432 bits (1110),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/259 (84%), Positives = 236/259 (91%), Gaps = 0/259 (0%)
 Frame = +3

Query  117  ELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLFTTPGALQYLS  296
            ELIANA YIGTPGKGILAADESTGTIGKR  SIN EN E+NRR LRELLFTTPGALQY+S
Sbjct  45   ELIANAAYIGTPGKGILAADESTGTIGKRFVSINVENVESNRRALRELLFTTPGALQYIS  104

Query  297  GVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQRC  476
            G+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT GLDGL  RC
Sbjct  105  GIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTTTGLDGLGDRC  164

Query  477  QKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVDG  656
            +KYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVPIVEPEILVDG
Sbjct  165  KKYYEAGARFAKWRAVLKIGNNEPSELAIHENAYGLARYAVICQENGLVPIVEPEILVDG  224

Query  657  PHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTVR  836
             HDIEKCA VTERVLAACYKAL+DHHV+LEGTLLKPNMVTPGSD  ++VK EVIA++TVR
Sbjct  225  SHDIEKCAYVTERVLAACYKALSDHHVILEGTLLKPNMVTPGSDSGSKVKPEVIAKHTVR  284

Query  837  ALQRTMPAAVPAVVFLSGG  893
            ALQRT+PAAVPAVVFLSGG
Sbjct  285  ALQRTVPAAVPAVVFLSGG  303



>ref|XP_006857683.1| hypothetical protein AMTR_s00061p00163810 [Amborella trichopoda]
 gb|ERN19150.1| hypothetical protein AMTR_s00061p00163810 [Amborella trichopoda]
Length=357

 Score =   430 bits (1106),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 208/269 (77%), Positives = 236/269 (88%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+EL+  A YI +PGKGILAADESTGTIGKRL SIN EN E+NRR LRELLF
Sbjct  1    MSAFVGKYAEELMKIAQYIVSPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PGAL YLSGVILFEETLYQSTSSG+ FVD++ +  V+PGIKVD GVVEL GT+ ETT 
Sbjct  61   TSPGALSYLSGVILFEETLYQSTSSGQPFVDVLNDNGVIPGIKVDKGVVELAGTDSETTA  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RCQ+YY+AG RFAKWRAVLKIG+ EP+QLSI++NA+GLARYAIICQ+NGLVP
Sbjct  121  QGLDGLGARCQQYYKAGVRFAKWRAVLKIGSTEPSQLSIDQNAHGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA+VTERVLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGAHDIKKCAEVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDGP-KVG  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAEHTVTALRRTVPAAVPGIVFLSGG  268



>ref|XP_010448258.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   429 bits (1104),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 210/269 (78%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKR  SIN ENNE+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINVENNESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PG    LSGVILFEETLYQ TS GK FVDL+ E  V+PGIKVD GVV+L GTNGETTT
Sbjct  61   TSPGTFPCLSGVILFEETLYQKTSEGKPFVDLLMENGVIPGIKVDKGVVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI ENA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGTRCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGNHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSA-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>gb|AAR84667.1| fructose 1,6, bisphosphate aldolase [Salicornia herbacea]
Length=359

 Score =   430 bits (1105),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 209/269 (78%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+TLRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVESNRQTLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PGAL +LSGVILFEETLYQ TS GK F  L++E  V+PGIKVD GVVEL GTNGETTT
Sbjct  61   TSPGALPFLSGVILFEETLYQKTSQGKPFAQLLQENGVIPGIKVDKGVVELSGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQEYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE V AACYKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGNHDIKKCAAVTETVHAACYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  AEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>gb|KFK29173.1| hypothetical protein AALP_AA7G098900 [Arabis alpina]
Length=358

 Score =   429 bits (1102),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 209/269 (78%), Positives = 226/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKY DELI  A YI TPGKGILAADESTGTIGKR  SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYKDELIKTAKYIATPGKGILAADESTGTIGKRFSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PGAL  LSGVI FEETLYQ TS GK FVD + E  V+PGIKVD GVVEL GTNGETTT
Sbjct  61   TSPGALPCLSGVIFFEETLYQKTSDGKLFVDFLLENGVIPGIKVDKGVVELSGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI ENA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPAAVPGIVFLSGG  268



>dbj|BAA02729.1| cytoplasmic aldolase [Oryza sativa Japonica Group]
Length=358

 Score =   429 bits (1102),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 208/269 (77%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR  RELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRAFRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQY+SGVILF+ETLYQ T  GK FVD++KE   LPGIKVD G +E+ GT+ ETTT
Sbjct  61   CTPGALQYISGVILFDETLYQKTKDGKPFVDILKEAGALPGIKVDKGTIEVAGTDKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L ++C KYYEAGARFAKWRAVLKIG N+P+QL+I+ NA GLA YAIICQ+NGLVP
Sbjct  121  QGHDDLGKQCAKYYEAGARFAKWRAVLKIGPNQPSQLAIDLNAQGLACYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+P AVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPPAVPAIVFLSGG  268



>gb|ABG65931.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EAZ15405.1| hypothetical protein OsJ_30817 [Oryza sativa Japonica Group]
 dbj|BAG92549.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   429 bits (1102),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 208/269 (77%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR  RELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRAFRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQY+SGVILF+ETLYQ T  GK FVD++KE   LPGIKVD G +E+ GT+ ETTT
Sbjct  61   CTPGALQYISGVILFDETLYQKTKDGKPFVDVLKEAGALPGIKVDKGTIEVAGTDKETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L ++C KYYEAGARFAKWRAVLKIG N+P+QL+I+ NA GLA YAIICQ+NGLVP
Sbjct  121  QGHDDLGKQCAKYYEAGARFAKWRAVLKIGPNQPSQLAIDLNAQGLACYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGSD K +V 
Sbjct  181  IVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVR LQRT+P AVPA+VFLSGG
Sbjct  240  PEVIAEYTVRTLQRTVPPAVPAIVFLSGG  268



>ref|XP_007020393.1| Aldolase superfamily protein [Theobroma cacao]
 gb|EOY11918.1| Aldolase superfamily protein [Theobroma cacao]
Length=357

 Score =   428 bits (1100),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 231/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL  IN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLAGINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL +LSGVILFEETLYQ TS GK FV++++E NV+PGIKVD G VE+ GTNGETTT
Sbjct  61   TSPNALSFLSGVILFEETLYQKTSDGKPFVEVLQENNVIPGIKVDKGTVEIAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG NEP++LSI +NA GLARY+IICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAEGLARYSIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DGPHDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGPHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PQVIAEYTVAALRRTVPPAVPGIVFLSGG  268



>ref|XP_011095600.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Sesamum indicum]
Length=396

 Score =   429 bits (1103),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 207/270 (77%), Positives = 232/270 (86%), Gaps = 1/270 (0%)
 Frame = +3

Query  84   TMSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELL  263
            TMS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELL
Sbjct  39   TMSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIESNRQALRELL  98

Query  264  FTTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETT  443
            FT+P +L YLSGVILFEETLYQ TS GK FV++++E +V+PGIKVD G VE+ GTNGETT
Sbjct  99   FTSPSSLSYLSGVILFEETLYQKTSDGKPFVEVLQENDVIPGIKVDKGTVEIAGTNGETT  158

Query  444  TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLV  623
            TQG D L  RCQ+YY+AGARFAKWRAVLKIG +EP++LSI +NA GLARYAIICQ+NGLV
Sbjct  159  TQGFDSLGARCQQYYKAGARFAKWRAVLKIGPSEPSELSIQQNAQGLARYAIICQENGLV  218

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEIL DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V
Sbjct  219  PIVEPEILTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KV  277

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
              EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  278  APEVIAEYTVTALRRTVPPAVPGIVFLSGG  307



>ref|XP_006474808.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Citrus sinensis]
Length=357

