BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8328_g1_i1 len=514 path=[492:0-513]

Length=514
                                                                      Score     E

gb|AAK62818.1|  fructose-1,6-bisphosphate aldolase                      151   2e-42   Solanum lycopersicum
emb|CAL34034.1|  fructose-bisphosphate aldolase                         145   3e-41   Plantago major [cart-track plant]
gb|KHG27282.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      151   1e-40   
ref|XP_004246552.1|  PREDICTED: fructose-bisphosphate aldolase cy...    151   1e-40   
gb|KEH42090.1|  fructose-bisphosphate aldolase                          150   3e-40   
emb|CAB46520.1|  putative fructose-bisphosphate aldolase                146   4e-40   Phleum pratense [timothy]
ref|NP_001275379.1|  fructose-bisphosphate aldolase-like protein        149   4e-40   
ref|XP_002533605.1|  fructose-bisphosphate aldolase, putative           149   5e-40   Ricinus communis
ref|XP_002881445.1|  hypothetical protein ARALYDRAFT_482625             149   5e-40   
ref|XP_010495058.1|  PREDICTED: fructose-bisphosphate aldolase, c...    144   5e-40   
ref|XP_011101492.1|  PREDICTED: fructose-bisphosphate aldolase cy...    149   5e-40   
gb|KHN48186.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme     149   6e-40   
ref|XP_006851631.1|  hypothetical protein AMTR_s00040p00201950          149   6e-40   
ref|XP_009617881.1|  PREDICTED: fructose-bisphosphate aldolase cy...    149   6e-40   
emb|CAD12665.1|  putative fructose 1-,6-biphosphate aldolase            147   6e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009789131.1|  PREDICTED: fructose-bisphosphate aldolase cy...    149   6e-40   
ref|NP_001242086.1|  uncharacterized protein LOC100795446               149   7e-40   
ref|XP_011094409.1|  PREDICTED: fructose-bisphosphate aldolase cy...    149   7e-40   
ref|XP_003542562.1|  PREDICTED: fructose-bisphosphate aldolase, c...    149   7e-40   
ref|XP_004497605.1|  PREDICTED: fructose-bisphosphate aldolase, c...    149   9e-40   
ref|NP_001118453.1|  fructose-bisphosphate aldolase 6                   146   1e-39   Arabidopsis thaliana [mouse-ear cress]
sp|P46257.1|ALF2_PEA  RecName: Full=Fructose-bisphosphate aldolas...    147   3e-39   Pisum sativum [garden pea]
gb|EYU38615.1|  hypothetical protein MIMGU_mgv1a007931mg                148   3e-39   
gb|KHG11048.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme     147   4e-39   
ref|XP_009141597.1|  PREDICTED: fructose-bisphosphate aldolase, c...    147   4e-39   
gb|EMT15181.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      147   5e-39   
gb|EMT05696.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      146   6e-39   
gb|ACO44684.1|  fructose-bisphosphate aldolase                          146   6e-39   Triticum aestivum [Canadian hard winter wheat]
gb|KFK32724.1|  hypothetical protein AALP_AA6G280600                    146   6e-39   
ref|XP_007027627.1|  Aldolase superfamily protein isoform 2             146   6e-39   
ref|XP_007027626.1|  Aldolase superfamily protein isoform 1             147   7e-39   
ref|NP_181187.1|  fructose-bisphosphate aldolase 6                      146   7e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410823.1|  hypothetical protein EUTSA_v10016856mg             146   7e-39   
ref|NP_001045130.2|  Os01g0905800                                       146   8e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009778188.1|  PREDICTED: fructose-bisphosphate aldolase cy...    146   8e-39   
ref|XP_006293487.1|  hypothetical protein CARUB_v10023504mg             146   9e-39   
ref|XP_011048929.1|  PREDICTED: fructose-bisphosphate aldolase cy...    146   1e-38   
gb|EMS58841.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      145   1e-38   
ref|XP_008241287.1|  PREDICTED: fructose-bisphosphate aldolase, c...    145   1e-38   
ref|XP_006645191.1|  PREDICTED: fructose-bisphosphate aldolase cy...    145   1e-38   
emb|CDM85268.1|  unnamed protein product                                145   2e-38   
gb|EMT31985.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      145   2e-38   
gb|EMS60368.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme      145   2e-38   
gb|ACO44683.1|  fructose-bisphosphate aldolase                          145   2e-38   Secale cereale
dbj|BAJ87658.1|  predicted protein                                      145   2e-38   
ref|XP_003564871.1|  PREDICTED: fructose-bisphosphate aldolase cy...    145   2e-38   
gb|AGB05599.1|  fructose-bisphosphate aldolase 2                        145   2e-38   
ref|XP_008442804.1|  PREDICTED: fructose-bisphosphate aldolase cy...    145   2e-38   
gb|KDP42683.1|  hypothetical protein JCGZ_23623                         145   2e-38   
ref|XP_009621833.1|  PREDICTED: fructose-bisphosphate aldolase cy...    145   2e-38   
ref|XP_009125243.1|  PREDICTED: fructose-bisphosphate aldolase, c...    145   2e-38   
ref|XP_002528593.1|  fructose-bisphosphate aldolase, putative           145   3e-38   Ricinus communis
ref|XP_006398826.1|  hypothetical protein EUTSA_v10013921mg             145   3e-38   
ref|XP_007202259.1|  hypothetical protein PRUPE_ppa007714mg             145   3e-38   
ref|XP_008442803.1|  PREDICTED: fructose-bisphosphate aldolase cy...    145   3e-38   
gb|AIX10949.1|  fructose-bisphosphate aldolase-like protein             145   3e-38   
ref|XP_010509469.1|  PREDICTED: fructose-bisphosphate aldolase, c...    145   3e-38   
ref|XP_010516868.1|  PREDICTED: fructose-bisphosphate aldolase, c...    145   3e-38   
ref|XP_010505193.1|  PREDICTED: fructose-bisphosphate aldolase, c...    145   3e-38   
ref|XP_006430290.1|  hypothetical protein CICLE_v10012049mg             144   4e-38   
ref|XP_010490860.1|  PREDICTED: fructose-bisphosphate aldolase, c...    144   4e-38   
gb|KDO61040.1|  hypothetical protein CISIN_1g018326mg                   144   4e-38   
ref|XP_006481883.1|  PREDICTED: fructose-bisphosphate aldolase cy...    144   4e-38   
ref|XP_006288022.1|  hypothetical protein CARUB_v10001255mg             144   4e-38   
emb|CDP05655.1|  unnamed protein product                                144   4e-38   
ref|XP_010243792.1|  PREDICTED: fructose-bisphosphate aldolase cy...    144   4e-38   
emb|CDP15370.1|  unnamed protein product                                144   4e-38   
ref|XP_009148810.1|  PREDICTED: fructose-bisphosphate aldolase, c...    142   4e-38   
gb|KDP34381.1|  hypothetical protein JCGZ_11264                         144   5e-38   
gb|AGV08373.1|  fructose-bisphosphate aldolase                          144   5e-38   
ref|XP_006654377.1|  PREDICTED: fructose-bisphosphate aldolase cy...    144   5e-38   
ref|NP_850759.1|  fructose-bisphosphate aldolase 4                      144   5e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32644.1|  fructose-bisphosphate aldolase-like protein             144   5e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001275267.1|  uncharacterized LOC102577842                       144   6e-38   
ref|XP_002283381.1|  PREDICTED: fructose-bisphosphate aldolase cy...    144   6e-38   Vitis vinifera
gb|KHN18736.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    143   9e-38   
gb|AAM62481.1|  fructose-bisphosphate aldolase-like protein             144   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568127.1|  fructose-bisphosphate aldolase 4                      144   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552992.1|  PREDICTED: fructose-bisphosphate aldolase, c...    143   1e-37   
ref|XP_010089415.1|  Fructose-bisphosphate aldolase cytoplasmic i...    143   1e-37   
ref|XP_003521445.1|  PREDICTED: fructose-bisphosphate aldolase, c...    143   1e-37   
ref|XP_010543462.1|  PREDICTED: fructose-bisphosphate aldolase, c...    143   1e-37   
gb|KFK24834.1|  hypothetical protein AALP_AA8G030900                    143   2e-37   
gb|KCW87412.1|  hypothetical protein EUGRSUZ_B03891                     142   2e-37   
ref|XP_008385438.1|  PREDICTED: fructose-bisphosphate aldolase cy...    142   2e-37   
ref|XP_004137873.1|  PREDICTED: fructose-bisphosphate aldolase cy...    142   2e-37   
ref|XP_010424793.1|  PREDICTED: fructose-bisphosphate aldolase, c...    145   2e-37   
ref|XP_002877893.1|  hypothetical protein ARALYDRAFT_906673             142   2e-37   
ref|NP_190861.1|  fructose-bisphosphate aldolase                        142   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004171756.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    143   2e-37   
dbj|BAE48790.1|  fructose-bisphosphate aldolase                         142   2e-37   Codonopsis lanceolata
ref|XP_006403749.1|  hypothetical protein EUTSA_v10010492mg             142   2e-37   
ref|XP_004249455.1|  PREDICTED: fructose-bisphosphate aldolase cy...    142   2e-37   
ref|XP_010426925.1|  PREDICTED: fructose-bisphosphate aldolase, c...    142   2e-37   
gb|AHY18973.1|  fructose-bisphosphate aldolase                          142   2e-37   
ref|XP_010045253.1|  PREDICTED: fructose-bisphosphate aldolase, c...    142   2e-37   
dbj|BAI59774.1|  aldolase C-1                                           142   2e-37   Phyllostachys edulis [kikko-chiku]
emb|CDY66283.1|  BnaCnng50220D                                          142   2e-37   
emb|CDX78134.1|  BnaA09g33290D                                          142   2e-37   
sp|P17784.2|ALF_ORYSJ  RecName: Full=Fructose-bisphosphate aldola...    142   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006291269.1|  hypothetical protein CARUB_v10017399mg             143   3e-37   
ref|XP_010527812.1|  PREDICTED: fructose-bisphosphate aldolase, c...    142   3e-37   
ref|XP_011043938.1|  PREDICTED: fructose-bisphosphate aldolase cy...    142   4e-37   
gb|EPS71641.1|  fructose-bisphosphate aldolase                          142   4e-37   
gb|ABK96406.1|  unknown                                                 141   4e-37   Populus trichocarpa x Populus deltoides
ref|XP_010049816.1|  PREDICTED: fructose-bisphosphate aldolase cy...    141   5e-37   
ref|XP_002325037.1|  fructose-1 family protein                          141   5e-37   Populus trichocarpa [western balsam poplar]
ref|XP_006661653.1|  PREDICTED: fructose-bisphosphate aldolase cy...    141   5e-37   
gb|ABK93066.1|  unknown                                                 141   5e-37   Populus trichocarpa [western balsam poplar]
ref|XP_009122681.1|  PREDICTED: fructose-bisphosphate aldolase, c...    141   6e-37   
emb|CAB77243.2|  fructose-bisphosphate aldolase                         141   6e-37   Persea americana
gb|ABB16974.1|  unknown                                                 141   6e-37   Solanum tuberosum [potatoes]
dbj|BAL41455.1|  fructose-bisphosphate aldolase 1                       140   8e-37   
ref|NP_001265896.1|  fructose-bisphosphate aldolase, cytoplasmic ...    140   2e-36   
ref|XP_009352993.1|  PREDICTED: fructose-bisphosphate aldolase, c...    140   2e-36   
ref|XP_010558953.1|  PREDICTED: fructose-bisphosphate aldolase, c...    139   3e-36   
dbj|BAA02729.1|  cytoplasmic aldolase                                   139   3e-36   Oryza sativa Japonica Group [Japonica rice]
gb|ABG65931.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    139   3e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EAY94426.1|  hypothetical protein OsI_16195                          139   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_010089414.1|  Fructose-bisphosphate aldolase, cytoplasmic ...    139   3e-36   
ref|XP_009365337.1|  PREDICTED: fructose-bisphosphate aldolase, c...    139   3e-36   
gb|KFK34541.1|  hypothetical protein AALP_AA5G159400                    139   4e-36   
ref|XP_006381780.1|  fructose-1 family protein                          139   4e-36   
gb|KCW48359.1|  hypothetical protein EUGRSUZ_K02073                     139   5e-36   
ref|XP_007145245.1|  hypothetical protein PHAVU_007G222900g             139   5e-36   
ref|XP_010036726.1|  PREDICTED: fructose-bisphosphate aldolase, c...    139   5e-36   
gb|AFK43805.1|  unknown                                                 139   6e-36   
ref|XP_004970966.1|  PREDICTED: fructose-bisphosphate aldolase cy...    138   7e-36   
ref|XP_004952502.1|  PREDICTED: fructose-bisphosphate aldolase cy...    138   9e-36   
ref|XP_008386943.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    138   1e-35   
gb|AAG21429.1|AF308587_1  cytosolic aldolase                            138   1e-35   Fragaria x ananassa
ref|XP_010553342.1|  PREDICTED: fructose-bisphosphate aldolase, c...    138   1e-35   
gb|ACO44685.1|  fructose-bisphosphate aldolase                          138   1e-35   Hordeum vulgare [barley]
ref|XP_004303023.1|  PREDICTED: fructose-bisphosphate aldolase cy...    137   1e-35   
ref|XP_008462541.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    137   1e-35   
ref|XP_004143304.1|  PREDICTED: fructose-bisphosphate aldolase, c...    137   1e-35   
ref|XP_009115993.1|  PREDICTED: fructose-bisphosphate aldolase, c...    137   1e-35   
ref|XP_008391753.1|  PREDICTED: fructose-bisphosphate aldolase cy...    137   1e-35   
ref|XP_009411827.1|  PREDICTED: fructose-bisphosphate aldolase cy...    137   2e-35   
ref|XP_008799938.1|  PREDICTED: fructose-bisphosphate aldolase cy...    137   3e-35   
gb|ABA27085.1|  TO114-2                                                 130   3e-35   Taraxacum officinale [dandelion]
dbj|BAI59775.1|  aldolase C-2                                           137   3e-35   Phyllostachys edulis [kikko-chiku]
ref|XP_002453822.1|  hypothetical protein SORBIDRAFT_04g019020          137   3e-35   Sorghum bicolor [broomcorn]
ref|XP_007202254.1|  hypothetical protein PRUPE_ppa007696mg             137   3e-35   
ref|XP_010278210.1|  PREDICTED: fructose-bisphosphate aldolase cy...    137   3e-35   
ref|XP_010932289.1|  PREDICTED: fructose-bisphosphate aldolase cy...    137   3e-35   
gb|AFK42407.1|  unknown                                                 129   3e-35   
gb|ABK21911.1|  unknown                                                 136   4e-35   Picea sitchensis
ref|XP_009412699.1|  PREDICTED: fructose-bisphosphate aldolase cy...    136   4e-35   
emb|CAA37290.1|  unnamed protein product                                136   4e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009402715.1|  PREDICTED: fructose-bisphosphate aldolase cy...    136   4e-35   
sp|P29356.1|ALF_SPIOL  RecName: Full=Fructose-bisphosphate aldola...    136   5e-35   Spinacia oleracea
ref|XP_008391754.1|  PREDICTED: fructose-bisphosphate aldolase cy...    136   5e-35   
ref|XP_009352992.1|  PREDICTED: fructose-bisphosphate aldolase cy...    136   6e-35   
gb|AES98478.2|  fructose-bisphosphate aldolase                          136   6e-35   
ref|XP_010683863.1|  PREDICTED: fructose-bisphosphate aldolase, c...    135   7e-35   
ref|XP_010940458.1|  PREDICTED: fructose-bisphosphate aldolase cy...    135   8e-35   
ref|XP_004303022.1|  PREDICTED: fructose-bisphosphate aldolase cy...    135   9e-35   
ref|XP_008241286.1|  PREDICTED: fructose-bisphosphate aldolase cy...    135   1e-34   
ref|XP_008775192.1|  PREDICTED: fructose-bisphosphate aldolase cy...    135   1e-34   
gb|KHN40026.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme     135   2e-34   
ref|NP_001242367.1|  uncharacterized protein LOC100778363               135   2e-34   
ref|XP_009411974.1|  PREDICTED: fructose-bisphosphate aldolase cy...    134   2e-34   
ref|XP_009365338.1|  PREDICTED: fructose-bisphosphate aldolase cy...    134   3e-34   
ref|XP_003615520.1|  Fructose-bisphosphate aldolase                     137   3e-34   
ref|XP_010912239.1|  PREDICTED: fructose-bisphosphate aldolase cy...    134   3e-34   
ref|XP_007207750.1|  hypothetical protein PRUPE_ppa1027146mg            134   3e-34   
ref|XP_010927580.1|  PREDICTED: fructose-bisphosphate aldolase cy...    134   4e-34   
gb|KHN46204.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme     133   8e-34   
gb|EMS53099.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme     134   8e-34   
gb|AAB61592.1|  fructose-biphosphate aldolase                           132   9e-34   Mesembryanthemum crystallinum
gb|AAR88661.1|  fructose-bisphosphate aldolase                          132   2e-33   Pandanus amaryllifolius [pandan rampeh]
ref|XP_008797227.1|  PREDICTED: fructose-bisphosphate aldolase cy...    132   2e-33   
dbj|BAA11395.1|  putative aldolase                                      127   2e-33   Brassica rapa
ref|XP_010676114.1|  PREDICTED: fructose-bisphosphate aldolase, c...    131   2e-33   
ref|XP_002970423.1|  hypothetical protein SELMODRAFT_267384             131   3e-33   
ref|XP_008386942.1|  PREDICTED: fructose-bisphosphate aldolase cy...    131   3e-33   
ref|XP_002458944.1|  hypothetical protein SORBIDRAFT_03g043140          131   3e-33   Sorghum bicolor [broomcorn]
ref|XP_002978503.1|  hypothetical protein SELMODRAFT_176914             130   5e-33   
ref|XP_006857683.1|  hypothetical protein AMTR_s00061p00163810          130   5e-33   
gb|AAR84667.1|  fructose 1,6, bisphosphate aldolase                     130   6e-33   Salicornia herbacea
ref|NP_001150049.1|  fructose-bisphosphate aldolase cytoplasmic i...    130   7e-33   Zea mays [maize]
gb|ACG24536.1|  fructose-bisphosphate aldolase cytoplasmic isozyme      129   7e-33   Zea mays [maize]
gb|ACG68894.1|  fructose-biphosphate aldolase                           130   1e-32   Sesuvium portulacastrum [sea-purslane]
ref|NP_001105336.1|  fructose-bisphosphate aldolase, cytoplasmic ...    129   1e-32   Zea mays [maize]
gb|ACF79162.1|  unknown                                                 129   1e-32   Zea mays [maize]
ref|XP_010252855.1|  PREDICTED: fructose-bisphosphate aldolase, c...    129   1e-32   
ref|XP_007142455.1|  hypothetical protein PHAVU_008G282000g             129   2e-32   
ref|XP_007141361.1|  hypothetical protein PHAVU_008G189200g             128   4e-32   
gb|AGZ15378.1|  fructose-bisphosphate aldolase                          128   6e-32   
ref|XP_002969534.1|  hypothetical protein SELMODRAFT_231316             128   6e-32   
ref|XP_002986752.1|  hypothetical protein SELMODRAFT_425653             127   6e-32   
ref|XP_010433486.1|  PREDICTED: fructose-bisphosphate aldolase, c...    127   6e-32   
emb|CDP13668.1|  unnamed protein product                                127   7e-32   
ref|XP_010438739.1|  PREDICTED: fructose-bisphosphate aldolase, c...    127   7e-32   
ref|XP_006284000.1|  hypothetical protein CARUB_v10005122mg             127   8e-32   
ref|NP_194383.1|  fructose-bisphosphate aldolase 5                      127   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448258.1|  PREDICTED: fructose-bisphosphate aldolase, c...    127   1e-31   
ref|XP_006452683.1|  hypothetical protein CICLE_v10008762mg             126   1e-31   
ref|XP_006452682.1|  hypothetical protein CICLE_v10008762mg             126   2e-31   
gb|AAQ90153.1|  putative fructose-bisphosphate aldolase protein         123   2e-31   Solanum tuberosum [potatoes]
ref|XP_006413170.1|  hypothetical protein EUTSA_v10025556mg             126   2e-31   
gb|KHN23819.1|  Uridine kinase-like protein 4                           130   2e-31   
ref|XP_004244020.1|  PREDICTED: fructose-bisphosphate aldolase, c...    126   3e-31   
ref|XP_010929015.1|  PREDICTED: fructose-bisphosphate aldolase, c...    126   3e-31   
ref|XP_004491539.1|  PREDICTED: fructose-bisphosphate aldolase, c...    125   3e-31   
ref|XP_006474808.1|  PREDICTED: fructose-bisphosphate aldolase, c...    125   3e-31   
ref|XP_002519633.1|  fructose-bisphosphate aldolase, putative           125   4e-31   Ricinus communis
ref|XP_003544567.1|  PREDICTED: fructose-bisphosphate aldolase, c...    125   5e-31   
ref|NP_001237315.1|  fructose-bisphosphate aldolase                     125   5e-31   
ref|XP_009142435.1|  PREDICTED: fructose-bisphosphate aldolase, c...    125   6e-31   
gb|EPS69505.1|  fructose-bisphosphate aldolase                          124   1e-30   
gb|KFK29173.1|  hypothetical protein AALP_AA7G098900                    124   1e-30   
ref|XP_011095600.1|  PREDICTED: fructose-bisphosphate aldolase, c...    124   2e-30   
emb|CDX94320.1|  BnaC01g18640D                                          127   2e-30   
ref|XP_009620969.1|  PREDICTED: fructose-bisphosphate aldolase, c...    124   2e-30   
gb|ABK23585.1|  unknown                                                 124   2e-30   Picea sitchensis
gb|EYU27475.1|  hypothetical protein MIMGU_mgv1a008862mg                123   3e-30   
ref|XP_010942543.1|  PREDICTED: fructose-bisphosphate aldolase, c...    123   3e-30   
ref|XP_006346102.1|  PREDICTED: fructose-bisphosphate aldolase, c...    123   4e-30   
ref|XP_010246553.1|  PREDICTED: fructose-bisphosphate aldolase, c...    122   5e-30   
gb|ACD10928.1|  fructose-bisphosphate aldolase                          117   6e-30   Lemna minor
ref|XP_002437265.1|  hypothetical protein SORBIDRAFT_10g023850          122   8e-30   Sorghum bicolor [broomcorn]
sp|P46256.1|ALF1_PEA  RecName: Full=Fructose-bisphosphate aldolas...    122   8e-30   Pisum sativum [garden pea]
ref|XP_006377966.1|  fructose-1 family protein                          122   1e-29   
ref|XP_011039825.1|  PREDICTED: fructose-bisphosphate aldolase, c...    121   1e-29   
ref|XP_002299056.1|  fructose-1 family protein                          121   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009799651.1|  PREDICTED: fructose-bisphosphate aldolase, c...    121   1e-29   
gb|KHN43919.1|  Uridine kinase-like protein 4                           124   2e-29   
gb|ACN85313.1|  fructose-bisphosphate aldolase cytoplasmic isozyme      121   2e-29   Oryza brachyantha
ref|XP_011000316.1|  PREDICTED: fructose-bisphosphate aldolase, c...    121   2e-29   
gb|ABK22375.1|  unknown                                                 121   2e-29   Picea sitchensis
ref|XP_008782993.1|  PREDICTED: fructose-bisphosphate aldolase, c...    120   3e-29   
ref|XP_007020393.1|  Aldolase superfamily protein                       120   3e-29   
ref|XP_010103967.1|  Fructose-bisphosphate aldolase, cytoplasmic ...    120   3e-29   
gb|KDP32624.1|  hypothetical protein JCGZ_13174                         120   5e-29   
ref|XP_001768658.1|  predicted protein                                  119   6e-29   
