BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83276_g1_i1 len=1765 path=[1743:0-1764]

Length=1765
                                                                      Score     E

ref|XP_004245248.1|  PREDICTED: uncharacterized protein LOC101254717    406   7e-133   
ref|XP_006356629.1|  PREDICTED: uncharacterized protein LOC102585748    403   1e-131   
ref|XP_011081852.1|  PREDICTED: uncharacterized protein LOC105164...    374   4e-120   
emb|CDP18437.1|  unnamed protein product                                371   2e-119   
ref|XP_011081851.1|  PREDICTED: uncharacterized protein LOC105164...    373   1e-118   
ref|XP_009616323.1|  PREDICTED: uncharacterized protein LOC104108884    347   5e-110   
ref|XP_009776914.1|  PREDICTED: uncharacterized protein LOC104226586    340   3e-107   
ref|XP_002284674.1|  PREDICTED: uncharacterized protein LOC100247517    323   1e-100   Vitis vinifera
ref|XP_002308629.2|  hypothetical protein POPTR_0006s26160g             322   6e-100   Populus trichocarpa [western balsam poplar]
ref|XP_011019696.1|  PREDICTED: uncharacterized protein LOC105122337    320   2e-99    
ref|XP_002324258.2|  hypothetical protein POPTR_0018s00980g             312   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011026540.1|  PREDICTED: uncharacterized protein LOC105127...    305   3e-93    
ref|XP_011026542.1|  PREDICTED: uncharacterized protein LOC105127...    303   1e-92    
ref|XP_010254161.1|  PREDICTED: uncharacterized protein LOC104595...    296   9e-90    
ref|XP_010254162.1|  PREDICTED: uncharacterized protein LOC104595...    295   1e-89    
ref|XP_010254160.1|  PREDICTED: uncharacterized protein LOC104595...    295   2e-89    
ref|XP_009348445.1|  PREDICTED: uncharacterized protein LOC103940093    290   3e-88    
gb|KDP34236.1|  hypothetical protein JCGZ_07807                         290   6e-88    
ref|XP_007227718.1|  hypothetical protein PRUPE_ppa006815mg             288   2e-87    
ref|XP_008219834.1|  PREDICTED: uncharacterized protein LOC103320008    288   3e-87    
ref|XP_010249804.1|  PREDICTED: uncharacterized protein LOC104592250    288   5e-87    
ref|XP_006450586.1|  hypothetical protein CICLE_v10008522mg             286   1e-86    
ref|XP_006476169.1|  PREDICTED: uncharacterized protein LOC102623549    283   4e-85    
ref|XP_002516598.1|  conserved hypothetical protein                     282   1e-84    Ricinus communis
ref|XP_004291408.1|  PREDICTED: uncharacterized protein LOC101296169    278   3e-83    
gb|EYU21898.1|  hypothetical protein MIMGU_mgv1a023680mg                273   6e-82    
ref|XP_007024099.1|  Pre-mRNA cleavage complex 2 protein Pcf11, p...    264   4e-78    
ref|XP_007024096.1|  Pre-mRNA cleavage complex 2 protein Pcf11, p...    264   5e-78    
ref|XP_007024097.1|  Pre-mRNA cleavage complex 2 protein Pcf11, p...    264   5e-78    
ref|XP_010670779.1|  PREDICTED: uncharacterized protein LOC104887750    264   1e-77    
ref|XP_008378282.1|  PREDICTED: uncharacterized protein LOC103441384    261   5e-77    
ref|XP_009377372.1|  PREDICTED: uncharacterized protein LOC103965985    261   7e-77    
ref|XP_007024100.1|  Pre-mRNA cleavage complex 2 protein Pcf11, p...    258   1e-75    
ref|XP_007024098.1|  Pre-mRNA cleavage complex 2 protein Pcf11, p...    257   1e-75    
ref|XP_007024095.1|  Pre-mRNA cleavage complex 2 protein Pcf11, p...    257   2e-75    
ref|XP_008445115.1|  PREDICTED: uncharacterized protein LOC103488251    255   7e-75    
ref|XP_010095494.1|  hypothetical protein L484_014922                   254   8e-74    
ref|XP_004136330.1|  PREDICTED: uncharacterized protein LOC101223099    251   2e-73    
ref|XP_008466352.1|  PREDICTED: uncharacterized protein LOC103503787    244   2e-70    
gb|KDP37202.1|  hypothetical protein JCGZ_06258                         238   2e-68    
ref|XP_007161279.1|  hypothetical protein PHAVU_001G056900g             238   5e-68    
ref|XP_004501266.1|  PREDICTED: uncharacterized protein LOC101504073    238   5e-68    
ref|XP_006596130.1|  PREDICTED: uncharacterized protein LOC100789...    234   7e-67    
ref|XP_007024101.1|  Pre-mRNA cleavage complex 2 protein Pcf11, p...    233   7e-67    
ref|XP_006596129.1|  PREDICTED: uncharacterized protein LOC100789...    234   1e-66    
gb|KHN10288.1|  hypothetical protein glysoja_017892                     234   1e-66    
ref|XP_006601110.1|  PREDICTED: uncharacterized protein LOC100804101    232   7e-66    
ref|XP_007137095.1|  hypothetical protein PHAVU_009G099100g             232   7e-66    
ref|XP_003603497.1|  hypothetical protein MTR_3g108290                  232   9e-66    
ref|XP_010049056.1|  PREDICTED: uncharacterized protein LOC104437741    222   1e-62    
ref|XP_002528195.1|  conserved hypothetical protein                     222   2e-62    Ricinus communis
gb|KHN16478.1|  hypothetical protein glysoja_036580                     221   1e-61    
ref|XP_010915049.1|  PREDICTED: uncharacterized protein LOC105040...    220   3e-61    
ref|XP_010915050.1|  PREDICTED: uncharacterized protein LOC105040...    219   4e-61    
ref|XP_010925327.1|  PREDICTED: uncharacterized protein LOC105047...    214   5e-59    
ref|XP_010925325.1|  PREDICTED: uncharacterized protein LOC105047...    214   1e-58    
gb|KEH39801.1|  DUF581 family protein                                   203   6e-56    
ref|XP_011002688.1|  PREDICTED: uncharacterized protein LOC105109635    204   9e-56    
ref|XP_002299638.1|  hypothetical protein POPTR_0001s17990g             201   6e-55    Populus trichocarpa [western balsam poplar]
gb|KHG30602.1|  Ig mu chain C region                                    201   4e-54    
ref|XP_010048088.1|  PREDICTED: uncharacterized protein LOC104436935    199   5e-54    
ref|XP_006595139.1|  PREDICTED: uncharacterized protein LOC100793...    199   7e-54    
ref|XP_006465550.1|  PREDICTED: uncharacterized protein LOC102619...    196   5e-53    
ref|XP_009409336.1|  PREDICTED: uncharacterized protein LOC103991...    196   2e-52    
ref|XP_010098043.1|  hypothetical protein L484_026173                   195   3e-52    
ref|XP_004302916.1|  PREDICTED: uncharacterized protein LOC101296975    193   4e-52    
ref|XP_009409338.1|  PREDICTED: uncharacterized protein LOC103991...    194   5e-52    
ref|XP_008228506.1|  PREDICTED: uncharacterized protein LOC103327911    192   2e-51    
ref|XP_008793450.1|  PREDICTED: uncharacterized protein LOC103709740    191   2e-51    
ref|XP_006465552.1|  PREDICTED: uncharacterized protein LOC102619...    191   5e-51    
gb|KDO51185.1|  hypothetical protein CISIN_1g015987mg                   190   9e-51    
gb|KHM98768.1|  hypothetical protein glysoja_030821                     190   2e-50    
ref|XP_003546353.1|  PREDICTED: uncharacterized protein LOC100816...    189   3e-50    
ref|XP_010526125.1|  PREDICTED: uncharacterized protein LOC104803775    188   3e-50    
ref|XP_006427041.1|  hypothetical protein CICLE_v10025884mg             188   4e-50    
ref|XP_009385799.1|  PREDICTED: uncharacterized protein LOC103973058    188   9e-50    
ref|XP_009409337.1|  PREDICTED: uncharacterized protein LOC103991...    187   4e-49    
gb|KDO51186.1|  hypothetical protein CISIN_1g015987mg                   184   4e-48    
ref|XP_010526185.1|  PREDICTED: uncharacterized protein LOC104803816    178   1e-46    
ref|XP_004151202.1|  PREDICTED: uncharacterized protein LOC101221258    179   2e-46    
ref|XP_010519921.1|  PREDICTED: uncharacterized protein LOC104799214    176   1e-45    
ref|XP_004498618.1|  PREDICTED: uncharacterized protein LOC101497948    171   3e-44    
ref|XP_008447495.1|  PREDICTED: uncharacterized serine-rich prote...    172   5e-44    
ref|XP_004486723.1|  PREDICTED: uncharacterized protein LOC101503653    168   8e-43    
ref|XP_007150668.1|  hypothetical protein PHAVU_005G171700g             167   3e-42    
ref|XP_006844350.1|  hypothetical protein AMTR_s00142p00035060          165   2e-41    
ref|XP_008394004.1|  PREDICTED: uncharacterized protein LOC103456137    149   1e-38    
emb|CDX83224.1|  BnaA03g22820D                                          154   3e-38    
ref|XP_006405241.1|  hypothetical protein EUTSA_v10000253mg             152   5e-38    
gb|KEH39566.1|  DUF581 family protein                                   145   7e-35    
ref|XP_002873514.1|  hypothetical protein ARALYDRAFT_487982             144   8e-35    
ref|XP_006288109.1|  hypothetical protein CARUB_v10001342mg             143   2e-34    
ref|XP_009133958.1|  PREDICTED: uncharacterized protein LOC103858365    142   4e-34    
ref|NP_180140.1|  uncharacterized protein                               142   4e-34    Arabidopsis thaliana [mouse-ear cress]
gb|KHG28688.1|  Inactive tyrosine-protein kinase 7                      139   2e-33    
emb|CDY38508.1|  BnaC03g26890D                                          139   2e-33    
ref|XP_004138874.1|  PREDICTED: uncharacterized protein LOC101212300    139   7e-33    
ref|XP_008777180.1|  PREDICTED: uncharacterized protein LOC103697154    138   2e-32    
gb|KGN62889.1|  hypothetical protein Csa_2G379200                       140   2e-32    
ref|XP_006465553.1|  PREDICTED: uncharacterized protein LOC102619...    135   1e-31    
emb|CBI20951.3|  unnamed protein product                                129   1e-31    
ref|XP_004160865.1|  PREDICTED: uncharacterized protein LOC101229906    135   2e-31    
ref|XP_004297111.1|  PREDICTED: uncharacterized protein LOC101295...    133   2e-31    
ref|XP_010024261.1|  PREDICTED: uncharacterized protein LOC104414788    132   7e-31    
ref|XP_010326674.1|  PREDICTED: uncharacterized protein LOC101247367    131   8e-31    
ref|XP_009774582.1|  PREDICTED: uncharacterized protein LOC104224595    131   1e-30    
emb|CDO99077.1|  unnamed protein product                                129   6e-30    
ref|XP_010491878.1|  PREDICTED: uncharacterized protein LOC104769377    130   7e-30    
ref|XP_006360776.1|  PREDICTED: uncharacterized protein LOC102602108    129   7e-30    
ref|XP_002880699.1|  hypothetical protein ARALYDRAFT_481422             129   9e-30    
ref|XP_007217267.1|  hypothetical protein PRUPE_ppa011797mg             124   3e-29    
ref|XP_006294596.1|  hypothetical protein CARUB_v10023632mg             127   4e-29    
ref|XP_010256094.1|  PREDICTED: uncharacterized protein LOC104596562    125   2e-28    
dbj|BAK01330.1|  predicted protein                                      125   3e-28    
ref|XP_009613879.1|  PREDICTED: uncharacterized protein LOC104106921    124   5e-28    
gb|KDP40194.1|  hypothetical protein JCGZ_02192                         124   7e-28    
ref|XP_007034793.1|  NAD(P)H-quinone oxidoreductase subunit H, pu...    123   9e-28    
ref|XP_006489415.1|  PREDICTED: uncharacterized protein LOC102612013    123   9e-28    
gb|KDO74541.1|  hypothetical protein CISIN_1g022550mg                   123   1e-27    
ref|XP_006419965.1|  hypothetical protein CICLE_v10005538mg             123   1e-27    
ref|XP_009418943.1|  PREDICTED: uncharacterized protein LOC103999034    124   1e-27    
ref|XP_008786298.1|  PREDICTED: uncharacterized protein LOC103704680    125   1e-27    
emb|CDM81788.1|  unnamed protein product                                123   2e-27    
ref|XP_010932772.1|  PREDICTED: uncharacterized protein LOC105053366    122   2e-27    
ref|XP_006645564.1|  PREDICTED: uncharacterized protein LOC102712952    120   2e-27    
ref|XP_010259075.1|  PREDICTED: uncharacterized protein LOC104598615    122   4e-27    
ref|XP_010917764.1|  PREDICTED: uncharacterized protein LOC105042310    122   4e-27    
ref|XP_007034795.1|  NAD(P)H-quinone oxidoreductase subunit H, pu...    119   6e-27    
ref|XP_009402313.1|  PREDICTED: uncharacterized protein LOC103986133    120   2e-26    
ref|XP_006379838.1|  hypothetical protein POPTR_0008s15440g             119   2e-26    
ref|XP_008778118.1|  PREDICTED: uncharacterized protein LOC103697950    119   2e-26    
ref|XP_003569894.1|  PREDICTED: insulinoma-associated protein 1-l...    120   3e-26    
ref|XP_004960849.1|  PREDICTED: uncharacterized protein LOC101768...    119   4e-26    
ref|XP_008775847.1|  PREDICTED: uncharacterized protein LOC103696099    119   4e-26    
ref|XP_004139816.1|  PREDICTED: uncharacterized protein LOC101210425    118   5e-26    
gb|KDP21434.1|  hypothetical protein JCGZ_21905                         118   5e-26    
ref|XP_011071604.1|  PREDICTED: uncharacterized protein LOC105157011    117   8e-26    
ref|XP_004968428.1|  PREDICTED: uncharacterized protein LOC101762...    118   1e-25    
ref|XP_010912830.1|  PREDICTED: uncharacterized protein LOC105038376    117   2e-25    
ref|XP_008447157.1|  PREDICTED: uncharacterized protein LOC103489674    116   2e-25    
ref|XP_008804956.1|  PREDICTED: uncharacterized protein LOC103718086    117   3e-25    
gb|ABK96022.1|  unknown                                                 110   4e-25    Populus trichocarpa [western balsam poplar]
ref|XP_011032681.1|  PREDICTED: uncharacterized protein LOC105131415    115   4e-25    
ref|XP_002307593.1|  putative senescence-associated protein SAG102      115   5e-25    Populus trichocarpa [western balsam poplar]
gb|ACG39774.1|  hypothetical protein                                    115   8e-25    Zea mays [maize]
ref|NP_001146437.1|  uncharacterized protein LOC100280020               112   1e-24    Zea mays [maize]
ref|XP_002455061.1|  hypothetical protein SORBIDRAFT_03g003720          114   2e-24    Sorghum bicolor [broomcorn]
ref|NP_001143884.1|  uncharacterized protein LOC100276685               112   2e-24    Zea mays [maize]
gb|KEH39567.1|  DUF581 family protein                                   115   2e-24    
ref|XP_002517116.1|  conserved hypothetical protein                     113   3e-24    Ricinus communis
gb|AFW80215.1|  hypothetical protein ZEAMMB73_719306                    114   4e-24    
gb|EYU41472.1|  hypothetical protein MIMGU_mgv1a010847mg                112   5e-24    
ref|XP_011090704.1|  PREDICTED: uncharacterized protein LOC105171329    112   5e-24    
ref|XP_008390911.1|  PREDICTED: uncharacterized protein LOC103453139    112   7e-24    
emb|CDX76742.1|  BnaC08g33280D                                          112   9e-24    
ref|XP_008654714.1|  PREDICTED: uncharacterized protein LOC100276...    114   1e-23    
ref|XP_010417342.1|  PREDICTED: uncharacterized protein LOC104703...    111   1e-23    
ref|XP_009117041.1|  PREDICTED: uncharacterized protein LOC103842172    111   1e-23    
ref|XP_007223281.1|  hypothetical protein PRUPE_ppa009460mg             110   3e-23    
ref|XP_002440716.1|  hypothetical protein SORBIDRAFT_09g005550          111   3e-23    Sorghum bicolor [broomcorn]
ref|XP_008224293.1|  PREDICTED: uncharacterized protein LOC103324037    110   4e-23    
ref|XP_009393038.1|  PREDICTED: uncharacterized protein LOC103978...    109   4e-23    
ref|XP_009393037.1|  PREDICTED: uncharacterized protein LOC103978...    109   4e-23    
ref|XP_006379837.1|  hypothetical protein POPTR_0008s15440g             109   5e-23    
gb|EEE53994.1|  hypothetical protein OsJ_00627                          109   6e-23    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70052.1|  hypothetical protein OsI_00649                          110   6e-23    Oryza sativa Indica Group [Indian rice]
ref|XP_009369861.1|  PREDICTED: uncharacterized protein LOC103959236    109   6e-23    
ref|XP_009335321.1|  PREDICTED: uncharacterized protein LOC103928038    109   7e-23    
ref|XP_009398366.1|  PREDICTED: uncharacterized protein LOC103982978    108   8e-23    
ref|XP_002282784.1|  PREDICTED: uncharacterized protein LOC100245904    109   8e-23    Vitis vinifera
ref|XP_002314686.2|  senescence-associated family protein               109   9e-23    Populus trichocarpa [western balsam poplar]
ref|XP_008361364.1|  PREDICTED: uncharacterized protein LOC103425066    108   9e-23    
ref|XP_008340997.1|  PREDICTED: uncharacterized protein LOC103403932    108   1e-22    
ref|XP_008362006.1|  PREDICTED: uncharacterized protein LOC103425695    108   1e-22    
emb|CDY11512.1|  BnaA09g40780D                                          108   1e-22    
ref|XP_009345875.1|  PREDICTED: uncharacterized protein LOC103937650    108   1e-22    
ref|XP_003536527.1|  PREDICTED: uncharacterized protein LOC100776...    107   2e-22    
ref|XP_011026145.1|  PREDICTED: uncharacterized protein LOC105126833    108   2e-22    
ref|XP_006826248.1|  hypothetical protein AMTR_s00004p00011050          111   2e-22    
gb|KHN15761.1|  hypothetical protein glysoja_012553                     107   2e-22    
ref|XP_002300834.2|  hypothetical protein POPTR_0002s05170g             107   2e-22    Populus trichocarpa [western balsam poplar]
ref|XP_011026736.1|  PREDICTED: uncharacterized protein LOC105127...    108   2e-22    
gb|KHN10679.1|  hypothetical protein glysoja_019110                     107   3e-22    
ref|XP_011026754.1|  PREDICTED: uncharacterized protein LOC105127...    107   3e-22    
ref|XP_010551715.1|  PREDICTED: uncharacterized protein LOC104822263    106   3e-22    
ref|XP_003556054.1|  PREDICTED: uncharacterized protein LOC100807...    106   4e-22    
ref|XP_010417344.1|  PREDICTED: uncharacterized protein LOC104703...    107   6e-22    
ref|XP_007143270.1|  hypothetical protein PHAVU_007G058400g             105   9e-22    
ref|XP_010096150.1|  hypothetical protein L484_005429                   105   1e-21    
ref|XP_010545091.1|  PREDICTED: uncharacterized protein LOC104817557    105   1e-21    
ref|XP_004496709.1|  PREDICTED: uncharacterized protein LOC101512...    105   1e-21    
gb|ACU18819.1|  unknown                                                 103   2e-21    Glycine max [soybeans]
ref|XP_003536591.1|  PREDICTED: uncharacterized protein LOC100811607    104   2e-21    
ref|XP_010419717.1|  PREDICTED: uncharacterized protein LOC104705412    105   2e-21    
ref|XP_011079875.1|  PREDICTED: uncharacterized protein LOC105163284    104   4e-21    
ref|XP_010039726.1|  PREDICTED: uncharacterized protein LOC104428433    104   5e-21    
gb|KHN02567.1|  hypothetical protein glysoja_002591                     103   7e-21    
gb|KHG29474.1|  putative hect-type ubiquitin ligase-interacting cred    102   7e-21    
ref|XP_007162449.1|  hypothetical protein PHAVU_001G153200g             103   7e-21    
ref|XP_008368829.1|  PREDICTED: uncharacterized protein LOC103432...    103   7e-21    
ref|NP_001241512.1|  uncharacterized protein LOC100788456               103   7e-21    
ref|XP_010086615.1|  hypothetical protein L484_002440                   103   8e-21    
ref|XP_008368831.1|  PREDICTED: uncharacterized protein LOC103432...    103   8e-21    
ref|XP_002524763.1|  conserved hypothetical protein                     102   1e-20    Ricinus communis
gb|KHG19761.1|  Phosphoenolpyruvate carboxykinase [ATP]                 102   1e-20    
ref|XP_003590616.1|  Senescence-associated protein SAG102               101   1e-20    
ref|XP_009370804.1|  PREDICTED: uncharacterized protein LOC103960115    102   1e-20    
gb|AAQ54554.1|  putative senescence-associated protein SAG102         98.2    1e-20    Malus domestica [apple tree]
ref|XP_010034891.1|  PREDICTED: uncharacterized protein LOC104424223    102   2e-20    
ref|XP_009367618.1|  PREDICTED: uncharacterized protein LOC103957220    102   2e-20    
ref|XP_007050558.1|  Uncharacterized protein isoform 3                  101   2e-20    
ref|XP_008223983.1|  PREDICTED: uncharacterized protein LOC103323750  97.8    2e-20    
ref|XP_007050556.1|  Uncharacterized protein isoform 1                  102   2e-20    
ref|XP_009408940.1|  PREDICTED: uncharacterized protein LOC103991276    103   2e-20    
ref|XP_008386467.1|  PREDICTED: uncharacterized protein LOC103448977    101   2e-20    
ref|XP_010679067.1|  PREDICTED: GATA zinc finger domain-containin...    102   2e-20    
gb|EPS72550.1|  hypothetical protein M569_02210                         100   5e-20    
gb|KEH43856.1|  senescence-associated protein SAG102                    100   6e-20    
ref|XP_007144648.1|  hypothetical protein PHAVU_007G173400g             100   6e-20    
ref|XP_004290613.1|  PREDICTED: uncharacterized protein LOC101301347    100   7e-20    
ref|XP_007157118.1|  hypothetical protein PHAVU_002G044300g             100   7e-20    
ref|XP_003518913.1|  PREDICTED: uncharacterized protein LOC100790354  99.8    8e-20    
ref|XP_011030673.1|  PREDICTED: uncharacterized protein LOC105130051    100   8e-20    
ref|XP_010541643.1|  PREDICTED: uncharacterized protein LOC104815048    101   8e-20    
ref|XP_004496710.1|  PREDICTED: uncharacterized protein LOC101512...  99.4    1e-19    
gb|KDO68685.1|  hypothetical protein CISIN_1g023402mg                 99.8    1e-19    
ref|XP_003632307.1|  PREDICTED: uncharacterized protein LOC100855273  99.8    1e-19    
emb|CDY65610.1|  BnaC05g51730D                                        99.4    1e-19    
gb|KFK39549.1|  hypothetical protein AALP_AA3G258500                  99.0    2e-19    
ref|XP_002516241.1|  conserved hypothetical protein                   99.0    2e-19    Ricinus communis
gb|ACU18495.1|  unknown                                               98.6    2e-19    Glycine max [soybeans]
ref|XP_006444040.1|  hypothetical protein CICLE_v10021541mg           99.0    2e-19    
emb|CDX93919.1|  BnaC04g20780D                                        97.8    3e-19    
ref|XP_004496711.1|  PREDICTED: uncharacterized protein LOC101512...  98.2    3e-19    
gb|KHN35172.1|  hypothetical protein glysoja_004938                   97.8    4e-19    
emb|CDX98213.1|  BnaC07g08850D                                        97.8    4e-19    
gb|EPS61768.1|  hypothetical protein M569_13027                       97.1    4e-19    
gb|EEE62544.1|  hypothetical protein OsJ_17342                        97.1    4e-19    Oryza sativa Japonica Group [Japonica rice]
gb|AAW57809.1|  unknown protein                                       98.2    5e-19    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009145313.1|  PREDICTED: uncharacterized protein LOC103869027  97.4    5e-19    
ref|XP_004495187.1|  PREDICTED: uncharacterized protein LOC101500639  96.3    9e-19    
ref|XP_006399652.1|  hypothetical protein EUTSA_v10014059mg           97.4    1e-18    
ref|XP_006406148.1|  hypothetical protein EUTSA_v10021330mg           96.7    1e-18    
gb|KHN30484.1|  hypothetical protein glysoja_033222                   96.3    1e-18    
ref|XP_007200454.1|  hypothetical protein PRUPE_ppa008958mg           96.7    1e-18    
ref|XP_006651664.1|  PREDICTED: uncharacterized protein LOC102710774  96.7    2e-18    
ref|XP_006298348.1|  hypothetical protein CARUB_v10014416mg           95.9    2e-18    
ref|NP_188894.2|  uncharacterized protein                             95.9    2e-18    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01470.1|  unnamed protein product                              95.5    2e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135815.1|  PREDICTED: uncharacterized protein LOC103859963  95.5    2e-18    
emb|CDX92948.1|  BnaA03g36700D                                        95.5    2e-18    
ref|XP_009108785.1|  PREDICTED: uncharacterized protein LOC103834467  95.5    2e-18    
ref|XP_006573876.1|  PREDICTED: uncharacterized protein LOC100806...  95.5    2e-18    
ref|XP_010511489.1|  PREDICTED: uncharacterized protein LOC104787578  95.5    2e-18    
emb|CDY34246.1|  BnaA01g24630D                                        95.1    3e-18    
ref|XP_010472580.1|  PREDICTED: uncharacterized protein LOC104752...  95.9    3e-18    
emb|CDY24316.1|  BnaC03g42890D                                        94.4    3e-18    
ref|XP_003538645.1|  PREDICTED: uncharacterized protein LOC100803983  95.1    3e-18    
ref|NP_196707.1|  uncharacterized protein                             95.9    3e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007050557.1|  Uncharacterized protein isoform 2                94.7    6e-18    
ref|NP_001050841.1|  Os03g0665200                                     94.7    6e-18    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010429571.1|  PREDICTED: uncharacterized protein LOC104714035  95.1    6e-18    
ref|XP_002885510.1|  hypothetical protein ARALYDRAFT_318984           94.4    6e-18    
ref|XP_008465643.1|  PREDICTED: uncharacterized protein LOC103503283  94.4    6e-18    
ref|XP_010466540.1|  PREDICTED: uncharacterized protein LOC104746710  93.6    9e-18    
gb|KDO73844.1|  hypothetical protein CISIN_1g023035mg                 93.2    9e-18    
ref|XP_006452849.1|  hypothetical protein CICLE_v10009353mg           92.8    1e-17    
ref|XP_009121945.1|  PREDICTED: uncharacterized protein LOC103846716  93.6    1e-17    
emb|CDX69754.1|  BnaA10g21030D                                        93.6    1e-17    
ref|XP_004982230.1|  PREDICTED: uncharacterized protein LOC101781327  93.6    1e-17    
ref|XP_006474697.1|  PREDICTED: uncharacterized protein LOC102630338  92.4    2e-17    
ref|XP_008235397.1|  PREDICTED: uncharacterized protein LOC103334227  93.6    2e-17    
gb|KDO73843.1|  hypothetical protein CISIN_1g023035mg                 92.4    2e-17    
ref|XP_004493689.1|  PREDICTED: uncharacterized protein LOC101511525  92.4    2e-17    
gb|EYU46562.1|  hypothetical protein MIMGU_mgv1a011071mg              92.8    2e-17    
gb|AGV54150.1|  senescence-associated protein                         91.3    3e-17    
ref|XP_003559606.1|  PREDICTED: uncharacterized protein LOC100838840  92.8    3e-17    
gb|KEH23784.1|  senescence-associated protein SAG102                  91.7    5e-17    
gb|KFK35459.1|  hypothetical protein AALP_AA5G286800                  90.9    7e-17    
gb|KDO73842.1|  hypothetical protein CISIN_1g023035mg                 91.3    8e-17    
ref|XP_010468873.1|  PREDICTED: uncharacterized protein LOC104748993  90.9    1e-16    
ref|XP_010525211.1|  PREDICTED: uncharacterized protein LOC104803039  90.1    1e-16    
ref|XP_010472582.1|  PREDICTED: uncharacterized protein LOC104752...  90.9    1e-16    
ref|XP_009405652.1|  PREDICTED: uncharacterized protein LOC103988746  90.9    1e-16    
ref|XP_009398546.1|  PREDICTED: uncharacterized protein LOC103983103  90.9    1e-16    
ref|XP_009138646.1|  PREDICTED: uncharacterized protein LOC103862722  89.7    1e-16    
emb|CDY53722.1|  BnaAnng12630D                                        90.9    2e-16    
gb|KHN17740.1|  hypothetical protein glysoja_005937                   89.4    2e-16    
ref|XP_010049378.1|  PREDICTED: uncharacterized protein LOC104438012  89.7    2e-16    
ref|XP_010488286.1|  PREDICTED: uncharacterized protein LOC104766154  89.4    2e-16    
ref|XP_010552767.1|  PREDICTED: uncharacterized protein LOC104823044  89.4    2e-16    
ref|XP_007012589.1|  Uncharacterized protein TCM_037491               89.0    3e-16    
gb|ABK92901.1|  unknown                                               88.6    4e-16    
ref|XP_009381147.1|  PREDICTED: uncharacterized protein LOC103969369  89.7    4e-16    
ref|XP_004172961.1|  PREDICTED: uncharacterized LOC101203170          89.0    4e-16    
ref|XP_002878503.1|  mediator of aba-regulated dormancy 1             88.6    5e-16    
ref|XP_011039950.1|  PREDICTED: uncharacterized protein LOC105136...  88.2    6e-16    
ref|XP_002276822.1|  PREDICTED: uncharacterized protein LOC100264520  87.8    6e-16    
ref|XP_010038097.1|  PREDICTED: uncharacterized protein LOC104426665  87.8    1e-15    
ref|XP_007138634.1|  hypothetical protein PHAVU_009G225200g           87.4    1e-15    
ref|XP_006402297.1|  hypothetical protein EUTSA_v10006167mg           87.4    1e-15    
ref|NP_001276134.1|  uncharacterized protein LOC100816402             87.0    1e-15    
ref|XP_006381591.1|  senescence-associated family protein             87.0    1e-15    
emb|CAN80273.1|  hypothetical protein VITISV_039443                   86.7    2e-15    
ref|XP_010099092.1|  hypothetical protein L484_002533                 86.7    2e-15    
ref|XP_004287657.1|  PREDICTED: uncharacterized protein LOC101302689  86.7    2e-15    
gb|EYU28312.1|  hypothetical protein MIMGU_mgv1a012573mg              86.3    2e-15    
emb|CCW28820.1|  putative protein contains domain DUF581              85.9    2e-15    
gb|EMT02465.1|  hypothetical protein F775_18381                       88.2    3e-15    
ref|XP_004488103.1|  PREDICTED: uncharacterized protein LOC101495380  85.9    3e-15    
ref|XP_002464115.1|  hypothetical protein SORBIDRAFT_01g012570        86.7    4e-15    
ref|XP_004146977.1|  PREDICTED: uncharacterized protein LOC101203170  85.9    4e-15    
ref|XP_009116987.1|  PREDICTED: uncharacterized protein LOC103842124  85.5    4e-15    
ref|XP_002455878.1|  hypothetical protein SORBIDRAFT_03g026700        85.9    4e-15    
gb|AAM65522.1|  unknown                                               85.1    6e-15    
gb|AFW68044.1|  hypothetical protein ZEAMMB73_047842                  85.9    6e-15    
ref|NP_567143.1|  uncharacterized protein                             85.1    6e-15    
gb|AAK92226.1|  senescence-associated protein SAG102                  85.1    7e-15    
ref|NP_001241284.1|  uncharacterized protein LOC100801983             84.7    8e-15    
emb|CAB86422.1|  putative protein                                     84.7    8e-15    
emb|CDP20908.1|  unnamed protein product                              84.7    9e-15    
ref|XP_008344046.1|  PREDICTED: uncharacterized protein LOC103406845  84.3    1e-14    
emb|CCW28755.1|  hypothetical protein ARAX_ADH035P21-010              84.0    1e-14    
gb|ABB47637.1|  expressed protein                                     84.7    1e-14    
ref|XP_010261774.1|  PREDICTED: uncharacterized protein LOC104600503  84.3    1e-14    
ref|XP_006291783.1|  hypothetical protein CARUB_v10017953mg           84.0    1e-14    
emb|CDY56452.1|  BnaA09g55700D                                        83.6    2e-14    
emb|CDX76690.1|  BnaC08g32760D                                        83.6    2e-14    
gb|KHG19486.1|  Cyclin-dependent kinase 1                             83.6    2e-14    
ref|NP_001064631.1|  Os10g0422600                                     84.7    2e-14    
ref|XP_010512731.1|  PREDICTED: uncharacterized protein LOC104788659  84.0    2e-14    
dbj|BAK00497.1|  predicted protein                                    83.6    2e-14    
gb|KHN42788.1|  hypothetical protein glysoja_038350                   83.6    2e-14    
gb|AFK45930.1|  unknown                                               83.2    2e-14    
ref|XP_004297110.1|  PREDICTED: uncharacterized protein LOC101295...  84.3    2e-14    
ref|XP_009384472.1|  PREDICTED: uncharacterized protein LOC103972012  82.8    2e-14    
gb|EEC66972.1|  hypothetical protein OsI_33632                        85.1    3e-14    
gb|AFK45439.1|  unknown                                               82.8    3e-14    
ref|XP_010230541.1|  PREDICTED: insulinoma-associated protein 1-l...  83.6    3e-14    
dbj|BAJ87875.1|  predicted protein                                    83.6    4e-14    
emb|CDM83271.1|  unnamed protein product                              82.8    4e-14    
ref|XP_006850969.1|  hypothetical protein AMTR_s00025p00205050        82.0    6e-14    
gb|AFK36042.1|  unknown                                               82.0    6e-14    
ref|XP_003568806.1|  PREDICTED: uncharacterized protein LOC100839396  82.8    8e-14    
ref|XP_009337183.1|  PREDICTED: uncharacterized protein LOC103929682  81.6    8e-14    
ref|XP_007154560.1|  hypothetical protein PHAVU_003G129000g           81.3    9e-14    
ref|XP_010273868.1|  PREDICTED: uncharacterized protein LOC104609291  81.3    1e-13    
ref|XP_011093870.1|  PREDICTED: uncharacterized protein LOC105173708  81.3    1e-13    
gb|EMT08776.1|  hypothetical protein F775_26362                       81.6    1e-13    
ref|XP_009768798.1|  PREDICTED: uncharacterized protein LOC104219767  80.1    2e-13    
gb|KDP33943.1|  hypothetical protein JCGZ_07514                       80.5    2e-13    
ref|XP_003546515.1|  PREDICTED: uncharacterized protein LOC100813156  80.5    2e-13    
ref|XP_004969057.1|  PREDICTED: uncharacterized protein LOC101756250  79.7    4e-13    
ref|NP_001168625.1|  uncharacterized protein LOC100382411             77.0    4e-13    
gb|EYU25829.1|  hypothetical protein MIMGU_mgv1a012423mg              79.3    4e-13    
ref|XP_004242888.1|  PREDICTED: uncharacterized protein LOC101257280  79.0    5e-13    
ref|XP_009588502.1|  PREDICTED: fe-S cluster assembly protein DRE...  78.2    8e-13    
gb|EMT02626.1|  hypothetical protein F775_22942                       75.9    8e-13    
ref|XP_009389838.1|  PREDICTED: uncharacterized protein LOC103976369  79.0    8e-13    
ref|XP_009359713.1|  PREDICTED: uncharacterized protein LOC103950249  78.6    9e-13    
ref|XP_003595357.1|  hypothetical protein MTR_2g042970                78.6    1e-12    
ref|XP_009596467.1|  PREDICTED: uncharacterized protein LOC104092...  78.2    1e-12    
ref|XP_009413890.1|  PREDICTED: uncharacterized protein LOC103995...  79.0    1e-12    
ref|XP_010263374.1|  PREDICTED: uncharacterized protein LOC104601643  77.8    1e-12    
ref|XP_004299764.1|  PREDICTED: uncharacterized protein LOC101305665  77.8    1e-12    
ref|XP_010047455.1|  PREDICTED: uncharacterized protein LOC104436393  77.0    2e-12    
ref|XP_011078126.1|  PREDICTED: uncharacterized protein LOC105161946  77.4    2e-12    
ref|XP_008341145.1|  PREDICTED: uncharacterized protein LOC103404068  77.0    2e-12    
ref|XP_007202485.1|  hypothetical protein PRUPE_ppa010520mg           77.0    2e-12    
ref|XP_009797679.1|  PREDICTED: uncharacterized protein LOC104244...  75.5    2e-12    
ref|XP_003569292.1|  PREDICTED: uncharacterized protein LOC100833077  77.4    2e-12    
ref|XP_008664449.1|  PREDICTED: uncharacterized protein LOC103643065  75.1    2e-12    
ref|XP_009598285.1|  PREDICTED: uncharacterized protein LOC104094125  75.1    2e-12    
ref|XP_008337831.1|  PREDICTED: uncharacterized protein LOC103400918  77.0    3e-12    
ref|XP_004508016.1|  PREDICTED: uncharacterized protein LOC101489014  76.6    3e-12    
ref|XP_003542370.1|  PREDICTED: uncharacterized protein LOC100499825  76.6    4e-12    
gb|EEE50981.1|  hypothetical protein OsJ_31565                        75.9    4e-12    
gb|KHN07883.1|  hypothetical protein glysoja_032427                   76.3    4e-12    
ref|XP_004251977.1|  PREDICTED: uncharacterized protein LOC101261201  75.9    4e-12    
ref|XP_009413888.1|  PREDICTED: uncharacterized protein LOC103995...  77.0    5e-12    
dbj|BAJ99378.1|  predicted protein                                    77.0    5e-12    
ref|XP_009418174.1|  PREDICTED: uncharacterized protein LOC103998425  75.9    5e-12    
dbj|BAJ89728.1|  predicted protein                                    76.6    5e-12    
gb|ACU13810.1|  unknown                                               75.9    5e-12    
gb|KCW45789.1|  hypothetical protein EUGRSUZ_L00403                   76.3    6e-12    
emb|CDP12493.1|  unnamed protein product                              73.9    7e-12    
gb|AFK43551.1|  unknown                                               75.5    8e-12    
ref|XP_009790189.1|  PREDICTED: uncharacterized protein LOC104237694  75.1    1e-11    
ref|XP_006344574.1|  PREDICTED: uncharacterized protein LOC102592989  74.7    1e-11    
ref|XP_004983199.1|  PREDICTED: uncharacterized protein LOC101756881  75.5    1e-11    
ref|XP_007223863.1|  hypothetical protein PRUPE_ppa010802mg           75.1    1e-11    
ref|XP_008223946.1|  PREDICTED: uncharacterized protein LOC103323715  75.1    1e-11    
ref|XP_010937305.1|  PREDICTED: uncharacterized protein LOC105056700  74.7    1e-11    
dbj|BAJ84784.1|  predicted protein                                    74.3    1e-11    
ref|XP_003609974.1|  hypothetical protein MTR_4g124930                75.1    1e-11    
gb|KEH32424.1|  DUF581 family protein                                 74.7    1e-11    
ref|XP_008782831.1|  PREDICTED: uncharacterized protein LOC103702271  74.3    1e-11    
gb|EAY84681.1|  hypothetical protein OsI_06053                        74.3    1e-11    
ref|XP_004243694.1|  PREDICTED: uncharacterized protein LOC101247342  74.3    2e-11    
ref|XP_002467232.1|  hypothetical protein SORBIDRAFT_01g021730        74.7    2e-11    
ref|XP_010939880.1|  PREDICTED: uncharacterized protein LOC105058604  74.3    2e-11    
gb|KCW84194.1|  hypothetical protein EUGRSUZ_B01058                   74.7    2e-11    
ref|XP_008242270.1|  PREDICTED: uncharacterized protein LOC103340616  74.3    2e-11    
gb|EYU25754.1|  hypothetical protein MIMGU_mgv1a013722mg              73.9    2e-11    
ref|XP_010108338.1|  hypothetical protein L484_000276                 73.9    3e-11    
gb|ACU18537.1|  unknown                                               73.2    3e-11    
ref|NP_001042207.2|  Os01g0180400                                     71.6    3e-11    
ref|XP_006367693.1|  PREDICTED: uncharacterized protein LOC102582298  73.6    3e-11    
ref|NP_001043459.1|  Os01g0593200                                     73.9    3e-11    
gb|AAT68207.1|  unknown                                               73.2    3e-11    
ref|XP_008800449.1|  PREDICTED: uncharacterized protein LOC103714811  73.2    4e-11    
ref|XP_009362022.1|  PREDICTED: uncharacterized protein LOC103952199  73.2    4e-11    
emb|CDX97112.1|  BnaC09g45130D                                        73.6    4e-11    
ref|NP_001147938.1|  LOC100281547                                     73.2    5e-11    
ref|XP_010654676.1|  PREDICTED: uncharacterized protein LOC104880242  74.3    6e-11    
ref|XP_010913792.1|  PREDICTED: uncharacterized protein LOC105039352  72.4    7e-11    
ref|XP_006353132.1|  PREDICTED: uncharacterized protein LOC102588703  72.4    7e-11    
ref|XP_009620958.1|  PREDICTED: uncharacterized protein LOC104112673  72.4    8e-11    
emb|CDX85864.1|  BnaC06g22700D                                        72.0    8e-11    
ref|XP_011082642.1|  PREDICTED: uncharacterized protein LOC105165360  73.2    8e-11    
ref|XP_002451637.1|  hypothetical protein SORBIDRAFT_04g005000        72.0    9e-11    
ref|NP_001046050.1|  Os02g0174800                                     71.6    1e-10    
ref|XP_006400639.1|  hypothetical protein EUTSA_v10014483mg           72.0    1e-10    
ref|XP_009413887.1|  PREDICTED: uncharacterized protein LOC103995...  73.9    1e-10    
ref|XP_010687552.1|  PREDICTED: uncharacterized protein LOC104901657  72.0    1e-10    
ref|XP_011094050.1|  PREDICTED: uncharacterized protein LOC105173853  71.6    1e-10    
ref|XP_010656704.1|  PREDICTED: uncharacterized protein LOC100244902  71.6    1e-10    
ref|XP_006288533.1|  hypothetical protein CARUB_v10001805mg           71.6    1e-10    
ref|XP_003570391.1|  PREDICTED: uncharacterized protein LOC100830428  70.9    2e-10    
ref|XP_006644331.1|  PREDICTED: uncharacterized protein LOC102722...  71.6    2e-10    
ref|XP_006573878.1|  PREDICTED: uncharacterized protein LOC100806...  71.2    2e-10    
ref|XP_009370028.1|  PREDICTED: uncharacterized protein LOC103959403  71.2    2e-10    
emb|CBI24060.3|  unnamed protein product                              71.6    2e-10    
ref|XP_009104736.1|  PREDICTED: uncharacterized protein LOC103830676  70.9    2e-10    
emb|CDX68157.1|  BnaA07g21970D                                        70.5    3e-10    
gb|KDO68689.1|  hypothetical protein CISIN_1g023402mg                 70.9    3e-10    
ref|XP_008450954.1|  PREDICTED: uncharacterized protein LOC103492390  70.5    3e-10    
ref|XP_006843916.1|  hypothetical protein AMTR_s00007p00269180        70.1    4e-10    
ref|XP_007014556.1|  Uncharacterized protein TCM_039757               70.1    4e-10    
emb|CDX73126.1|  BnaC06g35740D                                        70.1    4e-10    
gb|KFK26293.1|  hypothetical protein AALP_AA8G229200                  70.1    4e-10    
ref|XP_006655055.1|  PREDICTED: uncharacterized protein LOC102709846  70.1    5e-10    
ref|XP_004951742.1|  PREDICTED: uncharacterized protein LOC101780165  69.7    6e-10    
emb|CDY16556.1|  BnaC09g37170D                                        69.7    6e-10    
ref|XP_004152859.1|  PREDICTED: uncharacterized protein LOC101216928  68.9    9e-10    
ref|XP_004144050.1|  PREDICTED: uncharacterized protein LOC101213046  68.9    9e-10    
ref|XP_010428491.1|  PREDICTED: uncharacterized protein LOC104713133  68.9    9e-10    
ref|XP_004172869.1|  PREDICTED: uncharacterized LOC101216928          68.9    1e-09    
gb|EYU46563.1|  hypothetical protein MIMGU_mgv1a011071mg              69.7    1e-09    
gb|AAM64456.1|  unknown                                               68.6    1e-09    
ref|XP_008450708.1|  PREDICTED: uncharacterized protein LOC103492205  68.9    1e-09    
ref|XP_010520527.1|  PREDICTED: uncharacterized protein LOC104799612  68.9    1e-09    
ref|XP_008391418.1|  PREDICTED: uncharacterized protein LOC103453642  68.9    1e-09    
ref|XP_004171679.1|  PREDICTED: uncharacterized protein LOC101225191  68.6    1e-09    
ref|XP_006573877.1|  PREDICTED: uncharacterized protein LOC100806...  68.9    1e-09    
gb|EAY75628.1|  hypothetical protein OsI_03533                        68.6    2e-09    
ref|NP_001044080.2|  Os01g0719000                                     68.6    2e-09    
ref|XP_010493181.1|  PREDICTED: uncharacterized protein LOC104770451  68.2    2e-09    
ref|XP_010454376.1|  PREDICTED: uncharacterized protein LOC104736143  68.2    2e-09    
ref|NP_197570.1|  uncharacterized protein                             68.2    2e-09    
ref|XP_010420915.1|  PREDICTED: uncharacterized protein LOC104706...  68.2    2e-09    
ref|NP_565095.1|  uncharacterized protein                             67.8    2e-09    
ref|XP_009405434.1|  PREDICTED: uncharacterized protein LOC103988579  66.2    2e-09    
gb|AAD55282.1|AC008263_13  ESTs gb|T04387, gb|R84022 and gb|T4223...  67.0    3e-09    
ref|XP_010471593.1|  PREDICTED: uncharacterized protein LOC104751364  67.0    4e-09    
ref|XP_009414825.1|  PREDICTED: uncharacterized protein LOC103995837  67.0    4e-09    
ref|XP_006648360.1|  PREDICTED: uncharacterized protein LOC102722090  66.2    5e-09    
emb|CDY45072.1|  BnaA02g05040D                                        67.0    5e-09    
ref|XP_011019964.1|  PREDICTED: uncharacterized protein LOC105122525  66.6    6e-09    
gb|EMS50102.1|  hypothetical protein TRIUR3_19222                     65.9    6e-09    
emb|CDX92442.1|  BnaA10g14810D                                        66.6    6e-09    
gb|KFK41932.1|  hypothetical protein AALP_AA2G190500                  66.2    6e-09    
ref|XP_010498329.1|  PREDICTED: uncharacterized protein LOC104776034  66.2    6e-09    
ref|XP_009404182.1|  PREDICTED: uncharacterized protein LOC103987573  65.9    6e-09    
ref|XP_009120780.1|  PREDICTED: uncharacterized protein LOC103845...  66.6    6e-09    
gb|AAR87176.1|  expressed protein, 3'-partial                         67.0    7e-09    
ref|XP_009126470.1|  PREDICTED: uncharacterized protein LOC103851370  66.2    1e-08    
ref|XP_002874011.1|  hypothetical protein ARALYDRAFT_910113           65.9    1e-08    
emb|CDY26695.1|  BnaA06g13270D                                        65.5    1e-08    
gb|ADE77804.1|  unknown                                               64.7    1e-08    
ref|XP_009592195.1|  PREDICTED: uncharacterized protein LOC104089085  64.7    2e-08    
ref|XP_010535802.1|  PREDICTED: uncharacterized protein LOC104810989  64.7    2e-08    
ref|XP_009786339.1|  PREDICTED: uncharacterized protein LOC104234473  65.5    2e-08    
ref|XP_010477123.1|  PREDICTED: uncharacterized protein LOC104756260  64.7    2e-08    
gb|EAY96771.1|  hypothetical protein OsI_18697                        64.3    2e-08    
gb|KFK44059.1|  hypothetical protein AALP_AA1G210600                  64.7    2e-08    
ref|XP_009103259.1|  PREDICTED: uncharacterized protein LOC103829349  63.9    2e-08    
emb|CDY01294.1|  BnaA07g10670D                                        63.9    2e-08    
ref|XP_008779193.1|  PREDICTED: uncharacterized protein LOC103698924  63.5    3e-08    
gb|ABK22160.1|  unknown                                               63.5    3e-08    
ref|NP_564160.1|  uncharacterized protein                             63.5    3e-08    
ref|XP_008645296.1|  PREDICTED: uncharacterized protein LOC103626680  64.3    3e-08    
ref|XP_010416352.1|  PREDICTED: uncharacterized protein LOC104702225  63.9    4e-08    
ref|XP_009149391.1|  PREDICTED: uncharacterized protein LOC103872714  63.9    4e-08    
ref|XP_009596717.1|  PREDICTED: uncharacterized protein LOC104092760  64.7    4e-08    
ref|NP_001054809.2|  Os05g0180500                                     64.7    5e-08    
ref|XP_009592194.1|  PREDICTED: uncharacterized protein LOC104089084  63.2    5e-08    
ref|XP_011017613.1|  PREDICTED: uncharacterized protein LOC105120905  63.5    6e-08    
ref|XP_006388240.1|  hypothetical protein POPTR_0269s00220g           63.5    6e-08    
ref|XP_006372217.1|  hypothetical protein POPTR_0018s14350g           63.5    6e-08    