 Score =   427 bits (1098),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 230/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL +LSGVILFEETLYQ TS GK FV++++E NV+PGIKVD G VE+ GTNGETTT
Sbjct  61   TSPNALSFLSGVILFEETLYQKTSDGKPFVEVLQENNVIPGIKVDKGTVEIAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMV PGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVAPGSDGP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  AEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_010246553.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Nelumbo nucifera]
Length=357

 Score =   427 bits (1098),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 230/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVI FEETLYQ TS GK FV++++E NV+PGIKVD G V++ GTNGETTT
Sbjct  61   TSPNALAYLSGVIHFEETLYQKTSGGKPFVEVLQENNVIPGIKVDKGTVDIAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG NEP++L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVGALRRTVPPAVPGIVFLSGG  268



>gb|AFK45996.1| unknown [Lotus japonicus]
Length=314

 Score =   425 bits (1093),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 206/250 (82%), Positives = 223/250 (89%), Gaps = 1/250 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANA YIG PGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSNFKGKYHDELIANAAYIGIPGKGILAADESTGTIGKRLASINVENVETNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+SGVILFEETLYQST++GK FVD++KE  VLPGIKVD G VEL GT+GETTT
Sbjct  61   TTPGALQYISGVILFEETLYQSTAAGKPFVDVLKEAGVLPGIKVDKGTVELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RC KYY+AGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGARCAKYYKAGARFAKWRAVLKIGPNEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA +TERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILVDGPHDIHKCAAITERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVR  836
             EV+AE+TVR
Sbjct  240  PEVVAEHTVR  249



>ref|XP_010252855.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Nelumbo nucifera]
Length=357

 Score =   427 bits (1097),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 207/269 (77%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIETNRRELRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ TS GK FV++++E NV+PGIKVD G V++ GT GETTT
Sbjct  61   TSPNALAYLSGVILFEETLYQKTSDGKPFVEVLEENNVIPGIKVDKGTVDIAGTKGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG NEP++L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGNHDINKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  AEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_009142435.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Brassica rapa]
 emb|CDX89329.1| BnaA01g15640D [Brassica napus]
Length=358

 Score =   427 bits (1097),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 207/269 (77%), Positives = 228/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKR  SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PGAL  LSGVILFEETLYQ TS GK FV+ ++E  V+PGIKVD GVV+L GTNGETTT
Sbjct  61   TSPGALPCLSGVILFEETLYQKTSDGKPFVEFLQENGVIPGIKVDKGVVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI ENA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VL+A YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLSAVYKALNDHHVLLEGTLLKPNMVTPGSDSA-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_010676114.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Beta vulgaris subsp. vulgaris]
Length=357

 Score =   426 bits (1095),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 228/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKR  SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINVENIESNRQILRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PGAL ++SGVILFEETLYQ TS GK FV++++E  V+PGIKVD GVVEL GTN ETTT
Sbjct  61   TSPGALSFISGVILFEETLYQKTSEGKPFVEVLQENGVIPGIKVDKGVVELAGTNEETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQEYYKAGARFAKWRAVLKIGVTEPSELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMV PGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVVPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAEYTV AL+RT+P AVP VVFLSGG
Sbjct  240  AEVIAEYTVTALRRTVPPAVPGVVFLSGG  268



>ref|XP_002869605.1| hypothetical protein ARALYDRAFT_492157 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45864.1| hypothetical protein ARALYDRAFT_492157 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   426 bits (1094),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 208/269 (77%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKR  SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINVENVESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PGA   LSGVILFEETLYQ TS GK FVDL+ E  V+PGIKVD GVV+L GTNGETTT
Sbjct  61   TSPGAFPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGVVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI ENA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP ++FLSGG
Sbjct  240  PEVIAEYTVTALRRTVPPAVPGILFLSGG  268



>emb|CAN83666.1| hypothetical protein VITISV_008795 [Vitis vinifera]
Length=357

 Score =   426 bits (1094),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI NA YI TPGKGILAADESTGTIGKRL SI  +NNE NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLSSIKVDNNEPNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ+T  GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALSYLSGVILFEETLYQNTRDGKPFVEVLQENNVIPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWR+VLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRSVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGS    +V 
Sbjct  181  IVEPEILTDGDHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGS-AGPKVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            +EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  SEVIAEYTVAALRRTVPPAVPGIVFLSGG  268



>ref|XP_002263794.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Vitis vinifera]
 emb|CBI39851.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   425 bits (1093),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI NA YI TPGKGILAADESTGTIGKRL SI  +NNE NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLSSIKVDNNEPNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ+T  GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALSYLSGVILFEETLYQNTRDGKPFVEVLQENNVIPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWR+VLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRSVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGS    +V 
Sbjct  181  IVEPEILTDGDHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGS-AGPKVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            +EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  SEVIAEYTVAALRRTVPPAVPGIVFLSGG  268



>ref|XP_006284000.1| hypothetical protein CARUB_v10005122mg [Capsella rubella]
 gb|EOA16898.1| hypothetical protein CARUB_v10005122mg [Capsella rubella]
Length=358

 Score =   425 bits (1093),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 208/269 (77%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKR  SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PG +  LSGVILFEETLYQ TS GK FVDL+ E  V+PGIKVD GVV+L GTNGETTT
Sbjct  61   TSPGTVPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGVVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI ENA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_011037763.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Populus euphratica]
Length=357

 Score =   425 bits (1092),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 208/269 (77%), Positives = 228/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+  AL YLSGVILFEETLYQ TS GK FV+++ E NV+PGIKVD GVVEL GTNGETTT
Sbjct  61   TSGKALPYLSGVILFEETLYQKTSDGKPFVEVLHENNVIPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEFTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_006346102.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Solanum tuberosum]
Length=357

 Score =   424 bits (1091),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 208/269 (77%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+EL+ NA YI TPGKGILAADESTGTIGKRL SIN EN EANR+ LRELLF
Sbjct  1    MSAFVGKYAEELMKNAKYIATPGKGILAADESTGTIGKRLSSINVENIEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ+T  GK FV+L++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALPYLSGVILFEETLYQNTCDGKPFVELLQENNVVPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCAQYYKAGARFAKWRAVLKIGATEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE VLAA YKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGNHDIKKCAAATETVLAAVYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  AEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_006661653.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=361

 Score =   424 bits (1090),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 209/272 (77%), Positives = 231/272 (85%), Gaps = 4/272 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKR  SIN EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEDNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQY+SGVILFEETLYQ T  GK FVD+++EG  LPGIKVD G VE+ GT+ ETTT
Sbjct  61   CTPGALQYISGVILFEETLYQKTKDGKLFVDVLREGGALPGIKVDRGTVEVAGTDRETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L ++C +YYEAGARFAKWRAVLKIG +EP+QL+I+ NA GLARYAI+CQ+NGLVP
Sbjct  121  QGHDDLGKQCARYYEAGARFAKWRAVLKIGAHEPSQLAIDLNAQGLARYAIVCQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTE---RVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKN  797
            IVEPEILVDG HDI++CA V+E     LAACYKALN+HHVLLEGTLLKPNMVTPGSD K 
Sbjct  181  IVEPEILVDGAHDIDRCAYVSEGGGGRLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-  239

Query  798  RVKAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            +V  EVIAEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  240  KVAPEVIAEYTVRTLQRTVPAAVPALVFLSGG  271



>ref|XP_009799651.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Nicotiana sylvestris]
Length=357

 Score =   424 bits (1090),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 230/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL +LSGVILFEETLYQ+TS GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALTHLSGVILFEETLYQNTSDGKPFVEVLQENNVVPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE VLAA YKALNDHHVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEILTDGDHDIKKCAAATETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSNSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  AEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_011000316.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Populus euphratica]
Length=357

 Score =   424 bits (1089),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 208/269 (77%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+  AL YLSGVILFEETLYQ TS GK FV+++ E NV+PGIKVD GVVEL GTNGETTT
Sbjct  61   TSGKALPYLSGVILFEETLYQKTSDGKPFVEVLHENNVIPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGAHDIMKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEFTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_006656232.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Oryza brachyantha]
Length=358