ref|XP_009391905.1|  PREDICTED: fructose-bisphosphate aldolase, c...    119   7e-29   
ref|XP_010061415.1|  PREDICTED: fructose-bisphosphate aldolase, c...    119   7e-29   
ref|XP_011037763.1|  PREDICTED: fructose-bisphosphate aldolase, c...    119   7e-29   
ref|XP_002263794.1|  PREDICTED: fructose-bisphosphate aldolase, c...    119   7e-29   Vitis vinifera
ref|XP_003563638.1|  PREDICTED: fructose-bisphosphate aldolase, c...    119   1e-28   
ref|XP_001767043.1|  predicted protein                                  118   1e-28   
ref|NP_001142344.1|  hypothetical protein                               113   2e-28   Zea mays [maize]
ref|XP_005649618.1|  cytosolic aldolase                                 118   3e-28   
ref|XP_003617895.1|  Fructose-bisphosphate aldolase                     117   4e-28   
ref|XP_005709261.1|  fructose-bisphosphate aldolase, class I            117   5e-28   
ref|XP_008355755.1|  PREDICTED: fructose-bisphosphate aldolase, c...    117   5e-28   
gb|AAF27640.1|AF217804_1  fructose-1,6-biphosphate aldolase             117   5e-28   Cyanidium caldarium
ref|XP_007205428.1|  hypothetical protein PRUPE_ppa007744mg             117   6e-28   
ref|XP_002869605.1|  hypothetical protein ARALYDRAFT_492157             117   6e-28   
ref|XP_008353167.1|  PREDICTED: fructose-bisphosphate aldolase, c...    117   7e-28   
emb|CAN83666.1|  hypothetical protein VITISV_008795                     117   7e-28   Vitis vinifera
ref|XP_008363363.1|  PREDICTED: fructose-bisphosphate aldolase, c...    116   8e-28   
ref|XP_009141596.1|  PREDICTED: fructose-bisphosphate aldolase, c...    115   2e-27   
emb|CDY43716.1|  BnaAnng07310D                                          115   2e-27   
ref|XP_005833999.1|  hypothetical protein GUITHDRAFT_86602              115   3e-27   
ref|XP_004965915.1|  PREDICTED: fructose-bisphosphate aldolase, c...    114   5e-27   
gb|ADA68259.1|  fructose-biphosphate aldolase                           108   7e-27   
ref|XP_006659075.1|  PREDICTED: fructose-bisphosphate aldolase cy...    113   1e-26   
gb|ACG27929.1|  fructose-bisphosphate aldolase, cytoplasmic isozy...    113   1e-26   Zea mays [maize]
ref|XP_010545295.1|  PREDICTED: fructose-bisphosphate aldolase, c...    113   1e-26   
ref|NP_001058042.1|  Os06g0608700                                       113   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656232.1|  PREDICTED: fructose-bisphosphate aldolase, c...    113   1e-26   
emb|CCP50142.1|  fructose-biphosphate aldolase                          108   1e-26   
ref|XP_006679107.1|  hypothetical protein BATDEDRAFT_35107              113   2e-26   
ref|NP_001060880.1|  Os08g0120600                                       112   2e-26   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85287.1|  predicted protein                                      112   2e-26   
gb|ADA68261.1|  fructose-biphosphate aldolase                           107   3e-26   
ref|XP_002779064.1|  Fructose-bisphosphate aldolase C, putative         106   3e-26   Perkinsus marinus ATCC 50983
gb|EEE65995.1|  hypothetical protein OsJ_21934                          114   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004039906.1|  hypothetical protein IMG5_006010                   112   4e-26   
gb|EMT11738.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    112   4e-26   
ref|XP_002869606.1|  fructose-bisphosphate aldolase, cytoplasmic        112   4e-26   
ref|XP_003738517.1|  PREDICTED: fructose-bisphosphate aldolase A-...    111   6e-26   
emb|CDW83208.1|  fructose-bisphosphate aldolase cytoplasmic isozy...    111   8e-26   
gb|ACN85267.1|  fructose-bisphosphate aldolase cytoplasmic isozyme      110   1e-25   Oryza alta
ref|XP_004139771.1|  PREDICTED: fructose-bisphosphate aldolase, c...    110   1e-25   
gb|EMS50182.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    113   1e-25   
emb|CCP50127.1|  fructose-biphosphate aldolase                          105   1e-25   
ref|XP_010438740.1|  PREDICTED: fructose-bisphosphate aldolase, c...    110   2e-25   
ref|XP_008447787.1|  PREDICTED: fructose-bisphosphate aldolase, c...    109   2e-25   
ref|XP_010448259.1|  PREDICTED: fructose-bisphosphate aldolase, c...    109   2e-25   
ref|XP_010433490.1|  PREDICTED: fructose-bisphosphate aldolase, c...    110   2e-25   
ref|XP_002765540.1|  fructose-1,6-bisphosphate aldolase, putative       109   3e-25   
ref|XP_002766649.1|  fructose-1,6-bisphosphate aldolase, putative       109   4e-25   
dbj|BAM15893.1|  putative fructose-bisphosphate aldolase                102   4e-25   
ref|XP_001765506.1|  predicted protein                                  108   4e-25   
dbj|BAD95159.1|  fructose bisphosphate aldolase - like protein          102   5e-25   
ref|XP_010089412.1|  Fructose-bisphosphate aldolase cytoplasmic i...    108   7e-25   
ref|XP_002784645.1|  fructose-1,6-bisphosphate aldolase, putative       108   7e-25   
gb|AAZ39527.1|  fructose-biphosphate aldolase                           108   9e-25   
gb|ETN69103.1|  fructose-bisphosphate aldolase class-I                  108   1e-24   
gb|AFK34348.1|  unknown                                                 106   2e-24   
gb|ADT61995.1|  aldolase                                                107   2e-24   
ref|XP_005843070.1|  hypothetical protein CHLNCDRAFT_59826              107   2e-24   
gb|ERL95792.1|  hypothetical protein D910_00308                         102   3e-24   
ref|XP_010089409.1|  Fructose-bisphosphate aldolase cytoplasmic i...    106   3e-24   
ref|XP_002779280.1|  fructose-1,6-bisphosphate aldolase, putative       106   3e-24   
emb|CDJ40769.1|  fructose-1,6-bisphosphate aldolase, putative           106   4e-24   
gb|ABF60003.1|  fructose bisphosphate aldolase                          106   4e-24   
emb|CDJ65822.1|  fructose-1,6-bisphosphate aldolase, putative           106   4e-24   
dbj|BAD17916.1|  fructose-bisphosphate aldolase A-1                     105   5e-24   
ref|XP_004363843.1|  aldolase A                                         105   5e-24   
ref|XP_004294907.1|  PREDICTED: fructose-bisphosphate aldolase, c...    106   5e-24   
ref|XP_008218850.1|  PREDICTED: fructose-bisphosphate aldolase, c...    105   7e-24   
ref|XP_001458636.1|  hypothetical protein                               105   8e-24   
ref|XP_002785910.1|  fructose-1,6-bisphosphate aldolase, putative       105   8e-24   
ref|XP_001461644.1|  hypothetical protein                               105   8e-24   
ref|XP_001759800.1|  predicted protein                                  105   8e-24   
ref|NP_194382.1|  fructose-bisphosphate aldolase 7                      105   9e-24   
emb|CAA37226.1|  fructose 1,6-diphosphate aldolase                      105   9e-24   
ref|XP_003898325.1|  PREDICTED: fructose-bisphosphate aldolase A        105   1e-23   
ref|XP_002768822.1|  fructose-1,6-bisphosphate aldolase, putative       105   1e-23   
ref|XP_008360651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   1e-23   
ref|XP_004706093.1|  PREDICTED: fructose-bisphosphate aldolase A        104   2e-23   
emb|CDJ29479.1|  fructose-1,6-bisphosphate aldolase, putative           103   2e-23   
gb|AAA51697.1|  fructose 1,6-diphosphate aldolase A (EC 4.1.2.13)       102   2e-23   
ref|XP_001460782.1|  hypothetical protein                               104   2e-23   
ref|XP_008069845.1|  PREDICTED: fructose-bisphosphate aldolase A        104   2e-23   
ref|XP_007248760.1|  PREDICTED: fructose-bisphosphate aldolase A-...    104   2e-23   
ref|XP_007534724.1|  PREDICTED: fructose-bisphosphate aldolase A        104   2e-23   
ref|XP_004461535.1|  PREDICTED: fructose-bisphosphate aldolase A ...    104   2e-23   
ref|XP_003736686.1|  GA19329, isoform D                                 103   3e-23   
emb|CEF67881.1|  Fructose-bisphosphate aldolase, class-I family a...    103   3e-23   
ref|XP_001955842.1|  GF16038                                            103   3e-23   
ref|XP_006430289.1|  hypothetical protein CICLE_v10012049mg             103   3e-23   
ref|XP_007948392.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   4e-23   
gb|AAH16170.1|  Similar to aldolase A, fructose-bisphosphate            102   4e-23   
ref|XP_006285375.1|  hypothetical protein CARUB_v10006772mg             103   4e-23   
gb|ACO09344.1|  Fructose-bisphosphate aldolase A                        103   4e-23   
ref|XP_007948391.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   5e-23   
ref|XP_006260659.1|  PREDICTED: fructose-bisphosphate aldolase A        103   5e-23   
ref|XP_008822133.1|  PREDICTED: fructose-bisphosphate aldolase A        103   5e-23   
ref|XP_005591674.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   5e-23   
ref|XP_008582808.1|  PREDICTED: fructose-bisphosphate aldolase A        103   6e-23   
ref|XP_005591675.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   6e-23   
ref|XP_007987695.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   6e-23   
ref|XP_005591673.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   6e-23   
gb|EHH31572.1|  Fructose-bisphosphate aldolase A                        103   6e-23   
ref|XP_010615647.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   6e-23   
ref|XP_003362760.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   6e-23   
ref|XP_006148273.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   6e-23   
ref|XP_005405250.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   6e-23   
ref|XP_004856150.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   6e-23   
ref|XP_004623206.1|  PREDICTED: fructose-bisphosphate aldolase A        102   6e-23   
ref|XP_004856149.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   6e-23   
ref|XP_006896609.1|  PREDICTED: fructose-bisphosphate aldolase A        103   7e-23   
ref|XP_010351767.1|  PREDICTED: fructose-bisphosphate aldolase A        102   7e-23   
ref|XP_006148270.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   7e-23   
ref|XP_006148271.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   7e-23   
ref|XP_849434.1|  PREDICTED: fructose-bisphosphate aldolase A iso...    102   7e-23   
ref|XP_004773998.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   7e-23   
ref|XP_005351300.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   7e-23   
ref|XP_003477897.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   7e-23   
ref|XP_010615646.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   7e-23   
ref|NP_919358.2|  fructose-bisphosphate aldolase A                      102   7e-23   
ref|XP_004057522.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   7e-23   
dbj|BAB29638.1|  unnamed protein product                                102   7e-23   
ref|XP_005405249.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   7e-23   
gb|AAN04476.1|  aldolase A                                              102   7e-23   
ref|XP_006148272.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   7e-23   
ref|NP_001127068.1|  fructose-bisphosphate aldolase A                   102   7e-23   
ref|XP_005007620.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   8e-23   
ref|NP_001138305.1|  fructose-bisphosphate aldolase A                   102   8e-23   
ref|XP_005351299.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   8e-23   
pdb|1EWD|A  Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabb...    102   8e-23   
gb|AAH66218.1|  Aldolase A, fructose-bisphosphate                       102   8e-23   
gb|AAA40715.1|  aldolase A                                              102   8e-23   
ref|NP_000025.1|  fructose-bisphosphate aldolase A isoform 1            102   8e-23   
emb|CAG46678.1|  ALDOA                                                  102   8e-23   
ref|XP_005598856.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   8e-23   
ref|XP_005598855.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   8e-23   
pdb|4ALD|A  Chain A, Human Muscle Fructose 1,6-Bisphosphate Aldol...    102   8e-23   
gb|AAX37024.1|  aldolase A                                              102   8e-23   
emb|CDJ61342.1|  fructose-1,6-bisphosphate aldolase, putative           102   8e-23   
ref|NP_031464.1|  fructose-bisphosphate aldolase A isoform 2            102   8e-23   
ref|NP_036627.1|  fructose-bisphosphate aldolase A                      102   8e-23   
gb|EAW79936.1|  aldolase A, fructose-bisphosphate, isoform CRA_b        102   8e-23   
ref|XP_005064462.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   8e-23   
pdb|1ADO|A  Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabb...    102   8e-23   
ref|XP_009248864.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
ref|XP_006977158.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
ref|NP_001230106.1|  fructose-bisphosphate aldolase A isoform 2         102   9e-23   
gb|EDM17390.1|  aldolase A, isoform CRA_g                               102   9e-23   
ref|XP_004397238.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
ref|XP_004397239.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
gb|EDL17444.1|  mCG22383, isoform CRA_d                                 102   9e-23   
ref|XP_003281983.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
pdb|1EWE|A  Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabb...    102   9e-23   
pdb|1EX5|A  Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabb...    102   9e-23   
pdb|2QUU|A  Chain A, Dihydroxyacetone Phosphate Schiff Base Inter...    102   9e-23   
ref|XP_004692069.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
ref|XP_003510151.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
ref|XP_004439453.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
gb|EDL17443.1|  mCG22383, isoform CRA_c                                 102   9e-23   
ref|XP_010596800.1|  PREDICTED: fructose-bisphosphate aldolase A        102   9e-23   
ref|XP_004057524.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
ref|XP_009194530.1|  PREDICTED: uncharacterized protein LOC101012125    105   9e-23   
pdb|1ZAH|A  Chain A, Fructose-1,6-Bisphosphate Aldolase From Rabb...    102   9e-23   
ref|XP_008151082.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
ref|XP_007659655.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    102   9e-23   
pdb|6ALD|A  Chain A, Rabbit Muscle Aldolase AFRUCTOSE-1,6-Bisphos...    102   9e-23   
ref|XP_004773997.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   9e-23   
ref|NP_001075707.1|  fructose-bisphosphate aldolase A                   102   9e-23   
pdb|3B8D|A  Chain A, Fructose 1,6-Bisphosphate Aldolase From Rabb...    102   9e-23   
ref|XP_003998733.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
pdb|3DFN|A  Chain A, D33n Mutant Fructose-1,6-Bisphosphate Aldola...    102   1e-22   
ref|XP_006230271.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_005064461.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
pdb|3DFQ|A  Chain A, D33s Mutant Fructose-1,6-Bisphosphate Aldola...    102   1e-22   
ref|XP_005621412.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_004586918.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|NP_001186199.1|  aldolase 1 A retrogene 1                           102   1e-22   
ref|XP_005064460.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
gb|EWM25715.1|  fructose-bisphosphate aldolase                          102   1e-22   
ref|XP_004020929.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_004586917.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|NP_001170778.1|  fructose-bisphosphate aldolase A isoform 1 p...    102   1e-22   
gb|KHJ98724.1|  fructose-bisphosphate aldolase class-I                  102   1e-22   
ref|NP_001095385.1|  fructose-bisphosphate aldolase A                   102   1e-22   
gb|ABR26214.1|  fructose-bisphosphate aldolase cytoplasmic isozyme    97.8    1e-22   
ref|XP_004670308.1|  PREDICTED: fructose-bisphosphate aldolase A-...    102   1e-22   
ref|XP_004439452.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_008256149.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_004397236.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_004856148.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_006734040.1|  PREDICTED: fructose-bisphosphate aldolase A        101   1e-22   
ref|XP_007648927.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_008151081.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_004692068.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_008683470.1|  PREDICTED: fructose-bisphosphate aldolase A        102   1e-22   
pdb|1J4E|A  Chain A, Fructose-1,6-Bisphosphate Aldolase Covalentl...    102   1e-22   
ref|XP_008151080.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_009007647.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
gb|ERG82018.1|  fructose-bisphosphate aldolase 1                        102   1e-22   
ref|XP_005224933.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
dbj|BAD17895.1|  fructose-bisphosphate aldolase A                       102   1e-22   
ref|XP_004397235.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|XP_009007646.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
ref|NP_001278765.1|  fructose-bisphosphate aldolase A                   102   1e-22   
ref|XP_002927403.1|  PREDICTED: fructose-bisphosphate aldolase A-...    102   1e-22   
ref|XP_005697728.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   1e-22   
gb|EGW11725.1|  Fructose-bisphosphate aldolase A                        102   2e-22   
gb|KFM60571.1|  Fructose-bisphosphate aldolase                          102   2e-22   
emb|CDJ53561.1|  fructose-1,6-bisphosphate aldolase, putative           102   2e-22   
ref|XP_005963204.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   2e-22   
ref|XP_006070551.1|  PREDICTED: fructose-bisphosphate aldolase A ...    102   2e-22   
ref|XP_001107644.1|  PREDICTED: fructose-bisphosphate aldolase A ...    104   2e-22   
gb|AEE62864.1|  unknown                                                 102   2e-22   
ref|XP_003706230.1|  PREDICTED: fructose-bisphosphate aldolase-like     102   2e-22   
gb|ENN71864.1|  hypothetical protein YQE_11479                          101   2e-22   
ref|XP_003438531.1|  PREDICTED: fructose-bisphosphate aldolase A        101   2e-22   
ref|XP_004574681.1|  PREDICTED: fructose-bisphosphate aldolase A-...    101   2e-22   
ref|NP_001079799.1|  uncharacterized protein LOC379489                  101   2e-22   
emb|CAA30979.1|  aldolase A                                             101   2e-22   
gb|AAH84349.1|  MGC64482 protein                                        101   2e-22   
ref|XP_005323880.1|  PREDICTED: fructose-bisphosphate aldolase A ...    101   2e-22   
dbj|BAE01802.1|  unnamed protein product                                100   2e-22   
dbj|BAD17882.1|  fructose-bisphosphate aldolase B                       101   2e-22   
gb|ELW66379.1|  Fructose-bisphosphate aldolase A                        103   2e-22   
gb|KFO36279.1|  Fructose-bisphosphate aldolase A                        103   3e-22   
ref|XP_005323882.1|  PREDICTED: fructose-bisphosphate aldolase A ...    101   3e-22   
ref|XP_004386688.1|  PREDICTED: fructose-bisphosphate aldolase A ...    101   3e-22   
ref|XP_005591672.1|  PREDICTED: fructose-bisphosphate aldolase A ...    103   3e-22   
gb|AHB50480.1|  fructose-bisphosphate aldolase                          101   3e-22   
ref|XP_006914150.1|  PREDICTED: fructose-bisphosphate aldolase A ...    101   3e-22   
gb|ADO27974.1|  fructose-bisphosphate aldolase A                        101   3e-22   
gb|AFG26286.1|  aldolase class-1 protein                                100   3e-22   
ref|XP_006914149.1|  PREDICTED: fructose-bisphosphate aldolase A ...    101   3e-22   
ref|XP_004386687.1|  PREDICTED: fructose-bisphosphate aldolase A ...    101   3e-22   
ref|XP_010386293.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    103   4e-22   
ref|XP_008552364.1|  PREDICTED: fructose-bisphosphate aldolase-like     100   4e-22   
ref|XP_006181597.1|  PREDICTED: fructose-bisphosphate aldolase A ...    100   4e-22   
ref|XP_003795911.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    103   4e-22   
ref|XP_007186435.1|  PREDICTED: fructose-bisphosphate aldolase A ...    100   4e-22   
ref|XP_007572807.1|  PREDICTED: fructose-bisphosphate aldolase A        100   4e-22   
ref|NP_001171728.1|  fructose-bisphosphate aldolase                     100   5e-22   
gb|KFM23457.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...    100   5e-22   
ref|XP_007107408.1|  PREDICTED: fructose-bisphosphate aldolase A ...    100   5e-22   
ref|XP_003762120.1|  PREDICTED: fructose-bisphosphate aldolase A        100   5e-22   
ref|NP_001013965.1|  fructose-bisphosphate aldolase                     100   5e-22   
emb|CBJ30268.1|  fructose-1,6-bisphosphate aldolase                     100   5e-22   
dbj|BAD17888.1|  fructose-bisphosphate aldolase A                       100   5e-22   
ref|XP_005882049.1|  PREDICTED: fructose-bisphosphate aldolase A ...    100   6e-22   
ref|XP_008435032.1|  PREDICTED: fructose-bisphosphate aldolase A        100   6e-22   
ref|XP_003240405.1|  PREDICTED: fructose-bisphosphate aldolase          100   6e-22   
ref|NP_001264269.1|  fructose-bisphosphate aldolase A-like              100   6e-22   
gb|EDL36725.1|  mCG22349                                                100   6e-22   
ref|XP_005882048.1|  PREDICTED: fructose-bisphosphate aldolase A ...    100   7e-22   
ref|XP_007452833.1|  PREDICTED: fructose-bisphosphate aldolase A ...    100   7e-22   
ref|XP_006757826.1|  PREDICTED: fructose-bisphosphate aldolase A ...    100   7e-22   
emb|CDI83988.1|  fructose-1,6-bisphosphate aldolase, putative           100   7e-22   
ref|XP_010339012.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...    102   7e-22   
ref|XP_006103383.1|  PREDICTED: fructose-bisphosphate aldolase A ...    100   7e-22   
ref|XP_005749301.1|  PREDICTED: fructose-bisphosphate aldolase A-...    100   8e-22   
dbj|BAB84033.1|  fructose-1,6-bisphosphate aldolase A                   102   8e-22   
ref|XP_005534132.1|  PREDICTED: fructose-bisphosphate aldolase A      99.8    8e-22   
ref|XP_006103382.1|  PREDICTED: fructose-bisphosphate aldolase A ...    100   8e-22   
ref|XP_008194890.1|  PREDICTED: fructose-bisphosphate aldolase is...  99.8    8e-22   