>ref|XP_004245248.1| PREDICTED: uncharacterized protein LOC101254717 [Solanum lycopersicum]
Length=406

 Score =   406 bits (1044),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 242/412 (59%), Positives = 279/412 (68%), Gaps = 19/412 (5%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESD  328
             ML+KRTRS QK Q MG LM D  S+S+    VF +KHK +SFFNVP +FVG NPK SESD
Sbjct  1     MLKKRTRSHQKVQTMGHLMSDGISDSYFQPDVFVRKHKNNSFFNVPGVFVGFNPKGSESD  60

Query  329   SVRSPTSPLEFRVFSTLSNTLRSQRS-SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPI  505
             SVRSPTSPL+FRVFS L N  RS  S   G  K+WGC+KVGL I+D+LDD+ K  G +  
Sbjct  61    SVRSPTSPLDFRVFSNLGNPFRSSTSEGAGANKTWGCTKVGLGIVDSLDDEMKHSGKVFR  120

Query  506   PSKSKNIIFGPQMSCKTQNFLN-HSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLF  682
              S SKNI+FG QM  K  +F +   DS    KSLPKNI IFP T  K  NL   SS V+F
Sbjct  121   SSDSKNILFGTQMRIKAHDFQSCVDDSLEEPKSLPKNISIFPHTLSKSSNLRKGSSDVVF  180

Query  683   GIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQN--  856
             GIGDA L E   S N RS SLDSGRS S FAS A+R     + + G+E+ IN  +SQ   
Sbjct  181   GIGDA-LSEHEYSRNFRSCSLDSGRSSSRFASLANR-----TVAVGSENAINPVVSQTKC  234

Query  857   VRELSKLGN-SSGAKLRSMPVPAGS-------ISTSKIELSEDYTCVRTHGPNPKVTHIF  1012
             VR  SKLGN + GAKL  +P P GS       IS S I+LSEDYTCVRT GPN KVTHIF
Sbjct  235   VRGCSKLGNPAGGAKLSPIPTPVGSNTSLVGSISASDIQLSEDYTCVRTRGPNAKVTHIF  294

Query  1013  CDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIF  1192
             CDCILECHNNE  NF KN  E+  L +     E   S+PSSDFL FC +CKKKLDGKDI+
Sbjct  295   CDCILECHNNELPNFCKNANEKTVLPEVTDSSEVLTSFPSSDFLRFCSSCKKKLDGKDIY  354

Query  1193  IYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYESSLFIAT  1348
             +YRGEKAFCS  CRSE ILIDEE EK N   +   KPNSR+E +++ LFIAT
Sbjct  355   MYRGEKAFCSLDCRSEAILIDEEMEKVNNDSESSIKPNSRDEVFDTGLFIAT  406



>ref|XP_006356629.1| PREDICTED: uncharacterized protein LOC102585748 [Solanum tuberosum]
Length=407

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 242/413 (59%), Positives = 280/413 (68%), Gaps = 20/413 (5%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESD  328
             ML+KRTRS QK   MG LM D  S+S+  S V  +KHK +SFFNVP +FVGLNPK SESD
Sbjct  1     MLKKRTRSHQKVHTMGHLMSDGISDSYFQSDVLVRKHKSNSFFNVPGVFVGLNPKGSESD  60

Query  329   SVRSPTSPLEFRVFSTLSNTLRSQRS-SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPI  505
             SVRSPTSPL+FRVFS L N  RS  S   G  K+WGC+KVGL I+D+LDD+ K+ G +  
Sbjct  61    SVRSPTSPLDFRVFSNLGNPFRSSTSEGAGANKTWGCTKVGLGIVDSLDDEMKQSGKVFR  120

Query  506   PSKSKNIIFGPQMSCKTQNFLN-HSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLF  682
              S SKNI+FG QM  KT +F +   DS    KSLPKNI IFP T  K  NL   SS V+F
Sbjct  121   SSDSKNILFGTQMRIKTHDFQSCVDDSLEEPKSLPKNISIFPHTLSKSSNLRKGSSDVVF  180

Query  683   GIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQN--  856
             GIGDA L E   S N RS SLDSGRS S FAS A+R     + +FG+E+ IN  +S    
Sbjct  181   GIGDA-LSEHELSRNFRSCSLDSGRSSSRFASLANR-----TVAFGSENAINPVVSHTKC  234

Query  857   VRELSKLGN-SSGAKLRSMPVPAGS-------ISTSKIELSEDYTCVRTHGPNPKVTHIF  1012
             VR  SKLGN + GAKL  +P P GS       IS S IELSEDYTCVRT GPN KVTHIF
Sbjct  235   VRGCSKLGNPAGGAKLSPIPTPVGSNTSLVGSISASDIELSEDYTCVRTRGPNAKVTHIF  294

Query  1013  CDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIF  1192
             CDCILECHNNE  NF KN  E+  L +     E   S+PSSDFL FC +CKK+LDGKDI+
Sbjct  295   CDCILECHNNELPNFCKNANEKTVLPEVTDSSEVLTSFPSSDFLRFCSSCKKRLDGKDIY  354

Query  1193  IYRGEKAFCSSSCRSEEILIDEEKE-KTNKGGDDFEKPNSREEPYESSLFIAT  1348
             +YRGEKAFCS  CRSE ILIDEE E K N   +   KPNSR+E +++ LFI T
Sbjct  355   MYRGEKAFCSLDCRSEAILIDEEMEKKVNNHSESTIKPNSRDEVFDTGLFIVT  407



>ref|XP_011081852.1| PREDICTED: uncharacterized protein LOC105164785 isoform X2 [Sesamum 
indicum]
 ref|XP_011081853.1| PREDICTED: uncharacterized protein LOC105164785 isoform X2 [Sesamum 
indicum]
 ref|XP_011081854.1| PREDICTED: uncharacterized protein LOC105164785 isoform X2 [Sesamum 
indicum]
Length=422