 Score =   424 bits (1089),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 228/270 (84%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVEPNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQST+SG  FVD++K G V+PGIKVD G VE+ GTNGETTT
Sbjct  61   TAPGALQYLSGVILFEETLYQSTASGTPFVDVLKAGGVVPGIKVDKGTVEIAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIG-TNEPTQLSINENANGLARYAIICQQNGLV  623
            QGLD L  RC KYYEAGARFAKWRAVLKIG   EP++L++ +NA GLARYA+ICQ+NGLV
Sbjct  121  QGLDSLGARCAKYYEAGARFAKWRAVLKIGAAGEPSELAVKQNAEGLARYALICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEIL DG HDI+ CA VTERVLAA YK+LNDH VLLEGTLLKPNMVTPGSD   +V
Sbjct  181  PIVEPEILTDGGHDIKTCAAVTERVLAAVYKSLNDHKVLLEGTLLKPNMVTPGSDSP-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             AEVI EYTV AL+RT+P AVP +VFLSGG
Sbjct  240  GAEVIGEYTVAALRRTVPPAVPGIVFLSGG  269



>ref|XP_004139771.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Cucumis sativus]
 ref|XP_004156348.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Cucumis sativus]
 gb|KGN44117.1| hypothetical protein Csa_7G195260 [Cucumis sativus]
Length=403

 Score =   425 bits (1093),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/272 (75%), Positives = 231/272 (85%), Gaps = 1/272 (0%)
 Frame = +3

Query  78   LITMSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRE  257
            L+ MS + GKYA+ELI NA +I TPGKGILAADESTGTIGKRL SI+ EN E+NR+ LRE
Sbjct  44   LLIMSAFVGKYAEELIKNAKFIATPGKGILAADESTGTIGKRLASISVENVESNRQALRE  103

Query  258  LLFTTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGE  437
            LLFT+P AL YLSGVILFEETLYQ TS GK FV++++E NV+PGIKVD G VEL GTNGE
Sbjct  104  LLFTSPNALSYLSGVILFEETLYQKTSDGKPFVEVLQENNVIPGIKVDKGTVELAGTNGE  163

Query  438  TTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNG  617
            TTTQG D L  RC ++Y+AGARFAKWRAVLKIG +EP++LSI +NA GLARYAIICQ+NG
Sbjct  164  TTTQGFDSLGARCAQFYKAGARFAKWRAVLKIGPSEPSELSIQQNAQGLARYAIICQENG  223

Query  618  LVPIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKN  797
            LVPIVEPEIL DGPHDI KCA  TE VLAA YKAL+DHHVLLEGTLLKPNMVTPGS    
Sbjct  224  LVPIVEPEILTDGPHDINKCAAATEIVLAAVYKALSDHHVLLEGTLLKPNMVTPGSGSP-  282

Query  798  RVKAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            +V  EV+AEYTV AL+RT+PAAVP VVFLSGG
Sbjct  283  KVAPEVVAEYTVAALRRTVPAAVPGVVFLSGG  314



>ref|XP_001768658.1| predicted protein [Physcomitrella patens]
 gb|EDQ66596.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   423 bits (1088),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 228/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ Y GKYA+EL A A Y+ TPGKGILAADESTGTIGKRL SI  EN EANR+ LRELLF
Sbjct  1    MAPYSGKYAEELQATAKYVATPGKGILAADESTGTIGKRLSSIKVENVEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPG  +YLSGVILFEETLYQ TS GK FVD+MKE  ++PGIKVD G +EL GTNGETTT
Sbjct  61   TTPGVGEYLSGVILFEETLYQKTSDGKPFVDVMKENGIIPGIKVDKGTIELWGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC  YY AGARFAKWRAVLKIG  EPT+L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLHKRCAAYYNAGARFAKWRAVLKIGALEPTELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG H IEKCA+VTE+VLAACYKALND +VLLEGTLLKPNMVTPGSD + +V 
Sbjct  181  IVEPEILVDGLHSIEKCAEVTEKVLAACYKALNDQNVLLEGTLLKPNMVTPGSDAE-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+A+YTVR LQRT+P AVP +VFLSGG
Sbjct  240  PEVVAQYTVRTLQRTVPPAVPGIVFLSGG  268



>ref|XP_010929015.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 isoform X1 [Elaeis guineensis]
 ref|XP_010929016.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 isoform X2 [Elaeis guineensis]
Length=357

 Score =   423 bits (1088),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/269 (76%), Positives = 228/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ T+ GK FVD++ E +V+PGIKVD G VE+ GTN ETTT
Sbjct  61   TSPNALSYLSGVILFEETLYQKTTGGKPFVDVLIENSVIPGIKVDKGTVEIAGTNSETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE+VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGNHDIKKCAAVTEKVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVAALRRTVPPAVPGIVFLSGG  268



>ref|XP_004244020.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Solanum lycopersicum]
Length=357

 Score =   423 bits (1088),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 207/269 (77%), Positives = 228/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLSSINVENIEPNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQSTS GK FV+L++E +V+PGIKVD G V+L GTNGETTT
Sbjct  61   TSPNALPYLSGVILFEETLYQSTSDGKPFVELLQENHVVPGIKVDKGTVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQYYKAGARFAKWRAVLKIGATEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE VLAA YKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGNHDIKKCAAATETVLAAVYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  AEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_006452682.1| hypothetical protein CICLE_v10008762mg [Citrus clementina]
 gb|ESR65922.1| hypothetical protein CICLE_v10008762mg [Citrus clementina]
Length=357

 Score =   423 bits (1087),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 204/269 (76%), Positives = 228/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI  PGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIAAPGKGILAADESTGTIGKRLASINVENIESNRQVLRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL +LSGVILFEETLYQ TS GK FV++++E NV+PGIKVD G VE+ GTN ETTT
Sbjct  61   TSPNALSFLSGVILFEETLYQKTSDGKPFVEVLQENNVIPGIKVDKGTVEIAGTNCETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMV PGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVAPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  AEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_008218850.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Prunus mume]
Length=357

 Score =   422 bits (1085),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ T+ GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALTYLSGVILFEETLYQKTTDGKPFVEVLQENNVIPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+K A VTE VLAA YKALN+HHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGDHDIKKNAAVTETVLAAVYKALNEHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPAAVPGIVFLSGG  268



>gb|ACU16628.1| unknown [Glycine max]
Length=273

 Score =   419 bits (1077),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 202/242 (83%), Positives = 217/242 (90%), Gaps = 0/242 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +K KY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN EANRR LRELLF
Sbjct  1    MSSFKSKYQDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEANRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGA + LSGVILFEETLYQ T+SGK FV+LMKEG VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGAFECLSGVILFEETLYQKTASGKPFVELMKEGGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL  RCQKYYEAGARFAKWRAVLKIG NEP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGARCQKYYEAGARFAKWRAVLKIGPNEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHDI KCA+VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+ K   +
Sbjct  181  IVEPEILVDGPHDINKCAEVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSESKKSPQ  240

Query  807  AE  812
            ++
Sbjct  241  SD  242



>ref|XP_008447787.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Cucumis melo]
Length=357

 Score =   422 bits (1085),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 203/269 (75%), Positives = 230/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA +I TPGKGILAADESTGTIGKRL SI+ EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKFIATPGKGILAADESTGTIGKRLASISVENVESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ TS GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALSYLSGVILFEETLYQKTSDGKPFVEVLQENNVIPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC ++Y+AGARFAKWRAVLKIG +EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQFYKAGARFAKWRAVLKIGPSEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DGPHDI+KCA  TE VLAA YKAL+DHHVLLEGTLLKPNMVTPGS    +V 
Sbjct  181  IVEPEILTDGPHDIKKCAAATEIVLAAVYKALSDHHVLLEGTLLKPNMVTPGSGSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +V+AEYTV AL+RT+PAAVP VVFLSGG
Sbjct  240  PQVVAEYTVAALRRTVPAAVPGVVFLSGG  268