>gb|AAK62818.1| fructose-1,6-bisphosphate aldolase [Solanum lycopersicum]
Length=208

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+TKKPW+L+FS+GRALQQSTLKAWGGK+EN + AQ  FL RCKAN
Sbjct  120  SEEEATVNLNAMNKLQTKKPWSLSFSFGRALQQSTLKAWGGKEENVQKAQAAFLTRCKAN  179

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G++NL+ GASESLH KDYKY
Sbjct  180  SEATLGKYVGASNLSEGASESLHVKDYKY  208



>emb|CAL34034.1| fructose-bisphosphate aldolase [Plantago major]
Length=120

 Score =   145 bits (367),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLKTKKPW+L+FS+GRALQQSTLKAW GK+EN   AQ  FL R KAN
Sbjct  32   SEEEATINLNAMNKLKTKKPWSLSFSFGRALQQSTLKAWAGKEENIGKAQAAFLTRAKAN  91

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY+GS+ L+ GASESLH KDYKY
Sbjct  92   SEATLGTYSGSSTLSEGASESLHVKDYKY  120



>gb|KHG27282.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Gossypium 
arboreum]
Length=353

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKLKTKKPW+L+FS+GRALQQSTLKAWGGK EN   AQ+ FL RCKAN
Sbjct  265  SEEEATVNLNAMNKLKTKKPWSLSFSFGRALQQSTLKAWGGKAENVAKAQEAFLVRCKAN  324

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  325  SEATLGTYKGDAKLGEGAAESLHVKDYKY  353



>ref|XP_004246552.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Solanum lycopersicum]
Length=358

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+TKKPW+L+FS+GRALQQSTLKAWGGK+EN + AQ  FL RCKAN
Sbjct  270  SEEEATVNLNAMNKLQTKKPWSLSFSFGRALQQSTLKAWGGKEENVQKAQAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G++NL+ GASESLH KDYKY
Sbjct  330  SEATLGKYVGASNLSEGASESLHVKDYKY  358



>gb|KEH42090.1| fructose-bisphosphate aldolase [Medicago truncatula]
Length=358

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNAMNKLK KKPW LTFSYGRALQQSTLKAWGGK EN   AQ   L RCKAN
Sbjct  270  SEEEASVNLNAMNKLKGKKPWTLTFSYGRALQQSTLKAWGGKDENIPKAQAALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G+ANL  GASESLH KDYKY
Sbjct  330  SEATLGTYQGNANLGDGASESLHVKDYKY  358



>emb|CAB46520.1| putative fructose-bisphosphate aldolase [Phleum pratense]
Length=227

 Score =   146 bits (369),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+TKKPW L+FS+GRALQQSTLKAW GK+EN   AQ  FL RCKAN
Sbjct  139  SEEEATVNLNAMNKLQTKKPWFLSFSFGRALQQSTLKAWSGKEENVGKAQKAFLVRCKAN  198

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  199  SEATLGTYKGDATLGEGASESLHVKDYKY  227



>ref|NP_001275379.1| fructose-bisphosphate aldolase-like protein [Solanum tuberosum]
 ref|XP_006341152.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Solanum tuberosum]
 gb|ABC01905.1| fructose-bisphosphate aldolase-like protein [Solanum tuberosum]
Length=358

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+ATVNLNAMNKL+TKKPW+L+FS+GRALQQSTLKAWGGK+EN + AQ  FL RCKAN
Sbjct  270  SEEQATVNLNAMNKLQTKKPWSLSFSFGRALQQSTLKAWGGKEENVQKAQAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG YAG++NL+ GASESLH KDYKY
Sbjct  330  SDATLGKYAGASNLSEGASESLHVKDYKY  358



>ref|XP_002533605.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
 gb|EEF28774.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
Length=358

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+LTFS+GRALQQSTLKAWGGK+EN K AQ  FL RCKAN
Sbjct  270  SEEEATINLNAMNKLKGKKPWSLTFSFGRALQQSTLKAWGGKEENIKKAQAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG+Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGSYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_002881445.1| hypothetical protein ARALYDRAFT_482625 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57704.1| hypothetical protein ARALYDRAFT_482625 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKLKTKKPW+L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  270  SEEEATRNLNAMNKLKTKKPWSLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_010495058.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=166

 Score =   144 bits (363),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN   AQ  FLAR KAN
Sbjct  78   SEEEATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVDKAQKAFLARAKAN  137

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GASESLH KDYKY
Sbjct  138  SEATLGAYKGDAQLGDGASESLHVKDYKY  166



>ref|XP_011101492.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Sesamum indicum]
Length=358

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKLKTKKPW+L+FSYGRALQQSTLKAW GK EN   AQ VF ARCKAN
Sbjct  270  SEEEATVNLNAMNKLKTKKPWSLSFSYGRALQQSTLKAWAGKVENIPKAQTVFHARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A ++ GASESLH KDYKY
Sbjct  330  SEATLGTYQGGAAMSEGASESLHVKDYKY  358



>gb|KHN48186.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Glycine 
soja]
Length=346

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMN+LK KKPW+LTFSYGRALQQSTLKAWGGK EN   AQ   L RCKAN
Sbjct  258  SEEEATVNLNAMNQLKGKKPWSLTFSYGRALQQSTLKAWGGKDENIPKAQSALLVRCKAN  317

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  318  SEATLGTYKGDATLGEGASESLHVKDYKY  346



>ref|XP_006851631.1| hypothetical protein AMTR_s00040p00201950 [Amborella trichopoda]
 gb|ERN13161.1| hypothetical protein AMTR_s00040p00201950 [Amborella trichopoda]
Length=357

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLKT KPWNL+FS+GRALQQSTLK W GK+EN  AAQ  FLARCKAN
Sbjct  269  SEEEATLNLNAMNKLKTNKPWNLSFSFGRALQQSTLKTWAGKEENIPAAQKAFLARCKAN  328

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A +  GASESLH KDYKY
Sbjct  329  SEATLGTYKGDAPVGEGASESLHVKDYKY  357



>ref|XP_009617881.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Nicotiana tomentosiformis]
Length=358

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+TKKPW+L+FS+GRALQQSTLKAW GK+EN + AQ  FL RCKAN
Sbjct  270  SEEEATVNLNAMNKLQTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YAG+ NL+ GASESLH KDYKY
Sbjct  330  SEATLGKYAGATNLSEGASESLHVKDYKY  358



>emb|CAD12665.1| putative fructose 1-,6-biphosphate aldolase [Triticum aestivum]
Length=267

 Score =   147 bits (370),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  179  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWSGKTENEEKARAAFLVRCKAN  238

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A LA GASESLH KDYKY
Sbjct  239  SEATLGTYKGDATLAEGASESLHVKDYKY  267



>ref|XP_009789131.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Nicotiana sylvestris]
Length=358

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+TKKPW+L+FS+GRALQQSTLKAW GK+EN + AQ  FL RCKAN
Sbjct  270  SEEEATVNLNAMNKLQTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YAG+ NL+ GASESLH KDYKY
Sbjct  330  SEATLGKYAGATNLSEGASESLHVKDYKY  358



>ref|NP_001242086.1| uncharacterized protein LOC100795446 [Glycine max]
 gb|ACU23111.1| unknown [Glycine max]
Length=358

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMN+LK KKPW+LTFSYGRALQQSTLKAWGGK EN   AQ   L RCKAN
Sbjct  270  SEEEATVNLNAMNQLKGKKPWSLTFSYGRALQQSTLKAWGGKDENIPKAQSALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>ref|XP_011094409.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Sesamum indicum]
Length=358

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKLKTKKPW+L+FS+GRALQQSTLKAW GK+EN   AQ  FLARCKAN
Sbjct  270  SEEEATVNLNAMNKLKTKKPWSLSFSFGRALQQSTLKAWSGKEENVPKAQAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G   L+ GASESLH KDYKY
Sbjct  330  SEATLGTYQGGGALSEGASESLHVKDYKY  358



>ref|XP_003542562.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Glycine max]
Length=358

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMN+LK KKPW+LTFSYGRALQQSTLKAWGGK EN   AQ   L RCKAN
Sbjct  270  SEEEATVNLNAMNQLKGKKPWSLTFSYGRALQQSTLKAWGGKDENIPKAQSALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>ref|XP_004497605.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Cicer arietinum]
Length=358

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKLK KKPW+LTFSYGRALQQSTLKAWGGK EN   AQ   L RCKAN
Sbjct  270  SEEEATVNLNAMNKLKGKKPWSLTFSYGRALQQSTLKAWGGKDENIAKAQAALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G ANL  GASESLH KDYKY
Sbjct  330  SEATLGKYQGDANLGDGASESLHVKDYKY  358



>ref|NP_001118453.1| fructose-bisphosphate aldolase 6 [Arabidopsis thaliana]
 gb|AEC09257.1| fructose-bisphosphate aldolase 6 [Arabidopsis thaliana]
Length=267

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  179  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  238

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  239  SEATLGAYKGDAKLGEGAAESLHVKDYKY  267



>sp|P46257.1|ALF2_PEA RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
2 [Pisum sativum]
 emb|CAA61947.1| fructose-1,6-bisphosphate aldolase [Pisum sativum]
Length=359

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNA+N++K KKPW L+FS+GRALQQSTLKAWGGK EN KAAQD  L R KAN
Sbjct  271  SEEEASVNLNAINQIKGKKPWTLSFSFGRALQQSTLKAWGGKTENVKAAQDALLTRAKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G++NL AGASESLH KDYKY
Sbjct  331  SEATLGTYKGASNLGAGASESLHVKDYKY  359



>gb|EYU38615.1| hypothetical protein MIMGU_mgv1a007931mg [Erythranthe guttata]
Length=390