 Score =   374 bits (960),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 273/425 (64%), Gaps = 29/425 (7%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESD  328
             MLRKRTRS QKDQ M  LMPD+ SES+  S + +QKHK +SF  V  LFVG NP+ SESD
Sbjct  1     MLRKRTRSHQKDQHMNNLMPDAISESYFHSDILSQKHKTNSFLKVSGLFVGFNPRSSESD  60

Query  329   SVRSPTSPLEFRVFSTLSNTLRSQRS-SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPI  505
             SVRSPTSPL+FR+FS+  N  R  RS +EGH KSW CSKVGLSIID+LDD  K++G +  
Sbjct  61    SVRSPTSPLDFRIFSSFGNPFRCPRSQNEGHHKSWDCSKVGLSIIDSLDDGAKKVGKVTG  120

Query  506   PSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFG  685
              S +KNI+FG QMS +  NF +H DS     SLPK++ +FP    +P N+H  +S  +F 
Sbjct  121   SSDNKNILFGRQMSIRRPNFCSHVDSLEKPNSLPKDVAVFPNARAEPANVHKGNSDAVFE  180

Query  686   IGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQN--V  859
             IG+A +E      N R  SLDS R GSH   F +RKS   SGS   E+ +N    ++  +
Sbjct  181   IGEAVVEPE-PYQNFRPCSLDSERYGSHLTKFGNRKSRFGSGSLVPENTMNQMPWESALL  239

Query  860   RELSKLGNSSGAKLRSMP--VPAG-----SISTSKIELSEDYTCVRTHGPNPKVTHIFCD  1018
                 +LG+ SG KL S+P  + +G     SI  S+IELSEDYTCVRTHGPNPKVTHIF D
Sbjct  240   GGSPELGSLSGEKLSSIPPSIQSGTCLLDSIPASEIELSEDYTCVRTHGPNPKVTHIFRD  299

Query  1019  CILECHNNEFTNFSKNGEEEN------------GLSKGPGCCEEHFS---YPSSDFLSFC  1153
              ILECHN+E T F K  E  N            GL   P   E       YP  DFL FC
Sbjct  300   RILECHNDEVTEFLKKSENGNATPEADELADVLGLYPTPEADEPAVVLGLYPPKDFLKFC  359

Query  1154  YTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYESS  1333
             Y+C+KKLDG+DI++YRGEKAFCS SCRS+EI IDEE EKTN    +    NS +E  ESS
Sbjct  360   YSCQKKLDGEDIYMYRGEKAFCSYSCRSQEIEIDEEMEKTNNASSEIS--NSSQEISESS  417

Query  1334  LFIAT  1348
             LFI T
Sbjct  418   LFITT  422



>emb|CDP18437.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 224/395 (57%), Positives = 270/395 (68%), Gaps = 10/395 (3%)
 Frame = +2

Query  191   MGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESDSVRSPTSPLEFRVF  370
             MGQL  D  SES + S   A ++K SSFFNVP LFVG N K SESDS RSPTSPL+FRVF
Sbjct  1     MGQLNSDVVSESFVHSDFLAHRNKNSSFFNVPGLFVGFNSKNSESDSARSPTSPLDFRVF  60

Query  371   STLSNTLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQM  544
             ST  N  RS + S    HQK+W  +KVGLSIID+LD + K+ G +   S SKNI+FGP++
Sbjct  61    STWGNPFRSPKLSHESHHQKTWDTNKVGLSIIDSLDYEVKQSGKVLRSSDSKNILFGPKI  120

Query  545   SCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSA  724
               KT NF N +DSF A KSLPK++ IFP  + K  NL N SS VLF IGD PL+   S  
Sbjct  121   RIKTPNFNNCTDSFEAPKSLPKDVGIFPFAKSKLSNLQNGSSDVLFEIGDGPLQRN-SLG  179

Query  725   NMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVREL-SKLGNSSGAKL  901
             N R  SLDSGRSGSH +  A+  SNL S +F + +G   A S +  ++ S LG+SSGA+ 
Sbjct  180   NFRPCSLDSGRSGSHLSRLANHNSNLSSTNFSSSNGTGPATSPSHFKIGSVLGDSSGAEQ  239

Query  902   RSMPVPA-----GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKN  1066
              S+         G+IS S+IELSEDYTCVR HGPNPKVTHIF DC+LEC N+E +NF K 
Sbjct  240   PSITATIANGLIGTISPSEIELSEDYTCVRKHGPNPKVTHIFGDCVLECRNSELSNFGKY  299

Query  1067  GEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEI  1246
              EE N L     C E   SYPSSDFLSFCY+CKKKLDG+DI++YRGEKAFCS +CR EEI
Sbjct  300   KEEGNALPLTAECSEVPTSYPSSDFLSFCYSCKKKLDGEDIYMYRGEKAFCSWACRLEEI  359

Query  1247  LIDEEKEKTNKG-GDDFEKPNSREEPYESSLFIAT  1348
             +IDEE EK N    +   KP++ EE  E+ LFI+T
Sbjct  360   MIDEETEKCNTNVSEKSSKPSNSEELSETGLFIST  394



>ref|XP_011081851.1| PREDICTED: uncharacterized protein LOC105164785 isoform X1 [Sesamum 
indicum]
Length=502

 Score =   373 bits (958),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 225/425 (53%), Positives = 273/425 (64%), Gaps = 29/425 (7%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESD  328
             MLRKRTRS QKDQ M  LMPD+ SES+  S + +QKHK +SF  V  LFVG NP+ SESD
Sbjct  81    MLRKRTRSHQKDQHMNNLMPDAISESYFHSDILSQKHKTNSFLKVSGLFVGFNPRSSESD  140

Query  329   SVRSPTSPLEFRVFSTLSNTLRSQRS-SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPI  505
             SVRSPTSPL+FR+FS+  N  R  RS +EGH KSW CSKVGLSIID+LDD  K++G +  
Sbjct  141   SVRSPTSPLDFRIFSSFGNPFRCPRSQNEGHHKSWDCSKVGLSIIDSLDDGAKKVGKVTG  200

Query  506   PSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFG  685
              S +KNI+FG QMS +  NF +H DS     SLPK++ +FP    +P N+H  +S  +F 
Sbjct  201   SSDNKNILFGRQMSIRRPNFCSHVDSLEKPNSLPKDVAVFPNARAEPANVHKGNSDAVFE  260

Query  686   IGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQN--V  859
             IG+A +E      N R  SLDS R GSH   F +RKS   SGS   E+ +N    ++  +
Sbjct  261   IGEAVVEPE-PYQNFRPCSLDSERYGSHLTKFGNRKSRFGSGSLVPENTMNQMPWESALL  319

Query  860   RELSKLGNSSGAKLRSMP--VPAG-----SISTSKIELSEDYTCVRTHGPNPKVTHIFCD  1018
                 +LG+ SG KL S+P  + +G     SI  S+IELSEDYTCVRTHGPNPKVTHIF D
Sbjct  320   GGSPELGSLSGEKLSSIPPSIQSGTCLLDSIPASEIELSEDYTCVRTHGPNPKVTHIFRD  379

Query  1019  CILECHNNEFTNFSKNGEEEN------------GLSKGPGCCEEHFS---YPSSDFLSFC  1153
              ILECHN+E T F K  E  N            GL   P   E       YP  DFL FC
Sbjct  380   RILECHNDEVTEFLKKSENGNATPEADELADVLGLYPTPEADEPAVVLGLYPPKDFLKFC  439

Query  1154  YTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYESS  1333
             Y+C+KKLDG+DI++YRGEKAFCS SCRS+EI IDEE EKTN    +    NS +E  ESS
Sbjct  440   YSCQKKLDGEDIYMYRGEKAFCSYSCRSQEIEIDEEMEKTNNASSEIS--NSSQEISESS  497

Query  1334  LFIAT  1348
             LFI T
Sbjct  498   LFITT  502



>ref|XP_009616323.1| PREDICTED: uncharacterized protein LOC104108884 [Nicotiana tomentosiformis]
Length=390

 Score =   347 bits (890),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 229/411 (56%), Positives = 270/411 (66%), Gaps = 33/411 (8%)
 Frame = +2

Query  152   MLRKRTRSQ-KDQQMGQ-LMPDSSSESH-LSSGVFAQKHKVSSFFNVPA-LFVGLN-PKQ  316
             MLRKR+RS  K QQMGQ L+ DS S+S  L +     K+       VPA +FVGLN P +
Sbjct  1     MLRKRSRSHHKVQQMGQHLISDSYSQSDVLLANRKHNKNNNFFNVPVPASVFVGLNNPTK  60

Query  317   --SESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQKSWGC-SKVGLSIIDALD--DKT  481
               SESDSVRSPTSPL+FRVFS L N  R       ++ +WGC +KVGL I+D+LD  D+ 
Sbjct  61    VSSESDSVRSPTSPLDFRVFSNLGNPFR-------NKATWGCCTKVGLGIVDSLDNDDEM  113

Query  482   KRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHN  661
             K+ G +   S SKNI+FG QM  KTQNF          KSLPKNI IFP T  K  NL  
Sbjct  114   KKSGKVLRSSDSKNILFGTQMRIKTQNF---QTCVEEPKSLPKNISIFPHTLSKSSNLEK  170

Query  662   DSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINS  841
              +S V+FGIG+APLE  +S  N RS SLDSGR  +HFAS         S +FG E+G N 
Sbjct  171   GNSDVVFGIGEAPLEHELSR-NFRSCSLDSGRFIAHFAS---------SANFGYENGTNP  220

Query  842   AIS--QNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFC  1015
              +S  Q VR  SKLG    +   S  + AG+IS S IELSEDYTCVRT GPN KVTHIF 
Sbjct  221   VVSHTQCVRGCSKLGPKPTSVGSSTSL-AGAISASDIELSEDYTCVRTRGPNAKVTHIFG  279

Query  1016  DCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFI  1195
             DCILECHNNE TNF KN  E+  L +     E   SYPSSDFL FCY+CKKKLDG+DI++
Sbjct  280   DCILECHNNELTNFCKNANEKTTLPEVVDSSEVLTSYPSSDFLRFCYSCKKKLDGEDIYM  339

Query  1196  YRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYESSLFIAT  1348
             YRGEKAFCS +CRSE ILIDEE EK N   ++  KPNSR+E +E+ LFIAT
Sbjct  340   YRGEKAFCSLNCRSEAILIDEEMEKLNNDSENTIKPNSRDEVFETGLFIAT  390



>ref|XP_009776914.1| PREDICTED: uncharacterized protein LOC104226586 [Nicotiana sylvestris]
 ref|XP_009776915.1| PREDICTED: uncharacterized protein LOC104226586 [Nicotiana sylvestris]
Length=394

 Score =   340 bits (871),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 225/411 (55%), Positives = 267/411 (65%), Gaps = 29/411 (7%)
 Frame = +2

Query  152   MLRKRTRSQ-KDQQMGQ-LMPDSSSESH-LSSGVFAQKHKVSSFFNVPA-LFVGLN---P  310
             MLRKR+RS  K Q MGQ L+ DS S+   L +     K+       VPA +FVGLN    
Sbjct  1     MLRKRSRSHHKFQHMGQHLISDSYSQPDVLLANRKHNKNNNFFNVPVPAGVFVGLNNPTK  60

Query  311   KQSESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQKSWGC-SKVGLSIIDALD--DKT  481
               SESDSVRSPTSPL+FRVFS L N  R       ++ +WGC +KVGL I+D+LD  D+ 
Sbjct  61    ASSESDSVRSPTSPLDFRVFSNLGNPFR-------NKATWGCCTKVGLGIVDSLDNDDEM  113

Query  482   KRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHN  661
             K+ G +   S SKNI+FG QM  KTQNF          KSLPKNI IFP T  K  NL  
Sbjct  114   KKSGKVLRSSDSKNILFGTQMKIKTQNF---QTCVEEPKSLPKNISIFPHTLSKSSNLEK  170

Query  662   DSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINS  841
              +S V+FGIG+APLE  +S  N RS SLDSGRS +HFAS A+     HS +FG+ +G N 
Sbjct  171   GNSDVVFGIGEAPLEHELSR-NFRSFSLDSGRSIAHFASLAN-----HSLNFGSGNGTNP  224

Query  842   AIS--QNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFC  1015
              +S  Q  R  SKLG    +   S  +  G+IS S IELSEDYTCVRT GPN KVTHIF 
Sbjct  225   VVSHTQCARGCSKLGPMPTSVGSSASL-VGAISASDIELSEDYTCVRTRGPNAKVTHIFG  283

Query  1016  DCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFI  1195
             DCILECHNNE TNF KN  E+  L +         SYPSSDFL FCY+CKKKLDG+DI++
Sbjct  284   DCILECHNNELTNFCKNASEKTTLPEVVDSSGVLTSYPSSDFLRFCYSCKKKLDGEDIYM  343

Query  1196  YRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYESSLFIAT  1348
             YRGEKAFCS +CRSE ILIDEE EK N   ++  KPNSR+E +E+ LFIAT
Sbjct  344   YRGEKAFCSLNCRSEAILIDEEMEKLNNDSENTIKPNSRDEVFETGLFIAT  394



>ref|XP_002284674.1| PREDICTED: uncharacterized protein LOC100247517 [Vitis vinifera]
 ref|XP_010648585.1| PREDICTED: uncharacterized protein LOC100247517 [Vitis vinifera]
 ref|XP_010648586.1| PREDICTED: uncharacterized protein LOC100247517 [Vitis vinifera]
Length=411

 Score =   323 bits (829),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 253/389 (65%), Gaps = 18/389 (5%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQ-LMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SE  322
             MLRKR+RS QKDQ MG   M D+ SE +  S V  QKHK +SFF+VP LFVGLN K  S+
Sbjct  1     MLRKRSRSFQKDQHMGHPTMADAVSELYFQSDVMGQKHKGNSFFSVPGLFVGLNYKGLSD  60

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSE-GHQKSWGCSKVGLSIIDALDDKTKRLGNL  499
             SDSVRSPTSPL+FRVFS L +  RS RSS+ G  KSW CSKVGLSIID+LDD  K  G +
Sbjct  61    SDSVRSPTSPLDFRVFSNLGSPFRSPRSSQDGQHKSWDCSKVGLSIIDSLDDGGKLSGKV  120

Query  500   PIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVL  679
                S+SK I+FGPQM  KT N  +H + F  +KSLPKN   FP T+ K      DS  V+
Sbjct  121   LGSSESKTILFGPQMRIKTPNSPSHINFFDGSKSLPKNYASFPHTQIKSRPQKRDSD-VV  179

Query  680   FGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV  859
             F I + PLE   +   +RS SLDS RS S   +   R+SNL SG+      + + +S   
Sbjct  180   FEIEETPLEPE-AFGRIRSCSLDSSRSFSSLTNLTKRQSNLSSGNL-CPGNMTTQVSSPP  237

Query  860   RELSKLGNSSG---AKLRSMPVPAGS-------ISTSKIELSEDYTCVRTHGPNPKVTHI  1009
             + L    N       KL S+P   GS       +S S+IELSEDYTCV +HGPNPK THI
Sbjct  238   QILGGNPNPDNFLPMKLNSIPASVGSGQGLIGSLSASEIELSEDYTCVISHGPNPKTTHI  297

Query  1010  FCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKD  1186
             + DCILECH+N+  N +KN E + G      C +    YPS+DFLS CY+CKKKL +GKD
Sbjct  298   YGDCILECHSNDLANHNKNDEHKIGSPLIVECSDNSTPYPSNDFLSICYSCKKKLEEGKD  357

Query  1187  IFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             I++YRGEKAFCS +CRS+EILIDEE EKT
Sbjct  358   IYMYRGEKAFCSLNCRSQEILIDEEMEKT  386



>ref|XP_002308629.2| hypothetical protein POPTR_0006s26160g [Populus trichocarpa]
 gb|EEE92152.2| hypothetical protein POPTR_0006s26160g [Populus trichocarpa]
Length=411

 Score =   322 bits (824),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 208/387 (54%), Positives = 250/387 (65%), Gaps = 15/387 (4%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SE  322
             MLRKRTRS QKDQQMGQL M DS SESH  S      HK +SFF VP LFVG + K  S+
Sbjct  1     MLRKRTRSLQKDQQMGQLTMSDSGSESHFQSDNMGHNHKANSFFTVPGLFVGSSLKGLSD  60

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQ-KSWGCSKVGLSIIDALDDKTKRLGNL  499
              DSVRSPTSPL+FR+FS + N  +S RSS G Q KSW C+KVGLSI+D+LDD  K  G +
Sbjct  61    CDSVRSPTSPLDFRMFSNIGNPSKSPRSSHGGQRKSWDCNKVGLSIVDSLDDDGKGSGKV  120

Query  500   PIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVL  679
                S+SKNI+FGP++  KT NF + +DSF A KSLP+N  IFP T  K   L   SS VL
Sbjct  121   LRSSESKNILFGPRVRSKTPNFQSRTDSFQAPKSLPRNFAIFPRTLTKS-PLLKGSSDVL  179

Query  680   FGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV  859
             F IG+ P  +      +RS SLDS RS S  +  A + S   SG+F  ++         +
Sbjct  180   FEIGEDP-SDSEPFGKIRSCSLDSCRSFSSLSRLAGQNSKASSGNFCLDNVTTRGECPQL  238

Query  860   RELSKLGNS-SGAKLRSMPVPA-------GSISTSKIELSEDYTCVRTHGPNPKVTHIFC  1015
                S   N+ S   L   P+         GS+S S+IELSEDYTCV +HGPNPK THI+ 
Sbjct  239   FGGSPNSNNFSNTNLTFTPMSVSSGNGFIGSLSASEIELSEDYTCVISHGPNPKTTHIYG  298

Query  1016  DCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIF  1192
             DCILEC +N+ +NF KN  +E GL +   C +   S+PS  FLSFCY C KKLD GKDI+
Sbjct  299   DCILECQSNDLSNFGKNEAKEIGLPQAVTCSKIPGSFPSEVFLSFCYYCNKKLDEGKDIY  358

Query  1193  IYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             IYRGEKAFCS SCRSEEI+IDEE E T
Sbjct  359   IYRGEKAFCSLSCRSEEIMIDEELENT  385



>ref|XP_011019696.1| PREDICTED: uncharacterized protein LOC105122337 [Populus euphratica]
Length=411

 Score =   320 bits (821),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 208/387 (54%), Positives = 249/387 (64%), Gaps = 15/387 (4%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SE  322
             MLRKRTRS QKDQQMGQL M DS SESH  S      HK +SFF VP LFVG + K  S+
Sbjct  1     MLRKRTRSLQKDQQMGQLTMSDSGSESHFQSDNTGHNHKANSFFTVPGLFVGSSLKGLSD  60

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQ-KSWGCSKVGLSIIDALDDKTKRLGNL  499
              DSVRSPTSPL+FR+FS + N  +S RSS G Q KSW C+KVGLSI+D+LDD  K  G +
Sbjct  61    CDSVRSPTSPLDFRMFSNIGNPSKSPRSSHGGQRKSWDCNKVGLSIVDSLDDDGKGSGKV  120

Query  500   PIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVL  679
                S+SKNI+FGP++  KT NF + +DSF A KSLP+N  IFP T  K   L   SS VL
Sbjct  121   LRSSESKNILFGPRVRSKTPNFQSRTDSFQAPKSLPRNFAIFPRTLTKS-PLLKGSSDVL  179

Query  680   FGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEH-GINSAISQN  856
             F IG+ P  +      +RS SLDS RS S  +  A + S   SG+F  ++        Q 
Sbjct  180   FEIGEDP-SDSEPFGKIRSCSLDSCRSFSSMSRLAGQNSKASSGNFCLDNITTRGECPQL  238

Query  857   VRELSKLGNSSGAKLRSMPVPA-------GSISTSKIELSEDYTCVRTHGPNPKVTHIFC  1015
             +       N S   L   P+         GS+S S+IELSEDYTCV +HGPNPK THI+ 
Sbjct  239   LGGSPNSNNFSNTNLTFTPMSVSSGNGFIGSLSASEIELSEDYTCVISHGPNPKTTHIYG  298

Query  1016  DCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIF  1192
             DCILEC +N+ +NF KN  +E GL +   C +   S+PS  FLSFCY C KKLD GKDI+
Sbjct  299   DCILECQSNDLSNFGKNETKEIGLPQAVTCPKIPGSFPSKVFLSFCYYCNKKLDEGKDIY  358

Query  1193  IYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             IYRGEKAFCS SCRSEEI+IDEE E T
Sbjct  359   IYRGEKAFCSLSCRSEEIMIDEELENT  385



>ref|XP_002324258.2| hypothetical protein POPTR_0018s00980g [Populus trichocarpa]
 gb|EEF02823.2| hypothetical protein POPTR_0018s00980g [Populus trichocarpa]
Length=415

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 206/397 (52%), Positives = 249/397 (63%), Gaps = 28/397 (7%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQL-MPDSSSESHLS-SGVFAQKHKVSSFFNVPALFVGLNPKQ-S  319
             MLRKRTRS +KDQQ GQL M DS SES+          HK +SFF VP LFVGL+ K  S
Sbjct  1     MLRKRTRSLKKDQQTGQLTMSDSGSESYFQPDNNMGHSHKANSFFTVPGLFVGLSHKGLS  60

Query  320   ESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEG-HQKSWGCSKVGLSIIDALDDKT-----  481
             + DSVRSPTSPL+ R+FS + N  +S RSS G  QKSW C+KVGLSI+D+LDD       
Sbjct  61    DCDSVRSPTSPLDSRMFSNIGNPHKSLRSSHGGQQKSWDCNKVGLSILDSLDDDDDDDDG  120

Query  482   KRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHN  661
             K  G +   S+SKNI+FGP++  KT NF +H+D F A KSLP+N  IFP T  K   L  
Sbjct  121   KGYGKVLQSSESKNILFGPRVRSKTANFQSHTDPFQAPKSLPRNFAIFPRTLTKS-PLQK  179

Query  662   DSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRK-SNLHSGSFG-TEHGI  835
             DSS VLF IG+ P E    S         S  S   F+S +     NL + S   + H I
Sbjct  180   DSSDVLFEIGEGPFE----SETFGRIRSCSLDSCRSFSSMSRLAGQNLKASSLNFSLHNI  235

Query  836   NSAIS---QNVRELSKLGNSSGAKLRSMPVPAGS-------ISTSKIELSEDYTCVRTHG  985
              + +    Q +   S   N S   L   P+ A S       +S S+IELSEDYTCV +HG
Sbjct  236   TTQVDCPPQLLGGSSNTNNFSNTNLTYTPMSASSGNGFISSLSASEIELSEDYTCVISHG  295

Query  986   PNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCK  1165
             PNPK THI+  CILECH+N+F+NF KN E+E GL++   C +   S+PS DFLSFCY C 
Sbjct  296   PNPKTTHIYGGCILECHSNDFSNFGKNKEKEIGLAQAATCSKIPSSFPSEDFLSFCYYCN  355

Query  1166  KKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             KKLD GKDI+IYRGEKAFCS SCRSEEI+IDEE E T
Sbjct  356   KKLDEGKDIYIYRGEKAFCSLSCRSEEIMIDEELENT  392



>ref|XP_011026540.1| PREDICTED: uncharacterized protein LOC105127111 isoform X1 [Populus 
euphratica]
 ref|XP_011026541.1| PREDICTED: uncharacterized protein LOC105127111 isoform X2 [Populus 
euphratica]
Length=438

 Score =   305 bits (781),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 214/399 (54%), Positives = 257/399 (64%), Gaps = 24/399 (6%)
 Frame = +2

Query  140   GLRTMLRKRTRS-QKDQQMGQL-MPDSSSESHLS-SGVFAQKHKVSSFFNVPALFVGLNP  310
             G   MLRKRTRS +KDQQ GQL M DS SES+          HK +SFFNVP LFVGL+ 
Sbjct  17    GFVAMLRKRTRSLKKDQQTGQLTMSDSGSESYFQPDNNMGYSHKANSFFNVPGLFVGLSH  76

Query  311   KQ-SESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEG-HQKSWGCSKVGLSIIDALDDKT-  481
             K  S+ DSVRSPTSPL+ R+FS + N  +S RSS G  QKSW C+KVGLSI+D+LDD   
Sbjct  77    KGLSDCDSVRSPTSPLDSRMFSNIGNPHKSLRSSHGGQQKSWDCNKVGLSILDSLDDDDD  136

Query  482   ----KRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPF  649
                 K  G +   S+SKNI+FGP++  KT NF +H+D F A KSLP+N  IFP T  K  
Sbjct  137   DDHGKGYGRVLQSSESKNILFGPRVRSKTANFQSHTDPFQAPKSLPRNFAIFPRTLTKS-  195

Query  650   NLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEH  829
              L  DSS VLF IG+ P E   S   +RS SLDS RS S  +  A +     S +F  ++
Sbjct  196   PLQKDSSGVLFEIGEGPFESE-SFGKIRSCSLDSCRSFSSMSRLAGQNLKASSLNFSLDN  254

Query  830   GINSAIS---QNVRELSKLGNSSGAKLRSMPVPAGS-------ISTSKIELSEDYTCVRT  979
              I + +    Q +   S   N S   L   P+ AGS       +S S+IELSEDYTCV +
Sbjct  255   -ITTQVDCPPQLLGGSSNTNNFSNTNLTCTPISAGSGNGFISSLSASEIELSEDYTCVIS  313

Query  980   HGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYT  1159
             HGPNPK THI+ DCILECH N+F+NF KN E E GL++   C +   S+PS DFLSFCY 
Sbjct  314   HGPNPKTTHIYGDCILECHYNDFSNFGKNKETEIGLAQAATCSKIPSSFPSEDFLSFCYY  373

Query  1160  CKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             C KKLD GKDI+IYRGEKAFCS SCRSEEI+IDEE E T
Sbjct  374   CNKKLDEGKDIYIYRGEKAFCSLSCRSEEIMIDEELENT  412



>ref|XP_011026542.1| PREDICTED: uncharacterized protein LOC105127111 isoform X3 [Populus 
euphratica]
 ref|XP_011026543.1| PREDICTED: uncharacterized protein LOC105127111 isoform X4 [Populus 
euphratica]
Length=418

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 213/395 (54%), Positives = 256/395 (65%), Gaps = 24/395 (6%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQL-MPDSSSESHLS-SGVFAQKHKVSSFFNVPALFVGLNPKQ-S  319
             MLRKRTRS +KDQQ GQL M DS SES+          HK +SFFNVP LFVGL+ K  S
Sbjct  1     MLRKRTRSLKKDQQTGQLTMSDSGSESYFQPDNNMGYSHKANSFFNVPGLFVGLSHKGLS  60

Query  320   ESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEG-HQKSWGCSKVGLSIIDALDDKT-----  481
             + DSVRSPTSPL+ R+FS + N  +S RSS G  QKSW C+KVGLSI+D+LDD       
Sbjct  61    DCDSVRSPTSPLDSRMFSNIGNPHKSLRSSHGGQQKSWDCNKVGLSILDSLDDDDDDDHG  120

Query  482   KRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHN  661
             K  G +   S+SKNI+FGP++  KT NF +H+D F A KSLP+N  IFP T  K   L  
Sbjct  121   KGYGRVLQSSESKNILFGPRVRSKTANFQSHTDPFQAPKSLPRNFAIFPRTLTKS-PLQK  179

Query  662   DSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINS  841
             DSS VLF IG+ P E   S   +RS SLDS RS S  +  A +     S +F  ++ I +
Sbjct  180   DSSGVLFEIGEGPFESE-SFGKIRSCSLDSCRSFSSMSRLAGQNLKASSLNFSLDN-ITT  237

Query  842   AIS---QNVRELSKLGNSSGAKLRSMPVPAGS-------ISTSKIELSEDYTCVRTHGPN  991
              +    Q +   S   N S   L   P+ AGS       +S S+IELSEDYTCV +HGPN
Sbjct  238   QVDCPPQLLGGSSNTNNFSNTNLTCTPISAGSGNGFISSLSASEIELSEDYTCVISHGPN  297

Query  992   PKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKK  1171
             PK THI+ DCILECH N+F+NF KN E E GL++   C +   S+PS DFLSFCY C KK
Sbjct  298   PKTTHIYGDCILECHYNDFSNFGKNKETEIGLAQAATCSKIPSSFPSEDFLSFCYYCNKK  357