>ref|XP_007205428.1| hypothetical protein PRUPE_ppa007744mg [Prunus persica]
 gb|EMJ06627.1| hypothetical protein PRUPE_ppa007744mg [Prunus persica]
Length=357

 Score =   422 bits (1085),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ T+ GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALTYLSGVILFEETLYQKTTDGKPFVEVLQENNVIPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+K A VTE VLAA YKALN+HHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGDHDIKKNAAVTETVLAAVYKALNEHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPAAVPGIVFLSGG  268



>ref|XP_006413170.1| hypothetical protein EUTSA_v10025556mg [Eutrema salsugineum]
 gb|ESQ54623.1| hypothetical protein EUTSA_v10025556mg [Eutrema salsugineum]
Length=358

 Score =   422 bits (1085),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 207/269 (77%), Positives = 226/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKR  SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL  LSGVILFEETLYQ T+ GK FVD + E  V+PGIKVD GVVEL GTNGETTT
Sbjct  61   TSPDALPCLSGVILFEETLYQKTTDGKPFVDFLLENGVIPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI ENA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCQEYYKAGARFAKWRAVLKIGDTEPSELSIQENAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEHTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_002299056.1| fructose-1 family protein [Populus trichocarpa]
 gb|ABK94744.1| unknown [Populus trichocarpa]
 gb|EEE83861.1| fructose-1 family protein [Populus trichocarpa]
Length=357

 Score =   422 bits (1084),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+  AL YLSGVILFEETLYQ  S GK FV++++E N++PGIKVD GVVEL GTNGETTT
Sbjct  61   TSGKALPYLSGVILFEETLYQKASDGKPFVEVLQENNIIPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA VTE VLAA YKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGSHDIKKCAAVTETVLAAVYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|NP_194383.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
 ref|NP_001031721.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
 emb|CAA18217.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 emb|CAB79508.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAM64926.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAN72017.1| fructose-bisphosphate aldolase - like protein [Arabidopsis thaliana]
 gb|AAP68283.1| At4g26530 [Arabidopsis thaliana]
 gb|AEE85214.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
 gb|AEE85215.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
Length=358

 Score =   422 bits (1084),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 226/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKR  SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PG    LSGVILFEETLYQ T+ GK FV+L+ E  V+PGIKVD GVV+L GTNGETTT
Sbjct  61   TSPGTFPCLSGVILFEETLYQKTTDGKPFVELLMENGVIPGIKVDKGVVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI ENA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|NP_001058042.1| Os06g0608700 [Oryza sativa Japonica Group]
 dbj|BAD35621.1| putative fructose-bisphosphate aldolase [Oryza sativa Japonica 
Group]
 dbj|BAF19956.1| Os06g0608700 [Oryza sativa Japonica Group]
 dbj|BAG89311.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96633.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86648.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86655.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80950.1| hypothetical protein OsI_23662 [Oryza sativa Indica Group]
 gb|ACN85163.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Oryza nivara]
Length=358

 Score =   422 bits (1084),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 206/270 (76%), Positives = 228/270 (84%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVEPNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGA QYLSGVILFEETLYQST++G  FVD++K G V+PGIKVD G V++ GTNGETTT
Sbjct  61   TTPGAFQYLSGVILFEETLYQSTAAGTPFVDVLKAGGVVPGIKVDKGTVDIAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIG-TNEPTQLSINENANGLARYAIICQQNGLV  623
            QGLD L  RC KYYEAGARFAKWRAVLKIG   EP++L++ +NA GLARYA+ICQ+NGLV
Sbjct  121  QGLDSLGARCAKYYEAGARFAKWRAVLKIGAAGEPSELAVKQNAEGLARYALICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEIL DG HDI+ CA VTERVLAA YK+LNDH VLLEGTLLKPNMVTPGSD   +V
Sbjct  181  PIVEPEILTDGAHDIKTCAAVTERVLAAVYKSLNDHKVLLEGTLLKPNMVTPGSDSP-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             AEVI EYTV AL+RT+P AVP +VFLSGG
Sbjct  240  GAEVIGEYTVAALRRTVPPAVPGIVFLSGG  269



>ref|XP_002519633.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
 gb|EEF42778.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
Length=357

 Score =   422 bits (1084),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 204/269 (76%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL +LSGVILFEETLYQ TS GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALSHLSGVILFEETLYQKTSDGKPFVEVLQENNVVPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DGPHDI+KCA +TE VLAA YKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGPHDIKKCAAMTEIVLAAVYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E+IAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEMIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_001767043.1| predicted protein [Physcomitrella patens]
 gb|EDQ68209.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   421 bits (1083),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 203/269 (75%), Positives = 228/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ Y GKYA+EL A A YI TPGKGILAADESTGTIGKRL SI  EN EANR+ LRELLF
Sbjct  1    MAPYSGKYAEELQATAKYIATPGKGILAADESTGTIGKRLSSIKVENVEANRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPG  ++LSGVILFEETLYQ T+ GK FVD+MKE  ++PGIKVD G + L GTNGETTT
Sbjct  61   TTPGVGEFLSGVILFEETLYQKTADGKPFVDVMKENGIIPGIKVDKGTINLWGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L +RC  YY+AGARFAKWRAVLKIG  EPT+L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDDLHKRCAAYYDAGARFAKWRAVLKIGELEPTELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG H I+KCA+VTE+VLAACYKALND HVLLEGTLLKPNMVTPGSD + +V 
Sbjct  181  IVEPEILVDGSHSIDKCAEVTEKVLAACYKALNDQHVLLEGTLLKPNMVTPGSDAE-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+A+YTVR LQRT+P AVP +VFLSGG
Sbjct  240  PEVVAKYTVRTLQRTVPPAVPGIVFLSGG  268



>ref|XP_010438739.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   421 bits (1083),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 226/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKR  SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PG    LSGVILFEETLYQ TS GK FVDL+ E  V+PGIKVD GVV+L GTNGETTT
Sbjct  61   TSPGTFPCLSGVILFEETLYQKTSEGKPFVDLLMENGVIPGIKVDKGVVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI ENA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGTRCQEYYKAGARFAKWRAVLKIGDTEPSELSIQENAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI++CA VTE VLAA YKALN+HHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGSHDIKQCAAVTETVLAAVYKALNEHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA+YTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIADYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_008363363.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Malus domestica]
Length=357

 Score =   421 bits (1082),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 204/269 (76%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ +S GK FV +++E NV+PGIKVD G V L GTNGETTT
Sbjct  61   TSPNALPYLSGVILFEETLYQKSSDGKPFVKILQENNVIPGIKVDKGTVXLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQYYKAGARFAKWRAVLKIGLTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE+VLAA YKALN+ HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGDHDIKKCAAATEKVLAAVYKALNEQHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPAAVPGIVFLSGG  268



>emb|CDP13668.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 207/269 (77%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS   GKYA+ELI  A YI +PGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSASVGKYAEELIKTANYIASPGKGILAADESTGTIGKRLASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PGAL  LSGVILFEETLYQ TS GK FV++++E NV+PGIKVD GVVEL GTNGETTT
Sbjct  61   TSPGALACLSGVILFEETLYQKTSDGKPFVEVLQENNVVPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RC +YY AGARFAKWRAVLKIG  EP++LS+ +NA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCAQYYRAGARFAKWRAVLKIGPTEPSELSVQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA VTE VLAA YKAL+DHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGNHDIKKCAAVTEIVLAAVYKALSDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPAAVPGIVFLSGG  268



>ref|XP_011039825.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Populus euphratica]
Length=357

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+  AL YLSGVILFEETLYQ  S GK FV++++E N++PGIKVD GVV+L GTNGETTT
Sbjct  61   TSRKALPYLSGVILFEETLYQKASDGKPFVEVLQENNIIPGIKVDKGVVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA VTE VLAA YKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGSHDIKKCAAVTETVLAAVYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_006377966.1| fructose-1 family protein [Populus trichocarpa]
 gb|ERP55763.1| fructose-1 family protein [Populus trichocarpa]
Length=357