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNAMNKLK KKPW LTFS+GRALQQSTLKAW GK+EN   AQ  FL RCKAN
Sbjct  302  SEEEASVNLNAMNKLKAKKPWTLTFSFGRALQQSTLKAWAGKEENVGKAQAAFLTRCKAN  361

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY GS++L+ GASESLH KDYKY
Sbjct  362  SEATLGTYKGSSSLSEGASESLHVKDYKY  390



>gb|KHG11048.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Gossypium 
arboreum]
Length=358

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPW+L+FS+GRALQQSTLK W GK+EN K AQD  L RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWSLSFSFGRALQQSTLKTWAGKEENVKKAQDALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAELCEGAAESLHVKDYKY  358



>ref|XP_009141597.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=358

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGVYKGDAQLGEGAAESLHVKDYKY  358



>gb|EMT15181.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Aegilops 
tauschii]
 emb|CDM85265.1| unnamed protein product [Triticum aestivum]
Length=358

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWSGKTENEEKARAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A LA GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLAEGASESLHVKDYKY  358



>gb|EMT05696.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Aegilops 
tauschii]
Length=358

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWSGKTENEEKARAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A LA GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLAEGASESLHVKDYKY  358



>gb|ACO44684.1| fructose-bisphosphate aldolase [Triticum aestivum]
Length=358

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWSGKTENEEKARAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A LA GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLAEGASESLHVKDYKY  358



>gb|KFK32724.1| hypothetical protein AALP_AA6G280600 [Arabis alpina]
Length=358

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGVYKGDAQLGDGAAESLHVKDYKY  358



>ref|XP_007027627.1| Aldolase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY08129.1| Aldolase superfamily protein isoform 2 [Theobroma cacao]
Length=358

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLKTKKPW+L+FS+GRALQQSTLKAW GK+EN K AQ   L RCKAN
Sbjct  270  SEEEATLNLNAMNKLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVKKAQAALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAQLGEGAAESLHVKDYKY  358



>ref|XP_007027626.1| Aldolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY08128.1| Aldolase superfamily protein isoform 1 [Theobroma cacao]
Length=377

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLKTKKPW+L+FS+GRALQQSTLKAW GK+EN K AQ   L RCKAN
Sbjct  289  SEEEATLNLNAMNKLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVKKAQAALLVRCKAN  348

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  349  SEATLGTYKGDAQLGEGAAESLHVKDYKY  377



>ref|NP_181187.1| fructose-bisphosphate aldolase 6 [Arabidopsis thaliana]
 gb|AAD24630.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AAK59404.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AAL34218.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AAM61668.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 dbj|BAE98935.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AEC09256.1| fructose-bisphosphate aldolase 6 [Arabidopsis thaliana]
Length=358

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGAYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_006410823.1| hypothetical protein EUTSA_v10016856mg [Eutrema salsugineum]
 gb|ESQ52276.1| hypothetical protein EUTSA_v10016856mg [Eutrema salsugineum]
Length=358

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGAYKGDAQLGEGAAESLHVKDYKY  358



>ref|NP_001045130.2| Os01g0905800 [Oryza sativa Japonica Group]
 dbj|BAA08845.1| aldolase C-1 [Oryza sativa]
 dbj|BAA08830.1| aldolase C-1 [Oryza sativa]
 dbj|BAD82731.1| fructose-bisphosphate aldolase isoenzyme C-1 [Oryza sativa Japonica 
Group]
 gb|ABL74560.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
 dbj|BAG96902.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07044.2| Os01g0905800 [Oryza sativa Japonica Group]
 gb|ADM86841.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
 gb|AEV58398.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
Length=358

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL TKKPW L+FS+GRALQQSTLKAWGGK EN   AQ  F+ RCKAN
Sbjct  270  SEEEATVNLNAMNKLSTKKPWALSFSFGRALQQSTLKAWGGKTENVVKAQKAFITRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYQGDAVLGEGASESLHVKDYKY  358



>ref|XP_009778188.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Nicotiana sylvestris]
Length=358

 Score =   146 bits (368),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL+TK+PW L+FS+GRALQQSTLKAWGGK EN + A+  FL RCKAN
Sbjct  270  SEEEATRNLNAMNKLQTKRPWTLSFSFGRALQQSTLKAWGGKVENVEKARAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YAGS+NL+ GASESLH KDYKY
Sbjct  330  SEATLGKYAGSSNLSEGASESLHVKDYKY  358



>ref|XP_006293487.1| hypothetical protein CARUB_v10023504mg [Capsella rubella]
 gb|EOA26385.1| hypothetical protein CARUB_v10023504mg [Capsella rubella]
Length=358

 Score =   146 bits (368),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGAYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_011048929.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Populus euphratica]
Length=358

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKLKTKKPW+L+FS+GRALQQSTLKAW GK EN + AQ  FL RCKAN
Sbjct  270  SEEEATRNLNAMNKLKTKKPWSLSFSFGRALQQSTLKAWAGKTENVEKAQAAFLCRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A+L  GASESLH KDYKY
Sbjct  330  SEATLGTYQGDASLGEGASESLHVKDYKY  358



>gb|EMS58841.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Triticum 
urartu]
Length=358

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWSGKTENEEKARTAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>ref|XP_008241287.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Prunus mume]
Length=358

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKLK KKPW L+FS+GRALQQSTLKAW GK+EN KAAQ+ FL R KAN
Sbjct  270  SEEEATVNLNAMNKLKGKKPWTLSFSFGRALQQSTLKAWAGKEENIKAAQEAFLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A +  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKIGEGAAESLHVKDYKY  358



>ref|XP_006645191.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=358

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+L TKKPW+L+FS+GRALQQSTLKAWGGK EN + AQ  F+ RCKAN
Sbjct  270  SEEEATLNLNAMNRLDTKKPWSLSFSFGRALQQSTLKAWGGKVENLEKAQKAFITRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDAVLGEGASESLHVKDYKY  358



>emb|CDM85268.1| unnamed protein product [Triticum aestivum]
Length=358

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWAGKAENEEKARKAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>gb|EMT31985.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Aegilops 
tauschii]
Length=358

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWAGKAENEEKARKAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>gb|EMS60368.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Triticum 
urartu]
Length=358

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLETKKPWNLSFSFGRALQQSTLKAWAGKVENEEKARKAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>gb|ACO44683.1| fructose-bisphosphate aldolase [Secale cereale]
Length=358

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWSGKAENEEKARTAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>dbj|BAJ87658.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWSGKTENEEKARAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>ref|XP_003564871.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Brachypodium distachyon]
Length=358

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPW L+FS+GRALQQSTLKAW GK+EN + A+  FL RCK+N
Sbjct  270  SEEEATLNLNAMNKLQTKKPWFLSFSFGRALQQSTLKAWAGKEENIEKARQAFLVRCKSN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A LA GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLAEGASESLHVKDYKY  358



>gb|AGB05599.1| fructose-bisphosphate aldolase 2 [Camellia oleifera]
Length=358

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLKTKKPW LTFS+GRALQ STLKAW GK EN + AQ  FL RCKAN
Sbjct  270  SEEEATINLNAMNKLKTKKPWTLTFSFGRALQASTLKAWLGKPENVQKAQAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY GS  L+ GA+ESLH KDYKY
Sbjct  330  SEATLGTYQGSGKLSEGAAESLHVKDYKY  358



>ref|XP_008442804.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
isoform X2 [Cucumis melo]
Length=358

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK+EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKEENVEKARAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G ANL+ GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDANLSEGAAESLHVKDYKY  358



>gb|KDP42683.1| hypothetical protein JCGZ_23623 [Jatropha curcas]
Length=358

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKLKTKKPW+L+FS+GRALQQSTLKAW GK EN + AQ  FL R KAN
Sbjct  270  SEEEATVNLNAMNKLKTKKPWSLSFSFGRALQQSTLKAWAGKPENVQKAQAAFLVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G+A L  GASESLH KDYKY
Sbjct  330  SEATLGTYQGNATLGEGASESLHVKDYKY  358



>ref|XP_009621833.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Nicotiana tomentosiformis]
Length=358

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL+TK+PW L+FS+GRALQQSTLKAWGGK EN + A+  FL RCKAN
Sbjct  270  SEEEATRNLNAMNKLQTKRPWTLSFSFGRALQQSTLKAWGGKVENVEKARAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y GS+NL+ GASESLH KDYKY
Sbjct  330  SEATLGKYVGSSNLSEGASESLHVKDYKY  358



>ref|XP_009125243.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=358

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK WGGK+EN KAAQ+    RCKAN
Sbjct  270  SEEEATKNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWGGKEENVKAAQEALYVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVKDYKY  358



>ref|XP_002528593.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
 gb|EEF33801.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
Length=358

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLKTKKPW L+FS+GRALQ STLKAW GK+EN K AQ+  L RCKAN
Sbjct  270  SEEEATLNLNAMNKLKTKKPWTLSFSFGRALQASTLKAWAGKEENVKKAQEALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGAAESLHVKDYKY  358



>ref|XP_006398826.1| hypothetical protein EUTSA_v10013921mg [Eutrema salsugineum]
 gb|ESQ40279.1| hypothetical protein EUTSA_v10013921mg [Eutrema salsugineum]
Length=359

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN + AQ+ FLAR KAN
Sbjct  271  SEEEATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVEKAQNAFLARAKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEAT+G Y G A L  GASESLH KDYKY
Sbjct  331  SEATIGAYKGDAQLGEGASESLHVKDYKY  359



>ref|XP_007202259.1| hypothetical protein PRUPE_ppa007714mg [Prunus persica]
 gb|EMJ03458.1| hypothetical protein PRUPE_ppa007714mg [Prunus persica]
Length=358

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW L+FS+GRALQQSTLKAW GK+EN KAAQ+ FL R KAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWTLSFSFGRALQQSTLKAWAGKEENIKAAQEAFLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_008442803.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
isoform X1 [Cucumis melo]
Length=370

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK+EN + A+  FL RCKAN
Sbjct  282  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKEENVEKARAAFLTRCKAN  341

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G ANL+ GA+ESLH KDYKY
Sbjct  342  SEATLGTYKGDANLSEGAAESLHVKDYKY  370



>gb|AIX10949.1| fructose-bisphosphate aldolase-like protein [Gardenia jasminoides]
Length=358

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLKTKKPW+LTFS+GRALQQSTLKAW GK+EN   AQ  FL+RCKAN
Sbjct  270  SEEEATLNLNAMNKLKTKKPWSLTFSFGRALQQSTLKAWAGKEENVPKAQAAFLSRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A L  GASESLH KDYKY
Sbjct  330  SDATLGKYEGGALLGDGASESLHVKDYKY  358



>ref|XP_010509469.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWFLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGAYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_010516868.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWFLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGAYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_010505193.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Camelina sativa]
Length=358

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW L+FS+GRALQQSTLK WGGK+EN K AQ+ FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWFLSFSFGRALQQSTLKTWGGKEENVKKAQEAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGAYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_006430290.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
 gb|ESR43530.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
Length=358

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLKAW GK+EN + AQ  FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAQLGEGAAESLHVKDYKY  358



>ref|XP_010490860.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=359

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN   AQ  FLAR KAN
Sbjct  271  SEEEATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVDKAQKAFLARAKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GASESLH KDYKY
Sbjct  331  SEATLGAYKGDAQLGDGASESLHVKDYKY  359



>gb|KDO61040.1| hypothetical protein CISIN_1g018326mg [Citrus sinensis]
Length=358

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLKAW GK+EN + AQ  FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAQLGEGAAESLHVKDYKY  358



>ref|XP_006481883.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Citrus sinensis]
Length=358

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLKAW GK+EN + AQ  FL RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAQLGEGAAESLHVKDYKY  358



>ref|XP_006288022.1| hypothetical protein CARUB_v10001255mg [Capsella rubella]
 gb|EOA20920.1| hypothetical protein CARUB_v10001255mg [Capsella rubella]
Length=359

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN + AQ  FLAR KAN
Sbjct  271  SEEEATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVEKAQKAFLARAKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GASESLH KDYKY
Sbjct  331  SEATLGGYKGDAQLGDGASESLHVKDYKY  359



>emb|CDP05655.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+LTFS+GRALQQSTLKAW GK+EN   AQ  FL+RCKAN
Sbjct  272  SEEEATRNLNAMNRLKTKKPWSLTFSFGRALQQSTLKAWAGKEENIPKAQAAFLSRCKAN  331

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A+L  GASESLH KDYKY
Sbjct  332  SDATLGKYEGGASLGEGASESLHVKDYKY  360



>ref|XP_010243792.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Nelumbo nucifera]
Length=358

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK+EN + AQ  FLARCKAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQSAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG+Y G A +  GASESLH KDYKY
Sbjct  330  SEATLGSYKGDAPIGEGASESLHVKDYKY  358



>emb|CDP15370.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+LTFS+GRALQQSTLKAW GK+EN   AQ  FL+RCKAN
Sbjct  270  SEEEATRNLNAMNRLKTKKPWSLTFSFGRALQQSTLKAWAGKEENIPKAQAAFLSRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A+L  GASESLH KDYKY
Sbjct  330  SDATLGKYEGGASLGEGASESLHVKDYKY  358



>ref|XP_009148810.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
2-like, partial [Brassica rapa]
Length=274

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  186  SEEEATKNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  245

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  246  SEATLGTYKGDAKLGDGAAESLHVKDYKY  274



>gb|KDP34381.1| hypothetical protein JCGZ_11264 [Jatropha curcas]
Length=358

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LK KKPW+LTFS+GRALQQSTLKAW GK+EN K AQ   L RCKAN
Sbjct  270  SEEEATRNLNAMNQLKGKKPWSLTFSFGRALQQSTLKAWAGKEENIKKAQAALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G ANL  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDANLGEGAAESLHVKDYKY  358



>gb|AGV08373.1| fructose-bisphosphate aldolase [Arachis hypogaea]
Length=358

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNA+N++K KKPW+L+FS+GRALQQSTLKAW GK+EN K AQ+ FL R KAN
Sbjct  270  SEEEATLNLNAINQVKGKKPWSLSFSFGRALQQSTLKAWSGKEENVKKAQEAFLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY GSANL  GASESLH KDYKY
Sbjct  330  SEATLGTYKGSANLGEGASESLHVKDYKY  358



>ref|XP_006654377.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=358

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQQSTLKAW GK EN ++A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLSTKKPWSLSFSFGRALQQSTLKAWAGKTENVESARKAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDAVLGEGASESLHVKDYKY  358



>ref|NP_850759.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
 emb|CAB82934.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AED90643.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
Length=359

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN   AQ  FLAR KAN
Sbjct  271  SEEEATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVDKAQKAFLARAKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GASESLH KDYKY
Sbjct  331  SEATLGGYKGDAQLGEGASESLHVKDYKY  359



>gb|AAL32644.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAM13358.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
Length=359

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN   AQ  FLAR KAN
Sbjct  271  SEEEATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVDKAQKAFLARAKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GASESLH KDYKY
Sbjct  331  SEATLGGYKGDAQLGEGASESLHVKDYKY  359



>ref|NP_001275267.1| uncharacterized LOC102577842 [Solanum tuberosum]
 gb|ABB29926.1| fructose-bisphosphate aldolase-like [Solanum tuberosum]
Length=358

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL+TKKPW L+FS+GRALQQSTLKAW GK+EN   AQ   L RCKAN
Sbjct  270  SEEEATRNLNAMNKLQTKKPWTLSFSFGRALQQSTLKAWSGKEENIGKAQAALLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YAGS+NL  GASESLH KDYKY
Sbjct  330  SEATLGKYAGSSNLGDGASESLHVKDYKY  358



>ref|XP_002283381.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Vitis vinifera]
 emb|CAN71905.1| hypothetical protein VITISV_035583 [Vitis vinifera]
Length=358

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPWNL+FS+GRALQQSTLKAW GK+EN   A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWNLSFSFGRALQQSTLKAWSGKEENVVKARGAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>gb|KHN18736.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 [Glycine 
soja]
Length=358

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNK + KKPW+L+FS+GRALQQSTLKAWGGK EN K AQD   ARC AN
Sbjct  270  SEEEATLNLNAMNKYQGKKPWSLSFSFGRALQQSTLKAWGGKDENIKKAQDALFARCNAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S ATLGTY G A LA GASESLH KDYKY
Sbjct  330  SHATLGTYKGDATLAEGASESLHVKDYKY  358



>gb|AAM62481.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
Length=393

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN   AQ  FLAR KAN
Sbjct  305  SEEEATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVDKAQKAFLARAKAN  364

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GASESLH KDYKY
Sbjct  365  SEATLGGYKGDAQLGEGASESLHVKDYKY  393



>ref|NP_568127.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
 gb|AED90642.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
Length=393

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN   AQ  FLAR KAN
Sbjct  305  SEEEATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVDKAQKAFLARAKAN  364

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GASESLH KDYKY
Sbjct  365  SEATLGGYKGDAQLGEGASESLHVKDYKY  393



>ref|XP_010552992.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
2-like [Tarenaya hassleriana]
Length=358

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMN+ K KKPW LTFSYGRALQQSTLK WGGK+EN + AQ  FLAR KAN
Sbjct  270  SEEEATVNLNAMNQTKGKKPWRLTFSYGRALQQSTLKTWGGKEENVEKAQSAFLARAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG+Y G A L  GASESLH KDYKY
Sbjct  330  SEATLGSYKGDAKLVEGASESLHVKDYKY  358



>ref|XP_010089415.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Morus notabilis]
 gb|EXB37768.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Morus notabilis]
Length=358

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+ KKPW LTFS+GRALQQSTLKAW GK+EN   AQ   L RCKAN
Sbjct  270  SEEEATLNLNAMNKLQGKKPWTLTFSFGRALQQSTLKAWAGKEENIPKAQAALLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G+A LA GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGNATLAEGAAESLHVKDYKY  358



>ref|XP_003521445.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Glycine max]
Length=358

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNK + KKPW+L+FS+GRALQQSTLKAWGGK EN K AQD   ARC AN
Sbjct  270  SEEEATLNLNAMNKSQGKKPWSLSFSFGRALQQSTLKAWGGKDENIKKAQDALFARCNAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S ATLGTY G A LA GASESLH KDYKY
Sbjct  330  SHATLGTYKGDATLAEGASESLHVKDYKY  358



>ref|XP_010543462.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Tarenaya hassleriana]
Length=358