Query  1172  LD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             LD GKDI+IYRGEKAFCS SCRSEEI+IDEE E T
Sbjct  358   LDEGKDIYIYRGEKAFCSLSCRSEEIMIDEELENT  392



>ref|XP_010254161.1| PREDICTED: uncharacterized protein LOC104595233 isoform X2 [Nelumbo 
nucifera]
Length=442

 Score =   296 bits (757),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 256/427 (60%), Gaps = 30/427 (7%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSES  325
             MLRKR+RS QKDQ  G LMPD +SES   S V  QKHK SSFF VP LFVG   K  S+S
Sbjct  15    MLRKRSRSLQKDQYKGHLMPDCASESGFQSDVSEQKHKGSSFFRVPDLFVGFCSKGLSDS  74

Query  326   DSVRSPTSPLEFRVFSTLSNTLRSQRSS-EGHQKSWGCSKVGLSIIDALDDKTKRLGNLP  502
             +S RSPTSPL++RVFS + N  RS RS  +G QKSWGCSKVGLSI+D+L+D++K  G + 
Sbjct  75    ESARSPTSPLDYRVFSNIGNPFRSPRSCLDGRQKSWGCSKVGLSIVDSLNDESKPSGKVF  134

Query  503   IPSKSKNIIFGPQMSCKT---QNFLNHS-DSFGAAKSLPKNIPIFPCTEPKPFNLHNDSS  670
               S+S+NI+FG Q+       Q+ LN S DSF + +SLPK++   P  E K  +    +S
Sbjct  135   QSSESRNILFGSQLKVSIPSPQSHLNGSPDSFASPRSLPKSLLTLPHPEAKSPHFQMYNS  194

Query  671   YVLFGIGDAPL-EEGISSANMrsrsldsgrsgsHFASFASRKSNLH------SGSFGTEH  829
              ++FG G+     E +                  F+   S +++L       S    T+ 
Sbjct  195   EIVFGDGEMQFGVETVGKNRSCLSDSGRSSPSYDFSMSPSPQTSLTNAEDFCSDQKSTQL  254

Query  830   GINSAIS--QNVRE-LSK---LGNSSGAKLRSMPVPAGS-------ISTSKIELSEDYTC  970
             G  S IS  +N+   LSK   LGNS G K  S+P+  GS       +S S+IELSEDYTC
Sbjct  255   GSPSVISGEKNLDNCLSKKPSLGNSFGMKPSSLPISIGSGHEFMASLSASEIELSEDYTC  314

Query  971   VRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSF  1150
             V +HGPNP+ THIF DCILECH  E T+  K   E         C +    YPS+DFLSF
Sbjct  315   VISHGPNPRTTHIFGDCILECHTKESTSCKKEKLEIESPCVD-KCLDGPVMYPSNDFLSF  373

Query  1151  CYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEK-TNKGGDDFEKPNSREEPY  1324
             CY+CKKKLD  KDI++YRGEKAFCS  CRS+EILI+EE EK  N   +   +  S EE +
Sbjct  374   CYSCKKKLDEKKDIYMYRGEKAFCSFICRSQEILIEEEMEKNINNSSECSPESTSPEEIF  433

Query  1325  ESSLFIA  1345
              S + +A
Sbjct  434   LSGMVVA  440



>ref|XP_010254162.1| PREDICTED: uncharacterized protein LOC104595233 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010254163.1| PREDICTED: uncharacterized protein LOC104595233 isoform X3 [Nelumbo 
nucifera]
Length=428

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 256/427 (60%), Gaps = 30/427 (7%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSES  325
             MLRKR+RS QKDQ  G LMPD +SES   S V  QKHK SSFF VP LFVG   K  S+S
Sbjct  1     MLRKRSRSLQKDQYKGHLMPDCASESGFQSDVSEQKHKGSSFFRVPDLFVGFCSKGLSDS  60

Query  326   DSVRSPTSPLEFRVFSTLSNTLRSQRSS-EGHQKSWGCSKVGLSIIDALDDKTKRLGNLP  502
             +S RSPTSPL++RVFS + N  RS RS  +G QKSWGCSKVGLSI+D+L+D++K  G + 
Sbjct  61    ESARSPTSPLDYRVFSNIGNPFRSPRSCLDGRQKSWGCSKVGLSIVDSLNDESKPSGKVF  120

Query  503   IPSKSKNIIFGPQMSCKT---QNFLNHS-DSFGAAKSLPKNIPIFPCTEPKPFNLHNDSS  670
               S+S+NI+FG Q+       Q+ LN S DSF + +SLPK++   P  E K  +    +S
Sbjct  121   QSSESRNILFGSQLKVSIPSPQSHLNGSPDSFASPRSLPKSLLTLPHPEAKSPHFQMYNS  180

Query  671   YVLFGIGDAPL-EEGISSANMrsrsldsgrsgsHFASFASRKSNLH------SGSFGTEH  829
              ++FG G+     E +                  F+   S +++L       S    T+ 
Sbjct  181   EIVFGDGEMQFGVETVGKNRSCLSDSGRSSPSYDFSMSPSPQTSLTNAEDFCSDQKSTQL  240

Query  830   GINSAIS--QNVRE-LSK---LGNSSGAKLRSMPVPAGS-------ISTSKIELSEDYTC  970
             G  S IS  +N+   LSK   LGNS G K  S+P+  GS       +S S+IELSEDYTC
Sbjct  241   GSPSVISGEKNLDNCLSKKPSLGNSFGMKPSSLPISIGSGHEFMASLSASEIELSEDYTC  300

Query  971   VRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSF  1150
             V +HGPNP+ THIF DCILECH  E T+  K   E         C +    YPS+DFLSF
Sbjct  301   VISHGPNPRTTHIFGDCILECHTKESTSCKKEKLEIESPCVD-KCLDGPVMYPSNDFLSF  359

Query  1151  CYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEK-TNKGGDDFEKPNSREEPY  1324
             CY+CKKKLD  KDI++YRGEKAFCS  CRS+EILI+EE EK  N   +   +  S EE +
Sbjct  360   CYSCKKKLDEKKDIYMYRGEKAFCSFICRSQEILIEEEMEKNINNSSECSPESTSPEEIF  419

Query  1325  ESSLFIA  1345
              S + +A
Sbjct  420   LSGMVVA  426



>ref|XP_010254160.1| PREDICTED: uncharacterized protein LOC104595233 isoform X1 [Nelumbo 
nucifera]
Length=444

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 256/427 (60%), Gaps = 30/427 (7%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSES  325
             MLRKR+RS QKDQ  G LMPD +SES   S V  QKHK SSFF VP LFVG   K  S+S
Sbjct  17    MLRKRSRSLQKDQYKGHLMPDCASESGFQSDVSEQKHKGSSFFRVPDLFVGFCSKGLSDS  76

Query  326   DSVRSPTSPLEFRVFSTLSNTLRSQRSS-EGHQKSWGCSKVGLSIIDALDDKTKRLGNLP  502
             +S RSPTSPL++RVFS + N  RS RS  +G QKSWGCSKVGLSI+D+L+D++K  G + 
Sbjct  77    ESARSPTSPLDYRVFSNIGNPFRSPRSCLDGRQKSWGCSKVGLSIVDSLNDESKPSGKVF  136

Query  503   IPSKSKNIIFGPQMSCKT---QNFLNHS-DSFGAAKSLPKNIPIFPCTEPKPFNLHNDSS  670
               S+S+NI+FG Q+       Q+ LN S DSF + +SLPK++   P  E K  +    +S
Sbjct  137   QSSESRNILFGSQLKVSIPSPQSHLNGSPDSFASPRSLPKSLLTLPHPEAKSPHFQMYNS  196

Query  671   YVLFGIGDAPL-EEGISSANMrsrsldsgrsgsHFASFASRKSNLH------SGSFGTEH  829
              ++FG G+     E +                  F+   S +++L       S    T+ 
Sbjct  197   EIVFGDGEMQFGVETVGKNRSCLSDSGRSSPSYDFSMSPSPQTSLTNAEDFCSDQKSTQL  256

Query  830   GINSAIS--QNVRE-LSK---LGNSSGAKLRSMPVPAGS-------ISTSKIELSEDYTC  970
             G  S IS  +N+   LSK   LGNS G K  S+P+  GS       +S S+IELSEDYTC
Sbjct  257   GSPSVISGEKNLDNCLSKKPSLGNSFGMKPSSLPISIGSGHEFMASLSASEIELSEDYTC  316

Query  971   VRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSF  1150
             V +HGPNP+ THIF DCILECH  E T+  K   E         C +    YPS+DFLSF
Sbjct  317   VISHGPNPRTTHIFGDCILECHTKESTSCKKEKLEIESPCVD-KCLDGPVMYPSNDFLSF  375

Query  1151  CYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEK-TNKGGDDFEKPNSREEPY  1324
             CY+CKKKLD  KDI++YRGEKAFCS  CRS+EILI+EE EK  N   +   +  S EE +
Sbjct  376   CYSCKKKLDEKKDIYMYRGEKAFCSFICRSQEILIEEEMEKNINNSSECSPESTSPEEIF  435

Query  1325  ESSLFIA  1345
              S + +A
Sbjct  436   LSGMVVA  442



>ref|XP_009348445.1| PREDICTED: uncharacterized protein LOC103940093 [Pyrus x bretschneideri]
Length=398

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 213/415 (51%), Positives = 262/415 (63%), Gaps = 39/415 (9%)
 Frame = +2

Query  152   MLRKRTRS-QKDQ-QMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SE  322
             MLRKR+RS QKDQ QMG L     S++   S V     K SSFF+VP LFVGL+PK  S+
Sbjct  1     MLRKRSRSVQKDQHQMGHL---PISDAAAGSDVLGHNPKSSSFFSVPGLFVGLSPKGLSD  57

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGN  496
              D+VRSPTSPL+FRVFS L N  RS RS+   G Q+SWG SKVGLSIID+LDD  K  G 
Sbjct  58    CDAVRSPTSPLDFRVFSNLGNPYRSPRSNHDGGQQRSWGSSKVGLSIIDSLDD-VKSSGR  116

Query  497   LPIPSKSKNIIFGPQMSC----KTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHND  664
             +P  S+SKNI+FGP M      K Q+ +   DS  + KSLPKN  IFP ++ K   L   
Sbjct  117   VPRSSESKNILFGPGMRINKTPKPQSNVKPFDS--SPKSLPKNYAIFPHSKTKS-PLQKG  173

Query  665   SSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEH-----  829
             SS VLF IG+ P  E  S   +RS SLDSGR+ S  +  ++   N  SG F  E+     
Sbjct  174   SSDVLFEIGEPP-SEPESFGKIRSSSLDSGRAFSTLSGLSNLNPNSTSGIFCPENLTTHQ  232

Query  830   --GINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVT  1003
               G +  ++  ++  S +G+S+G          GS+S S+IELSEDYTCV +HG  PK T
Sbjct  233   FIGGSPNLATQMKTGS-IGSSNGF--------VGSLSASEIELSEDYTCVISHGAKPKKT  283

Query  1004  HIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFS-YPSSDFLSFCYTCKKKL-D  1177
             HIF DCILECH+ +  NF KN E+E G + GPG   ++F  YP  +FLSFCY C KKL +
Sbjct  284   HIFGDCILECHSEDANNFGKNEEKEIGFT-GPGPSLDNFGHYPLDNFLSFCYYCNKKLEE  342

Query  1178  GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKP-NSREEPYESSLF  1339
             GKDI+IYRGEKAFCS SCRSEEILIDE  EK N      EKP  S EE +E+ + 
Sbjct  343   GKDIYIYRGEKAFCSLSCRSEEILIDEALEKCND--QSSEKPLESDEELFETGML  395



>gb|KDP34236.1| hypothetical protein JCGZ_07807 [Jatropha curcas]
Length=407

 Score =   290 bits (742),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 261/420 (62%), Gaps = 36/420 (9%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSE  322
             MLRKRTRS QKDQQMG L M D  SES++ S      HK +SFF+VP LFVG  PK  S+
Sbjct  1     MLRKRTRSHQKDQQMGPLTMSDPDSESYIQSDSIGNSHKTNSFFSVPGLFVGSTPKGLSD  60

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSS---EGHQKSWGCSKVGLSIIDALDD-KTKRL  490
              DSVRSPTSPL+FRVFS L N  RS RSS   + +QKSW CSKVGLSI+++LDD + K  
Sbjct  61    CDSVRSPTSPLDFRVFSNLGNPHRSPRSSHIGQQNQKSWDCSKVGLSIVNSLDDDEMKHS  120

Query  491   GNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSS  670
             G +   S+SKNI+FG ++  KT NF  + +SF A KSLP+N  I P T P    L   SS
Sbjct  121   GKVLRSSESKNILFGQKVRIKTPNFQPNVNSFEAPKSLPRNFAISPHT-PIKSPLPKGSS  179

Query  671   YVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAIS  850
              V+F IG+A L E      +RS SLDS +S S  +  A R SNL SG+      +N+  +
Sbjct  180   DVVFEIGEA-LSEPEQYGKIRSCSLDSCKSFSTLSRLADRNSNLSSGN----SHLNNLTT  234

Query  851   QNVRELSKLGNSSGAK------LRSMPVPAGS-------ISTSKIELSEDYTCVRTHGPN  991
             +    L   G S  +       L   P+P GS       +S S+IE SEDYTCV +HGPN
Sbjct  235   RANSPLQFSGVSPNSNKSLHMDLNLAPMPVGSASGYIASLSASEIENSEDYTCVISHGPN  294

Query  992   PKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKK  1171
             PK THI+ DCILEC+++E         +E G+ +         ++P +DFL+FCY C KK
Sbjct  295   PKKTHIYGDCILECYSDE--------GKEIGIPQAITSSAIPRTFPLNDFLNFCYHCSKK  346

Query  1172  LD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT-NKGGDDFEKPNSREEPYESSLFIA  1345
             L+ GKDI+IYRGEKAFCS SCRSEEI+ DEE EK  NK  D+    ++ EE +E+ +F A
Sbjct  347   LEGGKDIYIYRGEKAFCSLSCRSEEIMNDEEMEKAINKCSDESPIFDNGEELFENGIFDA  406



>ref|XP_007227718.1| hypothetical protein PRUPE_ppa006815mg [Prunus persica]
 gb|EMJ28917.1| hypothetical protein PRUPE_ppa006815mg [Prunus persica]
Length=394

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 210/412 (51%), Positives = 260/412 (63%), Gaps = 37/412 (9%)
 Frame = +2

Query  152   MLRKRTRS-QKDQ-QMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-S  319
             MLRKR+RS QKDQ QMG L + D+ S+      V     K +SFF+VP LFVGL+ K   
Sbjct  1     MLRKRSRSIQKDQHQMGHLPIADAGSD------VLGHNPKSNSFFSVPGLFVGLSSKGLI  54

Query  320   ESDSVRSPTSPLEFRVFSTLSNTLRSQRS-SEGHQKSWGCSKVGLSIIDALDDKTKRLGN  496
             +SDSVRSPTSPL+FRVFS L N  RS RS S+G Q+SWG SKVGLSIID+ DD  K  G 
Sbjct  55    DSDSVRSPTSPLDFRVFSNLGNPFRSPRSNSDGQQRSWGSSKVGLSIIDSFDDDVKFSGK  114

Query  497   LPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYV  676
             +P  S+SKNI+FGP M  KT +  ++++SF + KSLPKN  +FP ++ K   L   SS V
Sbjct  115   VPRSSESKNILFGPGMRIKTPDSQSNTNSFASPKSLPKNYAVFPHSKIKS-PLEKGSSDV  173

Query  677   LFGIGDAPLEE----GISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGI---  835
             LF IG++P E      I S ++ S    S  SG    +  S   N   GS  T+  I   
Sbjct  174   LFEIGESPTEPESFGKIRSCSLDSGRAFSTLSGLSNLNPNSTSGNFCMGSLTTQPFIGGS  233

Query  836   -NSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIF  1012
              N A   N      +G+S+G          GS+S S+IELSEDYTCV +HG NPK THIF
Sbjct  234   PNLATQMNT---GSIGSSNGL--------VGSLSASEIELSEDYTCVISHGANPKKTHIF  282

Query  1013  CDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHF-SYPSSDFLSFCYTCKKKL-DGKD  1186
              DCIL CH+N+ +NF KN  +E G ++ PG    +F  YPS++FLSFCY C KKL +GKD
Sbjct  283   GDCILGCHSNDLSNFGKNEGKEIGFAR-PGTSLGNFVQYPSNNFLSFCYYCNKKLEEGKD  341

Query  1187  IFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKP-NSREEPYESSLF  1339
             I+IYRGEKAFCS SCRSEEILIDEE EK N      EKP  S EE +E+ + 
Sbjct  342   IYIYRGEKAFCSLSCRSEEILIDEELEKCND--QSSEKPLESDEELFETGII  391



>ref|XP_008219834.1| PREDICTED: uncharacterized protein LOC103320008 [Prunus mume]
Length=394

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 210/404 (52%), Positives = 262/404 (65%), Gaps = 21/404 (5%)
 Frame = +2

Query  152   MLRKRTRS-QKDQ-QMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-S  319
             MLRKR+RS QKDQ QMG L + D+ S+      V     K +SFF+VP LFVGL+ K   
Sbjct  1     MLRKRSRSIQKDQHQMGHLPIADAGSD------VLGHNPKSNSFFSVPGLFVGLSSKGLI  54

Query  320   ESDSVRSPTSPLEFRVFSTLSNTLRSQRS-SEGHQKSWGCSKVGLSIIDALDDKTKRLGN  496
             +SDSVRSPTSPL+FRVFS L N  RS RS S+G Q+SWG SKVGLSIID+ DD  K  G 
Sbjct  55    DSDSVRSPTSPLDFRVFSNLGNPFRSPRSNSDGQQRSWGSSKVGLSIIDSFDDDVKFSGK  114

Query  497   LPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYV  676
             +P  S+SKNI+FGP M  KT +  ++++SF + KSLPKN  +FP ++ K   L   SS V
Sbjct  115   VPRSSESKNILFGPGMRIKTPDSQSNTNSFASPKSLPKNYAVFPHSKIKS-PLEKGSSDV  173

Query  677   LFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQN  856
             LF IG++P E   S   +RS SLDSGR+ S  +  ++   N  SG+F  E          
Sbjct  174   LFEIGESPTEPE-SFGKIRSCSLDSGRAFSTLSGLSNLNPNSTSGNFCMESLTTQPFIGG  232

Query  857   VRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECH  1036
                L+   N+    + S     GS+S S+IELSEDYTCV +HG NPK THIF DCIL CH
Sbjct  233   SPNLATQMNT--GSIGSSNGLVGSLSASEIELSEDYTCVISHGANPKKTHIFGDCILGCH  290

Query  1037  NNEFTNFSKNGEEENGLSKGPGCCEEHF-SYPSSDFLSFCYTCKKKL-DGKDIFIYRGEK  1210
             +N+ +NF KN  +E G ++ PG    +F  YPS++FLSFCY C KKL +GKDI+IYRGEK
Sbjct  291   SNDLSNFGKNEGKEIGFAR-PGTSLGNFVQYPSNNFLSFCYYCNKKLEEGKDIYIYRGEK  349

Query  1211  AFCSSSCRSEEILIDEEKEKTNKGGDDFEKP-NSREEPYESSLF  1339
             AFCS SCRSEEILIDEE EK N      EKP  S EE +E+ + 
Sbjct  350   AFCSLSCRSEEILIDEELEKCND--QSSEKPLESDEELFETGII  391



>ref|XP_010249804.1| PREDICTED: uncharacterized protein LOC104592250 [Nelumbo nucifera]
 ref|XP_010249805.1| PREDICTED: uncharacterized protein LOC104592250 [Nelumbo nucifera]
 ref|XP_010249806.1| PREDICTED: uncharacterized protein LOC104592250 [Nelumbo nucifera]
Length=411

 Score =   288 bits (737),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 184/393 (47%), Positives = 231/393 (59%), Gaps = 35/393 (9%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SES  325
             MLRKR+RS QKDQ    +MPD +SES   S V  QKHK SSFF+VP LFVG   K  S+S
Sbjct  1     MLRKRSRSLQKDQSKSHIMPDCASESGFQSDVSGQKHKGSSFFSVPGLFVGFGSKGLSDS  60

Query  326   DSVRSPTSPLEFRVFSTLSNTLRSQRS-SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLP  502
             +S RSPTSPL++R+FS L N  RS RS S+G QKSW CSKVGLSI+D+L+D++K  G + 
Sbjct  61    ESARSPTSPLDYRIFSGLGNPFRSPRSCSDGPQKSWDCSKVGLSIVDSLNDESKPSGKVL  120

Query  503   IPSKSKNIIFGPQMSCKTQNFLNH----SDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSS  670
               S+SK+I+FG QM     +   H     DS  A +SLPK+    P         H    
Sbjct  121   RSSESKSILFGSQMKMNIPSPRRHLEGSVDSIVAPRSLPKSFVPLP---------HTLIK  171

Query  671   YVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGS--------FGTE  826
               L  I   P++  I                  F+   S  +NL +G+        +  +
Sbjct  172   IPLIEIQLEPMQ--IGKVRSCLSDSGRSSPPWDFSRSPSPLTNLANGNINSNVKDIWAEQ  229

Query  827   HGINSAISQNVRELSKLGNSSGAKLRSMPVP-------AGSISTSKIELSEDYTCVRTHG  985
               I S     +  +  L NS G K  S+P+         GS+S S IELSEDYTCV +HG
Sbjct  230   KTIQSGSPPIISGVPNLDNSLGMKPSSLPISIGSGHGFMGSLSASDIELSEDYTCVISHG  289

Query  986   PNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCK  1165
             PNP+ THIF DCILECH N+  N SK  E+  G  +     +    YPS+DFLSFCY+CK
Sbjct  290   PNPRTTHIFGDCILECHINDLINCSKK-EQGIGSPRVEKRSDGSVPYPSNDFLSFCYSCK  348

Query  1166  KKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
             KKLD GKDIF+YRGEKAFCSSSCRS+EIL++EE
Sbjct  349   KKLDEGKDIFMYRGEKAFCSSSCRSQEILVEEE  381



>ref|XP_006450586.1| hypothetical protein CICLE_v10008522mg [Citrus clementina]
 gb|ESR63826.1| hypothetical protein CICLE_v10008522mg [Citrus clementina]
Length=399

 Score =   286 bits (733),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 194/385 (50%), Positives = 239/385 (62%), Gaps = 23/385 (6%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSE  322
             MLRKRTRS +K+QQM  L  P+S +ES  +S    +  K +S FNVP LFVGL+PK  S+
Sbjct  1     MLRKRTRSVEKEQQMSHLKTPESVAESFFNS----ENLKGNSLFNVPGLFVGLSPKGLSD  56

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQ-KSWGCSKVGLSIIDALDDKTKRLGNL  499
             +DSVRSPTSPL+FR FS L N+ RS +S+   Q KSW  SKVGLSIID+L +  K    +
Sbjct  57    TDSVRSPTSPLDFRAFSNLGNSFRSPKSAHYEQHKSWDTSKVGLSIIDSLRNDMKPSSKV  116

Query  500   PIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVL  679
              + S+SKNIIFGPQM  KT N   + +SF A KSLPKN  IFPCT+ K   L   +S V+
Sbjct  117   -LRSESKNIIFGPQMRIKTPNSQTNINSFDAPKSLPKNYAIFPCTQIKSL-LQTGNSDVV  174

Query  680   FGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEH-GINSAISQN  856
               IG+ P EE       RS SLDS RS    A F    S + S +FG E      +    
Sbjct  175   LEIGETPFEEHEPFGKTRSCSLDSCRSFPVLAGFTDCGSIMSSENFGFEKLACQESSPLM  234

Query  857   VRELSKLGNSSGAKLRSMPVPAGS-------ISTSKIELSEDYTCVRTHGPNPKVTHIFC  1015
             V    +  N S +K+  M    GS       +S S+IELSEDYT V +HGPNP+ THI+ 
Sbjct  235   VGGSPRSNNFSDSKVNLMSTSIGSGNGFTESLSASEIELSEDYTRVVSHGPNPRTTHIYG  294

Query  1016  DCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFI  1195
             DCILEC  N+ ++  KN  E +      G       YPS DFLSFC +C KKL+GKDI+I
Sbjct  295   DCILECRTNDQSDDYKNEAEGSD-----GVMIITTQYPSDDFLSFCCSCNKKLEGKDIYI  349

Query  1196  YRGEKAFCSSSCRSEEILIDEEKEK  1270
             YRGEKAFCS+ CRS+EILIDEE EK
Sbjct  350   YRGEKAFCSADCRSQEILIDEEMEK  374



>ref|XP_006476169.1| PREDICTED: uncharacterized protein LOC102623549 [Citrus sinensis]
 gb|KDO79677.1| hypothetical protein CISIN_1g015829mg [Citrus sinensis]
 gb|KDO79678.1| hypothetical protein CISIN_1g015829mg [Citrus sinensis]
Length=399

 Score =   283 bits (723),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 193/385 (50%), Positives = 239/385 (62%), Gaps = 23/385 (6%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSE  322
             MLRKRTRS +K+QQM  L  P+S +ES  +S    +    +S FNVP LFVGL+PK  S+
Sbjct  1     MLRKRTRSVEKEQQMSHLKTPESVAESFFNS----ENLTGNSLFNVPGLFVGLSPKGLSD  56

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQ-KSWGCSKVGLSIIDALDDKTKRLGNL  499
             +DSVRSPTSPL+FR FS L N+ RS +S+   Q KSW  SKVGLSIID+L +  K    +
Sbjct  57    TDSVRSPTSPLDFRAFSNLGNSFRSPKSAHYEQHKSWDTSKVGLSIIDSLRNDMKPSSKV  116

Query  500   PIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVL  679
              + S+SKNIIFGPQM  KT N   + +SF A KSLPKN  IFPCT+ K   L   +S V+
Sbjct  117   -LRSESKNIIFGPQMRIKTPNSQTNINSFDAPKSLPKNYAIFPCTQIKSL-LQKGNSDVV  174

Query  680   FGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV  859
               IG+ P EE       RS SLDS RS    A F    S + S +FG E       S  +
Sbjct  175   LEIGETPFEEHEPFGKTRSCSLDSCRSFPALAGFTDCGSIMSSENFGFEKLACQESSPLM  234

Query  860   RELSKLGNS---SGAKLRSMPVPAG-----SISTSKIELSEDYTCVRTHGPNPKVTHIFC  1015
                S   N+   S   L S  + +G     S+S S+IELSEDYT V +HGPNP+ THI+ 
Sbjct  235   VGGSPRSNNFLDSKVNLMSTSIGSGNGFTESLSASEIELSEDYTRVVSHGPNPRTTHIYG  294

Query  1016  DCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFI  1195
             DCILEC  N+ ++  KN  E +      G       YPS DFLSFC +C KKL+GKDI+I
Sbjct  295   DCILECRTNDQSDDYKNEAEGSD-----GVMIITTQYPSDDFLSFCCSCNKKLEGKDIYI  349

Query  1196  YRGEKAFCSSSCRSEEILIDEEKEK  1270
             YRGEKAFCS+ CR++EILIDEE EK
Sbjct  350   YRGEKAFCSADCRAQEILIDEEMEK  374



>ref|XP_002516598.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45939.1| conserved hypothetical protein [Ricinus communis]
Length=435

 Score =   282 bits (722),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 204/425 (48%), Positives = 262/425 (62%), Gaps = 38/425 (9%)
 Frame = +2

Query  143   LRTMLRKRTRS-QKDQQMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-  313
             L  MLRKRTRS QKDQQMG L M DS S+ +  S      HK +SFFNVP LFVGL+PK 
Sbjct  24    LGVMLRKRTRSLQKDQQMGPLTMSDSGSQFNSQSDCLGYNHKRTSFFNVPGLFVGLSPKG  83