 Score =   421 bits (1081),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             +  AL YLSGVILFEETLYQ +S GK FV++++E NV+PGIKVD GVVEL GTNGETTT
Sbjct  61   KSGKALPYLSGVILFEETLYQKSSDGKPFVEVLQENNVIPGIKVDKGVVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGAHDIKKCAAATETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE+TV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEFTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_010433486.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X1 [Camelina sativa]
 ref|XP_010433487.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Camelina sativa]
 ref|XP_010433488.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Camelina sativa]
 ref|XP_010433489.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Camelina sativa]
Length=358

 Score =   421 bits (1082),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 226/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKR  SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+PG    LSGVILFEETLYQ TS GK FVDL+ E  V+PGIKVD GVV+L GTNGETTT
Sbjct  61   TSPGTFPCLSGVILFEETLYQKTSDGKPFVDLLMESGVIPGIKVDKGVVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGTRCQEYYKAGARFAKWRAVLKIGATEPSELSIQDNAKGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI++CA VTE VLAA YKALN+HHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGSHDIKQCAAVTETVLAAVYKALNEHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIA+YTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIADYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_010103967.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 [Morus 
notabilis]
 gb|EXB97670.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 [Morus 
notabilis]
Length=357

 Score =   421 bits (1081),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI  A YI TPGKGILAADESTGTIGKRL SIN EN E NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKTAKYIATPGKGILAADESTGTIGKRLASINVENIELNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL  LSGVILFEETLYQ TS GK FV++++E  V+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALSCLSGVILFEETLYQKTSDGKPFVEVLEENGVVPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCSQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DGPHDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGPHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAE+TV AL+RT+P AVP +VFLSGG
Sbjct  240  AEVIAEHTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_010089412.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Morus notabilis]
 gb|EXB37765.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Morus notabilis]
Length=339

 Score =   419 bits (1078),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/269 (74%), Positives = 230/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS ++ KY DELIANA Y  TPGKGILAADE+   +  R  +IN EN E+NRR LRELLF
Sbjct  1    MSAFRSKYQDELIANAAYFRTPGKGILAADETIDEMTDRFSAINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQYLSG+ILFEETLYQ T++GK FV+++KEG VLPGI +D G+VELPGTNGETTT
Sbjct  61   TTPGALQYLSGIILFEETLYQKTAAGKPFVEVLKEGGVLPGIGIDKGLVELPGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            +GLD L QRC+KYYEAG RFAKW+ VLKIGTNEP+QL+INENA+ LARYA ICQ+N LVP
Sbjct  121  EGLDDLGQRCRKYYEAGVRFAKWQVVLKIGTNEPSQLAINENASVLARYAAICQENRLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            +VEP+IL++G HDIEKCA  +ERVLAA YKALNDHHVLLE TLLKP+MVTPG   K +V 
Sbjct  181  VVEPDILLEGSHDIEKCAAASERVLAAIYKALNDHHVLLEATLLKPSMVTPGLKAK-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTVRALQRT+PAAVPA++FLSGG
Sbjct  240  PEVIAEYTVRALQRTVPAAVPAILFLSGG  268



>ref|XP_008353167.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Malus domestica]
Length=357

 Score =   420 bits (1079),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 204/269 (76%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ +S GK FV +++E NV+PGIKVD G V L GTNGETTT
Sbjct  61   TSPNALPYLSGVILFEETLYQKSSDGKPFVKILQENNVIPGIKVDKGTVXLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQYYKAGARFAKWRAVLKIGLTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE+VLAA YKALN+ HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGDHDIKKCAAATEKVLAAVYKALNEQHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPAAVPGIVFLSGG  268



>ref|XP_010061415.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Eucalyptus grandis]
 gb|KCW68357.1| hypothetical protein EUGRSUZ_F02017 [Eucalyptus grandis]
Length=357

 Score =   420 bits (1079),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 206/269 (77%), Positives = 225/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL  IN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLAGINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P AL YLSGVILFEETLYQ TS GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TCPNALPYLSGVILFEETLYQKTSEGKPFVEVLQENNVIPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE VLAA YKALND HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGSHDIKKCAAATETVLAAVYKALNDQHVLLEGTLLKPNMVTPGSDSP-KVP  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVTALRRTVPPAVPGIVFLSGG  268



>ref|XP_004294907.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Fragaria vesca subsp. vesca]
Length=357

 Score =   420 bits (1079),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 204/269 (76%), Positives = 230/269 (86%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ+T+ GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALPYLSGVILFEETLYQNTTDGKPFVEVLQENNVIPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RC +YY+AGARFAKWR+VLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGARCAQYYKAGARFAKWRSVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE VLAA YKALN+ HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGDHDIKKCAAATEIVLAAVYKALNEQHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             +VIAEYTV AL+RT+PAAVP +VFLSGG
Sbjct  240  PQVIAEYTVTALRRTVPAAVPGIVFLSGG  268



>emb|CDY43716.1| BnaAnng07310D [Brassica napus]
Length=343

 Score =   419 bits (1077),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 202/270 (75%), Positives = 232/270 (86%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ +  KYADELIANA YIGTPGKGILAADEST TIGKR  S+N EN ++NRR LRELLF
Sbjct  1    MASFTTKYADELIANAAYIGTPGKGILAADESTDTIGKRFSSVNVENVDSNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSG-VVELPGTNGETT  443
            TTPGAL  +SGVIL EETLYQ +S+G  FVD++KEG VLPGIKVD G  VEL GTN ET 
Sbjct  61   TTPGALPCISGVILVEETLYQKSSNGTSFVDILKEGGVLPGIKVDKGRAVELAGTNSETI  120

Query  444  TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLV  623
            TQGLDGL +RC+KYYEAGARFAKW A+LKIG NEP++L+I+ENA GLARYA ICQ+NGLV
Sbjct  121  TQGLDGLGERCKKYYEAGARFAKWHALLKIGPNEPSELAIHENAYGLARYAAICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEP++ VDG HDI KCA+VTER LAACYKAL+DHHV+LEGTLLKPNMVTPGS+   +V
Sbjct  181  PIVEPDVSVDGSHDIHKCAEVTERFLAACYKALSDHHVMLEGTLLKPNMVTPGSESA-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
              EV+AEYTVRAL RT+PAAVPA++F+SGG
Sbjct  240  APEVVAEYTVRALLRTVPAAVPAILFMSGG  269



>ref|XP_001765506.1| predicted protein [Physcomitrella patens]
 gb|EDQ69767.1| predicted protein [Physcomitrella patens]
Length=355

 Score =   419 bits (1078),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 202/269 (75%), Positives = 229/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKYADELI  A +IGTPGKGILAADEST TIG RLQSIN EN EANR+ LRE+LF
Sbjct  1    MSAYWGKYADELIRTAKFIGTPGKGILAADESTSTIGTRLQSINVENTEANRQALREMLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG  Q+LSGVI++EETLYQ T +GK FV L++E  V+ GIKVD+GVV L GTNGETTT
Sbjct  61   TAPGIHQFLSGVIMYEETLYQKTLAGKPFVKLLEEMGVMTGIKVDTGVVPLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG DGL  RC+KYYEAGARFAKWRAVLKIG  EP++L I +NA GLARYAI+CQ+NGLVP
Sbjct  121  QGHDGLGARCKKYYEAGARFAKWRAVLKIGHTEPSELGIQQNAQGLARYAILCQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI KCA+VTERVLAACYKALND HVLLEGTLLKPNMVTPGS+   +V 
Sbjct  181  IVEPEVLSDGTHDIRKCAEVTERVLAACYKALNDQHVLLEGTLLKPNMVTPGSEAP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             ++IA++TVRALQRT+P AVPAV+FLSGG
Sbjct  240  CDIIAKFTVRALQRTVPPAVPAVMFLSGG  268



>gb|ACN85267.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Oryza alta]
Length=358