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMN+LK KKPW+LTFSYGRALQQSTLK W GK+EN + AQ  FLAR +AN
Sbjct  270  SEEEATVNLNAMNQLKGKKPWSLTFSYGRALQQSTLKTWAGKEENVEKAQAAFLARARAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G ANL  GASESLH KDYKY
Sbjct  330  SEATLGGYKGDANLVDGASESLHVKDYKY  358



>gb|KFK24834.1| hypothetical protein AALP_AA8G030900 [Arabis alpina]
Length=359

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+ATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN + AQ  FLAR KAN
Sbjct  271  SEEQATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVEKAQKAFLARAKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEA++G Y G ANL  GASESLH KDYKY
Sbjct  331  SEASVGGYKGDANLGEGASESLHVKDYKY  359



>gb|KCW87412.1| hypothetical protein EUGRSUZ_B03891, partial [Eucalyptus grandis]
Length=348

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATV+LNAMNK++ KKPW LTFSYGRALQQSTLKAW GK+EN + A++ FLARCKAN
Sbjct  260  SEEEATVHLNAMNKIEGKKPWTLTFSYGRALQQSTLKAWAGKEENVEKAREAFLARCKAN  319

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y+G A    GASESLH KDYKY
Sbjct  320  SEATLGAYSGDAGSVEGASESLHVKDYKY  348



>ref|XP_008385438.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Malus domestica]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQQSTLKAW GK EN + A+  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLNTKKPWSLSFSFGRALQQSTLKAWAGKDENVEKARAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLGTY G A L  GASESLH KDYKY
Sbjct  330  SDATLGTYKGDAALGDGASESLHVKDYKY  358



>ref|XP_004137873.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Cucumis sativus]
 gb|KGN59066.1| Fructose-bisphosphate aldolase [Cucumis sativus]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK+EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKEENVEKARAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L+ GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAELSEGAAESLHVKDYKY  358



>ref|XP_010424793.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=526

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN   AQ  FLAR KAN
Sbjct  438  SEEEATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVDKAQKAFLARAKAN  497

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GASESLH KDYKY
Sbjct  498  SEATLGAYKGDAQLGDGASESLHVKDYKY  526



>ref|XP_002877893.1| hypothetical protein ARALYDRAFT_906673 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010504045.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
 ref|XP_010515772.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
 gb|EFH54152.1| hypothetical protein ARALYDRAFT_906673 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVKDYKY  358



>ref|NP_190861.1| fructose-bisphosphate aldolase [Arabidopsis thaliana]
 emb|CAB86897.1| fructose bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAK96613.1| AT3g52930/F8J2_100 [Arabidopsis thaliana]
 gb|AAL15287.1| AT3g52930/F8J2_100 [Arabidopsis thaliana]
 gb|AAL36068.1| AT3g52930/F8J2_100 [Arabidopsis thaliana]
 gb|AAM64896.1| fructose bisphosphate aldolase-like protein [Arabidopsis thaliana]
 dbj|BAH20051.1| AT3G52930 [Arabidopsis thaliana]
 gb|AEE79012.1| fructose-bisphosphate aldolase [Arabidopsis thaliana]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVKDYKY  358



>ref|XP_004171756.1| PREDICTED: LOW QUALITY PROTEIN: fructose-bisphosphate aldolase 
cytoplasmic isozyme-like [Cucumis sativus]
Length=371

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK+EN + A+  FL RCKAN
Sbjct  283  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKEENVEKARAAFLTRCKAN  342

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L+ GA+ESLH KDYKY
Sbjct  343  SEATLGTYKGDAELSEGAAESLHVKDYKY  371



>dbj|BAE48790.1| fructose-bisphosphate aldolase [Codonopsis lanceolata]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+ATVNLNA+NK K KKPW+LTFS+GRALQQSTLKAW GK+EN   AQ  FLARCKAN
Sbjct  270  SEEQATVNLNAINKYKGKKPWSLTFSFGRALQQSTLKAWAGKEENVAKAQAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A+L+ GA+ESLH KDYKY
Sbjct  330  SEATLGTYEGGASLSEGAAESLHVKDYKY  358



>ref|XP_006403749.1| hypothetical protein EUTSA_v10010492mg [Eutrema salsugineum]
 gb|ESQ45202.1| hypothetical protein EUTSA_v10010492mg [Eutrema salsugineum]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  270  SEEEATKNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVKDYKY  358



>ref|XP_004249455.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Solanum lycopersicum]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL+TKKPW L+FS+GRALQQSTLKAW GK EN   AQ   L RCKAN
Sbjct  270  SEEEATRNLNAMNKLQTKKPWTLSFSFGRALQQSTLKAWSGKVENIGKAQAALLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YAGS+NL  GASESLH KDYKY
Sbjct  330  SEATLGKYAGSSNLGDGASESLHVKDYKY  358



>ref|XP_010426925.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  270  SEEEATKNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVKDYKY  358



>gb|AHY18973.1| fructose-bisphosphate aldolase [Brassica rapa subsp. chinensis]
 emb|CDY13330.1| BnaC06g14270D [Brassica napus]
 emb|CDX67550.1| BnaA07g15900D [Brassica napus]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  270  SEEEATKNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVKDYKY  358



>ref|XP_010045253.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Eucalyptus grandis]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATV+LNAMNK++ KKPW LTFSYGRALQQSTLKAW GK+EN + A++ FLARCKAN
Sbjct  270  SEEEATVHLNAMNKIEGKKPWTLTFSYGRALQQSTLKAWAGKEENVEKAREAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y+G A    GASESLH KDYKY
Sbjct  330  SEATLGAYSGDAGSVEGASESLHVKDYKY  358



>dbj|BAI59774.1| aldolase C-1 [Phyllostachys edulis]
Length=358

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLSTKKPWSLSFSFGRALQQSTLKAWAGKVENVEKARKAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDALLGEGASESLHVKDYKY  358



>emb|CDY66283.1| BnaCnng50220D [Brassica napus]
 emb|CDX76248.1| BnaA04g05120D [Brassica napus]
Length=358

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  270  SEEEATKNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVKDYKY  358



>emb|CDX78134.1| BnaA09g33290D [Brassica napus]
 emb|CDX73593.1| BnaC08g24100D [Brassica napus]
Length=358

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  270  SEEEATKNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVKDYKY  358



>sp|P17784.2|ALF_ORYSJ RecName: Full=Fructose-bisphosphate aldolase cytoplasmic isozyme; 
AltName: Full=Gravity-specific protein GSC 233 [Oryza sativa 
Japonica Group]
 gb|AAS05825.1| fructose 1,6-bisphosphate aldolase [Oryza sativa Japonica Group]
 gb|AAT85154.1| putative fructose-bisphosphate aldolase [Oryza sativa Japonica 
Group]
 gb|AAT85207.1| putative fructose-bisphosphate aldolase [Oryza sativa Japonica 
Group]
 gb|ACA50482.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
 gb|ADM86851.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
Length=358

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLSTKKPWSLSFSFGRALQQSTLKAWSGKAENIEKARAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDAVLGEGASESLHVKDYKY  358



>ref|XP_006291269.1| hypothetical protein CARUB_v10017399mg, partial [Capsella rubella]
 gb|EOA24167.1| hypothetical protein CARUB_v10017399mg, partial [Capsella rubella]
Length=396

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  308  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  367

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  368  SEATLGTYKGDAKLGDGAAESLHVKDYKY  396



>ref|XP_010527812.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Tarenaya hassleriana]
Length=358

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK+EN K AQ+ F+ RCKAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKEENVKKAQEAFVVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    GA ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKRGEGADESLHVKDYKY  358



>ref|XP_011043938.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Populus euphratica]
Length=358

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQQSTLKAW GK EN   A+   LARCKAN
Sbjct  270  SEEEATLNLNAMNKLNTKKPWSLSFSFGRALQQSTLKAWAGKPENVGKARAALLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>gb|EPS71641.1| fructose-bisphosphate aldolase [Genlisea aurea]
Length=358

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNL+AMNKLK KKPW L+FS+GRALQQSTLKAW GK+EN   AQ  FL R KAN
Sbjct  270  SEEEATVNLDAMNKLKGKKPWTLSFSFGRALQQSTLKAWAGKEENVPKAQAAFLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTYAGS  L+ GA+ESLH KDYKY
Sbjct  330  SEATLGTYAGSGALSEGAAESLHVKDYKY  358



>gb|ABK96406.1| unknown [Populus trichocarpa x Populus deltoides]
Length=358

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQQSTLKAW GK EN   A+   LARCKAN
Sbjct  270  SEEEATLNLNAMNKLNTKKPWSLSFSFGRALQQSTLKAWAGKPENVGKARAALLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>ref|XP_010049816.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Eucalyptus grandis]
 gb|KCW89240.1| hypothetical protein EUGRSUZ_A01538 [Eucalyptus grandis]
Length=358

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK+EN   AQ   L RCKAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKEENIPKAQAALLRRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLGTY G A L  GASESLH KDYKY
Sbjct  330  SDATLGTYKGDAQLGEGASESLHVKDYKY  358



>ref|XP_002325037.1| fructose-1 family protein [Populus trichocarpa]
 gb|ABK95754.1| unknown [Populus trichocarpa]
 gb|EEF03602.1| fructose-1 family protein [Populus trichocarpa]
Length=358

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQQSTLKAW GK EN   A+   LARCKAN
Sbjct  270  SEEEATLNLNAMNKLNTKKPWSLSFSFGRALQQSTLKAWAGKPENVGKARAALLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>ref|XP_006661653.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=361

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL  KKPW+L+FS+GRALQQSTLKAW GK EN + A++ FL RCKAN
Sbjct  273  SEEEATVNLNAMNKLTAKKPWSLSFSFGRALQQSTLKAWAGKTENTEKAREAFLVRCKAN  332

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  333  SEATLGTYKGDAVLGEGAAESLHVKDYKY  361



>gb|ABK93066.1| unknown [Populus trichocarpa]
Length=358

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW L+FS+GRALQQSTLKAW GK EN   A+   LARCKAN
Sbjct  270  SEEEATLNLNAMNKLNTKKPWTLSFSFGRALQQSTLKAWAGKPENVGKARAALLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDATLGEGASESLHVKDYKY  358



>ref|XP_009122681.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Brassica rapa]
Length=359

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+ATVNLNA+N+LK KKPW+LTFSYGRALQQSTLKAWGGK+EN + AQ  FLAR KAN
Sbjct  271  SEEQATVNLNAINQLKGKKPWSLTFSYGRALQQSTLKAWGGKEENVEKAQKAFLARAKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEAT G Y G A L  GASESLH KDYKY
Sbjct  331  SEATTGAYKGDAQLGEGASESLHVKDYKY  359



>emb|CAB77243.2| fructose-bisphosphate aldolase [Persea americana]
Length=358

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW L+FS+GRALQQSTLK W GK+EN K AQ  FL+RCKAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWTLSFSFGRALQQSTLKTWAGKEENVKKAQSAFLSRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    G SESLH KDYKY
Sbjct  330  SEATLGTYKGDAAKGEGVSESLHVKDYKY  358



>gb|ABB16974.1| unknown [Solanum tuberosum]
Length=358

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT  LNAMNKL+TKKPW L+FS+GRALQQSTLKAW GK+EN   AQ   L RCKAN
Sbjct  270  SEEEATRXLNAMNKLQTKKPWTLSFSFGRALQQSTLKAWSGKEENIGKAQAALLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YAGS+NL  GASESLH KDYKY
Sbjct  330  SEATLGKYAGSSNLGDGASESLHVKDYKY  358



>dbj|BAL41455.1| fructose-bisphosphate aldolase 1, partial [Linum grandiflorum]
Length=349

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+ATVNLNAMNKL+TKKPW+L+FS+GRALQ STLKAW GK+EN + AQ+ FLAR KAN
Sbjct  261  SEEQATVNLNAMNKLQTKKPWSLSFSFGRALQSSTLKAWAGKEENIEKAQNAFLARAKAN  320

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GASESLH KDYKY
Sbjct  321  SEATLGKYQGDATLGEGASESLHVKDYKY  349



>ref|NP_001265896.1| fructose-bisphosphate aldolase, cytoplasmic isozyme [Cicer arietinum]
 sp|O65735.1|ALF_CICAR RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Cicer arietinum]
 emb|CAA06308.1| cytosolic fructose-1,6-bisphosphate aldolase [Cicer arietinum]
Length=359

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNA+N++K KKPW L+FS+GRALQQSTLKAW GK+EN K AQD  L R KAN
Sbjct  271  SEEEATVNLNAINQVKGKKPWTLSFSFGRALQQSTLKAWSGKEENVKNAQDALLTRAKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G++ L  GASESLH KDYKY
Sbjct  331  SEATLGTYKGNSQLGEGASESLHVKDYKY  359



>ref|XP_009352993.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Pyrus x bretschneideri]
Length=358

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK  KPW+L+FS+GRALQQSTLKAW GK+EN K AQ+ FL R KAN
Sbjct  270  SEEEATINLNAMNKLKANKPWSLSFSFGRALQQSTLKAWSGKEENVKKAQEAFLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGNYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_010558953.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Tarenaya hassleriana]
Length=358

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK EN   AQ+ F+ RCKAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKDENVTKAQEAFIVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    GA ESLH KDYKY
Sbjct  330  SEATLGTYRGDAKRGEGADESLHVKDYKY  358



>dbj|BAA02729.1| cytoplasmic aldolase [Oryza sativa Japonica Group]
Length=358

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL  KKPW+L+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLSAKKPWSLSFSFGRALQQSTLKAWAGKTENVEKARAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAVLGEGAAESLHVKDYKY  358



>gb|ABG65931.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EAZ15405.1| hypothetical protein OsJ_30817 [Oryza sativa Japonica Group]
 dbj|BAG92549.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL  KKPW+L+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLSAKKPWSLSFSFGRALQQSTLKAWAGKTENVEKARAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAVLGEGAAESLHVKDYKY  358



>gb|EAY94426.1| hypothetical protein OsI_16195 [Oryza sativa Indica Group]
Length=358

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL  KKPW+L+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLSAKKPWSLSFSFGRALQQSTLKAWAGKTENVEKARAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAVLGEGAAESLHVKDYKY  358



>ref|XP_010089414.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Morus notabilis]
 gb|EXB37767.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Morus notabilis]
Length=358

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK+EN   AQ   L R KAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKEENIPKAQAALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A LA GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDATLAEGAAESLHVKDYKY  358



>ref|XP_009365337.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Pyrus x bretschneideri]
Length=358

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW L+FS+GRALQQSTLKAW GK+EN K AQ+ FL R KAN
Sbjct  270  SEEEATLNLNAMNKLKAKKPWTLSFSFGRALQQSTLKAWSGKEENVKKAQEAFLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+E+LH KDYKY
Sbjct  330  SEATLGAYKGDAKLGEGAAENLHVKDYKY  358



>gb|KFK34541.1| hypothetical protein AALP_AA5G159400 [Arabis alpina]
Length=358

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK EN KAAQ+    RCKAN
Sbjct  270  SEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWSGKAENVKAAQEALYVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH  DYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVADYKY  358



>ref|XP_006381780.1| fructose-1 family protein [Populus trichocarpa]
 gb|ABK93144.1| unknown [Populus trichocarpa]
 gb|ERP59577.1| fructose-1 family protein [Populus trichocarpa]
Length=358

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNA+NKLKTKKPW+L+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATRNLNAINKLKTKKPWSLSFSFGRALQQSTLKAWAGKTENVEKARAAFLCRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    GASESLH KDYKY
Sbjct  330  SEATLGTYQGDAAPGEGASESLHVKDYKY  358



>gb|KCW48359.1| hypothetical protein EUGRSUZ_K02073 [Eucalyptus grandis]
Length=349

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLK+W GK+EN   AQ     RCKAN
Sbjct  261  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKSWAGKEENVPKAQAALFTRCKAN  320

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  321  SEATLGTYKGDAKLGEGAAESLHVKDYKY  349



>ref|XP_007145245.1| hypothetical protein PHAVU_007G222900g [Phaseolus vulgaris]
 gb|ESW17239.1| hypothetical protein PHAVU_007G222900g [Phaseolus vulgaris]
Length=357

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMN LK KKPW LTFSYGRALQQSTLKAWGGK EN   AQ   L RCKAN
Sbjct  270  SEEEATVNLNAMNALKGKKPWALTFSYGRALQQSTLKAWGGKDENIPKAQAALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLGTY G A  + GASESLH KDYKY
Sbjct  330  SQATLGTYKGDAK-SDGASESLHVKDYKY  357



>ref|XP_010036726.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Eucalyptus grandis]
 gb|KCW48360.1| hypothetical protein EUGRSUZ_K02073 [Eucalyptus grandis]
Length=358

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLK+W GK+EN   AQ     RCKAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKSWAGKEENVPKAQAALFTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>gb|AFK43805.1| unknown [Medicago truncatula]
 gb|KEH28149.1| fructose-bisphosphate aldolase [Medicago truncatula]
Length=358

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNA+N++  KKPW L+FS+GRALQQSTLKAW GK+EN KAAQ+  L R KAN
Sbjct  270  SEEEASVNLNAINQVNGKKPWTLSFSFGRALQQSTLKAWSGKEENVKAAQEALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G++ L AGASESLH KDYKY
Sbjct  330  SEATLGTYKGNSKLGAGASESLHVKDYKY  358



>ref|XP_004970966.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Setaria italica]
Length=358

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQ STLKAW GK+EN + A+  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLNTKKPWSLSFSFGRALQASTLKAWAGKEENVEKARAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    G SESLH KDYKY
Sbjct  330  SEATLGTYKGDAAAGEGVSESLHVKDYKY  358



>ref|XP_004952502.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Setaria italica]
Length=358

 Score =   138 bits (347),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQ STLKAWGGK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLNTKKPWSLSFSFGRALQASTLKAWGGKVENVEKARAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    G SESLH KDYKY
Sbjct  330  SEATLGTYKGDAAAGEGVSESLHVKDYKY  358



>ref|XP_008386943.1| PREDICTED: LOW QUALITY PROTEIN: fructose-bisphosphate aldolase, 
cytoplasmic isozyme-like [Malus domestica]
Length=358

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+AT+NLNAMNKLK KKPW L+FS+GRALQQSTLKAW GK+EN K AQ+ FL R KAN
Sbjct  270  SEEDATLNLNAMNKLKAKKPWTLSFSFGRALQQSTLKAWSGKEENVKKAQEAFLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+E+LH KDYKY
Sbjct  330  SEATLGAYKGDAKLGEGAAENLHVKDYKY  358