Query  314   QSESDSVRSPTSPLEFRVFSTLSNT-LRSQRSSE-GHQKSWGCSKVGLSIIDALDDK---  478
              S+ DSVRSPTSPL+ R+FS L N+  RS RSS+ GHQKSW CSKVGLSI+++LDD+   
Sbjct  84    MSDCDSVRSPTSPLDLRLFSNLGNSSYRSPRSSQNGHQKSWDCSKVGLSIVNSLDDEDDD  143

Query  479   TKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLH  658
             TK  G +   S+SKNI+FG ++  KT  F  +++SF A KSLP+N  I P +  K  +L 
Sbjct  144   TKVSGKVLRSSESKNILFGQKVRIKTPTFQVNANSFEAPKSLPRNFAILPHSYTKS-SLQ  202

Query  659   NDSSYVLFGIGDAPLEE----GISSANMrsrsldsgrsgsHFASFASRKSNLHSGSF---  817
                S V+F IG+AP E      I S ++ S    S       +  A+R SN+  G+F   
Sbjct  203   KGCSKVIFEIGEAPTEPEHFGKIRSCSLDSCKSFST-----LSRLANRNSNVICGNFPLN  257

Query  818   GTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPA-----GSISTSKIELSEDYTCVRTH  982
                 G +S +  +     +  NS    L   P  +     GS+S S+IELSEDYTCV +H
Sbjct  258   NVATGTSSPLQFSGGSPPQSNNSLHMDLNLPPAGSTSGFVGSLSASEIELSEDYTCVISH  317

Query  983   GPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTC  1162
             GPN K THI+ DC+LEC++NE           + +   P        +PS+DFL+FCY C
Sbjct  318   GPNAKKTHIYGDCVLECYSNEGKEIRMPQAITSSIIPSP--------FPSNDFLNFCYYC  369

Query  1163  KKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEK-TNKGGDDFEKP--NSREEPYES  1330
              ++LD GKDI+IYRGEKAFCS SCRSEEI+IDEE EK TNK  D+ E P  ++ EE YE+
Sbjct  370   NRRLDGGKDIYIYRGEKAFCSLSCRSEEIMIDEEMEKTTNKTCDEPEPPKCDNGEELYEN  429

Query  1331  SLFIA  1345
              +F A
Sbjct  430   GIFDA  434



>ref|XP_004291408.1| PREDICTED: uncharacterized protein LOC101296169 [Fragaria vesca 
subsp. vesca]
Length=403

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 194/405 (48%), Positives = 253/405 (62%), Gaps = 30/405 (7%)
 Frame = +2

Query  152   MLRKRTRS-QKDQ---QMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNP-K  313
             MLRKRTRS QKDQ   QMG L + ++ SESH  S V     K + FF +P LFVGL P  
Sbjct  1     MLRKRTRSTQKDQDQHQMGHLPISNTGSESHFRSDVLGPNPKSNPFFTIPGLFVGLGPIG  60

Query  314   QSESDSVRSPTSPLEFRVFSTLSNTLRSQRSS-EGHQKSWGCSKVGLSIIDALDDKTKRL  490
              ++SDS+RSPTSPL+FRVFS L +  RS RS  +GH++SWG SKVGLSIID+ DD  K  
Sbjct  61    LTDSDSIRSPTSPLDFRVFSNLGSPFRSPRSPLDGHKRSWGSSKVGLSIIDSFDDDVKCS  120

Query  491   GNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSS  670
             G +P  S+SKNI+FGP M  KT++  ++++S G+ +SLPKN  IFP ++ K   L   SS
Sbjct  121   GKVPRSSESKNILFGPGMRIKTRDSRSNTNSIGSPRSLPKNYAIFPHSKVKS-PLQESSS  179

Query  671   YVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAI-  847
              V+F IG+ P  E  S   +RS S DS R+ S  +  +    N  + +F  E+  N    
Sbjct  180   DVVFEIGETP-SEPESFGKIRSCSFDSARTFSTLSGLSKLNPN-STRNFCLENVTNPQFI  237

Query  848   --SQNVRELSKLGNS-SGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCD  1018
               S N   L  +G++ SG +        GS+S S+IELSEDYTCV +HG NPK THIF D
Sbjct  238   GGSPNSATLMNVGSTGSGNEF------VGSLSASEIELSEDYTCVISHGANPKTTHIFGD  291

Query  1019  CILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFI  1195
             CIL CH+ + +   +N ++  G  +          YPS++FLSFC+ C K+L +GKDI+I
Sbjct  292   CIL-CHSEDLSKSFENEKKGIGSPQLATSLGSFVQYPSNNFLSFCHYCNKELEEGKDIYI  350

Query  1196  YRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYES  1330
             YRGEKAFCS SCRS EIL DEE E  N      ++P+  EEP ES
Sbjct  351   YRGEKAFCSLSCRSVEILNDEELEMCN------DEPS--EEPLES  387



>gb|EYU21898.1| hypothetical protein MIMGU_mgv1a023680mg [Erythranthe guttata]
Length=372

 Score =   273 bits (698),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 184/406 (45%), Positives = 230/406 (57%), Gaps = 55/406 (14%)
 Frame = +2

Query  191   MGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESDSVRSPTSPLEFRVF  370
             M  LMPDS SES+  S    QKHK  +F   P LFVG NPK SESDSVRSPTSPL+FR+F
Sbjct  1     MNNLMPDSVSESYFHSDTSTQKHKNDTFTKAPGLFVGFNPKSSESDSVRSPTSPLDFRIF  60

Query  371   STLSNTLRSQRS-SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             S L N  R  ++ +EG  KSWGCSKVGLSIID+LD++TK+ G    PS++KNI+FG Q++
Sbjct  61    SGLGNPFRCPKTQNEGCVKSWGCSKVGLSIIDSLDNETKQAGEFNRPSENKNILFGRQVN  120

Query  548   CKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSAN  727
                  F +H  +     SLPK++  F     K  N+    S V+F IG+AP E     +N
Sbjct  121   IPCPIFCSHEKT----NSLPKDVAAF----SKRANVRKGDSNVVFEIGEAPFE---PESN  169

Query  728   MrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRS  907
               +R+     SG +  +F +RKS   SG+              VRE       +   +  
Sbjct  170   GATRACSMDSSGRYLKNFGNRKSRFGSGNL-------------VRENVN---VNVNVMNP  213

Query  908   MPVPAG-SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENG  1084
              P+ +G  I  S+IELSEDYTCV THGPNPKVTHI+ DCILE H +E   F K       
Sbjct  214   TPLESGFIIPASEIELSEDYTCVITHGPNPKVTHIYGDCILERHKDENFEFFKK------  267

Query  1085  LSKGPGCC-----EEHFSY------------PSSDFLSFCYTCKKKLDGKDIFIYRGEKA  1213
             +  G GC      EE   +               DFL FCY+C K LDG+DI++YRGEKA
Sbjct  268   IDDGRGCILERQKEEKIEFFKKIEDGGASNPLDDDFLKFCYSCHKNLDGEDIYMYRGEKA  327

Query  1214  FCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREE-PYESSLFIAT  1348
             FCSS+CRS EI  DE+ EK N   D  E  +S EE    SSLFI  
Sbjct  328   FCSSNCRSLEIENDEKTEKANT--DSSEISDSCEEFSGSSSLFITA  371



>ref|XP_007024099.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 5 
[Theobroma cacao]
 gb|EOY26721.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 5 
[Theobroma cacao]
Length=403

 Score =   264 bits (675),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 223/377 (59%), Gaps = 30/377 (8%)
 Frame = +2

Query  194   GQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVF  370
             G +M D  SES+  S     +H  SS FN+P   VG + K  S+SD VRSPTSPL+ RVF
Sbjct  3     GNVMADPDSESYFQSDTLGLRHISSSLFNIPGFLVGFSTKGSSDSDMVRSPTSPLDLRVF  62

Query  371   STLSN--TLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGP  538
             +  SN  ++RS RSS   G+QK W CSK+GL I++ L D+ K  G      K KNIIFGP
Sbjct  63    ANFSNPFSVRSPRSSSQSGYQKKWDCSKMGLGIVNLLADEIKSDGEDLDSPKRKNIIFGP  122

Query  539   QMSCKTQNFLNHSDSF----GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLE  706
             Q+  K  +   +S  F      + SLP+N  I   ++ +  N ++  S ++FG  + PLE
Sbjct  123   QVKTKFPSSSRYSHEFLGNSMKSNSLPRNYIISQLSKDRKPNTNSGGSSLVFGNEEVPLE  182

Query  707   EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV---RELSKL  877
                 S+ +    +            +++  NL S SF +E+G  S  S ++   R L ++
Sbjct  183   PKSDSSRLSPSFIA-----------STKNCNLSSRSFCSENGTTSLNSSSLPIGRAL-QV  230

Query  878   GNSSGAKLRSMPVPAG----SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
              +S  +K  S+P+P G    S+S  +IELSEDYTC+ +HGPNPK THIF DCILECHN E
Sbjct  231   DDSLLSKPSSLPIPVGHSIGSLSAHEIELSEDYTCIISHGPNPKTTHIFGDCILECHNTE  290

Query  1046  FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCS  1222
              TNF K  E E  +S+     E    YPS +FLSFCY+C+KKL+  +DI++YRGEKAFCS
Sbjct  291   LTNFDKKAEPETKVSQLDKSPETSTPYPSDEFLSFCYSCQKKLEKDEDIYMYRGEKAFCS  350

Query  1223  SSCRSEEILIDEEKEKT  1273
               CRSEEI   EE EKT
Sbjct  351   FDCRSEEIFA-EEMEKT  366



>ref|XP_007024096.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 2 
[Theobroma cacao]
 gb|EOY26718.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 2 
[Theobroma cacao]
Length=394

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 223/377 (59%), Gaps = 30/377 (8%)
 Frame = +2

Query  194   GQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVF  370
             G +M D  SES+  S     +H  SS FN+P   VG + K  S+SD VRSPTSPL+ RVF
Sbjct  3     GNVMADPDSESYFQSDTLGLRHISSSLFNIPGFLVGFSTKGSSDSDMVRSPTSPLDLRVF  62

Query  371   STLSN--TLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGP  538
             +  SN  ++RS RSS   G+QK W CSK+GL I++ L D+ K  G      K KNIIFGP
Sbjct  63    ANFSNPFSVRSPRSSSQSGYQKKWDCSKMGLGIVNLLADEIKSDGEDLDSPKRKNIIFGP  122

Query  539   QMSCKTQNFLNHSDSF----GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLE  706
             Q+  K  +   +S  F      + SLP+N  I   ++ +  N ++  S ++FG  + PLE
Sbjct  123   QVKTKFPSSSRYSHEFLGNSMKSNSLPRNYIISQLSKDRKPNTNSGGSSLVFGNEEVPLE  182

Query  707   EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV---RELSKL  877
                 S+ +    +            +++  NL S SF +E+G  S  S ++   R L ++
Sbjct  183   PKSDSSRLSPSFIA-----------STKNCNLSSRSFCSENGTTSLNSSSLPIGRAL-QV  230

Query  878   GNSSGAKLRSMPVPAG----SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
              +S  +K  S+P+P G    S+S  +IELSEDYTC+ +HGPNPK THIF DCILECHN E
Sbjct  231   DDSLLSKPSSLPIPVGHSIGSLSAHEIELSEDYTCIISHGPNPKTTHIFGDCILECHNTE  290

Query  1046  FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCS  1222
              TNF K  E E  +S+     E    YPS +FLSFCY+C+KKL+  +DI++YRGEKAFCS
Sbjct  291   LTNFDKKAEPETKVSQLDKSPETSTPYPSDEFLSFCYSCQKKLEKDEDIYMYRGEKAFCS  350

Query  1223  SSCRSEEILIDEEKEKT  1273
               CRSEEI   EE EKT
Sbjct  351   FDCRSEEIFA-EEMEKT  366



>ref|XP_007024097.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 3 
[Theobroma cacao]
 gb|EOY26719.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 3 
[Theobroma cacao]
Length=404

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 223/377 (59%), Gaps = 30/377 (8%)
 Frame = +2

Query  194   GQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVF  370
             G +M D  SES+  S     +H  SS FN+P   VG + K  S+SD VRSPTSPL+ RVF
Sbjct  3     GNVMADPDSESYFQSDTLGLRHISSSLFNIPGFLVGFSTKGSSDSDMVRSPTSPLDLRVF  62

Query  371   STLSN--TLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGP  538
             +  SN  ++RS RSS   G+QK W CSK+GL I++ L D+ K  G      K KNIIFGP
Sbjct  63    ANFSNPFSVRSPRSSSQSGYQKKWDCSKMGLGIVNLLADEIKSDGEDLDSPKRKNIIFGP  122

Query  539   QMSCKTQNFLNHSDSF----GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLE  706
             Q+  K  +   +S  F      + SLP+N  I   ++ +  N ++  S ++FG  + PLE
Sbjct  123   QVKTKFPSSSRYSHEFLGNSMKSNSLPRNYIISQLSKDRKPNTNSGGSSLVFGNEEVPLE  182

Query  707   EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV---RELSKL  877
                 S+ +    +            +++  NL S SF +E+G  S  S ++   R L ++
Sbjct  183   PKSDSSRLSPSFIA-----------STKNCNLSSRSFCSENGTTSLNSSSLPIGRAL-QV  230

Query  878   GNSSGAKLRSMPVPAG----SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
              +S  +K  S+P+P G    S+S  +IELSEDYTC+ +HGPNPK THIF DCILECHN E
Sbjct  231   DDSLLSKPSSLPIPVGHSIGSLSAHEIELSEDYTCIISHGPNPKTTHIFGDCILECHNTE  290

Query  1046  FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCS  1222
              TNF K  E E  +S+     E    YPS +FLSFCY+C+KKL+  +DI++YRGEKAFCS
Sbjct  291   LTNFDKKAEPETKVSQLDKSPETSTPYPSDEFLSFCYSCQKKLEKDEDIYMYRGEKAFCS  350

Query  1223  SSCRSEEILIDEEKEKT  1273
               CRSEEI   EE EKT
Sbjct  351   FDCRSEEIFA-EEMEKT  366



>ref|XP_010670779.1| PREDICTED: uncharacterized protein LOC104887750 [Beta vulgaris 
subsp. vulgaris]
Length=424

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 192/438 (44%), Positives = 248/438 (57%), Gaps = 55/438 (13%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSES  325
             ML+KR+RS  KDQQMGQ+  D  SE++L S V  Q+ K +SFFNVP LFVGL P+  S+ 
Sbjct  1     MLKKRSRSIPKDQQMGQITSDGGSETNLQSDVLGQRQKTNSFFNVPGLFVGLTPRGASDC  60

Query  326   DSVRSPTSPLEFRVFSTLSNTLRSQRSS-EGHQKSWGCSKVGL-SIIDALDDKTKRLGNL  499
             DSVRSPTSPL+F++F     + R  +SS EG  K W C KVGL SI+D+LDD  +   N 
Sbjct  61    DSVRSPTSPLDFKLFCNFGCSFRFPKSSQEGTHKCWECHKVGLGSIVDSLDDHDEI--NQ  118

Query  500   PIPSK------SKNIIFGPQMSCK-TQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLH  658
             P+  K      S+ I+FG Q+  K + N  NH +   A KSLPKN  IFP    KP NL 
Sbjct  119   PVKDKVMASSNSRIILFGSQIRSKGSPNSPNHGNICEAPKSLPKNYAIFPNARLKPSNLQ  178

Query  659   NDSSYVLFGIGDAPLE-----EGISSANMrsrsldsgrsgsHFASFAS--RKSNLHSGSF  817
               SS VLF IG  PLE     E I S+++ SR L S        +  S  ++S    G  
Sbjct  179   EGSSDVLFEIGGDPLECDDPCEKIQSSSLDSRRLGSEICRLRTRNVESSTKRSCFEKGKG  238

Query  818   GTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAG-----SISTSKIELSEDYTCVRTH  982
                +G +S + +       L   +   + SMP  +G     S++  +IELSEDYTCV +H
Sbjct  239   TIGNGSSSDLVE-----GNLNTENELTIGSMPSGSGNDIARSLTPEEIELSEDYTCVISH  293

Query  983   GPNPKVTHIFCDCILECHNNEFTNFSKNGE-------EENGLSKGPGCCEEHFSYPSSDF  1141
             GPNPK THIF DC+LE H NE    +K           EN L K P        YPS+DF
Sbjct  294   GPNPKKTHIFGDCVLERHPNEIDLGNKRESFETIRPCLENSLQKSP-----LSPYPSNDF  348

Query  1142  LSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCR---------SEEILIDEEKEKTNKGGDD  1291
             LS CY CKKKL +G+DIF+YRGEKAFCS  CR          E+ +ID   E +N GG  
Sbjct  349   LSSCYFCKKKLEEGQDIFMYRGEKAFCSWDCRLEEISIEEEQEKSIIDAPGESSNNGG--  406

Query  1292  FEKPNSREEPYESSLFIA  1345
              E  N+ ++ +E ++F+A
Sbjct  407   -ESSNNGDDIFEKNIFVA  423



>ref|XP_008378282.1| PREDICTED: uncharacterized protein LOC103441384 [Malus domestica]
 ref|XP_008357492.1| PREDICTED: uncharacterized protein LOC103421244 [Malus domestica]
Length=398

 Score =   261 bits (667),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 206/409 (50%), Positives = 252/409 (62%), Gaps = 27/409 (7%)
 Frame = +2

Query  152   MLRKRTRS-QKDQ-QMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SE  322
             MLRKR+RS QKDQ QMG+L     S++   S V     K +SFF+VP LFVGL+ K  S+
Sbjct  1     MLRKRSRSVQKDQHQMGRL---PISDAAAGSDVLGHNPKSNSFFSVPGLFVGLSTKGLSD  57

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGN  496
              D+VRSPTSPL+FRVFS L    RS RS++  G Q+SWG SKVGLSIID++DD  K  G 
Sbjct  58    YDAVRSPTSPLDFRVFSNLGYPFRSPRSNQDGGQQRSWGSSKVGLSIIDSIDD-VKFFGK  116

Query  497   LPIPSKSKNIIFGPQMSC-KTQNFLNHSDSFG-AAKSLPKNIPIFPCTEPKPFNLHNDSS  670
             +P  S+SKNI+FGP M   K     +++  F  + KSLPKN  I P ++ K       SS
Sbjct  117   VPQSSESKNILFGPGMRINKIPEPQSNAKCFDYSPKSLPKNYAISPHSKIKS-PXQKGSS  175

Query  671   YVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAI-  847
              VLF IG+AP  E  S   +RS SLDSGR+ S  +  ++   N  SG F  E+       
Sbjct  176   DVLFEIGEAP-SEPESFGKIRSCSLDSGRAFSTLSGLSNLNPNSTSGGFCPENLTTXQFI  234

Query  848   --SQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDC  1021
               S N+    K G+     + S     GS+S S+IELSEDYTCV +HG NPK THIF DC
Sbjct  235   GGSPNLATQMKTGS-----IESSNGFVGSLSASEIELSEDYTCVISHGANPKKTHIFGDC  289

Query  1022  ILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIY  1198
             ILECH+ +  NF KN E+E G +      E    YPS +FLSFCY C KKL +GKDI+IY
Sbjct  290   ILECHSEDVNNFGKNVEKEIGFAHXGSSLENFGHYPSDNFLSFCYYCNKKLEEGKDIYIY  349

Query  1199  RGEKAFCSSSCRSEEILIDEEKEKTNK--GGDDFEKPNSREEPYESSLF  1339
             RGEKAFCS SCRSEEILIDEE EK N    G   E   S EE +E+ L 
Sbjct  350   RGEKAFCSLSCRSEEILIDEELEKCNDQSSGKPLE---SDEELFETGLL  395



>ref|XP_009377372.1| PREDICTED: uncharacterized protein LOC103965985 [Pyrus x bretschneideri]
Length=398

 Score =   261 bits (666),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 210/410 (51%), Positives = 254/410 (62%), Gaps = 29/410 (7%)
 Frame = +2

Query  152   MLRKRTRS-QKDQ-QMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SE  322
             MLRKR+RS QKDQ QMG L     S++   S V     K +SFF+VP LFVGL+ K  S+
Sbjct  1     MLRKRSRSVQKDQHQMGHL---PISDAAAGSDVLGHNPKSNSFFSVPGLFVGLSHKGLSD  57

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGN  496
              D+VRSPTSPL+FRVFS L    RS RS+   G Q+SWG SKVGLSIID++DD  K  G 
Sbjct  58    YDAVRSPTSPLDFRVFSNLGYPFRSPRSNHDGGQQRSWGSSKVGLSIIDSIDD-VKIFGK  116

Query  497   LPIPSKSKNIIFGPQMSC-KTQNFLNHSDSFG-AAKSLPKNIPIFPCTEPKPFNLHNDSS  670
             +P  S+SKNI+FGP M   K     +++  F  + KSLPKN  I P ++ K   L   SS
Sbjct  117   VPQSSESKNILFGPGMRINKIPEPQSNAKCFDYSPKSLPKNYAISPHSKIKS-PLQKGSS  175

Query  671   YVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAI-  847
              VLF IG+AP  E  S   +RS SLDSGR+ S  +  ++   N  SG F  E+       
Sbjct  176   DVLFEIGEAP-SEPESFGKIRSCSLDSGRAFSTLSGLSNLNPNSTSGDFCPENLTTHQFI  234

Query  848   --SQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDC  1021
               S N+    K G+     + S     GS+S S+IELSEDYTCV +HG NPK THIF DC
Sbjct  235   GGSPNLATQMKTGS-----IESSNGFVGSLSASEIELSEDYTCVISHGANPKKTHIFGDC  289

Query  1022  ILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFS-YPSSDFLSFCYTCKKKL-DGKDIFI  1195
             ILECH+ +  NF KN EEE   +  PG   E+F  YPS +FLSFCY C KKL +GKDI+I
Sbjct  290   ILECHSEDVNNFGKNVEEEIVFAH-PGSSLENFGHYPSDNFLSFCYYCNKKLEEGKDIYI  348

Query  1196  YRGEKAFCSSSCRSEEILIDEEKEKTN--KGGDDFEKPNSREEPYESSLF  1339
             YRGEKAFCS SCRSEEILIDEE EK N    G   E   S EE +E+ L 
Sbjct  349   YRGEKAFCSLSCRSEEILIDEELEKCNHQSSGKPLE---SDEELFETGLL  395



>ref|XP_007024100.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 6 
[Theobroma cacao]
 gb|EOY26722.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 6 
[Theobroma cacao]
Length=401

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 220/376 (59%), Gaps = 30/376 (8%)
 Frame = +2

Query  194   GQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVF  370
             G +M D  SES+  S     +H  SS FN+P   VG + K  S+SD VRSPTSPL+ RVF
Sbjct  3     GNVMADPDSESYFQSDTLGLRHISSSLFNIPGFLVGFSTKGSSDSDMVRSPTSPLDLRVF  62

Query  371   STLSN--TLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGP  538
             +  SN  ++RS RSS   G+QK W CSK+GL I++ L D+ K  G      K KNIIFGP
Sbjct  63    ANFSNPFSVRSPRSSSQSGYQKKWDCSKMGLGIVNLLADEIKSDGEDLDSPKRKNIIFGP  122

Query  539   QMSCKTQNFLNHSDSF----GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLE  706
             Q+  K  +   +S  F      + SLP+N  I   ++ +  N ++  S ++FG  + PLE
Sbjct  123   QVKTKFPSSSRYSHEFLGNSMKSNSLPRNYIISQLSKDRKPNTNSGGSSLVFGNEEVPLE  182

Query  707   EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV---RELSKL  877
                 S+ +    +            +++  NL S SF +E+G  S  S ++   R L ++
Sbjct  183   PKSDSSRLSPSFIA-----------STKNCNLSSRSFCSENGTTSLNSSSLPIGRAL-QV  230

Query  878   GNSSGAKLRSMPVPAG----SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
              +S  +K  S+P+P G    S+S  +IELSEDYTC+ +HGPNPK THIF DCILECHN E
Sbjct  231   DDSLLSKPSSLPIPVGHSIGSLSAHEIELSEDYTCIISHGPNPKTTHIFGDCILECHNTE  290

Query  1046  FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSS  1225
              TNF K  E E  +S+     E    YPS +FLSFCY+C+KKL+ KD  IY GEKAFCS 
Sbjct  291   LTNFDKKAEPETKVSQLDKSPETSTPYPSDEFLSFCYSCQKKLE-KDEDIYIGEKAFCSF  349

Query  1226  SCRSEEILIDEEKEKT  1273
              CRSEEI   EE EKT
Sbjct  350   DCRSEEIFA-EEMEKT  364



>ref|XP_007024098.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 4 
[Theobroma cacao]
 gb|EOY26720.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 4 
[Theobroma cacao]
Length=392

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 220/376 (59%), Gaps = 30/376 (8%)
 Frame = +2

Query  194   GQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVF  370
             G +M D  SES+  S     +H  SS FN+P   VG + K  S+SD VRSPTSPL+ RVF
Sbjct  3     GNVMADPDSESYFQSDTLGLRHISSSLFNIPGFLVGFSTKGSSDSDMVRSPTSPLDLRVF  62

Query  371   STLSN--TLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGP  538
             +  SN  ++RS RSS   G+QK W CSK+GL I++ L D+ K  G      K KNIIFGP
Sbjct  63    ANFSNPFSVRSPRSSSQSGYQKKWDCSKMGLGIVNLLADEIKSDGEDLDSPKRKNIIFGP  122

Query  539   QMSCKTQNFLNHSDSF----GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLE  706
             Q+  K  +   +S  F      + SLP+N  I   ++ +  N ++  S ++FG  + PLE
Sbjct  123   QVKTKFPSSSRYSHEFLGNSMKSNSLPRNYIISQLSKDRKPNTNSGGSSLVFGNEEVPLE  182

Query  707   EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV---RELSKL  877
                 S+ +    +            +++  NL S SF +E+G  S  S ++   R L ++
Sbjct  183   PKSDSSRLSPSFIA-----------STKNCNLSSRSFCSENGTTSLNSSSLPIGRAL-QV  230

Query  878   GNSSGAKLRSMPVPAG----SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
              +S  +K  S+P+P G    S+S  +IELSEDYTC+ +HGPNPK THIF DCILECHN E
Sbjct  231   DDSLLSKPSSLPIPVGHSIGSLSAHEIELSEDYTCIISHGPNPKTTHIFGDCILECHNTE  290

Query  1046  FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSS  1225
              TNF K  E E  +S+     E    YPS +FLSFCY+C+KKL+ KD  IY GEKAFCS 
Sbjct  291   LTNFDKKAEPETKVSQLDKSPETSTPYPSDEFLSFCYSCQKKLE-KDEDIYIGEKAFCSF  349

Query  1226  SCRSEEILIDEEKEKT  1273
              CRSEEI   EE EKT
Sbjct  350   DCRSEEIFA-EEMEKT  364



>ref|XP_007024095.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 1 
[Theobroma cacao]
 gb|EOY26717.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 1 
[Theobroma cacao]
Length=402

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 220/376 (59%), Gaps = 30/376 (8%)
 Frame = +2

Query  194   GQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVF  370
             G +M D  SES+  S     +H  SS FN+P   VG + K  S+SD VRSPTSPL+ RVF
Sbjct  3     GNVMADPDSESYFQSDTLGLRHISSSLFNIPGFLVGFSTKGSSDSDMVRSPTSPLDLRVF  62

Query  371   STLSN--TLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGP  538
             +  SN  ++RS RSS   G+QK W CSK+GL I++ L D+ K  G      K KNIIFGP
Sbjct  63    ANFSNPFSVRSPRSSSQSGYQKKWDCSKMGLGIVNLLADEIKSDGEDLDSPKRKNIIFGP  122

Query  539   QMSCKTQNFLNHSDSF----GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLE  706
             Q+  K  +   +S  F      + SLP+N  I   ++ +  N ++  S ++FG  + PLE
Sbjct  123   QVKTKFPSSSRYSHEFLGNSMKSNSLPRNYIISQLSKDRKPNTNSGGSSLVFGNEEVPLE  182