 Score =   419 bits (1078),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 206/270 (76%), Positives = 227/270 (84%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVEPNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQST++G  FVD++K G V+PGIKVD G VE+ GTN ETTT
Sbjct  61   TAPGALQYLSGVILFEETLYQSTAAGVPFVDVLKVGGVVPGIKVDKGTVEIAGTNSETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIG-TNEPTQLSINENANGLARYAIICQQNGLV  623
            QGLD L  RC KYYEAGARFAKWRAVLKIG   EP++L++ +NA GLARYA+ICQ+NGLV
Sbjct  121  QGLDSLGARCAKYYEAGARFAKWRAVLKIGAAGEPSELAVKQNAEGLARYALICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEIL DG HDI+ CA VTERVLAA YK+LNDH VLLEGTLLKPNMVTPGSD   +V
Sbjct  181  PIVEPEILTDGAHDIKTCAAVTERVLAAVYKSLNDHKVLLEGTLLKPNMVTPGSDSP-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             AEVI EYTV AL+RT+P AVP +VFLSGG
Sbjct  240  GAEVIGEYTVAALRRTVPPAVPGIVFLSGG  269



>gb|EPS69505.1| fructose-bisphosphate aldolase [Genlisea aurea]
Length=359

 Score =   419 bits (1077),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 206/270 (76%), Positives = 228/270 (84%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKY+DELI  A YI TPGKGILAADESTGTIGKRL  IN EN EANRR LRELLF
Sbjct  1    MSAFIGKYSDELIKTAKYIATPGKGILAADESTGTIGKRLAGINVENVEANRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQST++GK FV+L+ E  V+PGIKVD G VEL GT+GETTT
Sbjct  61   TSPSALSYLSGVILFEETLYQSTAAGKPFVELLNENGVVPGIKVDKGTVELAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIG-TNEPTQLSINENANGLARYAIICQQNGLV  623
            QGLD L  RCQ+YY+AGARFAKWRAVLKIG   EP++L++ +NA GLARYA ICQ+NGLV
Sbjct  121  QGLDSLGSRCQQYYKAGARFAKWRAVLKIGPAGEPSELAVQQNAQGLARYAAICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEIL DG H IEKCA VTE VLAA YKALNDH VLLEGTLLKPNMVTPGSD   +V
Sbjct  181  PIVEPEILTDGGHTIEKCAAVTETVLAAVYKALNDHKVLLEGTLLKPNMVTPGSDSP-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             AEVIAE+TVRAL+RT+P AVP +VFLSGG
Sbjct  240  AAEVIAEHTVRALRRTVPPAVPGIVFLSGG  269



>ref|XP_003563638.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Brachypodium distachyon]
Length=360

 Score =   419 bits (1076),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 204/270 (76%), Positives = 229/270 (85%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SI+ EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASISVENVESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGA++YLSGVILFEETLYQ +S G  FVD++K GNV+PGIKVD G VE+ GT+GETTT
Sbjct  61   TTPGAVEYLSGVILFEETLYQKSSDGTPFVDILKAGNVVPGIKVDKGTVEIAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIG-TNEPTQLSINENANGLARYAIICQQNGLV  623
            QGLD L  RC KYYEAGARFAKWRAVLKIG   EP++L++ +NA GLARYA+ICQ+NGLV
Sbjct  121  QGLDSLGARCAKYYEAGARFAKWRAVLKIGAAGEPSELAVKQNAEGLARYALICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEIL DG HDI+ CA  TERVLAA YK+LNDH VLLEGTLLKPNMVTPGSD   +V
Sbjct  181  PIVEPEILTDGGHDIKVCAAATERVLAAVYKSLNDHKVLLEGTLLKPNMVTPGSDSP-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             AEVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  GAEVIAEYTVAALRRTVPPAVPGIVFLSGG  269



>ref|XP_009620969.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Nicotiana tomentosiformis]
Length=357

 Score =   419 bits (1076),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 226/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SI  EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLASIKVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL +LSGVILFEETLYQ T  GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALTHLSGVILFEETLYQKTCDGKPFVEVLQENNVVPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQYYKAGARFAKWRAVLKIGPTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGNHDIKKCAAATETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            AEVIAEYTV AL RT+P AVP +VFLSGG
Sbjct  240  AEVIAEYTVTALCRTVPPAVPGIVFLSGG  268



>ref|XP_008355755.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Malus domestica]
Length=357

 Score =   418 bits (1075),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 204/269 (76%), Positives = 227/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL YLSGVILFEETLYQ +S GK FV++++E NV+PGIKVD G VEL GTNGETTT
Sbjct  61   TSPNALPYLSGVILFEETLYQKSSDGKPFVEILQENNVIPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQYYKAGARFAKWRAVLKIGLTEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA  TE VLAA YKALN+ HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGDHDIKKCAAATEMVLAAVYKALNEQHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAE TV AL+RT+PAAVP +VFLSGG
Sbjct  240  PEVIAECTVTALRRTVPAAVPGIVFLSGG  268



>ref|XP_009141596.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=343

 Score =   416 bits (1070),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 201/270 (74%), Positives = 232/270 (86%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ +  KYADELIANA YIGTPGKGILAADEST TIGKR  S+N EN +++RR LRELLF
Sbjct  1    MASFTTKYADELIANAAYIGTPGKGILAADESTDTIGKRFSSVNVENVDSSRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSG-VVELPGTNGETT  443
            TTPGAL  +SGVIL EETLYQ +S+G  FVD++KE  VLPGIKVD G  VEL GTN ET 
Sbjct  61   TTPGALPCISGVILVEETLYQKSSNGTPFVDILKERGVLPGIKVDKGRAVELAGTNSETI  120

Query  444  TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLV  623
            TQGLDGL +RC+KYYEAGARFAKW A+LK+G NEP++L+I+ENA GLARYA ICQ+NGLV
Sbjct  121  TQGLDGLGERCKKYYEAGARFAKWHALLKVGPNEPSELAIHENAYGLARYAAICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEP++ VDG HDI KCA+VTER LAACYKAL+DHHV+LEGTLLKPNMVTPGS+   +V
Sbjct  181  PIVEPDVSVDGSHDIHKCAEVTERFLAACYKALSDHHVMLEGTLLKPNMVTPGSESA-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
              EV+AEYTVRALQRT+PAAVPA++FLSGG
Sbjct  240  APEVVAEYTVRALQRTVPAAVPAILFLSGG  269



>ref|XP_010424793.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=526

 Score =   423 bits (1087),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 201/245 (82%), Positives = 219/245 (89%), Gaps = 0/245 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MSC+K K+ADELIANA YIGTPGKGILAADES GTIGKR  SIN EN E+NRR LRELLF
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESIGTIGKRFVSINVENVESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TTPGALQY+SG+ILFEETLYQ T+SGK FVD+MKE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TTPGALQYISGIILFEETLYQKTASGKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
             GLDGL  RC+KYYEAGARFAKWRAVLKIG  EP++L+I+ENA GLARYA+ICQ+NGLVP
Sbjct  121  IGLDGLGDRCKKYYEAGARFAKWRAVLKIGKEEPSELAIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDG HDIEKCA VTERVLAACYKAL+DHHV+LEGTLLKPNMVTPGSD  ++VK
Sbjct  181  IVEPEILVDGSHDIEKCASVTERVLAACYKALSDHHVILEGTLLKPNMVTPGSDSGSKVK  240

Query  807  AEVIA  821
             EVIA
Sbjct  241  PEVIA  245


 Score =   320 bits (819),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +3

Query  342  GKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRA  521
            GK FVD+MKE  VLPGIKVD G VEL GTNGETTT GLDGL  RC+KYYEAGARFAKWRA
Sbjct  253  GKLFVDVMKEAGVLPGIKVDKGTVELAGTNGETTTIGLDGLGDRCKKYYEAGARFAKWRA  312