>gb|AAG21429.1|AF308587_1 cytosolic aldolase [Fragaria x ananassa]
Length=358

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW L+FS+GRALQ STLKAW GK+EN KAAQ+  L R KAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWTLSFSFGRALQASTLKAWSGKKENVKAAQEALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_010553342.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Tarenaya hassleriana]
Length=358

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK EN   AQ+  L RCKAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKDENVAKAQEALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    GA ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKRGEGADESLHVKDYKY  358



>gb|ACO44685.1| fructose-bisphosphate aldolase [Hordeum vulgare]
Length=358

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLK   GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKPGSGKTENEEKARAAFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G   L  GASESLH KDYKY
Sbjct  330  SEATLGTYQGDGTLGEGASESLHVKDYKY  358



>ref|XP_004303023.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Fragaria vesca subsp. vesca]
Length=358

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW L+FS+GRALQ STLKAW GK+EN KAAQ+  L R KAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWTLSFSFGRALQASTLKAWSGKKENVKAAQEALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_008462541.1| PREDICTED: LOW QUALITY PROTEIN: fructose-bisphosphate aldolase 
cytoplasmic isozyme [Cucumis melo]
Length=338

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK EN   AQ   L RCKAN
Sbjct  202  SEEEATVNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKDENIPKAQAALLVRCKAN  261

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A ++ GA+ESLH  +YKY
Sbjct  262  SEATLGTYKGDAKISEGAAESLHVDNYKY  290



>ref|XP_004143304.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Cucumis sativus]
 ref|XP_004166910.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Cucumis sativus]
 gb|KGN48236.1| hypothetical protein Csa_6G450410 [Cucumis sativus]
Length=358

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK EN   AQ   L RCKAN
Sbjct  270  SEEEATINLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKDENIPKAQAALLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A ++ GA+ESLH  +YKY
Sbjct  330  SEATLGTYKGDAKISEGAAESLHVDNYKY  358



>ref|XP_009115993.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=358

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    R KAN
Sbjct  270  SEEEATKNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRGKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGDGAAESLHVKDYKY  358



>ref|XP_008391753.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Malus domestica]
Length=358

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK  KPW+L+FS+GRALQQSTLKAW GK+ N K AQ+ FL R KAN
Sbjct  270  SEEEATINLNAMNKLKANKPWSLSFSFGRALQQSTLKAWSGKEXNVKKAQEAFLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGNYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_009411827.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK+ N   A+  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKEGNIDKARTAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    G SESLH KDYKY
Sbjct  330  SEATLGTYKGDAAGGEGVSESLHVKDYKY  358



>ref|XP_008799938.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Phoenix dactylifera]
Length=358

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+ KKPW+L+FS+GRALQQSTLKAW GK+EN   A+   LARCKAN
Sbjct  270  SEEEATLNLNAMNKLEGKKPWSLSFSFGRALQQSTLKAWAGKEENIGKARAALLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A+ A G +ESLH KDYKY
Sbjct  330  SEATLGTYKGDASGAEGVTESLHVKDYKY  358



>gb|ABA27085.1| TO114-2 [Taraxacum officinale]
Length=109

 Score =   130 bits (327),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMN+ K KKPW LTFS+GRALQQSTLKAW GK EN + AQ  FLARCKAN
Sbjct  26   SEEEATVNLNAMNQYKGKKPWTLTFSFGRALQQSTLKAWSGKVENVEKAQAAFLARCKAN  85

Query  182  SEATLGTYAGSANLAAGASESLH  250
            SEATLG Y G + L+ GASESLH
Sbjct  86   SEATLGIYKGGSGLSEGASESLH  108



>dbj|BAI59775.1| aldolase C-2 [Phyllostachys edulis]
Length=358

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL TKKPW+L+FS+GRALQQSTLKAW GK+EN + A+   L RCKAN
Sbjct  270  SEEEATQNLNAMNKLSTKKPWSLSFSFGRALQQSTLKAWAGKEENVEKARKALLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH K YKY
Sbjct  330  SEATLGTYKGDAVLGEGASESLHVKGYKY  358



>ref|XP_002453822.1| hypothetical protein SORBIDRAFT_04g019020 [Sorghum bicolor]
 gb|EES06798.1| hypothetical protein SORBIDRAFT_04g019020 [Sorghum bicolor]
Length=358

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQ STLKAW GK+EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLNTKKPWSLSFSFGRALQASTLKAWAGKEENVEKARAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    G SESLH KDYKY
Sbjct  330  SEATLGTYKGDAAAGEGVSESLHVKDYKY  358



>ref|XP_007202254.1| hypothetical protein PRUPE_ppa007696mg [Prunus persica]
 gb|EMJ03453.1| hypothetical protein PRUPE_ppa007696mg [Prunus persica]
Length=358

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK+EN   AQ   L R KAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKEENIGKAQAALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_010278210.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Nelumbo nucifera]
Length=358

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+AT+NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK+EN + A+  FL RCKAN
Sbjct  270  SEEQATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKEENVQKARAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    G SESLH KDYKY
Sbjct  330  SEATLGTYKGDAAQGEGVSESLHVKDYKY  358



>ref|XP_010932289.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Elaeis guineensis]
Length=425

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+ KKPW+L+FS+GRALQQSTLK+W GK+EN + A+  FLARCKAN
Sbjct  337  SEEEATLNLNAMNKLEGKKPWSLSFSFGRALQQSTLKSWAGKEENVEKARAAFLARCKAN  396

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    G SESLH KDYKY
Sbjct  397  SEATLGTYKGDAAGGEGVSESLHVKDYKY  425



>gb|AFK42407.1| unknown [Lotus japonicus]
Length=78

 Score =   129 bits (324),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  35   MNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKANSEATLGTYAGS  214
            MNKLK KKPW+LTFS+GRALQQSTLKAW GK+EN + AQ  FL RCKANSEATLG+Y G 
Sbjct  1    MNKLKGKKPWSLTFSFGRALQQSTLKAWAGKEENVETAQATFLTRCKANSEATLGSYKGD  60

Query  215  ANLAAGASESLHEKDYKY  268
            ANLA GASESLH KDYKY
Sbjct  61   ANLAEGASESLHVKDYKY  78



>gb|ABK21911.1| unknown [Picea sitchensis]
 gb|ACN40269.1| unknown [Picea sitchensis]
Length=358

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPW L+FS+GRALQ STLK W GK EN   AQ  FL+RCKAN
Sbjct  270  SEEEATLNLNAMNKLQTKKPWTLSFSFGRALQASTLKTWAGKTENIPVAQAAFLSRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YAG ++   G SESLH KDYKY
Sbjct  330  SEATLGKYAGDSSKGNGVSESLHVKDYKY  358



>ref|XP_009412699.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW+L+FS+GRALQQSTLKAW GK+EN + A+   L RCKAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWSLSFSFGRALQQSTLKAWAGKEENVQKARAALLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    G SESLH KDYKY
Sbjct  330  SEATLGTYKGDAAGGEGVSESLHVKDYKY  358



>emb|CAA37290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            S+EEAT NLNAMNKL TKKPW+L+FS+GRALQQSTLKAW GK  N + A+  FL RCKAN
Sbjct  270  SKEEATRNLNAMNKLSTKKPWSLSFSFGRALQQSTLKAWSGKAANIEKARAAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  330  SEATLGTYKGDAVLGEGASESLHVKDYKY  358



>ref|XP_009402715.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+ KKPW+L+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLQGKKPWSLSFSFGRALQQSTLKAWAGKVENVEKARTAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A    G SESLH KDYKY
Sbjct  330  SEATLGTYKGDAAGGEGVSESLHVKDYKY  358



>sp|P29356.1|ALF_SPIOL RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Spinacia oleracea]
 emb|CAA46649.1| fructose-bisphosphate aldolase [Spinacia oleracea]
Length=357

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+TKKPW L+FSYGRALQQSTLKAW GK+EN   AQ+VFLAR K N
Sbjct  270  SEEEATLNLNAMNKLETKKPWTLSFSYGRALQQSTLKAWQGKEENVAKAQEVFLARAKGN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A   A ASESLH KDYKY
Sbjct  330  SEATLGKYQGGAG-GADASESLHVKDYKY  357



>ref|XP_008391754.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Malus domestica]
 ref|XP_008351441.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Malus domestica]
Length=358

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK+EN   AQ   L R KAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKEENIPKAQAALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_009352992.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Pyrus x bretschneideri]
Length=358

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK+EN   AQ   L R KAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKEENIPKAQAALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>gb|AES98478.2| fructose-bisphosphate aldolase [Medicago truncatula]
Length=384

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNA+N++  KKPW L+FS+G ALQQSTLKAW GK+EN KAAQ+  L R KAN
Sbjct  296  SEEEASVNLNAINQVNGKKPWTLSFSFGMALQQSTLKAWSGKEENVKAAQEALLTRAKAN  355

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G++ L AGASESLH KDYKY
Sbjct  356  SEATLGTYKGNSKLGAGASESLHVKDYKY  384



>ref|XP_010683863.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Beta vulgaris subsp. vulgaris]
Length=357

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+ KKPW L+FSYGRALQQSTLKAW GK+EN   AQ+VFLAR KAN
Sbjct  270  SEEEATLNLNAMNKLQAKKPWTLSFSYGRALQQSTLKAWSGKEENVSKAQEVFLARAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A   A ASESLH KDYKY
Sbjct  330  SEATLGKYQGGAA-GADASESLHVKDYKY  357



>ref|XP_010940458.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Elaeis guineensis]
Length=358

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLK W GKQEN + A+  FL+RCKAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKTWAGKQENVEKARAAFLSRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A    G SESLH KDYKY
Sbjct  330  SEATLGAYEGDAAKGEGVSESLHVKDYKY  358



>ref|XP_004303022.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Fragaria vesca subsp. vesca]
Length=358

 Score =   135 bits (340),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW L+FS+GRALQ STLKAW GK+EN KAAQ   L R KAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWTLSFSFGRALQASTLKAWSGKKENVKAAQQALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGIYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_008241286.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Prunus mume]
Length=358

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK KKPW L+FS+GRALQQSTLKAW GK EN   AQ   L R KAN
Sbjct  270  SEEEATLNLNAMNKLKGKKPWTLSFSFGRALQQSTLKAWAGKVENIGKAQAALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGTYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_008775192.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Phoenix dactylifera]
Length=358

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLK W GK+EN + A+  FL+RCKAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKTWAGKEENVEKARAAFLSRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A    G SESLH KDYKY
Sbjct  330  SEATLGAYKGDAGRGEGVSESLHVKDYKY  358



>gb|KHN40026.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Glycine 
soja]
Length=358

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNA+N++  KKPW+L+FS+GRALQQSTLKAW GK+EN K AQ+  L R KAN
Sbjct  270  SEEEASVNLNAINQVNGKKPWSLSFSFGRALQQSTLKAWSGKEENVKKAQEALLVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G++ LA GASESLH +DYKY
Sbjct  330  SEATLGTYKGNSKLADGASESLHVEDYKY  358



>ref|NP_001242367.1| uncharacterized protein LOC100778363 [Glycine max]
 gb|ACU24103.1| unknown [Glycine max]
Length=358

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNA+N++  KKPW+L+FS+GRALQQSTLKAW GK+EN K AQ+  L R KAN
Sbjct  270  SEEEASVNLNAINQVNGKKPWSLSFSFGRALQQSTLKAWSGKEENVKKAQEALLVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G++ LA GASESLH +DYKY
Sbjct  330  SEATLGTYKGNSKLADGASESLHVEDYKY  358



>ref|XP_009411974.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009411977.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLK W GK+EN + A   FL+RCKAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKTWAGKEENVEKAMAAFLSRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A    G SESLH KDYKY
Sbjct  330  SEATLGAYKGDATKGEGVSESLHVKDYKY  358



>ref|XP_009365338.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Pyrus x bretschneideri]
Length=358

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK+EN   AQ   L R KAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKEENIPKAQAALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGIYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_003615520.1| Fructose-bisphosphate aldolase [Medicago truncatula]
Length=737

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNA+N++  KKPW L+FS+GRALQQSTLKAW GK+EN KAAQ+  L R KAN
Sbjct  270  SEEEASVNLNAINQVNGKKPWTLSFSFGRALQQSTLKAWSGKEENVKAAQEALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G++ L AGASESLH KDYK+
Sbjct  330  SEATLGTYKGNSKLGAGASESLHVKDYKF  358


 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNA+N++  KKPW L+FS+G ALQQSTLKAW GK+EN KAAQ+  L R KAN
Sbjct  649  SEEEASVNLNAINQVNGKKPWTLSFSFGMALQQSTLKAWSGKEENVKAAQEALLTRAKAN  708

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G++ L AGASESLH KDYKY
Sbjct  709  SEATLGTYKGNSKLGAGASESLHVKDYKY  737



>ref|XP_010912239.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Elaeis guineensis]
Length=358

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLK W GK+EN + A+  FL+RCKAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKTWAGKEENVEKARAAFLSRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A    G SESLH KDYKY
Sbjct  330  SEATLGAYKGDAAKGEGVSESLHVKDYKY  358



>ref|XP_007207750.1| hypothetical protein PRUPE_ppa1027146mg [Prunus persica]
 gb|EMJ08949.1| hypothetical protein PRUPE_ppa1027146mg [Prunus persica]
Length=365

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+G ALQQSTLK+  GK EN + A+  FL RCKAN
Sbjct  277  SEEEATLNLNAMNKLNTKKPWSLSFSFGLALQQSTLKSRAGKDENVEKARVAFLGRCKAN  336

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G A L  GASESLH KDYKY
Sbjct  337  SEATLGTYKGDAALGDGASESLHVKDYKY  365



>ref|XP_010927580.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Elaeis guineensis]
Length=358

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL  KKPW+L+FS+GRALQQSTLKAW GK EN + A+  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLGGKKPWSLSFSFGRALQQSTLKAWAGKVENVEKARAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A    G SESLH KDYKY
Sbjct  330  SEATLGKYKGDAAGGEGVSESLHVKDYKY  358



>gb|KHN46204.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Glycine 
soja]
Length=358

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNA+N++  KKPW+L+FS+GRALQQSTLKAWGGK+EN K AQ+  L R KAN
Sbjct  270  SEEEASVNLNAINQVNGKKPWSLSFSFGRALQQSTLKAWGGKEENVKKAQEALLVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G++ LA GASESLH  +Y Y
Sbjct  330  SEATLGTYKGNSQLADGASESLHVSNYSY  358



>gb|EMS53099.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Triticum 
urartu]
Length=528

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            S EEAT+NLNAMNKL+TKKPWNL+FS+GRALQQSTLKAW GK EN + A+  FL RCKAN
Sbjct  396  SVEEATLNLNAMNKLQTKKPWNLSFSFGRALQQSTLKAWSGKAENEEKARAAFLVRCKAN  455

Query  182  SEATLGTYAGSANLAAGASESLHEKDYK  265
            SEATLGTY G A L  GASESLH  D +
Sbjct  456  SEATLGTYKGVATLGEGASESLHVTDCR  483



>gb|AAB61592.1| fructose-biphosphate aldolase [Mesembryanthemum crystallinum]
Length=357

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+ KKPW L+FSYGRALQ STLKAW GK+EN + AQ VFLAR K N
Sbjct  270  SEEEATVNLNAMNKLQGKKPWTLSFSYGRALQSSTLKAWSGKEENVEKAQAVFLARAKGN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A   A ASESLH KDYKY
Sbjct  330  SEATLGKYQGGAG-GADASESLHVKDYKY  357



>gb|AAR88661.1| fructose-bisphosphate aldolase [Pandanus amaryllifolius]
Length=358

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQQST+K W GK+EN  AAQ  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQQSTIKKWAGKKENVPAAQAPFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G+A   A ASESLH KDYKY
Sbjct  330  SEATLGKYGGAAPADAAASESLHVKDYKY  358



>ref|XP_008797227.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Phoenix dactylifera]
Length=358

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+ KKPW+L+FS+GRALQQSTLKAW GK++N + A+  FL+RCKAN
Sbjct  270  SEEEATLNLNAMNKLEGKKPWSLSFSFGRALQQSTLKAWAGKEQNVEKARAAFLSRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A   A  SESLH KDYKY
Sbjct  330  SEATLGKYKGDAAGGAVVSESLHVKDYKY  358



>dbj|BAA11395.1| putative aldolase [Brassica rapa]
Length=149

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LKTKKPW+L+FS+GRALQQSTLK W GK+EN KAAQ+    RCKAN
Sbjct  50   SEEEATKNLNAMNQLKTKKPWSLSFSFGRALQQSTLKTWAGKEENVKAAQEALYVRCKAN  109

Query  182  SEATLGTYAGSANLAAGASESL  247
            SEATLG Y G A L  GA+ESL
Sbjct  110  SEATLGPYKGDAKLGDGAAESL  131



>ref|XP_010676114.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Beta vulgaris subsp. vulgaris]
Length=357

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+  KPW L+FS+GRALQQSTLK W GK+EN + AQ+VFLARCKAN
Sbjct  270  SEEEATVNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWCGKKENVRKAQEVFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEA+LG Y  + + AA ASESL EK YKY
Sbjct  330  SEASLGKYIATGS-AAAASESLFEKAYKY  357



>ref|XP_002970423.1| hypothetical protein SELMODRAFT_267384 [Selaginella moellendorffii]
 gb|EFJ28553.1| hypothetical protein SELMODRAFT_267384 [Selaginella moellendorffii]
Length=358

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SE EAT NL+AMNKL   KPW L+FS+GRALQQSTLK WGGK+EN +AAQ VFL R KAN
Sbjct  270  SEVEATKNLDAMNKLDILKPWTLSFSFGRALQQSTLKTWGGKKENVEAAQKVFLVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y+G    A GASESLH KDYKY
Sbjct  330  SDATLGKYSGETESAEGASESLHVKDYKY  358



>ref|XP_008386942.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Malus domestica]
Length=358

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK+ N   AQ   L R KAN
Sbjct  270  SEEEATLNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKEGNIPKAQAALLTRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G A L  GA+ESLH KDYKY
Sbjct  330  SEATLGIYKGDAKLGEGAAESLHVKDYKY  358



>ref|XP_002458944.1| hypothetical protein SORBIDRAFT_03g043140 [Sorghum bicolor]
 gb|EES04064.1| hypothetical protein SORBIDRAFT_03g043140 [Sorghum bicolor]
Length=355

