BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83278_g1_i1 len=731 path=[744:0-730]

Length=731
                                                                      Score     E

emb|CDP02569.1|  unnamed protein product                              53.9    3e-05   



>emb|CDP02569.1| unnamed protein product [Coffea canephora]
Length=335

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 5/93 (5%)
 Frame = -3

Query  660  KLKQRFSFSDK-NLVFFDTCKCSSNSVQT-IPSAPAKNQDQKKNK--EPVAQSVPGWQII  493
            ++K+R  F DK  +VFF  CKCSSN+V   IPS  A+N  ++     E  A+      + 
Sbjct  237  RIKKRHKFLDKKGVVFFSGCKCSSNAVAGPIPSRVAENGMRRSASVSEAHAKEEETESLT  296

Query  492  RkkntkqqptttgkqTMSRIRTFEWLKQLSLEA  394
            R      Q  T  +  +SR RTFEWLKQLSLEA
Sbjct  297  RTTRQHDQQQTGKQA-LSRHRTFEWLKQLSLEA  328



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239096201126