Query  522  VLKIGTNEPTQLSINENANGLARYAIICQQNGLVPIVEPEILVDGPHDIEKCADVTERVL  701
            VLKIG  EP++L+I+ENA GLARYA+ICQ+NGLVPIVEPEILVDG HDIEKCA VTERVL
Sbjct  313  VLKIGKEEPSELAIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDIEKCASVTERVL  372

Query  702  AACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVKAEVIAEYTVRALQRTMPAAVPAVVF  881
            AACYKAL+DHHV+LEGTLLKPNMVTPGSD  ++VK EVIA +TVRALQRT+PAAVPAVVF
Sbjct  373  AACYKALSDHHVILEGTLLKPNMVTPGSDSGSKVKPEVIAAHTVRALQRTVPAAVPAVVF  432

Query  882  LSGG  893
            LSGG
Sbjct  433  LSGG  436



>dbj|BAJ85287.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88466.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score =   417 bits (1071),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 202/270 (75%), Positives = 228/270 (84%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADEL+  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRE+LF
Sbjct  1    MSAFVGKYADELMKTAKYIATPGKGILAADESTGTIGKRLASINVENVESNRQALREMLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL+YLSGVILFEETLYQ+ + G  FVD++K GNV+PGIKVD G V++ GT+GETTT
Sbjct  61   TAPGALEYLSGVILFEETLYQTAADGTPFVDILKAGNVIPGIKVDKGTVDIAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTN-EPTQLSINENANGLARYAIICQQNGLV  623
            QGLD L  RC KYYEAGARFAKWRAVLKIG   EP++L++ +NA GLARYA+ICQ+NGLV
Sbjct  121  QGLDSLGARCAKYYEAGARFAKWRAVLKIGPGAEPSELAVKQNAEGLARYALICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEIL DG HDI+ CA  TERVLAA YK+LNDH VLLEGTLLKPNMVTPGSD   +V
Sbjct  181  PIVEPEILTDGAHDIKACAAATERVLAAVYKSLNDHKVLLEGTLLKPNMVTPGSDSP-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             AEVIAEYTV AL+RT+P AVP VVFLSGG
Sbjct  240  GAEVIAEYTVAALRRTVPPAVPGVVFLSGG  269



>ref|XP_010942543.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Elaeis guineensis]
Length=357

 Score =   416 bits (1070),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 201/269 (75%), Positives = 224/269 (83%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T P AL YLSGVI FEETLYQ TS GK FV ++ E +V+PGIKVD G V++ GTN ETTT
Sbjct  61   TVPNALSYLSGVIFFEETLYQKTSDGKPFVHVLLENSVIPGIKVDKGTVDIAGTNSETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPTEPSELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DG HDI+KCA VTE+VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGNHDIKKCAAVTEKVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+ T+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVAALRHTVPPAVPGIVFLSGG  268



>gb|KDP32624.1| hypothetical protein JCGZ_13174 [Jatropha curcas]
Length=357

 Score =   416 bits (1069),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 203/269 (75%), Positives = 225/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRLASINVENVESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T   AL +LSGVILFEETLYQ TS GK FV++++E NV+PGIKVD G VEL GTN ETTT
Sbjct  61   TCGNALPFLSGVILFEETLYQKTSDGKPFVEVLQENNVIPGIKVDKGTVELAGTNSETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCAQYYKAGARFAKWRAVLKIGPTEPSELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPE+L DGPHDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEVLTDGPHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E IAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEEIAEYTVTALRRTVPPAVPGIVFLSGG  268



>emb|CBI30253.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   415 bits (1066),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/269 (77%), Positives = 224/269 (83%), Gaps = 19/269 (7%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+CYKGKY DELIANA YIGTPGKGILAADESTGTIGKRL SIN EN E NRR LRELLF
Sbjct  1    MTCYKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVEGNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
             TPGALQYLSGVILFEETLYQ T+SGK FVD+MKEG VLPGIKVD G V L GT+GETTT
Sbjct  61   CTPGALQYLSGVILFEETLYQKTASGKPFVDVMKEGGVLPGIKVDKGTVVLTGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL +RC KYY AGARFAKWRAVLKIG  EP++L+I+ENA GLARYA+ICQ+NGL  
Sbjct  121  QGLDGLGERCAKYYAAGARFAKWRAVLKIGPTEPSELAIHENAYGLARYAMICQENGL--  178

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
                            CA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS+ K +V 
Sbjct  179  ----------------CAYVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAK-KVS  221

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EV+AEYTVR LQRT+PAAVPA+VFLSGG
Sbjct  222  PEVVAEYTVRTLQRTVPAAVPAIVFLSGG  250



>gb|ACU18090.1| unknown [Glycine max]
Length=268

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 199/234 (85%), Positives = 212/234 (91%), Gaps = 0/234 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS +KGKY DELIANA YIGTPGKGILAADESTGTIGKRL SI+ EN E+NRR LRELLF
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASISVENIESNRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG LQYLSGVILFEETLYQST++GK FV+++KE  VLPGIKVD G VEL GTNGETTT
Sbjct  61   TAPGVLQYLSGVILFEETLYQSTAAGKPFVNVLKEAGVLPGIKVDKGTVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGL QRC KYYEAGARFAKWRAVLKIG NEP++LSI+ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLGQRCAKYYEAGARFAKWRAVLKIGPNEPSELSIHENAYGLARYAVICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSD  788
            IVEPEILVDGPHDI KCA VTERVLAACYKALNDHHVLLEGTLLKPNMVTPGS 
Sbjct  181  IVEPEILVDGPHDIHKCAAVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSQ  234



>ref|XP_006659075.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=360

 Score =   415 bits (1067),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/269 (75%), Positives = 225/269 (84%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+ Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SI  EN E NRR LRELLF
Sbjct  1    MAAYCGKYKDELIRNAAYIGTPGKGILAADESTGTIGKRLASIGVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL+ LSGVILFEETLYQST  G+ FVD++    VL GIKVD G V L GT+GETTT
Sbjct  61   TAPGALECLSGVILFEETLYQSTRDGRPFVDVLAAAGVLAGIKVDKGTVVLAGTDGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG DGLA+RC++YY AGARFAKWRAVL IG + P+QL+++ NA GLARYAIICQ+NGLVP
Sbjct  121  QGHDGLAERCRRYYAAGARFAKWRAVLSIGASRPSQLAVDANAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVE EILVDG H IE+CA+VTE VLAACYKAL+DHHVLLEGTLLKPNMVTPGSD K +  
Sbjct  181  IVEAEILVDGEHGIERCAEVTELVLAACYKALSDHHVLLEGTLLKPNMVTPGSDAK-KAS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E +AE+TVRAL RT+P AVPA+VFLSGG
Sbjct  240  PEAVAEHTVRALLRTVPPAVPAIVFLSGG  268



>ref|XP_008782993.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Phoenix dactylifera]
Length=357

 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 202/269 (75%), Positives = 223/269 (83%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADELIKTARYIATPGKGILAADESTGTIGKRLASINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL  LSGVILFEETLYQ +S G  FVD++ E +V+PGIKVD G VE+ GT  ETTT
Sbjct  61   TSPNALSCLSGVILFEETLYQKSSDGTPFVDVLMENSVIPGIKVDKGTVEIAGTKSETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RCQ+YY+AGARFAKWRAVLKIG  EP++L+I +NA GLARYAIICQ+NGL P
Sbjct  121  QGFDSLGARCQQYYKAGARFAKWRAVLKIGPAEPSELAIQQNAQGLARYAIICQENGLAP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI KCA VTERVLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGDHDITKCAAVTERVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVT  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             EVIAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEVIAEYTVAALRRTVPPAVPGIVFLSGG  268



>ref|XP_002970423.1| hypothetical protein SELMODRAFT_267384 [Selaginella moellendorffii]
 gb|EFJ28553.1| hypothetical protein SELMODRAFT_267384 [Selaginella moellendorffii]
Length=358