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 3/89 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW+L+FS+GRALQ STLKAW GK EN + A+  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLNTKKPWSLSFSFGRALQASTLKAWAGKVENIEKARAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G    AA  +ESLH KDYKY
Sbjct  330  SEATLGTYKGD---AAADTESLHVKDYKY  355



>ref|XP_002978503.1| hypothetical protein SELMODRAFT_176914 [Selaginella moellendorffii]
 gb|EFJ20489.1| hypothetical protein SELMODRAFT_176914 [Selaginella moellendorffii]
Length=358

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SE EAT NL+AMNKL   KPW L+FS+GRALQQSTLK WGGK+EN  AAQ VFL R KAN
Sbjct  270  SEVEATKNLDAMNKLDILKPWTLSFSFGRALQQSTLKTWGGKKENVAAAQKVFLVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y+G    A GASESLH KDYKY
Sbjct  330  SDATLGKYSGETESAEGASESLHVKDYKY  358



>ref|XP_006857683.1| hypothetical protein AMTR_s00061p00163810 [Amborella trichopoda]
 gb|ERN19150.1| hypothetical protein AMTR_s00061p00163810 [Amborella trichopoda]
Length=357

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPWNL+FS+GRALQQSTLKAW GK EN +AAQ  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLEVLKPWNLSFSFGRALQQSTLKAWAGKNENVEAAQGTFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEAT G Y GS    A ASESL+ K YKY
Sbjct  330  SEATFGKYVGSGAGGA-ASESLYVKGYKY  357



>gb|AAR84667.1| fructose 1,6, bisphosphate aldolase [Salicornia herbacea]
Length=359

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAM KL+  KPW L+FS+GRALQQSTLK WGGK+EN   AQ VFL RCKAN
Sbjct  270  SEEEATVNLNAMIKLEVLKPWTLSFSFGRALQQSTLKTWGGKKENLSKAQSVFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            SEATLG Y  + N   G ASESL +KDYKY
Sbjct  330  SEATLGKYVAAGNSDNGAASESLFQKDYKY  359



>ref|NP_001150049.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Zea mays]
 ref|XP_008654550.1| PREDICTED: uncharacterized protein LOC100272913 isoform X1 [Zea 
mays]
 gb|ACF86533.1| unknown [Zea mays]
 gb|ACG37623.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Zea mays]
 gb|AFW84242.1| fructose-bisphosphate aldolase [Zea mays]
Length=355

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL TKKPW L+FS+GRALQ STLKAW GK EN + A+  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLSTKKPWALSFSFGRALQASTLKAWAGKVENVEKARAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G    AA  +ESLH KDYKY
Sbjct  330  SEATLGTYKGD---AAADTESLHVKDYKY  355



>gb|ACG24536.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Zea mays]
Length=270

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL TKKPW+L+FS+GRALQ STLKAW GK EN + A+  FLARCKAN
Sbjct  186  SEEEATRNLNAMNKLSTKKPWSLSFSFGRALQASTLKAWAGKVENLEKARAAFLARCKAN  245

Query  182  SEATLGTYAGSANLAAGASESLHEKDYK  265
            SEATLGTY G    AA  +ESLH KDYK
Sbjct  246  SEATLGTYKGD---AAADTESLHVKDYK  270



>gb|ACG68894.1| fructose-biphosphate aldolase [Sesuvium portulacastrum]
Length=357

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+TKKPW L+FSYGRALQQ TLK W GK+EN + AQ  FLAR KAN
Sbjct  270  SEEEATVNLNAMNKLQTKKPWTLSFSYGRALQQFTLKTWAGKEENVEKAQAAFLARAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEA LG Y G A   A A ESLH KDYKY
Sbjct  330  SEAPLGKYVGGAG-GADAFESLHVKDYKY  357



>ref|NP_001105336.1| fructose-bisphosphate aldolase, cytoplasmic isozyme [Zea mays]
 sp|P08440.1|ALF_MAIZE RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Zea mays]
 gb|AAA33435.1| aldolase [Zea mays]
 emb|CAA31366.1| fructose bisphosphate aldolase [Zea mays]
 prf||1307278A cytoplasmic aldolase
Length=355

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL TKKPW+L+FS+GRALQ STLKAW GK EN + A+  FLARCKAN
Sbjct  270  SEEEATRNLNAMNKLSTKKPWSLSFSFGRALQASTLKAWAGKVENLEKARAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G    AA  +ESLH KDYKY
Sbjct  330  SEATLGTYKGD---AAADTESLHVKDYKY  355



>gb|ACF79162.1| unknown [Zea mays]
 gb|ACF85907.1| unknown [Zea mays]
 tpg|DAA56269.1| TPA: aldolase1 [Zea mays]
Length=355

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL TKKPW+L+FS+GRALQ STLKAW GK EN + A+  FLARCKAN
Sbjct  270  SEEEATRNLNAMNKLSTKKPWSLSFSFGRALQASTLKAWAGKVENLEKARAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G    AA  +ESLH KDYKY
Sbjct  330  SEATLGTYKGD---AAADTESLHVKDYKY  355



>ref|XP_010252855.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Nelumbo nucifera]
Length=357

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW L+FS+GRALQQSTLK WGGK+EN KAAQ+ FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLDVVKPWTLSFSFGRALQQSTLKTWGGKKENVKAAQEAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S ATLG Y G +   A ASESL+ K YKY
Sbjct  330  SVATLGKYTGGSG-GALASESLYVKGYKY  357



>ref|XP_007142455.1| hypothetical protein PHAVU_008G282000g [Phaseolus vulgaris]
 gb|ESW14449.1| hypothetical protein PHAVU_008G282000g [Phaseolus vulgaris]
Length=357

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQQSTLK WGGK+EN   AQ+ FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWGGKEENVAKAQEAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG + G +     ASESL+EK+YKY
Sbjct  330  SEATLGKHVGESQTGL-ASESLYEKNYKY  357



>ref|XP_007141361.1| hypothetical protein PHAVU_008G189200g [Phaseolus vulgaris]
 gb|ESW13355.1| hypothetical protein PHAVU_008G189200g [Phaseolus vulgaris]
Length=358

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA++NLNA+N++  KKPW+L+FS+GRALQQSTLKAWGGK+EN K AQ+  L R KAN
Sbjct  270  SEEEASLNLNAINQVNGKKPWSLSFSFGRALQQSTLKAWGGKEENVKKAQEALLVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY GS+ L  GA ESL+ ++YKY
Sbjct  330  SEATLGTYKGSSQLDDGAKESLYVENYKY  358



>gb|AGZ15378.1| fructose-bisphosphate aldolase [Phaseolus vulgaris]
Length=358

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA++NLNA+N++  KKPW+L+FS+GRALQQSTLKAWGGK+EN K AQ+  L R KAN
Sbjct  270  SEEEASLNLNAINQVNGKKPWSLSFSFGRALQQSTLKAWGGKEENVKKAQEALLVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY GS+ L  GA ESL+ ++YKY
Sbjct  330  SEATLGTYKGSSQLDDGAKESLYVENYKY  358



>ref|XP_002969534.1| hypothetical protein SELMODRAFT_231316 [Selaginella moellendorffii]
 gb|EFJ29622.1| hypothetical protein SELMODRAFT_231316 [Selaginella moellendorffii]
Length=357

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNK  T KPW L+FSYGRALQQSTLKAW GK+EN   AQ V L RCKAN
Sbjct  270  SEEEATLNLNAMNKFNTMKPWTLSFSYGRALQQSTLKAWSGKKENIPNAQKVLLGRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A   A ASESL+ K+YKY
Sbjct  330  SDATLGRYVGGAG-GASASESLYVKNYKY  357



>ref|XP_002986752.1| hypothetical protein SELMODRAFT_425653 [Selaginella moellendorffii]
 gb|EFJ12082.1| hypothetical protein SELMODRAFT_425653 [Selaginella moellendorffii]
Length=357

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNK  T KPW L+FSYGRALQQSTLKAW GK+EN   AQ V L RCKAN
Sbjct  270  SEEEATLNLNAMNKFNTMKPWTLSFSYGRALQQSTLKAWSGKKENIPNAQKVLLGRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A   A ASESL+ K+YKY
Sbjct  330  SDATLGRYVGGAG-GASASESLYVKNYKY  357



>ref|XP_010433486.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X1 [Camelina sativa]
 ref|XP_010433487.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Camelina sativa]
 ref|XP_010433488.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Camelina sativa]
 ref|XP_010433489.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Camelina sativa]
Length=358

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW LTFS+GRALQQSTLKAW GK EN   AQ  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLDVLKPWTLTFSFGRALQQSTLKAWAGKTENVAKAQATFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A+  + ASESL+ K YKY
Sbjct  330  SDATLGKYTGGASGDSAASESLYVKGYKY  358



>emb|CDP13668.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLN MNKL+  KPW L+FS+GRALQQSTLK W GK+EN + AQD FLARCKAN
Sbjct  270  SEEEATLNLNGMNKLEVLKPWTLSFSFGRALQQSTLKIWAGKKENVEKAQDAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            S+ATLG YAG +  A G ASESL+ K+YKY
Sbjct  330  SDATLGKYAGGS--AGGLASESLYVKEYKY  357



>ref|XP_010438739.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW LTFS+GRALQQSTLKAW GK EN   AQ  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLDVLKPWTLTFSFGRALQQSTLKAWAGKTENVAKAQATFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A+  + ASESL+ K YKY
Sbjct  330  SDATLGKYTGGASGDSAASESLYVKGYKY  358



>ref|XP_006284000.1| hypothetical protein CARUB_v10005122mg [Capsella rubella]
 gb|EOA16898.1| hypothetical protein CARUB_v10005122mg [Capsella rubella]
Length=358

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW LTFS+GRALQQSTLKAW GK EN   AQ  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLDVLKPWTLTFSFGRALQQSTLKAWAGKTENVGKAQATFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A+  + ASESL+ K YKY
Sbjct  330  SDATLGKYTGGASGDSAASESLYVKGYKY  358



>ref|NP_194383.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
 ref|NP_001031721.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
 emb|CAA18217.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 emb|CAB79508.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAM64926.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAN72017.1| fructose-bisphosphate aldolase - like protein [Arabidopsis thaliana]
 gb|AAP68283.1| At4g26530 [Arabidopsis thaliana]
 gb|AEE85214.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
 gb|AEE85215.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
Length=358

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW LTFS+GRALQQSTLKAW GK EN   AQ  FL RCK N
Sbjct  270  SEEEATLNLNAMNKLDVLKPWTLTFSFGRALQQSTLKAWAGKTENVAKAQATFLTRCKGN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A+  + ASESL+E+ YKY
Sbjct  330  SDATLGKYTGGASGDSAASESLYEEGYKY  358



>ref|XP_010448258.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW LTFS+GRALQQSTLKAW GK EN   AQ  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLAVLKPWTLTFSFGRALQQSTLKAWAGKTENVAKAQATFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A+  + ASESL+ K YKY
Sbjct  330  SDATLGKYTGGASGDSAASESLYVKGYKY  358



>ref|XP_006452683.1| hypothetical protein CICLE_v10008762mg [Citrus clementina]
 gb|ESR65923.1| hypothetical protein CICLE_v10008762mg [Citrus clementina]
Length=316

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+  KPW L+FS+GRALQQSTLK WGGK+EN   AQD F  RCKAN
Sbjct  229  SEEEATVNLNAMNKLEVLKPWTLSFSFGRALQQSTLKIWGGKKENVAKAQDAFSVRCKAN  288

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            SEATLG Y G +  A G ASESL+ K YKY
Sbjct  289  SEATLGKYTGGS--AGGLASESLYVKGYKY  316



>ref|XP_006452682.1| hypothetical protein CICLE_v10008762mg [Citrus clementina]
 gb|ESR65922.1| hypothetical protein CICLE_v10008762mg [Citrus clementina]
Length=357

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+  KPW L+FS+GRALQQSTLK WGGK+EN   AQD F  RCKAN
Sbjct  270  SEEEATVNLNAMNKLEVLKPWTLSFSFGRALQQSTLKIWGGKKENVAKAQDAFSVRCKAN  329

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            SEATLG Y G +  A G ASESL+ K YKY
Sbjct  330  SEATLGKYTGGS--AGGLASESLYVKGYKY  357



>gb|AAQ90153.1| putative fructose-bisphosphate aldolase protein [Solanum tuberosum]
Length=199

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+  KPW L+FS+GRALQQSTLK W GK+EN   AQ+ FL RCKAN
Sbjct  112  SEEEATVNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWCGKKENVGTAQEAFLTRCKAN  171

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G +   A ASESL  K YKY
Sbjct  172  SDATLGKYTGGSGSGA-ASESLFVKGYKY  199



>ref|XP_006413170.1| hypothetical protein EUTSA_v10025556mg [Eutrema salsugineum]
 gb|ESQ54623.1| hypothetical protein EUTSA_v10025556mg [Eutrema salsugineum]
Length=358

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW LTFS+GRALQQSTLKAW GK EN   AQ  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLDVLKPWTLTFSFGRALQQSTLKAWAGKTENVAKAQATFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G A+  + ASESL  K YKY
Sbjct  330  SDATLGKYTGGASDDSNASESLFVKGYKY  358



>gb|KHN23819.1| Uridine kinase-like protein 4 [Glycine soja]
Length=894

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQQSTLK WGGK+EN   AQ+ FLARCKAN
Sbjct  807  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWGGKKENVAKAQEAFLARCKAN  866

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G +  +   SESL+ K+YKY
Sbjct  867  SDATLGKYVGGSG-SGLTSESLYVKNYKY  894



>ref|XP_004244020.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Solanum lycopersicum]
Length=357

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+  KPW L+FS+GRALQQSTLK WGGK+EN   AQ+ FL RCKAN
Sbjct  270  SEEEATVNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWGGKKENVGKAQEAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G +   A ASESL  K YKY
Sbjct  330  SDATLGKYTGGSGSGA-ASESLFVKGYKY  357



>ref|XP_010929015.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 isoform X1 [Elaeis guineensis]
 ref|XP_010929016.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 isoform X2 [Elaeis guineensis]
Length=357

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNA+NKL+  KPW L+FS+GRALQQST+K W GK+EN  AAQ  FLARCKAN
Sbjct  270  SEEEATLNLNAINKLEVVKPWTLSFSFGRALQQSTIKKWAGKKENVPAAQQAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S ATLG YAG  N  A ASESL+ K YKY
Sbjct  330  SAATLGKYAG-GNADAAASESLYVKGYKY  357



>ref|XP_004491539.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Cicer arietinum]
Length=357

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+AT+NLNAMNKL   KPW L+FS+GRALQQSTLK W GK+EN   AQ+VFLARCKAN
Sbjct  270  SEEQATLNLNAMNKLDVVKPWTLSFSFGRALQQSTLKTWAGKKENVGKAQEVFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S++TLG Y G +     ASESL+ KDYKY
Sbjct  330  SDSTLGKYGGGSETGL-ASESLYVKDYKY  357



>ref|XP_006474808.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Citrus sinensis]
Length=357

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNK++  KPW L+FS+GRALQQSTLK WGGK+EN   AQD F  RCKAN
Sbjct  270  SEEEATVNLNAMNKIEVLKPWTLSFSFGRALQQSTLKIWGGKKENVAKAQDAFSVRCKAN  329

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            SEATLG Y G +  A G ASESL+ K YKY
Sbjct  330  SEATLGKYTGGS--AGGLASESLYVKGYKY  357



>ref|XP_002519633.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
 gb|EEF42778.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
Length=357

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 72/90 (80%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW L+FS+GRALQQSTLK W GK+EN + AQ+VFL RCK+N
Sbjct  270  SEEEATLNLNAMNKLPVLKPWTLSFSFGRALQQSTLKIWAGKKENIEKAQEVFLVRCKSN  329

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            SEATLG Y G    A+G ASESL+ K YKY
Sbjct  330  SEATLGKYTGGG--ASGLASESLYVKGYKY  357



>ref|XP_003544567.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Glycine max]
Length=357

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQQSTLK WGGK+EN   AQ+ FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWGGKKENVAKAQEAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G +  +   SESL+ K+YKY
Sbjct  330  SDATLGKYVGGSG-SGLTSESLYVKNYKY  357



>ref|NP_001237315.1| fructose-bisphosphate aldolase [Glycine max]
 gb|AAR86689.1| fructose-bisphosphate aldolase [Glycine max]
Length=357

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQQSTLK WGGK+EN   AQ+ FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWGGKKENVAKAQEAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G +  +   SESL+ K+YKY
Sbjct  330  SDATLGKYVGGSG-SGLTSESLYVKNYKY  357



>ref|XP_009142435.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Brassica rapa]
 emb|CDX89329.1| BnaA01g15640D [Brassica napus]
Length=358

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW LTFS+GRALQQSTLKAWGGK+EN   AQ  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLDLLKPWTLTFSFGRALQQSTLKAWGGKKENVAKAQATFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y   A+  + ASESL  K Y Y
Sbjct  330  SDATLGKYIAGASGDSAASESLFVKGYSY  358



>gb|EPS69505.1| fructose-bisphosphate aldolase [Genlisea aurea]
Length=359

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNL+AMNKL+  KPW L+FS+GRALQQSTLK WGGK EN + AQ  FLAR KAN
Sbjct  271  SEEEATVNLDAMNKLEALKPWTLSFSFGRALQQSTLKTWGGKPENVEKAQAAFLARSKAN  330

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y+G       ASESL+ K YKY
Sbjct  331  SEATLGKYSGGGTTGDLASESLYVKGYKY  359



>gb|KFK29173.1| hypothetical protein AALP_AA7G098900 [Arabis alpina]
Length=358

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW LTFS+GRALQQSTLKAW GK EN   AQ  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLDVLKPWTLTFSFGRALQQSTLKAWAGKTENVAKAQATFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATL  Y G A+  + ASESL  + YKY
Sbjct  330  SDATLAKYTGGASDDSAASESLFVEGYKY  358



>ref|XP_011095600.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Sesamum indicum]
Length=396

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL   KPW L+FS+GRALQQSTLK W GK+EN + AQ  FLARCKAN
Sbjct  309  SEEEATVNLNAMNKLDVLKPWTLSFSFGRALQQSTLKTWAGKKENVEKAQAAFLARCKAN  368

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G +     A++SL+EK YKY
Sbjct  369  SEATLGKYTGGSG-GDLATQSLYEKGYKY  396