Query  707   EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV---RELSKL  877
                 S+ +    +            +++  NL S SF +E+G  S  S ++   R L ++
Sbjct  183   PKSDSSRLSPSFIA-----------STKNCNLSSRSFCSENGTTSLNSSSLPIGRAL-QV  230

Query  878   GNSSGAKLRSMPVPAG----SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
              +S  +K  S+P+P G    S+S  +IELSEDYTC+ +HGPNPK THIF DCILECHN E
Sbjct  231   DDSLLSKPSSLPIPVGHSIGSLSAHEIELSEDYTCIISHGPNPKTTHIFGDCILECHNTE  290

Query  1046  FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSS  1225
              TNF K  E E  +S+     E    YPS +FLSFCY+C+KKL+ KD  IY GEKAFCS 
Sbjct  291   LTNFDKKAEPETKVSQLDKSPETSTPYPSDEFLSFCYSCQKKLE-KDEDIYIGEKAFCSF  349

Query  1226  SCRSEEILIDEEKEKT  1273
              CRSEEI   EE EKT
Sbjct  350   DCRSEEIFA-EEMEKT  364



>ref|XP_008445115.1| PREDICTED: uncharacterized protein LOC103488251 [Cucumis melo]
 ref|XP_008445116.1| PREDICTED: uncharacterized protein LOC103488251 [Cucumis melo]
 ref|XP_008445117.1| PREDICTED: uncharacterized protein LOC103488251 [Cucumis melo]
 ref|XP_008445118.1| PREDICTED: uncharacterized protein LOC103488251 [Cucumis melo]
 ref|XP_008445119.1| PREDICTED: uncharacterized protein LOC103488251 [Cucumis melo]
Length=399

 Score =   255 bits (652),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 178/389 (46%), Positives = 225/389 (58%), Gaps = 33/389 (8%)
 Frame = +2

Query  152   MLRKRTRS-QKDQ-QMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSE  322
             MLRKRTRS QKDQ +M Q+ +P S SE H          K SS F    LF GL+PK  E
Sbjct  1     MLRKRTRSVQKDQYRMNQMNVPCSGSELHT---------KCSSIFKRSHLFTGLSPKGLE  51

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSS--EGHQKSWGCSKVGLSIIDAL-DDKTKRLG  493
             SDS +SPTSPL+F V S+L N LRS RSS  EGH+K+W  SKVGLSIID+L DD +K  G
Sbjct  52    SDSAKSPTSPLDFWVLSSLGNPLRSPRSSSNEGHRKNWDSSKVGLSIIDSLNDDDSKLFG  111

Query  494   NLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSY  673
              +   S SK  +FGP+   K  N    ++     KSLPKN PIF   + K   +   +S 
Sbjct  112   KVLRSSDSKTALFGPRSVAKKSNCPPQANLIQGPKSLPKNYPIFQVPKTK-TPIEQGNSD  170

Query  674   VLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKS----NLHSGSFGTEHGINS  841
             V+F IG+ PLE             +  RS   +  FA R      ++ S S  TE   + 
Sbjct  171   VIFEIGETPLE--------YEPFGNYSRSFDSYRGFAPRAVINGLSVSSCSTTTESVASP  222

Query  842   AISQNVRELSKLGNSSGAKLR-SMPVPAGS---ISTSKIELSEDYTCVRTHGPNPKVTHI  1009
              + +  R   K   +    +   +    GS   +S S IELSEDYTCV +HGPNPK THI
Sbjct  223   CLGEEPRVSEKYPLTKPCSISLGLSCDNGSNKPLSASDIELSEDYTCVISHGPNPKTTHI  282

Query  1010  FCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKD  1186
             + DCILECH+N  ++ S+N  +E G            SY  +DFLS CY+C KKLD GKD
Sbjct  283   YGDCILECHSNYLSSSSENEMKEVGFPHPLKSLNTPTSYSLTDFLSMCYSCHKKLDEGKD  342

Query  1187  IFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             I+IYRGEKAFCS +CRS+E+L+DEE EK+
Sbjct  343   IYIYRGEKAFCSLTCRSQEMLMDEELEKS  371



>ref|XP_010095494.1| hypothetical protein L484_014922 [Morus notabilis]
 gb|EXB60468.1| hypothetical protein L484_014922 [Morus notabilis]
Length=431

 Score =   254 bits (648),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 260/441 (59%), Gaps = 52/441 (12%)
 Frame = +2

Query  152   MLRKRTRS-QKDQ-QMG-QLMPDSSSESHL-SSGVFAQKHKVSSFFNVPALFVGLNPK--  313
             MLRKRTRS QKDQ QMG Q + +S SES    S +    +   + F+   L VGL+PK  
Sbjct  1     MLRKRTRSIQKDQHQMGHQPITNSGSESFFFHSDILNNNNPKRNSFS--GLLVGLSPKGL  58

Query  314   --QSESDSVRSPTSPLEFRVFSTLSNTL----RSQRSSE--GHQKSWGCS-KVGL-SIID  463
                ++ DSVRSPTSPL+F++FS+L N      ++ RSS   G Q+SWG S KVGL SIID
Sbjct  59    ATSTDCDSVRSPTSPLDFKLFSSLGNPFFRSSKATRSSHENGQQRSWGGSTKVGLISIID  118

Query  464   ALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNF-LNHSDSFGAAKSLPKNIPIFPCTEP  640
             +LDD  K  G +   S+SKNI+FGP+   KT      +++SF + KSLPKN  IFP +  
Sbjct  119   SLDDDIKFPGKVLRSSESKNILFGPKFRVKTSTSGQANTNSFESPKSLPKNYAIFPHSSK  178

Query  641   KPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFG  820
                 L   SS VLF IG++PLE   S   +RS SLDS R+        S      S +F 
Sbjct  179   TKPPLEKGSSDVLFEIGESPLEPPDSLGQIRSCSLDSCRT-------MSNSPISTSMNFC  231

Query  821   TEHGINSAISQNVRELSKLGNS---SGAKLRSMPVP-------AGSISTSKIELSEDYTC  970
              E+ + + +S + +      NS   SG KL ++PV         GS+S S+IELSEDYTC
Sbjct  232   LENNVTTQVSSSPQFFGGSPNSNRISGTKLSTIPVSLGSGNGFIGSLSASEIELSEDYTC  291

Query  971   VRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEE--ENGLSKGPG-CCEEHFSYPSSDF  1141
             V +HGPNPK THIF DCILE  + + +NF+   ++  E G S+  G        YPS+ F
Sbjct  292   VISHGPNPKTTHIFGDCILETESCDLSNFAAKADDNKEIGFSQPIGKNTRISAPYPSNYF  351

Query  1142  LSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSR--  1312
             LSFCY+C KKL DGKDI+IYRGEKAFCS SCRS EIL+DEE EK+N   D    PNS   
Sbjct  352   LSFCYSCNKKLEDGKDIYIYRGEKAFCSLSCRSLEILMDEELEKSND-KDPENPPNSHDV  410

Query  1313  ---------EEPYESSLFIAT  1348
                      +E +E+ L  AT
Sbjct  411   DHDDDDDDGKELFETGLIAAT  431



>ref|XP_004136330.1| PREDICTED: uncharacterized protein LOC101223099 [Cucumis sativus]
 ref|XP_004162484.1| PREDICTED: uncharacterized LOC101223099 [Cucumis sativus]
 gb|KGN60140.1| hypothetical protein Csa_3G880550 [Cucumis sativus]
Length=386

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 217/369 (59%), Gaps = 23/369 (6%)
 Frame = +2

Query  203   MPDSSSE-SHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFST  376
             M DS SE   + S V   K K +SFF+ P LFVGLN K  S+SDSVRSPTSPLE RVFS 
Sbjct  1     MADSGSELCPVQSVVLGHKSKSNSFFSAPGLFVGLNFKVASDSDSVRSPTSPLELRVFSN  60

Query  377   LSNTLRSQRSSE-GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCK  553
             LSN++ S +SS+ GH++SWGCSKVGL I+D+LDD  K  G      ++KNIIFGPQ+  K
Sbjct  61    LSNSVGSPKSSQDGHRRSWGCSKVGLGIVDSLDDDNKLSGKALGSFENKNIIFGPQVRTK  120

Query  554   TQNFLNHSDSF---GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSA  724
              Q      D+       +SLPKN P FP   P      + SS VLF IG+ PLE   S  
Sbjct  121   NQTQNLQIDTVFPQAGPRSLPKNCPNFP---PPQLKKPSYSSEVLFEIGE-PLEFKTSKK  176

Query  725   NMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLR  904
             +            + +      +S  HS +   +    +A S+   ++     S+ A + 
Sbjct  177   SGACSLDSPRFVSASYG--VKGRSFFHSTNPFVKKLTTNADSEPQDKILSADISTPASI-  233

Query  905   SMPVPAG--SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEE  1078
             ++PVP    S+S ++IELSEDYT V +HG NPK THIF DCILECH+++  N +KN   E
Sbjct  234   TVPVPGTIESLSATEIELSEDYTRVISHGENPKTTHIFGDCILECHSDDLNNLNKNEMNE  293

Query  1079  NGLSKGPGCCEEHFSYPSS----DFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEE  1243
              G    P         P      DFLSFCY C KKL+ GKDI+IYRGEKAFCSS CR +E
Sbjct  294   IG---SPLSIRSSLDIPFQCQPIDFLSFCYFCNKKLESGKDIYIYRGEKAFCSSDCRYQE  350

Query  1244  ILIDEEKEK  1270
             I+I+EE EK
Sbjct  351   IMIEEEPEK  359



>ref|XP_008466352.1| PREDICTED: uncharacterized protein LOC103503787 [Cucumis melo]
Length=390

 Score =   244 bits (622),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 170/370 (46%), Positives = 214/370 (58%), Gaps = 21/370 (6%)
 Frame = +2

Query  203   MPDSSSE-SHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFST  376
             M DS SE   + S V   K K +SFF+ P LFVGLN K  S+SDSVRSPTSPLE RVFS 
Sbjct  1     MADSGSELCPVQSVVLGHKSKSNSFFSAPGLFVGLNFKVASDSDSVRSPTSPLELRVFSN  60

Query  377   LSNTLRSQRSS-EGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCK  553
             LSN++ S +SS +GH++SWGCSKVGL I+D+LDD  K  G      +SKNIIFGPQ+  K
Sbjct  61    LSNSVGSPKSSHDGHRRSWGCSKVGLGIVDSLDDDNKLSGKALGSFESKNIIFGPQVRTK  120

Query  554   TQNFLNHSDSF---GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSA  724
              Q      D+       +SLPKN P FP   P      + SS VLF IG+ PLE   S  
Sbjct  121   NQTPNLQIDTVFPQAGPRSLPKNCPNFP---PPQLKTPSYSSEVLFEIGE-PLEFKPSKK  176

Query  725   NMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLR  904
             +            + +   A  +S  HS +   +    +  S+   +      S+ A + 
Sbjct  177   SGACSLDSPRFVSASYG--AKGRSFFHSTNPFVKKVTTNGDSEPQDKTLSADISTPASI-  233

Query  905   SMPVPA--GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEE  1078
             ++PVP    S+S S+IELSEDYT V +HG NPK THIF DCILECH+++  N +   + E
Sbjct  234   TVPVPGIIESLSASEIELSEDYTRVISHGENPKTTHIFGDCILECHSDDLNNLNNLNKNE  293

Query  1079  NGLSKGPGCCEEHFSYP-----SSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSE  1240
                   P         P       DFLSFCY C KKL+ GKDI+IYRGEKAFCSS CR +
Sbjct  294   MNEIGAPLSIRSSLDIPPLQCQPIDFLSFCYFCNKKLESGKDIYIYRGEKAFCSSDCRYQ  353

Query  1241  EILIDEEKEK  1270
             EI+I+EE EK
Sbjct  354   EIMIEEEPEK  363



>gb|KDP37202.1| hypothetical protein JCGZ_06258 [Jatropha curcas]
Length=377

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 164/373 (44%), Positives = 206/373 (55%), Gaps = 38/373 (10%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQS-ESDSVRSPTSPLEFRVFSTL  379
             M DS+ ESH  S     +H  SSFFN+P  FVG   + S ESDSVRSPTSPL+F  FS L
Sbjct  1     MADSAPESHCQSDALGLRHTSSSFFNLPGFFVGFGSRGSTESDSVRSPTSPLDFSFFSNL  60

Query  380   SNTL-----RSQRSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQM  544
             SN       RS  +  G+QK W  SKVGLSII+ L D+TK    +    K KNIIFG Q+
Sbjct  61    SNPFSHKSPRSPPNQNGYQKKWDSSKVGLSIINLLADETKPTSEVLNSPKRKNIIFGSQV  120

Query  545   SCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKP--FNLHNDSSYVLFGIGDAPLE-EGI  715
               KT   +        + SLP++  +   ++ K   F      S  LFG      E +  
Sbjct  121   --KTGYSVR-------SNSLPRDYMLLLLSQTKTPNFEFCKSDSDALFGNDGVQSEPKPF  171

Query  716   SSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGA  895
              +++  S S  S  S   F S  +R +++ S    T  G+ +             N    
Sbjct  172   ENSSPISLSPKSPLSSKKFCS-ENRTTSITSLPLITGRGLQT------------DNPLET  218

Query  896   KLRSMPVPAGS-------ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN  1054
             K  S+PVP GS       +S  +IELSEDYTC+ ++GPNPK THIF DCILECH NE +N
Sbjct  219   KSSSIPVPVGSSQGYVGSLSAREIELSEDYTCIISYGPNPKTTHIFGDCILECHTNELSN  278

Query  1055  FSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCR  1234
             F K G   + L +   C E    YPS +FLSFCY+CKKKL+G DI IYRGEKAFCS  CR
Sbjct  279   FDKLGNLGSELPQEANCPEGSTPYPSDEFLSFCYSCKKKLEGDDIHIYRGEKAFCSFDCR  338

Query  1235  SEEILIDEEKEKT  1273
             SEEI  ++E EKT
Sbjct  339   SEEIFAEDETEKT  351



>ref|XP_007161279.1| hypothetical protein PHAVU_001G056900g [Phaseolus vulgaris]
 ref|XP_007161280.1| hypothetical protein PHAVU_001G056900g [Phaseolus vulgaris]
 gb|ESW33273.1| hypothetical protein PHAVU_001G056900g [Phaseolus vulgaris]
 gb|ESW33274.1| hypothetical protein PHAVU_001G056900g [Phaseolus vulgaris]
Length=399

 Score =   238 bits (606),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 182/409 (44%), Positives = 223/409 (55%), Gaps = 33/409 (8%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSES  325
             MLRKRTRS QKDQ   Q+   + SE++  S       K +S FN P LFVG+ PK   +S
Sbjct  1     MLRKRTRSIQKDQH--QVCKMTISEANFESHALGSNAKSNSIFNAPLLFVGMGPKGLLDS  58

Query  326   DSVRSPTSPLEFRVFSTLSNTLR--SQRSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNL  499
             DSV+SPTSPL+   FS LSN  R  S  S+EG Q+SW C+KVGLSIID+L++ +K    +
Sbjct  59    DSVKSPTSPLDVSFFSNLSNPFRTPSSLSNEGQQRSWDCAKVGLSIIDSLEECSKFSQKI  118

Query  500   PIPSKSKNIIFGPQMSCKTQNFLNHSD--SFGAAKSLPKNIPIFPCTEPKPFNLHNDSSY  673
                S+SK     PQ+  K  N   + D  S  A+KSLPK      C +   +    D S 
Sbjct  119   LQASESKKTTLCPQIITKAPNCKPYMDMESAYASKSLPKGSCRIHCAQ-NGYIFPKDEST  177

Query  674   VLFGIGDAPLE----EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINS  841
             VLF IG+AP +    E   S ++ S S     SG    +  S   NL             
Sbjct  178   VLFEIGEAPPQHESFEKAVSVSLDSCSPIRNLSGLTCPNIDSDPENLALKHKCCPPHFIG  237

Query  842   AISQNVRELSKLGNSSGAKLRSMPVPA-------GSISTSKIELSEDYTCVRTHGPNPKV  1000
                 N + L        A L S PV A        S+S S+IELSEDYTCV +HGPNPK 
Sbjct  238   GSHDNTQILLP------AALNSNPVAAVSSNEFIKSLSASEIELSEDYTCVISHGPNPKT  291

Query  1001  THIFCDCILECHNNEFTNFSKNGEEENGL---SKGPGCCEEHFSYPSS-DFLSFCYTCKK  1168
             THIFCD ILE H  +F   +KNGEE   L   S        HF  PSS DFLSFC+ C K
Sbjct  292   THIFCDFILETHATDFKKHNKNGEEGKELSLFSVNSMYAPNHF--PSSEDFLSFCHHCNK  349

Query  1169  KL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSR  1312
             KL +GKDI+IYRGEKAFCS SCR+ EI+IDEE EK++        P  R
Sbjct  350   KLEEGKDIYIYRGEKAFCSLSCRAIEIMIDEELEKSDSDSSPENSPKMR  398



>ref|XP_004501266.1| PREDICTED: uncharacterized protein LOC101504073 [Cicer arietinum]
Length=431

 Score =   238 bits (608),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 184/432 (43%), Positives = 245/432 (57%), Gaps = 35/432 (8%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQ-MGQLMPDS--SSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-Q  316
             MLRKR+RS QKDQ  MG +      +S+++  S    +  K +S FNVP LFVGL PK  
Sbjct  1     MLRKRSRSIQKDQHNMGHVTNTDGVNSDNYSQSHALGRNIKGNSIFNVPCLFVGLGPKGL  60

Query  317   SESDSVRSPTSPLEFRVFSTLSN-TLRSQRSS--EGHQKSWGCSKVGLSIIDALDDK--T  481
              +SDSVRSPTSPL+ +V S L N  +R+Q+SS  EG+Q+SW C KVGL I+++L+D   +
Sbjct  61    LDSDSVRSPTSPLDTKVLSNLGNPVIRNQKSSLFEGNQRSWDCCKVGLGIVESLEDCDCS  120

Query  482   KRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNI-PIFPCTEPKPFNLH  658
             +  G +    +SK+I    QM  K        DSF ++KSLPK    + P T+     +H
Sbjct  121   RICGKILQSPESKSISLSSQMMIKNLICQTCLDSFESSKSLPKEFCKVVPDTQNGSV-IH  179

Query  659   NDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTE----  826
             N  S VLF IG+  LE   S    RS SL+S       +  ++ K++ H   F  +    
Sbjct  180   NGESNVLFEIGETSLERDESFGRTRSFSLESCNPLKVNSGLSTSKTDSHIDDFAVKDVRF  239

Query  827   ------HGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGP  988
                   H I  + + N+   S+L  S+G  + S      S+S S+IELSEDYTCV +HGP
Sbjct  240   QDSSPPHFIGGSQNSNISPPSEL-KSNGVLICSSNEILKSLSASEIELSEDYTCVISHGP  298

Query  989   NPKVTHIFCDCILECH-----NNEFTNFSKNGEEENGLSKGPGCCEEHF-----SYPSSD  1138
             NPK THIF DCILE H      N F N     E+E     G      +       YPSS 
Sbjct  299   NPKTTHIFGDCILETHPDVFVKNHFKNEENEKEKEKEKENGVTLIGNNRLQIPNQYPSSA  358

Query  1139  FLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFE-KPNSR  1312
             FLSFC+ C KKLD GKDI+IYRGEKAFCS +CR+ EI+IDEE+EK+N   D+   KP   
Sbjct  359   FLSFCHHCNKKLDEGKDIYIYRGEKAFCSLTCRAMEIMIDEEREKSNTHCDENSPKPKLG  418

Query  1313  EEPYESSLFIAT  1348
             E+ +E+ +   T
Sbjct  419   EQIFETGIPTTT  430



>ref|XP_006596130.1| PREDICTED: uncharacterized protein LOC100789230 isoform X2 [Glycine 
max]
 gb|KHN09375.1| hypothetical protein glysoja_045241 [Glycine soja]
Length=406

 Score =   234 bits (598),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 180/423 (43%), Positives = 230/423 (54%), Gaps = 41/423 (10%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQ-MGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QS  319
             MLRKRTRS QKDQ   GQ+ + D++SESH   G      K +S FN P LFVG+  K   
Sbjct  1     MLRKRTRSIQKDQHHTGQMAISDTNSESHALGG----NGKSNSIFNAPLLFVGMGHKGLL  56

Query  320   ESDSVRSPTSPLEFRVFSTLSNTLR--SQRSSEGHQKSWGCSKVGLSIIDALDDKTKRLG  493
             + DSV+SPTSPL+F   S LSN  R  S  S+EG  +SW C+KVGLSIID+L++ +K   
Sbjct  57    DCDSVKSPTSPLDFGFLSNLSNPFRTPSSLSNEGPHRSWDCAKVGLSIIDSLEECSKFSW  116

Query  494   NLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSY  673
              +   S+SK     PQM  K     ++ DS  A+KSLPK+    PCT+        +S+ 
Sbjct  117   KILQASESKKTSLCPQMITKAPKCKSYMDSTQASKSLPKDFCKIPCTQNGSIVPKGEST-  175

Query  674   VLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRK--SNLHSGSFGTEHGINSAI  847
             VLF IG+ PLE       +               S++  K  S L   +F T+   N A+
Sbjct  176   VLFEIGETPLEHEFFGKAVSFS----------LDSYSPTKYLSGLTGSNFDTDSE-NFAL  224

Query  848   SQNVRELSKLGNSSG-------AKLRSMPVPA-------GSISTSKIELSEDYTCVRTHG  985
              Q       +G S         ++L S PV A        S+S  +IE SEDYTCV +HG
Sbjct  225   KQMCSPPHFIGGSQNNTKILLPSELNSNPVAAVYSNEFIESLSACEIENSEDYTCVISHG  284

Query  986   PNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSK-GPGCCEEHFSYPSSDFLSFCYTC  1162
             PN K THIFC CILE H N+     K  EE  GLS            YPS DFLS CY C
Sbjct  285   PNAKTTHIFCGCILETHANDSERHYKAEEEGKGLSLFSVNILHTPNQYPSHDFLSVCYHC  344

Query  1163  KKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYESSLF  1339
              KKL +GKDI+IYRGEK+FCS SCR  EI++DE+ EK+N   ++  K     E +E+   
Sbjct  345   NKKLEEGKDIYIYRGEKSFCSLSCREIEIMMDEQ-EKSNSSPENSPKCGFGGEVFETGTP  403

Query  1340  IAT  1348
             IAT
Sbjct  404   IAT  406



>ref|XP_007024101.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 7 
[Theobroma cacao]
 ref|XP_007024102.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 7 
[Theobroma cacao]
 ref|XP_007024103.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 7 
[Theobroma cacao]
 gb|EOY26723.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 7 
[Theobroma cacao]
 gb|EOY26724.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 7 
[Theobroma cacao]
 gb|EOY26725.1| Pre-mRNA cleavage complex 2 protein Pcf11, putative isoform 7 
[Theobroma cacao]
Length=360

 Score =   233 bits (594),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 148/353 (42%), Positives = 205/353 (58%), Gaps = 29/353 (8%)
 Frame = +2

Query  194   GQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVF  370
             G +M D  SES+  S     +H  SS FN+P   VG + K  S+SD VRSPTSPL+ RVF
Sbjct  3     GNVMADPDSESYFQSDTLGLRHISSSLFNIPGFLVGFSTKGSSDSDMVRSPTSPLDLRVF  62

Query  371   STLSN--TLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGP  538
             +  SN  ++RS RSS   G+QK W CSK+GL I++ L D+ K  G      K KNIIFGP
Sbjct  63    ANFSNPFSVRSPRSSSQSGYQKKWDCSKMGLGIVNLLADEIKSDGEDLDSPKRKNIIFGP  122

Query  539   QMSCKTQNFLNHSDSF----GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLE  706
             Q+  K  +   +S  F      + SLP+N  I   ++ +  N ++  S ++FG  + PLE
Sbjct  123   QVKTKFPSSSRYSHEFLGNSMKSNSLPRNYIISQLSKDRKPNTNSGGSSLVFGNEEVPLE  182

Query  707   EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV---RELSKL  877
                 S+ +    +            +++  NL S SF +E+G  S  S ++   R L ++
Sbjct  183   PKSDSSRLSPSFIA-----------STKNCNLSSRSFCSENGTTSLNSSSLPIGRAL-QV  230

Query  878   GNSSGAKLRSMPVPAG----SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
              +S  +K  S+P+P G    S+S  +IELSEDYTC+ +HGPNPK THIF DCILECHN E
Sbjct  231   DDSLLSKPSSLPIPVGHSIGSLSAHEIELSEDYTCIISHGPNPKTTHIFGDCILECHNTE  290

Query  1046  FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYR  1201
              TNF K  E E  +S+     E    YPS +FLSFCY+C+KKL+  +DI++YR
Sbjct  291   LTNFDKKAEPETKVSQLDKSPETSTPYPSDEFLSFCYSCQKKLEKDEDIYMYR  343



>ref|XP_006596129.1| PREDICTED: uncharacterized protein LOC100789230 isoform X1 [Glycine 
max]
Length=425

 Score =   234 bits (598),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 180/426 (42%), Positives = 230/426 (54%), Gaps = 41/426 (10%)
 Frame = +2

Query  143   LRTMLRKRTRS-QKDQQ-MGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK  313
                MLRKRTRS QKDQ   GQ+ + D++SESH   G      K +S FN P LFVG+  K
Sbjct  17    FEIMLRKRTRSIQKDQHHTGQMAISDTNSESHALGG----NGKSNSIFNAPLLFVGMGHK  72

Query  314   -QSESDSVRSPTSPLEFRVFSTLSNTLR--SQRSSEGHQKSWGCSKVGLSIIDALDDKTK  484
                + DSV+SPTSPL+F   S LSN  R  S  S+EG  +SW C+KVGLSIID+L++ +K
Sbjct  73    GLLDCDSVKSPTSPLDFGFLSNLSNPFRTPSSLSNEGPHRSWDCAKVGLSIIDSLEECSK  132

Query  485   RLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHND  664
                 +   S+SK     PQM  K     ++ DS  A+KSLPK+    PCT+        +
Sbjct  133   FSWKILQASESKKTSLCPQMITKAPKCKSYMDSTQASKSLPKDFCKIPCTQNGSIVPKGE  192

Query  665   SSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRK--SNLHSGSFGTEHGIN  838
             S+ VLF IG+ PLE       +               S++  K  S L   +F T+   N
Sbjct  193   ST-VLFEIGETPLEHEFFGKAVSFS----------LDSYSPTKYLSGLTGSNFDTDSE-N  240

Query  839   SAISQNVRELSKLGNSSG-------AKLRSMPVPA-------GSISTSKIELSEDYTCVR  976
              A+ Q       +G S         ++L S PV A        S+S  +IE SEDYTCV 
Sbjct  241   FALKQMCSPPHFIGGSQNNTKILLPSELNSNPVAAVYSNEFIESLSACEIENSEDYTCVI  300

Query  977   THGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSK-GPGCCEEHFSYPSSDFLSFC  1153
             +HGPN K THIFC CILE H N+     K  EE  GLS            YPS DFLS C
Sbjct  301   SHGPNAKTTHIFCGCILETHANDSERHYKAEEEGKGLSLFSVNILHTPNQYPSHDFLSVC  360

Query  1154  YTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYES  1330
             Y C KKL +GKDI+IYRGEK+FCS SCR  EI++DE+ EK+N   ++  K     E +E+
Sbjct  361   YHCNKKLEEGKDIYIYRGEKSFCSLSCREIEIMMDEQ-EKSNSSPENSPKCGFGGEVFET  419

Query  1331  SLFIAT  1348
                IAT
Sbjct  420   GTPIAT  425



>gb|KHN10288.1| hypothetical protein glysoja_017892 [Glycine soja]
Length=407

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 168/390 (43%), Positives = 222/390 (57%), Gaps = 20/390 (5%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQ-MGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSE  322
             MLRKR RS QKDQ  M +   +  S+SH  + V     K  S FNVP LFVGL PK   +
Sbjct  1     MLRKRNRSVQKDQHHMCEANSEHYSQSH-HALVGRNNIKGHSIFNVPCLFVGLGPKGLLD  59