 Score =   414 bits (1064),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 202/269 (75%), Positives = 228/269 (85%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            M+   GKYADELI NA YI TPGKGILAADESTGTIGKRL SI  EN E+NR+ LRELLF
Sbjct  1    MAAVVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASIKVENVESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGALQYLSGVILFEETLYQ T++GK FVD++ E  VLPGIKVD G V + GTNGETTT
Sbjct  61   TAPGALQYLSGVILFEETLYQKTAAGKPFVDVLLENGVLPGIKVDKGTVPIAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLDGLA RC +YY+AGARFAKWRAVL IG ++P++L I ENA GLARYA+ICQ+NGLVP
Sbjct  121  QGLDGLAGRCAEYYKAGARFAKWRAVLNIGPSQPSELGIQENAQGLARYAMICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEILVDGPHD++ CA VTE VLAA YKAL+DHHVLLEGTLLKPNMVT GS+   +V 
Sbjct  181  IVEPEILVDGPHDLKTCAKVTEVVLAAVYKALSDHHVLLEGTLLKPNMVTHGSEAP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
            A+ IAE TV AL+RT+PAAVP ++FLSGG
Sbjct  240  AQEIAEATVLALRRTVPAAVPGIMFLSGG  268



>ref|XP_009391905.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Musa acuminata subsp. malaccensis]
Length=357

 Score =   413 bits (1061),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/269 (75%), Positives = 224/269 (83%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADELI  A YI TPGKGILAADESTGTIGKRL SIN EN E NR+ LRELLF
Sbjct  1    MSAFVGKYADELIRTAKYIATPGKGILAADESTGTIGKRLSSINVENTEPNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            TT  AL  +SGVILFEETLYQ TS+GK FVD++ +  V+PGIKVD G+VEL GTNGETTT
Sbjct  61   TTFDALPSISGVILFEETLYQKTSAGKPFVDVLADNKVIPGIKVDKGIVELAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QG D L  RC +YY+AGARFAKWRAVLKIG  EP++L+I +NA GLARYAIICQ+NGLVP
Sbjct  121  QGFDSLGARCLQYYKAGARFAKWRAVLKIGPTEPSELAIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI+KCA VTE VLAA YKALNDHHVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGNHDIKKCAAVTETVLAAVYKALNDHHVLLEGTLLKPNMVTPGSDSP-KVA  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
              V+AEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PAVVAEYTVGALRRTVPPAVPGIVFLSGG  268



>gb|EYU27475.1| hypothetical protein MIMGU_mgv1a008862mg [Erythranthe guttata]
Length=360

 Score =   412 bits (1060),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/269 (75%), Positives = 224/269 (83%), Gaps = 1/269 (0%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIGKRLSSINVENIESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T+P AL  LSGVILFEETLYQ T+ GK FVD++ +  VLPGIKVD G V+L GTNGETTT
Sbjct  61   TSPSALPLLSGVILFEETLYQKTTDGKPFVDVLLDNGVLPGIKVDKGTVDLAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIGTNEPTQLSINENANGLARYAIICQQNGLVP  626
            QGLD L  RC +YY+AGARFAKWRAVLKIG  EP++LSI +NA GLARYAIICQ+NGLVP
Sbjct  121  QGLDSLGSRCSQYYKAGARFAKWRAVLKIGATEPSELSIQQNAQGLARYAIICQENGLVP  180

Query  627  IVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRVK  806
            IVEPEIL DG HDI++CA  TE VLAA YKALN+ HVLLEGTLLKPNMVTPGSD   +V 
Sbjct  181  IVEPEILTDGSHDIKQCAAATETVLAAVYKALNEQHVLLEGTLLKPNMVTPGSDSP-KVS  239

Query  807  AEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             E IAEYTV AL+RT+P AVP +VFLSGG
Sbjct  240  PEEIAEYTVAALRRTVPPAVPGIVFLSGG  268



>ref|NP_001060880.1| Os08g0120600 [Oryza sativa Japonica Group]
 dbj|BAD10819.1| putative fructose-bisphosphate aldolase [Oryza sativa Japonica 
Group]
 dbj|BAF22794.1| Os08g0120600 [Oryza sativa Japonica Group]
 gb|EAZ05423.1| hypothetical protein OsI_27635 [Oryza sativa Indica Group]
 gb|EAZ41341.1| hypothetical protein OsJ_25856 [Oryza sativa Japonica Group]
 dbj|BAG91658.1| unnamed protein product [Oryza sativa Japonica Group]
Length=362

 Score =   412 bits (1060),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/271 (76%), Positives = 224/271 (83%), Gaps = 3/271 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS Y GKY DELI NA YIGTPGKGILAADESTGTIGKRL SI  EN E NRR LRELLF
Sbjct  1    MSAYCGKYKDELIRNAAYIGTPGKGILAADESTGTIGKRLASIGVENVEENRRALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PGAL  LSGVILFEETLYQST  G  FVD++    VL GIKVD G VEL GT+ ETTT
Sbjct  61   TAPGALDCLSGVILFEETLYQSTRDGTPFVDVLAAAGVLAGIKVDKGTVELAGTDRETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIG--TNEPTQLSINENANGLARYAIICQQNGL  620
            QG DGL +RC++YY AGARFAKWRAVL IG  ++ P+QL+++ NA GLARYAIICQ+NGL
Sbjct  121  QGHDGLGERCRRYYAAGARFAKWRAVLSIGRASSRPSQLAVDANAQGLARYAIICQENGL  180

Query  621  VPIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNR  800
            VPIVEPEILVDG H IE CA+VTERVLAACYKAL+DHHVLLEGTLLKPNMVTPGSD   R
Sbjct  181  VPIVEPEILVDGEHGIEACAEVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDAA-R  239

Query  801  VKAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
               EV+AE+TVRAL RT+P AVPA+VFLSGG
Sbjct  240  APPEVVAEHTVRALLRTVPPAVPAIVFLSGG  270



>ref|XP_004965915.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Setaria italica]
Length=359

 Score =   411 bits (1056),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 201/270 (74%), Positives = 225/270 (83%), Gaps = 2/270 (1%)
 Frame = +3

Query  87   MSCYKGKYADELIANATYIGTPGKGILAADESTGTIGKRLQSINTENNEANRRTLRELLF  266
            MS + GKYADE++  A Y+ TPGKGILA+DESTGTIGKRL SIN EN E+NR+ LRELLF
Sbjct  1    MSAFVGKYADEMVKTAKYLATPGKGILASDESTGTIGKRLSSINLENVESNRQALRELLF  60

Query  267  TTPGALQYLSGVILFEETLYQSTSSGKKFVDLMKEGNVLPGIKVDSGVVELPGTNGETTT  446
            T PG   YLSGVILFEETLYQ TS GK FVDL+  G V+PGIKVD G VE+ GTNGETTT
Sbjct  61   TAPGVFDYLSGVILFEETLYQKTSDGKPFVDLLTAGGVVPGIKVDKGTVEIAGTNGETTT  120

Query  447  QGLDGLAQRCQKYYEAGARFAKWRAVLKIG-TNEPTQLSINENANGLARYAIICQQNGLV  623
            QGLD L  RC KYYEAGARFAKWRAVLKIG + EP++L++ +NA GLARYA+ICQ+NGLV
Sbjct  121  QGLDSLGARCAKYYEAGARFAKWRAVLKIGASGEPSELAVKQNAEGLARYALICQENGLV  180

Query  624  PIVEPEILVDGPHDIEKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSDCKNRV  803
            PIVEPEIL DG HDI+ CA VTERVLAA +K+LNDH VLLEGTLLK NMVTPGSD   +V
Sbjct  181  PIVEPEILTDGGHDIKTCAAVTERVLAAVFKSLNDHKVLLEGTLLKCNMVTPGSDSP-KV  239

Query  804  KAEVIAEYTVRALQRTMPAAVPAVVFLSGG  893
             AEVIAEYTV AL+RT+P AVP VVFLSGG
Sbjct  240  GAEVIAEYTVAALRRTVPPAVPGVVFLSGG  269



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1826707812600