>emb|CDX94320.1| BnaC01g18640D [Brassica napus]
Length=870

 Score =   127 bits (319),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL   KPW LTFS+GRALQQSTLKAWGGK+EN   AQ  FL RCKAN
Sbjct  782  SEEEATQNLNAMNKLDLLKPWTLTFSFGRALQQSTLKAWGGKKENVAKAQATFLVRCKAN  841

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y   A+  + ASESL  K Y Y
Sbjct  842  SDATLGKYIAGASGDSAASESLFVKGYSY  870



>ref|XP_009620969.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Nicotiana tomentosiformis]
Length=357

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+ATVNLNAMNKL+  KPW L+FS+GRALQQSTLK W GKQEN   AQ+ FLARCKAN
Sbjct  270  SEEDATVNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWAGKQENVAKAQEAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G +   A ASESL    YKY
Sbjct  330  SDATLGKYTGGSATGA-ASESLFVSGYKY  357



>gb|ABK23585.1| unknown [Picea sitchensis]
Length=364

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNA+N  KTKKPW L+FS+GRALQQSTLK W GK EN  AAQ  FLARCKAN
Sbjct  277  SEEEATLNLNAINACKTKKPWTLSFSFGRALQQSTLKTWAGKAENLGAAQKAFLARCKAN  336

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YA     A  A+ESLH KDYKY
Sbjct  337  SEATLGKYA-GGAGAGLATESLHVKDYKY  364



>gb|EYU27475.1| hypothetical protein MIMGU_mgv1a008862mg [Erythranthe guttata]
Length=360

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+  KPW L+FS+GRALQQSTLK W GK+EN + AQ  FLARCKAN
Sbjct  270  SEEEATVNLNAMNKLEVVKPWTLSFSFGRALQQSTLKTWAGKKENVEIAQAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAG--ASESLHEKDYKY  268
            SEATLG Y G +       AS+SL+EK YKY
Sbjct  330  SEATLGKYGGGSGSGGDGLASQSLYEKGYKY  360



>ref|XP_010942543.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Elaeis guineensis]
Length=357

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW L+FS+GRALQQST+K W GK+EN  AAQ  FL RC+AN
Sbjct  270  SEEEATLNLNAMNKLDVLKPWTLSFSFGRALQQSTIKKWAGKKENVAAAQKAFLVRCRAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G +  AA ASESL+ K Y+Y
Sbjct  330  SEATLGKYTGGSADAA-ASESLYVKGYRY  357



>ref|XP_006346102.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Solanum tuberosum]
Length=357

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQQSTLK WGG++EN   AQ+ FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWGGEKENVGKAQEAFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G +   A ASESL  K YKY
Sbjct  330  SDATLGKYTGGSGSGA-ASESLFVKGYKY  357



>ref|XP_010246553.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Nelumbo nucifera]
Length=357

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW L+FS+GRALQQSTLK W GK+EN  AAQ+ FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLAVLKPWTLSFSFGRALQQSTLKTWAGKKENVTAAQEAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG YAG +     ASESL+ K YKY
Sbjct  330  SDATLGKYAGGSGGGL-ASESLYVKGYKY  357



>gb|ACD10928.1| fructose-bisphosphate aldolase [Lemna minor]
Length=128

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN+LK KKPW+L+FS+GRALQQSTLKAW GK+EN + AQ  FL RCKAN
Sbjct  53   SEEEATRNLNAMNQLKGKKPWSLSFSFGRALQQSTLKAWAGKEENVEKAQAAFLTRCKAN  112

Query  182  SEATLGTYAGSA  217
            SEATLGTY G A
Sbjct  113  SEATLGTYKGDA  124



>ref|XP_002437265.1| hypothetical protein SORBIDRAFT_10g023850 [Sorghum bicolor]
 gb|EER88632.1| hypothetical protein SORBIDRAFT_10g023850 [Sorghum bicolor]
Length=358

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NL+AMNKL+  KPW L+FS+GRALQQSTLK W GK+EN  AAQ  FL RCKAN
Sbjct  270  SEEEATQNLDAMNKLEVLKPWTLSFSFGRALQQSTLKKWLGKKENVAAAQATFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEA LG Y GS    A ASESL+ K YKY
Sbjct  330  SEAGLGKYTGSGAGDAAASESLYVKGYKY  358



>sp|P46256.1|ALF1_PEA RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Pisum sativum]
 emb|CAA61946.1| fructose-1,6-bisphosphate aldolase [Pisum sativum]
Length=357

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+AT+NLNAMNK    KPW L+FS+GRALQQSTLK W GK+EN   AQDVFLARCKAN
Sbjct  270  SEEQATLNLNAMNKFDVVKPWTLSFSFGRALQQSTLKTWSGKKENVGKAQDVFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G +     ASESLH KDYKY
Sbjct  330  SEATLGKYGGGSGTGL-ASESLHVKDYKY  357



>ref|XP_006377966.1| fructose-1 family protein [Populus trichocarpa]
 gb|ERP55763.1| fructose-1 family protein [Populus trichocarpa]
Length=357

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQ+STLK W GK+EN + AQ+VFL RCK N
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQKSTLKTWAGKKENVEKAQEVFLVRCKGN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG YAG       ASESL EK YKY
Sbjct  330  SDATLGKYAGGGTGGL-ASESLFEKGYKY  357



>ref|XP_011039825.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Populus euphratica]
Length=357

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQ+STLK W GK+EN + AQ+VFL RCK N
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQKSTLKTWAGKKENVEKAQEVFLVRCKGN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G       ASESL EK YKY
Sbjct  330  SEATLGKYTGGGAGGL-ASESLFEKGYKY  357



>ref|XP_002299056.1| fructose-1 family protein [Populus trichocarpa]
 gb|ABK94744.1| unknown [Populus trichocarpa]
 gb|EEE83861.1| fructose-1 family protein [Populus trichocarpa]
Length=357

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQ+STLK W GK+EN + AQ+VFL RCK N
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQKSTLKTWAGKKENVEKAQEVFLVRCKGN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G       ASESL EK YKY
Sbjct  330  SEATLGKYTGGGAGGL-ASESLFEKGYKY  357



>ref|XP_009799651.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Nicotiana sylvestris]
Length=357

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEATVNLNAMNKL+  KPW L+FS+GRALQQSTLK W GK EN   AQ  FLARCKAN
Sbjct  270  SEEEATVNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWAGKPENVGKAQVAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G +   A ASESL    YKY
Sbjct  330  SDATLGKYTGGSATGA-ASESLFVSGYKY  357



>gb|KHN43919.1| Uridine kinase-like protein 4 [Glycine soja]
Length=804

 Score =   124 bits (312),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNK +  KPW L+FS+GRALQQSTLK WGGK+EN   AQ+ FLARCKAN
Sbjct  717  SEEEATLNLNAMNKSEVLKPWTLSFSFGRALQQSTLKTWGGKKENVAKAQEAFLARCKAN  776

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G +  +   SESL+ K+Y Y
Sbjct  777  SDATLGKYVGGSG-SGLTSESLYVKNYNY  804



>gb|ACN85313.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Oryza brachyantha]
Length=349

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+ NLNAMNKL   KPW LTFS+GRALQQST+K W GK+EN   AQ  FLARCKAN
Sbjct  262  SEEEASQNLNAMNKLAVLKPWTLTFSFGRALQQSTIKKWAGKKENVATAQAAFLARCKAN  321

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G+A  AA  SESL+ K Y Y
Sbjct  322  SEATLGKYGGAAGDAA-TSESLYVKGYTY  349



>ref|XP_011000316.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Populus euphratica]
Length=357

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQ+STLK W GK+EN + AQ+VFL RCK N
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQKSTLKTWAGKKENVEKAQEVFLLRCKGN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG YAG       ASESL EK YKY
Sbjct  330  SDATLGKYAGGGTGGL-ASESLFEKGYKY  357



>gb|ABK22375.1| unknown [Picea sitchensis]
Length=364

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNA+N  KTKKPW L+FS+GRALQQSTLK W GK EN  AAQ  FLARCKAN
Sbjct  277  SEEEATLNLNAINACKTKKPWTLSFSFGRALQQSTLKTWAGKAENLGAAQKAFLARCKAN  336

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YA     A  A+ESL+ KDYKY
Sbjct  337  SEATLGKYA-GGAGAGLATESLYVKDYKY  364



>ref|XP_008782993.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Phoenix dactylifera]
Length=357

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKLK  KPW L+FS+GRALQQST+K W GK+EN  AAQ  FLARCKAN
Sbjct  270  SEEEATLNLNAMNKLKVVKPWTLSFSFGRALQQSTIKKWAGKKENVPAAQQAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YA   +  A ASESL+ K YKY
Sbjct  330  SEATLGKYA-GGSADAAASESLYVKGYKY  357



>ref|XP_007020393.1| Aldolase superfamily protein [Theobroma cacao]
 gb|EOY11918.1| Aldolase superfamily protein [Theobroma cacao]
Length=357

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW L+FS+GRALQQSTLK WGGK+EN    Q  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLDVLKPWTLSFSFGRALQQSTLKTWGGKKENVGKGQQAFLLRCKAN  329

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            S+ATLG Y G +  A G ASESL  K YKY
Sbjct  330  SDATLGKYTGGS--AGGLASESLFVKGYKY  357



>ref|XP_010103967.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 [Morus 
notabilis]
 gb|EXB97670.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 [Morus 
notabilis]
Length=357

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMNKL+  KPW L+FS+GRALQQSTLK WGGK+EN   AQ+ FLAR KAN
Sbjct  270  SEEEATFNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWGGKKENIGKAQEAFLARAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEA+LG Y G +     ASESL  K YKY
Sbjct  330  SEASLGNYTGGSGTGL-ASESLFVKGYKY  357



>gb|KDP32624.1| hypothetical protein JCGZ_13174 [Jatropha curcas]
Length=357

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW L+FS+GRALQQSTLK WGGK+EN   AQ+ FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLPVLKPWTLSFSFGRALQQSTLKTWGGKKENVGKAQETFLVRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG Y G       ASESL  K YKY
Sbjct  330  SDATLGKYTGGGAGGL-ASESLFVKGYKY  357



>ref|XP_001768658.1| predicted protein [Physcomitrella patens]
 gb|EDQ66596.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN LKT KPW L+FS+GRALQ + LK WGGK+EN KAAQD    R KAN
Sbjct  270  SEEEATRNLNAMNALKTTKPWTLSFSFGRALQATVLKTWGGKKENVKAAQDALHVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY GS+      +ESLH K+Y Y
Sbjct  330  SEATLGTYGGSST--GEGTESLHVKNYVY  356



>ref|XP_009391905.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Musa acuminata subsp. malaccensis]
Length=357

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+AT+NLNAMNKL   KPW L+FS+GRALQQST+K W GK+EN  +AQ  FLARCKAN
Sbjct  270  SEEDATLNLNAMNKLGVLKPWTLSFSFGRALQQSTIKKWSGKKENVPSAQAAFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG YA      A ASESL+ KDYKY
Sbjct  330  SEATLGKYA-GCAADAAASESLYVKDYKY  357



>ref|XP_010061415.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Eucalyptus grandis]
 gb|KCW68357.1| hypothetical protein EUGRSUZ_F02017 [Eucalyptus grandis]
Length=357

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL   KPW L+FS+GRALQ STLK WGGK+EN   AQ+ FLARC AN
Sbjct  270  SEEEATLNLNAMNKLDVLKPWTLSFSFGRALQSSTLKTWGGKKENIGKAQEGFLARCLAN  329

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            SEATLG Y G    A G ASESL  K YKY
Sbjct  330  SEATLGKYTGGT--AGGLASESLFVKGYKY  357



>ref|XP_011037763.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Populus euphratica]
Length=357

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NL+AMNKL+  KPW L+FS+GRALQ+STLK W GK+EN + AQ+VFL RCK N
Sbjct  270  SEEEATLNLDAMNKLEVLKPWTLSFSFGRALQKSTLKTWAGKKENVEKAQEVFLLRCKGN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            S+ATLG YAG       ASESL EK YKY
Sbjct  330  SDATLGKYAGGGTGGL-ASESLFEKGYKY  357



>ref|XP_002263794.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Vitis vinifera]
 emb|CBI39851.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NLNAMNKL+  KPW L+FS+GRALQQSTLK WGGK EN   AQ  FL RCKAN
Sbjct  270  SEEEATLNLNAMNKLEVLKPWTLSFSFGRALQQSTLKTWGGKTENVGKAQGAFLGRCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G       ASESL+ K YKY
Sbjct  330  SEATLGKYEGGTGGGL-ASESLYVKGYKY  357



>ref|XP_003563638.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Brachypodium distachyon]
Length=360

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NL+AMNKL   KPW LTFS+GRALQQSTLK WGGK+EN  AAQ  FLARCK N
Sbjct  271  SEEEATKNLDAMNKLAVGKPWTLTFSFGRALQQSTLKKWGGKKENVAAAQATFLARCKGN  330

Query  182  SEATLGTY-AGSANLAAGASESLHEKDYKY  268
            SEATLG Y    A   A ASESLH   YKY
Sbjct  331  SEATLGKYAGAGAGGDAAASESLHVAGYKY  360



>ref|XP_001767043.1| predicted protein [Physcomitrella patens]
 gb|EDQ68209.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NLNAMN LKT KPW L+FS+GRALQ + LK WGGK+EN KAAQD    R KAN
Sbjct  270  SEEEATQNLNAMNALKTTKPWALSFSFGRALQATVLKTWGGKKENVKAAQDALHVRAKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLGTY G+A  +   +ESLH K+Y Y
Sbjct  330  SEATLGTYGGNA--SGEGTESLHVKNYVY  356



>ref|NP_001142344.1| hypothetical protein [Zea mays]
 gb|ACF88239.1| unknown [Zea mays]
 gb|AFW87254.1| hypothetical protein ZEAMMB73_254795 [Zea mays]
Length=131

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT NL+AMNKL+  KPW L+FS+GRALQQSTLK W GK+EN  AAQ  F+ RCKAN
Sbjct  43   SEEEATQNLDAMNKLEVLKPWTLSFSFGRALQQSTLKKWVGKKENVAAAQATFVIRCKAN  102

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEA LG YAGS    A ASESL+ K YKY
Sbjct  103  SEAALGKYAGSGAGDAAASESLYVKGYKY  131



>ref|XP_005649618.1| cytosolic aldolase [Coccomyxa subellipsoidea C-169]
 gb|EIE25074.1| cytosolic aldolase [Coccomyxa subellipsoidea C-169]
Length=365

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+A+VNL+AMNKL  +KPW L+FSYGRALQ S LKAWGGK +N KAAQ+ F+ R +AN
Sbjct  276  SEEDASVNLDAMNKLPGRKPWALSFSYGRALQASALKAWGGKADNVKAAQEAFMTRARAN  335

Query  182  SEATLGTYAGSAN-LAAGASESLHEKDYKY  268
              AT G Y   AN    G +ESLHEKDYKY
Sbjct  336  GAATKGQYKADANGRRLGHTESLHEKDYKY  365



>ref|XP_003617895.1| Fructose-bisphosphate aldolase [Medicago truncatula]
 gb|AET00854.1| fructose-bisphosphate aldolase [Medicago truncatula]
 gb|AFK40688.1| unknown [Medicago truncatula]
Length=357

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEE+AT+NL+AMNKL   KPW L+FS+GRALQQSTLK W GK+EN   AQ+VFLARCKAN
Sbjct  270  SEEQATLNLDAMNKLDVVKPWTLSFSFGRALQQSTLKTWAGKKENVGKAQEVFLARCKAN  329

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
            SEATLG Y G +     ASESL+ KDYKY
Sbjct  330  SEATLGKYGGGSGTGL-ASESLYVKDYKY  357



>ref|XP_005709261.1| fructose-bisphosphate aldolase, class I [Galdieria sulphuraria]
 gb|EME32741.1| fructose-bisphosphate aldolase, class I [Galdieria sulphuraria]
Length=356

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNAMN+++  KPW L+FSYGRALQ S LKAW GK EN +AAQ+ FLAR KAN
Sbjct  272  SEEEASVNLNAMNQVEMVKPWKLSFSYGRALQSSCLKAWQGKAENVRAAQEAFLARAKAN  331

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
             EATLG YAG      G +ESL  KDYKY
Sbjct  332  GEATLGKYAG----GTGNNESLFVKDYKY  356



>ref|XP_008355755.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Malus domestica]
Length=357

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NL+AMN+L   KPW L+FS+GRALQ STLK WGGK+EN   AQ  FL RC+AN
Sbjct  270  SEEEATLNLDAMNRLDVLKPWTLSFSFGRALQASTLKTWGGKKENVSKAQATFLTRCRAN  329

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            S+ATLG Y+G +  A G ASESL  K YKY
Sbjct  330  SDATLGKYSGGS--AGGLASESLFVKGYKY  357



>gb|AAF27640.1|AF217804_1 fructose-1,6-biphosphate aldolase [Galdieria sulphuraria]
Length=356

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEA+VNLNAMN+++  KPW L+FSYGRALQ S LKAW GK EN +AAQ+ FLAR KAN
Sbjct  272  SEEEASVNLNAMNQVEMVKPWKLSFSYGRALQSSCLKAWQGKAENVRAAQEAFLARAKAN  331

Query  182  SEATLGTYAGSANLAAGASESLHEKDYKY  268
             EATLG YAG      G +ESL  KDYKY
Sbjct  332  GEATLGKYAG----GTGNNESLFVKDYKY  356



>ref|XP_007205428.1| hypothetical protein PRUPE_ppa007744mg [Prunus persica]
 gb|EMJ06627.1| hypothetical protein PRUPE_ppa007744mg [Prunus persica]
Length=357

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    SEEEATVNLNAMNKLKTKKPWNLTFSYGRALQQSTLKAWGGKQENYKAAQDVFLARCKAN  181
            SEEEAT+NL+AMNKL   KPW L+FS+GRALQ STLK WGGK+EN   AQ+ FL RCKAN
Sbjct  270  SEEEATLNLDAMNKLDVLKPWTLSFSFGRALQASTLKTWGGKKENVGKAQENFLTRCKAN  329

Query  182  SEATLGTYAGSANLAAG-ASESLHEKDYKY  268
            S+ATLG Y G +  A G ASESL  K YKY
Sbjct  330  SDATLGKYGGGS--ADGLASESLFVKGYKY  357



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511043086476