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLP  502
             SDSVRSPTSPL+ RV S L N +R  RSS  H+K W C KVGL I+++L+D ++  G + 
Sbjct  60    SDSVRSPTSPLDARVLSNLGNPVRKPRSSP-HEKRWDCCKVGLGIVESLEDCSRFSGKIL  118

Query  503   IPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHN-----DS  667
                +SK +   PQ+  K  N   H DSF  +KSLPK+    P   P+  ++ +       
Sbjct  119   QSPESKRVSLSPQIMIKAPNCQIHRDSFEGSKSLPKDFCKAPYYAPQNGSVIHKGECESE  178

Query  668   SYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTE------H  829
             S VLF IG++ LE  +                +  +  A+  S+  + +F  +      H
Sbjct  179   STVLFEIGESGLELELFGKTRSCSLDSCSPLKA-LSGVATSYSDSDTDNFAMKDVSSPPH  237

Query  830   GINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHI  1009
              I  + + N    +K  NS+   + S      S+S S+IELSEDYTCV +HGPNPK THI
Sbjct  238   FIGGSQNSNNFTPTK-PNSTTLSISSSNEFIKSLSASEIELSEDYTCVISHGPNPKTTHI  296

Query  1010  FCDCILECHNNEFTNFSKNGEEENGLSK-GPGCCEEHFSYPSSDFLSFCYTCKKKL-DGK  1183
             F DCILE H+N F    K+ E+E  ++  G         YPSSDFLSFC+ C KKL +GK
Sbjct  297   FGDCILETHSNVFKTHFKSEEKEKRVNPLGNNKLGSPNPYPSSDFLSFCHHCNKKLEEGK  356

Query  1184  DIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             DI+IY GEKAFCS +CR+ EI+IDEE EK+
Sbjct  357   DIYIYGGEKAFCSFTCRAMEIMIDEELEKS  386



>ref|XP_006601110.1| PREDICTED: uncharacterized protein LOC100804101 [Glycine max]
 gb|KHN12075.1| hypothetical protein glysoja_040382 [Glycine soja]
Length=399

 Score =   232 bits (591),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 173/397 (44%), Positives = 216/397 (54%), Gaps = 36/397 (9%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQ-MGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QS  319
             MLRKRTRS QKDQ   GQ+ + D++SESH          K +S FN P LFVG+  K   
Sbjct  1     MLRKRTRSIQKDQHHTGQMAISDTNSESH----ALGSNGKSNSIFNSPLLFVGMGHKGLL  56

Query  320   ESDSVRSPTSPLEFRVFSTLSNTLR--SQRSSEGHQKSWGCSKVGLSIIDALDDKTKRLG  493
             +SDSV+SPTSPL+F   S LSN  R  S  S+EG  +SW C+KVGLSIID+L++ +K  G
Sbjct  57    DSDSVKSPTSPLDFGFLSNLSNPFRTPSSLSNEGQHRSWNCAKVGLSIIDSLEECSKFSG  116

Query  494   NLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSY  673
              +   S+SK     P M  K     ++ DS  A+KSLPK+     CT+        +S+ 
Sbjct  117   KILQASESKKTSLCPPMITKAPKCKSYMDSAQASKSLPKDFCKITCTQNGSIFPKGEST-  175

Query  674   VLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQ  853
             VL  IG+APLE       +               S     S L    F ++   N A+ Q
Sbjct  176   VLSEIGEAPLEYESFGKTVSFSLDS--------CSPIRNLSGLTGSDFDSD-SENFALKQ  226

Query  854   NVRELSKLGNSSG-------AKLRSMPVPA-------GSISTSKIELSEDYTCVRTHGPN  991
                    +G S         +++ S PV A        S+S S+IELSEDYTCV +HG N
Sbjct  227   MCSPPHFIGGSQNNTKFLLPSEVHSNPVAAVSSNEFIESLSASEIELSEDYTCVISHGSN  286

Query  992   PKVTHIFCDCILECHNNEFTNFSKNGEEENGLSK-GPGCCEEHFSYPSSDFLSFCYTCKK  1168
             PK THIFCDCILE H N+     K  EE  GL             YPS DFLS C+ C K
Sbjct  287   PKTTHIFCDCILESHVNDSERHYKAEEEGTGLPLFSVNILHTPSQYPSHDFLSVCHHCNK  346

Query  1169  KL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTN  1276
             KL DGKDI+IYRGEK+FCS SCR  EI  DEE+EK+N
Sbjct  347   KLEDGKDIYIYRGEKSFCSLSCREIEITNDEEQEKSN  383



>ref|XP_007137095.1| hypothetical protein PHAVU_009G099100g [Phaseolus vulgaris]
 gb|ESW09089.1| hypothetical protein PHAVU_009G099100g [Phaseolus vulgaris]
Length=423

 Score =   232 bits (592),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 177/426 (42%), Positives = 234/426 (55%), Gaps = 30/426 (7%)
 Frame = +2

Query  152   MLRKRTRSQKDQQ--MGQLMPDSSSESHLSSGVFAQKH---KVSSFFNVPALFVGLNPK-  313
             MLRKR RS + +Q  M  L    ++  H S    A      K  S FNVP L+VGL PK 
Sbjct  1     MLRKRNRSMQKEQHHMSNLTQCEANSEHYSQTHHALGRNNIKGHSIFNVPCLYVGLGPKG  60

Query  314   QSESDSVRSPTSPLEFRVFSTLSNTLRSQRSS--EGHQKSWGCSKVGLSIIDALDDKTKR  487
               +SDSVRSPTSPL+ RV S L N +R  RSS  EGH +SW C KVGL I+++L+D ++ 
Sbjct  61    LLDSDSVRSPTSPLDARVLSNLGNPVRKPRSSPHEGHPRSWDCCKVGLGIVESLEDCSRF  120

Query  488   LGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNI---PIFPCTEPKPFNLH  658
              G +    +SK +   PQM  K  N   H D    +KSLPK+    P  P       +  
Sbjct  121   SGKILQSPESKRVSVSPQMMIKASNCQIHRDFLEGSKSLPKDFCKAPYGPKNRSVTTHKG  180

Query  659   NDSSYVLFGIGDAPLEEGI----SSANMrsrsldsgrsgsHFA-------SFASRKSNLH  805
                S VLF IG++ LE  +     S ++ S S     SG + +       SFA +  N  
Sbjct  181   ESESTVLFEIGESGLEHELFRRTRSCSLDSCSQLKKLSGLNISFSDSDTDSFAVKDVNFQ  240

Query  806   SGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHG  985
               S    H I  + + N    +K  N++   + S      S+S S+IELSEDYTCV ++G
Sbjct  241   LSS--PPHFIGGSQNSNTFPPTKF-NTNTLSISSSNEFIKSLSASEIELSEDYTCVISYG  297

Query  986   PNPKVTHIFCDCILECHNNEFT--NFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYT  1159
             PNPK THIF DCILE H+N F     ++  E+E G++           YPSSDFLSFC+ 
Sbjct  298   PNPKTTHIFGDCILETHSNAFKIHYKNEEKEKEKGVNPVANRLGSPNPYPSSDFLSFCHH  357

Query  1160  CKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK--TNKGGDDFEKPNSREEPYES  1330
             C KKL +GKDI+IY GEKAFCS +CR+ EI+IDEE EK  TN   ++ EKP   E  +E+
Sbjct  358   CNKKLEEGKDIYIYGGEKAFCSLTCRAMEIMIDEELEKSNTNPPCENSEKPKLGELLFEA  417

Query  1331  SLFIAT  1348
              +  A+
Sbjct  418   DILTAS  423



>ref|XP_003603497.1| hypothetical protein MTR_3g108290 [Medicago truncatula]
 gb|AES73748.1| DUF581 family protein [Medicago truncatula]
Length=424

 Score =   232 bits (592),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 184/431 (43%), Positives = 242/431 (56%), Gaps = 39/431 (9%)
 Frame = +2

Query  152   MLRKRTRS-QKDQ-QMGQLM-PDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QS  319
             MLRKR+RS QKDQ QMG L   D++S+ +  S    +  K +  FNVP LFVGL PK   
Sbjct  1     MLRKRSRSIQKDQHQMGHLTNSDTNSDHYAQSHALGRNIKGNPIFNVPCLFVGLGPKGLL  60

Query  320   ESDSVRSPTSPLEFRVFSTLSNTLRSQRSS--EGHQKSWGCSKVGLSIIDALDD--KTKR  487
             +SDSVRSPTSPL+ RV S   N +R+ RSS  EG+Q+SW   KVGLSI+++L+D   ++ 
Sbjct  61    DSDSVRSPTSPLDTRVLSNSGNPVRNLRSSLLEGNQRSWDSCKVGLSIVESLEDCNCSRF  120

Query  488   LGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSF-GAAKSLPKNI-PIFPCTEPKPFNLHN  661
              G +     SK I   PQ   KT       DSF  ++KSLPK+   + PC E        
Sbjct  121   CGKILQSLDSKGISLSPQSMIKTPICETCMDSFESSSKSLPKDFGKVVPCVEDGSVIQKG  180

Query  662   D-SSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGIN  838
             +  S VLF IG+  LE        RS SLDS +S       A+ K++     F  +  + 
Sbjct  181   ECESNVLFEIGETSLEHDEPFGRTRSCSLDSCKSMKADFGLATSKTDSDIDDFAMKD-VT  239

Query  839   SAISQNVRELSKLGNSSG-----AKLRSMPVPAG-----SISTSKIELSEDYTCVRTHGP  988
               +S +   +    NS+      +K  ++ + +      S+S S+IELSEDYTCV +HGP
Sbjct  240   VQVSSSPHFIGGSQNSNAFIPAESKSNTLSICSSSEILKSLSASEIELSEDYTCVISHGP  299

Query  989   NPKVTHIFCDCILECHNN-EFTNFSKNGEEE---------NGLSKGPGCCEEHFSYPSSD  1138
             NPK THIF D ILE H +    N  KN E E         N LS+ P        YPSS 
Sbjct  300   NPKTTHIFGDYILETHPDLSIKNHFKNEENEKEKGVTLMGNKLSQTPN------QYPSSA  353

Query  1139  FLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSRE  1315
             FLSFC+ C KKLD GKDI+IYRGEKAFCS +CR+ EI+IDEE EK+N   ++  KP   E
Sbjct  354   FLSFCHHCDKKLDEGKDIYIYRGEKAFCSLTCRAIEIMIDEELEKSNSPCENSAKPKLGE  413

Query  1316  EPYESSLFIAT  1348
             + +E+ +   T
Sbjct  414   QIFEAGIPTTT  424



>ref|XP_010049056.1| PREDICTED: uncharacterized protein LOC104437741 [Eucalyptus grandis]
 ref|XP_010049057.1| PREDICTED: uncharacterized protein LOC104437741 [Eucalyptus grandis]
 ref|XP_010049058.1| PREDICTED: uncharacterized protein LOC104437741 [Eucalyptus grandis]
 ref|XP_010049059.1| PREDICTED: uncharacterized protein LOC104437741 [Eucalyptus grandis]
 ref|XP_010049061.1| PREDICTED: uncharacterized protein LOC104437741 [Eucalyptus grandis]
 gb|KCW81515.1| hypothetical protein EUGRSUZ_C02876 [Eucalyptus grandis]
 gb|KCW81516.1| hypothetical protein EUGRSUZ_C02876 [Eucalyptus grandis]
Length=379

 Score =   222 bits (566),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 159/398 (40%), Positives = 208/398 (52%), Gaps = 45/398 (11%)
 Frame = +2

Query  152   MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESD  328
             ML KRT S + +       DS+  S L S +  Q  +  S  ++P L+ GLNPK  ++ D
Sbjct  1     MLMKRTVSVQKEAGPMAKSDSNLRSGLQSALRRQNRRRKSLSSIPGLYAGLNPKGLADVD  60

Query  329   SVRSPTSPLEFRVFSTLSNTLRSQRSS-EGHQKSWGCSKVGLSIIDALDDKTKRLGNLPI  505
             SVRSPTSPL+F +F  LSN +RS RS   G +KSW CSKVGLSI+D+L+DK    G    
Sbjct  61    SVRSPTSPLDFMLFPYLSNPMRSPRSPCAGQRKSWDCSKVGLSIVDSLNDKGNSSGGALR  120

Query  506   PSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFG  685
                + NIIFGP +  K  N      S  + +SLPK+         K   LH+ S+ V+F 
Sbjct  121   SFHTGNIIFGPNIRVKNHNIETSISSIESPQSLPKDYTFSRYARAK-SPLHSSSTGVVFE  179

Query  686   IGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRE  865
             I D P EE      +                   R S+L S +      I S   +  RE
Sbjct  180   IADGP-EEPDPLGKI-------------------RSSSLDSCT------IMSYRPRLSRE  213

Query  866   LSKLGNSSGAKLRSMPVPA--------GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDC  1021
               KL   S     S+P P+         S+S S+IE SEDYTCV +HGP+ K THI+ DC
Sbjct  214   SPKLSKVSCTSPTSIPPPSVDPGRGFTDSLSASEIENSEDYTCVISHGPDSKTTHIYGDC  273

Query  1022  ILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIY  1198
             IL+CH +E +NF +  EE+  L +     E    Y   DFLSFC  CK+ L +G+DI+IY
Sbjct  274   ILKCHPSELSNFVEETEEDTVLPRV-KSSETPALYSHDDFLSFCCKCKEPLPEGEDIYIY  332

Query  1199  RGEKAFCSSSCRS------EEILIDEEKEKTNKGGDDF  1294
             RGEKAFCS  CRS      EE + D +K   +K GD  
Sbjct  333   RGEKAFCSVECRSEVSDRIEEAVEDYDKSPKSKSGDKL  370



>ref|XP_002528195.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34202.1| conserved hypothetical protein [Ricinus communis]
Length=374

 Score =   222 bits (565),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 161/373 (43%), Positives = 207/373 (55%), Gaps = 47/373 (13%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DS+ ESH  S     KH  SSFFN P  FVG   +  SESDSVRSPTSPL+F   S+L
Sbjct  1     MADSALESHCQSDALGLKHISSSFFNFPGFFVGFGSRGSSESDSVRSPTSPLDFSFLSSL  60

Query  380   SN--TLRSQRS--SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN  +L+S RS     HQK+W  SKVGL II+ L D+TK  G +    K KNIIFG Q+ 
Sbjct  61    SNPFSLKSPRSPSQNDHQKNWNSSKVGLGIINLLADETKPPGVVLNSPKRKNIIFGSQV-  119

Query  548   CKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFN--LHNDSSYVLFGIGDAPLE-EGIS  718
              KT   +        + SLP++  +    + K  N  L   +S  +FG+    LE +   
Sbjct  120   -KTGYSVR-------SNSLPRDYMLLLLPKTKTLNRQLGKSNSEAVFGVEAVQLECKPFE  171

Query  719   SANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAK  898
             +++  + S  S      F S  +R + + S SF  + G            +   +S G K
Sbjct  172   NSSPITLSPKSPLISKKFCS-ENRTTTITSLSFFDDGG------------TPTDDSLGTK  218

Query  899   LRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNF  1057
               S+PVP        GS+S   IELSEDYTC+ ++GPNPK THIF DCILECH NE +NF
Sbjct  219   SSSLPVPIGSSKGYVGSLSARDIELSEDYTCIISYGPNPKTTHIFGDCILECHTNELSNF  278

Query  1058  SKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCR  1234
                 E            E +   PS +FLSFCYTCKKKL+ + DI++YRGEKAFCS +C 
Sbjct  279   DMGSELPQ---------ETNSPLPSDEFLSFCYTCKKKLETRDDIYMYRGEKAFCSFNCH  329

Query  1235  SEEILIDEEKEKT  1273
             SEEI  ++E EKT
Sbjct  330   SEEIFGEDETEKT  342



>gb|KHN16478.1| hypothetical protein glysoja_036580 [Glycine soja]
Length=422

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 182/431 (42%), Positives = 233/431 (54%), Gaps = 41/431 (10%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQ-MGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSE  322
             MLRKR RS QKDQ  M ++  +  S+SH + G      K  S FNVP LFVGL PK   +
Sbjct  1     MLRKRNRSVQKDQHLMCEVNSEHYSQSHHALG--RNNIKGHSIFNVPCLFVGLGPKGLLD  58

Query  323   SDSVRSPTSPLE-FRVFSTLS-NTLRSQRSSEGHQKSWGCSKVGLSIIDALDD--KTKRL  490
             SDSVRSPTSPL+  RV S L  N +R  RSS  H++SW C KVGL I+++L+D   ++  
Sbjct  59    SDSVRSPTSPLDDARVLSNLGKNPVRKPRSSH-HERSWDCCKVGLGIVESLEDCSSSRFS  117

Query  491   GNLPIPSKSKNIIFGPQMS-CKTQNFLNHSDS-FGAAKSLPKNIPIFPCTEPKPFNLHND  664
             G +    +SK +   PQM   K  N   H DS    +KSLPK+     C  P P+  H +
Sbjct  118   GKILQSPESKRVSLSPQMMMIKAPNCQIHRDSSLEGSKSLPKDF----CKAP-PYYAHQN  172

Query  665   SSYV------------LFGIGDAPLE-----EGISSANMrsrsldsgrsgsHFASFASRK  793
              S V            LF IG++ LE        S +      L +    + F S +   
Sbjct  173   GSVVIHKGECESESTVLFEIGESGLELEPFGRTRSCSLDSCSPLKALSGVTTFYSNSDTD  232

Query  794   SNLHSGSFGTEHGI--NSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYT  967
             +N       +       S  S N    +KL NS+   +        S+S S+IELSEDYT
Sbjct  233   NNFAVKDVSSPPRFIGGSQNSNNNFTPTKL-NSTTLSISPSNDIIKSLSASEIELSEDYT  291

Query  968   CVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSK-GPGCCEEHFSYPSSDFL  1144
             CV +HGPNPK THIF DCILE H+N F    KN E+E+G+   G         YPSSDFL
Sbjct  292   CVISHGPNPKTTHIFGDCILETHSNAFKTHFKNEEKEHGVKPLGSNKLGSPKPYPSSDFL  351

Query  1145  SFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK--TNKGGDDFEKPNSRE  1315
             SFC+ C KKL +GKDI+IY GEKAFCS +CR+ EI+IDEE EK  TN   +   KP   E
Sbjct  352   SFCHHCNKKLEEGKDIYIYGGEKAFCSLTCRAMEIMIDEELEKSNTNPPCESSPKPKLGE  411

Query  1316  EPYESSLFIAT  1348
               +E+ +  AT
Sbjct  412   LLFETGILTAT  422



>ref|XP_010915049.1| PREDICTED: uncharacterized protein LOC105040284 isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   220 bits (560),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 174/407 (43%), Positives = 232/407 (57%), Gaps = 41/407 (10%)
 Frame = +2

Query  122   FSRAI*GLR--TMLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPAL  292
             FSR   G R   MLR+R R  Q +Q+ G LMPD         GV  QK + +SFF+VP L
Sbjct  6     FSRWEEGSRFEIMLRQRRRPVQGEQRKGHLMPD---------GV-VQKARSTSFFSVPGL  55

Query  293   FVGLNPKQS-ESDSVRSPTSPLEFRVFSTLSNT-LRSQRSS--EGHQKSWGCSKVGLSII  460
             FVG + K S +S+S RSPTSPL+++VFS L  + +RS RS   EG  +SW C++VGL ++
Sbjct  56    FVGFSAKGSPDSESARSPTSPLDYKVFSNLGGSFVRSPRSPGPEGQPRSWDCTRVGLGLV  115

Query  461   DALDDKTKRLGNLPIPSKSKNIIFGPQMSC-----KTQNFLNHSDSFGAA-KSLPKNIPI  622
             D+L+D++K  G +   S+SKNI+ G Q+       KT    +  +  G A  SLP+N+ +
Sbjct  116   DSLNDESKAGGRVLGLSESKNILLGSQLRINIPTPKTLLDPSRDEPLGPAPNSLPENVRV  175

Query  623   FPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNL  802
                      +  +  S    G   A LE G      RS S D GRS      F  R    
Sbjct  176   SAQAHIGSPSSRSGCSKPAVGSKGAELEPG-QLGKTRSWSADIGRSSLPLTRFMYRNPKS  234

Query  803   HSGSFGTEHGINSAI--SQNVRELSKLGNSSGAKLRSMPVPAGS-------ISTSKIELS  955
              S  F ++   NS +  S+ V + +   N SG    S+P+  GS       +S S+IELS
Sbjct  235   SSEIFPSDLK-NSTLDASRLVSKPTNFDNLSG----SLPISFGSSRGFISSLSASEIELS  289

Query  956   EDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKN--GEEENGLSKGPGCCEEHFSYP  1129
             EDYTC+ +HGPNPK THI+ DCILE H     + SKN  G+E  G S    C  +    P
Sbjct  290   EDYTCIISHGPNPKTTHIYGDCILESHPIHSPD-SKNKLGKEGGGSSWLVKCPMDSPPSP  348

Query  1130  SSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             S+DFLS C+ CKKKL+GKDI++YRGEKAFCS +CR +EILI+EE EK
Sbjct  349   SNDFLSRCFFCKKKLEGKDIYMYRGEKAFCSCNCREQEILIEEETEK  395



>ref|XP_010915050.1| PREDICTED: uncharacterized protein LOC105040284 isoform X2 [Elaeis 
guineensis]
Length=405

 Score =   219 bits (558),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 169/395 (43%), Positives = 228/395 (58%), Gaps = 39/395 (10%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQS-ES  325
             MLR+R R  Q +Q+ G LMPD         GV  QK + +SFF+VP LFVG + K S +S
Sbjct  1     MLRQRRRPVQGEQRKGHLMPD---------GV-VQKARSTSFFSVPGLFVGFSAKGSPDS  50

Query  326   DSVRSPTSPLEFRVFSTLSNT-LRSQRSS--EGHQKSWGCSKVGLSIIDALDDKTKRLGN  496
             +S RSPTSPL+++VFS L  + +RS RS   EG  +SW C++VGL ++D+L+D++K  G 
Sbjct  51    ESARSPTSPLDYKVFSNLGGSFVRSPRSPGPEGQPRSWDCTRVGLGLVDSLNDESKAGGR  110

Query  497   LPIPSKSKNIIFGPQM-----SCKTQNFLNHSDSFGAA-KSLPKNIPIFPCTEPKPFNLH  658
             +   S+SKNI+ G Q+     + KT    +  +  G A  SLP+N+ +         +  
Sbjct  111   VLGLSESKNILLGSQLRINIPTPKTLLDPSRDEPLGPAPNSLPENVRVSAQAHIGSPSSR  170

Query  659   NDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGIN  838
             +  S    G   A LE G      RS S D GRS      F  R     S  F ++   N
Sbjct  171   SGCSKPAVGSKGAELEPG-QLGKTRSWSADIGRSSLPLTRFMYRNPKSSSEIFPSDLK-N  228

Query  839   SAI--SQNVRELSKLGNSSGAKLRSMPVPAGS-------ISTSKIELSEDYTCVRTHGPN  991
             S +  S+ V + +   N SG    S+P+  GS       +S S+IELSEDYTC+ +HGPN
Sbjct  229   STLDASRLVSKPTNFDNLSG----SLPISFGSSRGFISSLSASEIELSEDYTCIISHGPN  284

Query  992   PKVTHIFCDCILECHNNEFTNFSKN--GEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCK  1165
             PK THI+ DCILE H     + SKN  G+E  G S    C  +    PS+DFLS C+ CK
Sbjct  285   PKTTHIYGDCILESHPIHSPD-SKNKLGKEGGGSSWLVKCPMDSPPSPSNDFLSRCFFCK  343

Query  1166  KKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             KKL+GKDI++YRGEKAFCS +CR +EILI+EE EK
Sbjct  344   KKLEGKDIYMYRGEKAFCSCNCREQEILIEEETEK  378



>ref|XP_010925327.1| PREDICTED: uncharacterized protein LOC105047898 isoform X2 [Elaeis 
guineensis]
Length=416

 Score =   214 bits (544),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 175/436 (40%), Positives = 242/436 (56%), Gaps = 57/436 (13%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SES  325
             MLRKR+R  Q +Q  G LMPDS+S+S  S+    QK + +SFF+VP LFVGL+ K   +S
Sbjct  1     MLRKRSRPVQSEQSKGLLMPDSASDSSFSANGAVQKARSASFFSVPGLFVGLSTKVLPDS  60

Query  326   DSVRSPTSPLEFRVFSTL-SNTLRSQRSS--EGHQKSWGCSKVGLSIIDALDDKTKRLGN  496
             +S +SPTSPL+ +VFS   S+ +RS RS   EG  +SW CSKVGL ++D+L+D++K  G 
Sbjct  61    ESAKSPTSPLDSKVFSNRGSSFVRSPRSPGPEGQPRSWHCSKVGLGLVDSLNDESKAGGK  120

Query  497   LPIPSKSKNIIFGPQMSCKT---QNFLN---HSDSFGAA--KSLPKNIPIFPCTEPKPFN  652
             +   S+S +I+ G +M       +  L+     +  GA   KSLP+N+    CT+P    
Sbjct  121   VLGFSESSSILLGSRMRINIPTPKTLLDGGIRDELLGAVTPKSLPENVGT--CTKPG-IG  177

Query  653   LHNDS---SYVLFGIGDAPLEEG-----------ISSANMrsrsldsgrsgsHFASFAS-  787
             L +     S +  G   A LE G           I S+++R          S    F S 
Sbjct  178   LPSSRFCCSKLAIGSKGAELEPGEFGKIRCWSIDIGSSSLRPTLFMYHNRRSGSEIFPSD  237

Query  788   -RKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGS-------ISTSK  943
              + S L S +              VR+ +   N SG    S+P+  GS       +S S+
Sbjct  238   SKNSKLDSPAL-------------VRKATNFDNFSG----SLPMSFGSSRGFMASLSASE  280

Query  944   IELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN-FSKNGEEENGLSKGPGCCEEHF  1120
             IELSEDYTC+ +HGPNPK THIF DCILE H     +  +K G+E  G S    C E+  
Sbjct  281   IELSEDYTCIISHGPNPKTTHIFGDCILESHRIPSPDSMNKLGKEGGGSSWLVECPEDSP  340

Query  1121  SYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEK  1300
                S+DFLS C++CKKKL+GKDIF+YRGEKAFCS  CR++EILI+EE EK      D   
Sbjct  341   PCASNDFLSNCFSCKKKLEGKDIFMYRGEKAFCSCDCRNKEILIEEEMEKPATDSSDSPC  400

Query  1301  PNSREEPYESSLFIAT  1348
              +  EE + + + +A+
Sbjct  401   SSFHEEIFMAGMAVAS  416



>ref|XP_010925325.1| PREDICTED: uncharacterized protein LOC105047898 isoform X1 [Elaeis 
guineensis]
Length=444

 Score =   214 bits (544),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 174/426 (41%), Positives = 243/426 (57%), Gaps = 37/426 (9%)
 Frame = +2

Query  152   MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SES  325
             MLRKR+R  Q +Q  G LMPDS+S+S  S+    QK + +SFF+VP LFVGL+ K   +S
Sbjct  29    MLRKRSRPVQSEQSKGLLMPDSASDSSFSANGAVQKARSASFFSVPGLFVGLSTKVLPDS  88

Query  326   DSVRSPTSPLEFRVFSTL-SNTLRSQRSS--EGHQKSWGCSKVGLSIIDALDDKTKRLGN  496
             +S +SPTSPL+ +VFS   S+ +RS RS   EG  +SW CSKVGL ++D+L+D++K  G 
Sbjct  89    ESAKSPTSPLDSKVFSNRGSSFVRSPRSPGPEGQPRSWHCSKVGLGLVDSLNDESKAGGK  148

Query  497   LPIPSKSKNIIFGPQMSCKT---QNFLN---HSDSFGAA--KSLPKNIPIFPCTEPKPFN  652
             +   S+S +I+ G +M       +  L+     +  GA   KSLP+N+    CT+P    
Sbjct  149   VLGFSESSSILLGSRMRINIPTPKTLLDGGIRDELLGAVTPKSLPENVGT--CTKPG-IG  205

Query  653   LHNDS---SYVLFGIGDAPLEEG-ISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFG  820
             L +     S +  G   A LE G        S  + S         + +R+S   S  F 
Sbjct  206   LPSSRFCCSKLAIGSKGAELEPGEFGKIRCWSIDIGSSSLRPTLFMYHNRRSG--SEIFP  263

Query  821   TEHGINSAISQN--VRELSKLGNSSGAKLRSMPVPAGS-------ISTSKIELSEDYTCV  973
             ++   NS +     VR+ +   N SG    S+P+  GS       +S S+IELSEDYTC+
Sbjct  264   SDSK-NSKLDSPALVRKATNFDNFSG----SLPMSFGSSRGFMASLSASEIELSEDYTCI  318

Query  974   RTHGPNPKVTHIFCDCILECHNNEFTN-FSKNGEEENGLSKGPGCCEEHFSYPSSDFLSF  1150
              +HGPNPK THIF DCILE H     +  +K G+E  G S    C E+     S+DFLS 
Sbjct  319   ISHGPNPKTTHIFGDCILESHRIPSPDSMNKLGKEGGGSSWLVECPEDSPPCASNDFLSN  378

Query  1151  CYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYES  1330
             C++CKKKL+GKDIF+YRGEKAFCS  CR++EILI+EE EK      D    +  EE + +
Sbjct  379   CFSCKKKLEGKDIFMYRGEKAFCSCDCRNKEILIEEEMEKPATDSSDSPCSSFHEEIFMA  438

Query  1331  SLFIAT  1348
              + +A+
Sbjct  439   GMAVAS  444



>gb|KEH39801.1| DUF581 family protein [Medicago truncatula]
Length=345

 Score =   203 bits (517),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 146/381 (38%), Positives = 197/381 (52%), Gaps = 49/381 (13%)
 Frame = +2

Query  242   VFAQKHKVSSFFNVPALFVGLNPKQSESDSVRSPTSPLE-FRVFSTLSNTLRSQRSSEGH  418
                   K  S F  P L+VGL     +SDS+RSPTSPL+   + S   NTLR+   ++G 
Sbjct  2     ALGSNEKRKSIFKAPLLYVGLG---MDSDSLRSPTSPLDDVTLLSNRGNTLRTSPPNQGQ  58

Query  419   QKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGP----QMSCKTQNFLNHSDSF  586
             ++ W C+KVGLSIID+L+D +K   N+ + S+     F P    QM  K  N  +  DS 
Sbjct  59    KRGWNCTKVGLSIIDSLEDCSKFSRNVLLSSEFNKGSFSPNPSPQMITKVTNCNHCLDSV  118

Query  587   GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgs  766
              A+KSLPK+    P T+      H   S V+F IG+  LE                    
Sbjct  119   MASKSLPKDFFKLPYTKNNSV-FHKGESNVVFEIGEPLLE--------------------  157

Query  767   HFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAG----SIS  934
                         H   FG     +  +   ++            L+ +  P      S+S
Sbjct  158   ------------HELPFGKSMSCSLDLYSPIKNSKFDSKCENFCLKPVSFPNTLLPVSLS  205

Query  935   TSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP--GCC  1108
              S+IE SEDYTCV +HGPNPK THIFCDCILE H ++     +N  EE G S  P  G  
Sbjct  206   ASEIENSEDYTCVISHGPNPKKTHIFCDCILEVHADDDVKKHQNKNEEEG-SSSPVVGRL  264

Query  1109  EEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGG  1285
             E    +PS++FL+FC  C KKLD GKDI+IYRGEK+FCS +CR+ EI+IDEE EK+N+  
Sbjct  265   ETPNQFPSAEFLTFCNHCNKKLDEGKDIYIYRGEKSFCSLACRAFEIMIDEELEKSNEPP  324

Query  1286  DDFEKPNSREEPYESSLFIAT  1348
             ++  +  S EE + S +F A 
Sbjct  325   ENSIELESGEEHFGSGIFTAV  345



>ref|XP_011002688.1| PREDICTED: uncharacterized protein LOC105109635 [Populus euphratica]
 ref|XP_011002689.1| PREDICTED: uncharacterized protein LOC105109635 [Populus euphratica]
Length=371

 Score =   204 bits (518),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 147/373 (39%), Positives = 194/373 (52%), Gaps = 44/373 (12%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSES-DSVRSPTSPLEFRVFSTL  379
             M DS +E++     F+ +H  SSFFN+P  FVG   + S+  DSVRSP SPL+F  F+ L
Sbjct  1     MADSDTETNSQPDTFSLRHLRSSFFNIPGFFVGCGYRGSQDFDSVRSPQSPLDFSFFTNL  60

Query  380   SNTL--RSQR-SSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSC  550
             SN    RS R   +  QK W C+KVGL I+  L D+TK  G +    K K IIF PQ+  
Sbjct  61    SNPFSNRSPRLPCQNVQKKWECNKVGLGIVHLLVDETKPTGEVLDSDKRKTIIFAPQVK-  119

Query  551   KTQNFLNHSDSFGAAKS--LPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSA  724
                       +F + KS  LP+N  I   ++ K  +     S   FG     LE      
Sbjct  120   ----------TFSSVKSNSLPRNYTI-SLSKTKTSSPRLGKSEGAFGSEGVLLE------  162

Query  725   NMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAIS--QNVRELSKLGNSSGAK  898
                          S     A+ K N  S  F +E+   S  S    + + S+   S   K
Sbjct  163   -------TKPFESSSVIGLATSKPNSSSQKFYSENRTTSTRSFPLEICDCSQTNRSLVIK  215

Query  899   LRSMPVPAG-------SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNF  1057
               S+P+  G       S+S  +IELSEDYTC+ +HGPNPK TH+F D ILECH+NE +NF
Sbjct  216   PNSLPITVGPGQGYVGSLSAREIELSEDYTCIISHGPNPKTTHVFGDYILECHSNELSNF  275

Query  1058  SKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCR  1234
              K    EN   K P   +    +P  +FLSFCY+CKKKL+  +DI++YRGEK FCS  C 
Sbjct  276   DKT---ENLGIKLPQEAKHPSPFPPDEFLSFCYSCKKKLEKAEDIYMYRGEKVFCSFDCH  332

Query  1235  SEEILIDEEKEKT  1273
             SEE   ++E EKT
Sbjct  333   SEEAFAEQETEKT  345



>ref|XP_002299638.1| hypothetical protein POPTR_0001s17990g [Populus trichocarpa]
 gb|EEE84443.1| hypothetical protein POPTR_0001s17990g [Populus trichocarpa]
Length=374

 Score =   201 bits (512),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 144/373 (39%), Positives = 190/373 (51%), Gaps = 41/373 (11%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSES-DSVRSPTSPLEFRVFSTL  379
             M DS +E++     F+ +H  SSFFN+P  FVG   + S+  DSVRSP SPL+F  F+ L
Sbjct  1     MADSDTETNSQPDTFSLRHLRSSFFNIPGFFVGCGYRGSQDFDSVRSPQSPLDFSFFTNL  60

Query  380   SNTL--RSQR-SSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSC  550
             SN    RS R   +  QK W C+KVGL I+  L D+TK  G +    K K IIF PQ+  
Sbjct  61    SNPFSNRSPRLPCQNVQKKWDCNKVGLGIVHLLVDETKPTGEVLDSDKRKTIIFAPQVK-  119

Query  551   KTQNFLNHSDSFGAAKS--LPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSA  724
                       +F + KS  LP+N  I         +    SS  L     A   EG+   
Sbjct  120   ----------TFSSVKSNSLPRNYTI-------SLSRTKTSSPRLGKSDGAFGSEGV---  159

Query  725   NMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAIS--QNVRELSKLGNSSGAK  898
                          S     A+ K NL S  F +E+   S  S    + + S+   S   K
Sbjct  160   ----LLETKPFESSSVIGLATSKPNLSSQKFYSENITTSTRSFPLEICDCSQTNKSLVIK  215

Query  899   LRSMPVPAGS-------ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNF  1057
               S+P+  GS       +S  +IELSEDYTC+ +HGPNPK TH+F D ILECH+NE +NF
Sbjct  216   PNSLPITVGSGQGYVGSLSAREIELSEDYTCIISHGPNPKTTHVFGDYILECHSNELSNF  275

Query  1058  SKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCR  1234
              K       L +     +    +P  +F SFCY+CKKKL+  +DI++YRGEK FCS  C 
Sbjct  276   DKTENPGIKLPQEAKHPKHPTPFPPDEFFSFCYSCKKKLEKAEDIYMYRGEKVFCSFDCH  335

Query  1235  SEEILIDEEKEKT  1273
             SEE   + E EKT
Sbjct  336   SEETFAERETEKT  348



>gb|KHG30602.1| Ig mu chain C region [Gossypium arboreum]
Length=462

 Score =   201 bits (512),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 150/386 (39%), Positives = 206/386 (53%), Gaps = 55/386 (14%)
 Frame = +2

Query  194   GQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVF  370
             G +M D   +S         +H  SS FN+P   VG + K  S+SD+VRSPTSPL+ RVF
Sbjct  3     GSVMADPDPDS----STLGLRHISSSLFNIPGFLVGFSTKGSSDSDAVRSPTSPLDLRVF  58

Query  371   STLSN--TLRSQRSSE--GHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGP  538
             +  SN  T+RS RSS   G QK   CSK+GL I++ L D  K  G      K  NI+FGP
Sbjct  59    ANFSNPFTVRSPRSSSQSGCQKKCDCSKIGLGIVNLLADDIKPDGGDLDSPKRMNIVFGP  118

Query  539   QMSCK-------TQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDA  697
             Q+  K       ++ +L +S     + SLP+N  I    + +     +  S   FG  + 
Sbjct  119   QVKTKFPYSSRYSREYLGNS---MKSNSLPRNYIISQLFQARK---SSTKSADYFGNEEV  172

Query  698   PLEE----GISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRE  865
              +E     G+S +               F S +S   N+ S SF +E   N+  S N   
Sbjct  173   SVEPKTDLGLSPS---------------FIS-SSENLNMSSESFCSE---NATFSTNSSP  213

Query  866   LS-----KLGNSSGAKLRSMPVPAG----SISTSKIELSEDYTCVRTHGPNPKVTHIFCD  1018
             L      ++ NS  +K  S+P+       S+ST +IELSEDYTC+ +HGPNPK TH+F D
Sbjct  214   LPIGRPLQVDNSLVSKPSSLPILLSHSMVSLSTHEIELSEDYTCIISHGPNPKTTHLFGD  273

Query  1019  CILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFI  1195
             CILECHNNE T F +  E    +       E    + S ++LSFCYTCKK+L+  +++++
Sbjct  274   CILECHNNELTIFDRKVESGTNVPPPAKSRETSTLHLSDEYLSFCYTCKKQLEKDEEVYM  333

Query  1196  YRGEKAFCSSSCRSEEILIDEEKEKT  1273
             +RGEKAFCS  C +EEI  DEE EKT
Sbjct  334   HRGEKAFCSFDCCTEEIFADEEMEKT  359



>ref|XP_010048088.1| PREDICTED: uncharacterized protein LOC104436935 [Eucalyptus grandis]
 gb|KCW80219.1| hypothetical protein EUGRSUZ_C01570 [Eucalyptus grandis]
Length=380

 Score =   199 bits (506),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 153/376 (41%), Positives = 201/376 (53%), Gaps = 50/376 (13%)
 Frame = +2

Query  152   MLRKRTRSQ-KDQQMGQ-LMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SE  322
             ML KR RS  KD+QM Q  + +   E +L+S       K ++ FN+P LFVGL PK+ S+
Sbjct  1     MLGKRARSVLKDRQMAQRTVANPDCELNLNS-------KRNTLFNLPGLFVGLTPKRLSD  53

Query  323   SDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQKSWGCSKVGLSIIDALDDKTKRL-GNL  499
             S+S  SPTSPL+F+ FSTL+N  +S +S + H+K W   KVGLSI+D+LDD  K L G +
Sbjct  54    SESANSPTSPLDFKAFSTLTNPNKSPKSPQ-HKKVWDRDKVGLSIVDSLDDHAKALPGKV  112

Query  500   PIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVL  679
                S SK    G QM  K  NF   +    AAKSLPKN          P  L + +S V+
Sbjct  113   HQSSNSKTFNLGHQMRPKNPNFDTDTRPVEAAKSLPKNYAFSHTHLKSP--LRDTNSNVV  170

Query  680   FGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINS--AISQ  853
             F IG    + G                   F    +R  +L+S +      +NS   +S+
Sbjct  171   FEIGVDLQDTG------------------PFG--KTRSCSLNSCTI-----VNSPSKLSE  205

Query  854   NVRELSKLGNSSGAKLRSMPVPA-------GSISTSKIELSEDYTCVRTHGPNPKVTHIF  1012
             +  + +    S  + L + PV          S+   +IELSEDYTC+  HGPN K THIF
Sbjct  206   SNPKSNNFFRSDQSSLLASPVSGNGINGLIASLPKKEIELSEDYTCITLHGPNKKTTHIF  265

Query  1013  CDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDI  1189
              DCILEC +N   +      + N LS      E    YPS  FLSFC+ CKK L +GKDI
Sbjct  266   GDCILECQSNGTMDI-HGTSQNNRLSSLSKTSEALTLYPSDIFLSFCFHCKKILEEGKDI  324

Query  1190  FIYRGEKAFCSSSCRS  1237
             ++YRGEKAFCSS CRS
Sbjct  325   YMYRGEKAFCSSQCRS  340



>ref|XP_006595139.1| PREDICTED: uncharacterized protein LOC100793953 isoform X1 [Glycine 
max]
 ref|XP_006595140.1| PREDICTED: uncharacterized protein LOC100793953 isoform X2 [Glycine 
max]
 ref|XP_006595141.1| PREDICTED: uncharacterized protein LOC100793953 isoform X3 [Glycine 
max]
 gb|KHN32601.1| hypothetical protein glysoja_022283 [Glycine soja]
Length=398

 Score =   199 bits (506),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 153/384 (40%), Positives = 204/384 (53%), Gaps = 38/384 (10%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DSSS   L     + + K  S F+     +G+  K   +S+SV SPTSPL+ R+FS L
Sbjct  1     MADSSSNFSLPCDALSLRQKSFSIFHTGGSRLGVGAKGLPDSESVWSPTSPLDCRLFSNL  60

Query  380   SNTLRSQRS----SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN   ++ S      GH+K +  SKVGL II +L ++TK   ++    K K IIFGPQ+ 
Sbjct  61    SNPFSAKSSRPSFQTGHKKQFDGSKVGLGIISSLANETKLNNDILAKFKRKGIIFGPQVK  120

Query  548   CKTQNFLNHSDS----FGAAKSLPKNIPI-------FPCTEPKPFNLHNDSSYVLFGIGD  694
                  F N++      +  + SLPKN  I        P +E + F+   D S    G  D
Sbjct  121   TGILKFSNNNQESLVPYLKSNSLPKNYVISLPSETTIPKSELENFD---DVS----GKKD  173

Query  695   APLE-EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAIS--QNVRE  865
                E E   S         S  S  +    +++ SNL     G  +  +  +S  Q   +
Sbjct  174   DYWECEAFKSTITSLPDSFSPSSLIN----STQNSNLGINELGVGNNASVLMSLPQVTSK  229

Query  866   LSKLGNSSGAKLRSMPVPA-------GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCI  1024
             +S++GNS   K  S+P+         GS+S  +IELSEDYTC+ +HGPNPK THIF DCI
Sbjct  230   VSQVGNSLKIKSNSLPISIDFSKGCIGSLSAREIELSEDYTCIISHGPNPKRTHIFGDCI  289

Query  1025  LECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYR  1201
             LECHN++FT FSK  E     S+ P   +    YPS + LSFCY+C KKL   +DI+ YR
Sbjct  290   LECHNHDFTEFSKKEEPAFSYSQVPSFSDGSAPYPSDNVLSFCYSCNKKLVKEEDIYRYR  349

Query  1202  GEKAFCSSSCRSEEILIDEEKEKT  1273
             GEKAFCS  C SEEIL  EE EKT
Sbjct  350   GEKAFCSFECGSEEILTGEELEKT  373



>ref|XP_006465550.1| PREDICTED: uncharacterized protein LOC102619830 isoform X1 [Citrus 
sinensis]
 ref|XP_006465551.1| PREDICTED: uncharacterized protein LOC102619830 isoform X2 [Citrus 
sinensis]
Length=375

 Score =   196 bits (499),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 204/374 (55%), Gaps = 40/374 (11%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DS+SE  + S  F  +   SS   +    VGL+ K  S+SD+V SPTSPL+FR F  L
Sbjct  1     MADSASEFSIQSDSFGIRQISSS---LSGFLVGLSSKGSSDSDTVWSPTSPLDFRAFVNL  57

Query  380   SN--TLRSQRS--SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN  +++S RS    G+QK W  S+VGL II++L ++ +    +    K KNI+FG Q+ 
Sbjct  58    SNPFSVKSPRSPPQNGYQKKWDSSEVGLGIINSLAEEKESTSAVCNSLKRKNIVFGSQVK  117

Query  548   ----CKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGI  715
                   +++F     SF  + SLP+N  I    + K      DSS  + G  + P + G 
Sbjct  118   NNIPYSSRHFYESVSSFMKSNSLPRNYMISQLPQTKNPKFPFDSSNSVVGNTEFPSQSGS  177

Query  716   SSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGA  895
              S++                + +++  +L S  F   +  +S I+ +   +  +      
Sbjct  178   FSSS---------------LTSSAQNQDLRSKMF---YSADSTITLSAPLV--IDRDLLV  217

Query  896   KLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN  1054
             K  S+P+P       AGS+S   IELSEDYTC+ +HGPNPK T IF DCIL+C  +E TN
Sbjct  218   KTSSLPIPIGSGHGHAGSLSARDIELSEDYTCIISHGPNPKTTRIFGDCILDCQAHELTN  277

Query  1055  FSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSC  1231
             F K  E+E  L++      +   Y S +FLSFCY+CKKKL+ G+DI++Y GEKAFCS  C
Sbjct  278   FDKQIEQEVELTQVSERPNDLSHYSSDEFLSFCYSCKKKLEKGEDIYMYGGEKAFCSFDC  337

Query  1232  RSEEILIDEEKEKT  1273
             RS+EI  +EE  K 
Sbjct  338   RSDEIFTEEEMGKA  351



>ref|XP_009409336.1| PREDICTED: uncharacterized protein LOC103991566 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=419

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 150/389 (39%), Positives = 202/389 (52%), Gaps = 51/389 (13%)
 Frame = +2

Query  146   RTMLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SE  322
             R MLR   + QKD   GQL+ DS+S+S  SS    QK + ++ F+VP LFVG + K  SE
Sbjct  27    REMLRGMNKVQKDHCKGQLLSDSTSDSCFSSNGLIQKARNATLFSVPGLFVGFSAKGLSE  86

Query  323   SDSVRSPTSPLEFRVFSTLSNT-LRSQRSS--EGHQKSWGCSKVGLSIIDALDDKTKRLG  493
             SD+VRSPTSPL+++ FS L ++ L   RS+  +G  + W  ++VGL ++D L+D+TK  G
Sbjct  87    SDAVRSPTSPLDYKGFSNLGHSFLGFSRSASLDGKPRCWDRTRVGLRLVDTLNDETKPCG  146

Query  494   NLPIPSKSKNIIFGPQMSCKTQNFLNH-----SDSFGAAKSLPKNIPIFPCTEPKPFNLH  658
              L   S+S NI+F P+M     +   H      D  GAA   PK++P    T P+     
Sbjct  147   KLLGLSESSNILFAPRMRINISSPKPHLVGPGDDCTGAA---PKSLPKDYRTSPQTGRSK  203

Query  659   NDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGIN  838
                S      G+  L    S     S S             +  KS++  GS        
Sbjct  204   GAESEC----GEVGLLRSCSVVVSTSSSTPIDSKSESEVFASDSKSSMAEGS--------  251

Query  839   SAISQNVRELSKLGNSSGAKLRSMPVPAG--------SISTSKIELSEDYTCVRTHGPNP  994
                  N  +LS           S+PV  G        S+S S+IE SEDYTC+ +HGPNP
Sbjct  252   ----ANFDKLSG----------SLPVSIGGSPCGVIASLSASEIEQSEDYTCIISHGPNP  297

Query  995   KVTHIFCDCILECH---NNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCK  1165
             K THIF DCILE H   + +     +  EE +     P   E+    PS DFL  C++CK
Sbjct  298   KTTHIFGDCILESHSFPSRDLRKKHRKDEERSAWMLKPS-EEDAPPCPSGDFLRCCFSCK  356

Query  1166  KKL-DGKDIFIYRGEKAFCSSSCRSEEIL  1249
             KKL +GKDI++YRGEKAFCS  CR +EIL
Sbjct  357   KKLEEGKDIYMYRGEKAFCSCDCRDQEIL  385



>ref|XP_010098043.1| hypothetical protein L484_026173 [Morus notabilis]
 gb|EXB74480.1| hypothetical protein L484_026173 [Morus notabilis]
Length=399

 Score =   195 bits (495),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 152/382 (40%), Positives = 202/382 (53%), Gaps = 33/382 (9%)
 Frame = +2

Query  200   LMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESDSVRSPTSPLEFRVFSTL  379
             LM DS  ES + S     +H   S F++P  FVG     S+SDS+RSPTSPL+  VFS L
Sbjct  5     LMADSDPESEIPSDTLGLRHISGSLFSIPGFFVGFGKGSSDSDSIRSPTSPLDIGVFSNL  64

Query  380   SN--TLRSQRSS----EGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQ  541
              N    R  RSS     G QK W  SKVGL I+++L D T   G L IP +  NIIFG Q
Sbjct  65    KNPANCRYARSSSLSQNGFQKEWHYSKVGLGIVNSLVDDTTG-GVLDIPKQ--NIIFGSQ  121

Query  542   MSCKTQN----FLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLE-  706
             +   T N    + +  DS   +KSLP N      ++ K       +  V+    + PLE 
Sbjct  122   VKTNTTNSFKDYHDSLDSSLKSKSLPTNYIASRLSQTKCLKSQLGAKNVVIDGKEVPLES  181

Query  707   EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNS  886
             E   +  +         S   F    S   NL S +F +E     + S  +    ++ NS
Sbjct  182   EPYKNTPLCFSDSTVPSSLVSF----SYTHNLRSENFCSEAKTRMSSSLVIGTAFEVENS  237

Query  887   SGAKLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
                K  ++P+P        GS+S  ++ELSEDYTC+ +HGPNPK  HIF DC+LEC  NE
Sbjct  238   LSIKPSTVPIPIGPSQGYVGSLSKREMELSEDYTCIISHGPNPKTIHIFGDCVLECCANE  297

Query  1046  FTNFSKNGEEENGLSKGPGCC---EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKA  1213
               NF K  +EE G+ K P      E+     S + L+FCY+CK+KL + KDI++YRGEKA
Sbjct  298   TENFGK--KEELGI-KSPQVAANSEDLGPVHSDEVLTFCYSCKRKLVEDKDIYMYRGEKA  354

Query  1214  FCSSSCRSEEILIDEEKEKTNK  1279
             FCS  C  +EI  DEE EKT++
Sbjct  355   FCSFDCCLDEI-SDEETEKTDQ  375



>ref|XP_004302916.1| PREDICTED: uncharacterized protein LOC101296975 [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   193 bits (491),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 144/363 (40%), Positives = 186/363 (51%), Gaps = 44/363 (12%)
 Frame = +2

Query  230   LSSGVFAQKHKVSSFFNVPALFVGLNPKQS-ESDSVRSPTSPLEFRVFSTLSN--TLRSQ  400
             + S     KH  S  F++P  FVG   K S +SDSVRSPTSPL+ R FS LSN   LRS 
Sbjct  2     VDSSSLKLKHTSSILFSIPDFFVGFGNKGSLDSDSVRSPTSPLDLRPFSNLSNPFRLRSA  61

Query  401   RS--SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQM------SCKT  556
             RS    G+ K W C K GL I+++L D+TK    +   SK K IIF PQ+      S K 
Sbjct  62    RSLSQNGNHKIWDCRKAGLGIVNSLVDETKATSEVLGSSKRKTIIFRPQLEKINPHSSKL  121

Query  557   QNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLE-EGISSANMr  733
             ++     D F  ++SLP+N  I P +E     L      V    G   L  E   S N+ 
Sbjct  122   RS--GSKDYFMKSRSLPRNYIIRPLSETISLRLQLKPDKVDVSSGSVGLLLESEPSENIA  179

Query  734   srsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMP  913
                         F   +SR S+       +  G NS        L    +S  A + S P
Sbjct  180   P-----------FLLDSSRASS----QIVSMQGENS--------LGFRPSSLPAPIVSNP  216

Query  914   VPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSK  1093
               A SI   ++ELSEDYTC+ +HGPNPK THIFCDCILECH  +  N  K   E     K
Sbjct  217   QSASSIPAREMELSEDYTCIISHGPNPKTTHIFCDCILECHTKDLNNVDKETVE----IK  272

Query  1094  GP--GCCEEHFSY-PSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEK  1264
              P  G  +E  ++ PS + L  CYTC+K L+G++I++ R EKAFCS  C S++I  +EE 
Sbjct  273   APQLGKHQEGLTHDPSDELLGSCYTCQKNLEGEEIYMCRSEKAFCSFDCHSDKIFAEEEA  332

Query  1265  EKT  1273
             E T
Sbjct  333   EGT  335



>ref|XP_009409338.1| PREDICTED: uncharacterized protein LOC103991566 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=391

 Score =   194 bits (493),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 145/380 (38%), Positives = 200/380 (53%), Gaps = 37/380 (10%)
 Frame = +2

Query  152   MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SESD  328
             MLR   + QKD   GQL+ DS+S+S  SS    QK + ++ F+VP LFVG + K  SESD
Sbjct  1     MLRGMNKVQKDHCKGQLLSDSTSDSCFSSNGLIQKARNATLFSVPGLFVGFSAKGLSESD  60

Query  329   SVRSPTSPLEFRVFSTLSNT-LRSQRSS--EGHQKSWGCSKVGLSIIDALDDKTKRLGNL  499
             +VRSPTSPL+++ FS L ++ L   RS+  +G  + W  ++VGL ++D L+D+TK  G L
Sbjct  61    AVRSPTSPLDYKGFSNLGHSFLGFSRSASLDGKPRCWDRTRVGLRLVDTLNDETKPCGKL  120

Query  500   PIPSKSKNIIFGPQMSCKTQNFLNH-----SDSFGAAKSLPKNIPIFPCTEPKPFNLHND  664
                S+S NI+F P+M     +   H      D  GAA   PK++P    T P+       
Sbjct  121   LGLSESSNILFAPRMRINISSPKPHLVGPGDDCTGAA---PKSLPKDYRTSPQTGR----  173

Query  665   SSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSA  844
                           +G  S       L S       +S     S   S  F ++    S+
Sbjct  174   -------------SKGAESECGEVGLLRSCSVVVSTSSSTPIDSKSESEVFASDS--KSS  218

Query  845   ISQNVRELSKLGNSSGAKLRSMPVPA-GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDC  1021
             +++      KL  S    +   P     S+S S+IE SEDYTC+ +HGPNPK THIF DC
Sbjct  219   MAEGSANFDKLSGSLPVSIGGSPCGVIASLSASEIEQSEDYTCIISHGPNPKTTHIFGDC  278

Query  1022  ILECH---NNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDI  1189
             ILE H   + +     +  EE +     P   E+    PS DFL  C++CKKKL +GKDI
Sbjct  279   ILESHSFPSRDLRKKHRKDEERSAWMLKPS-EEDAPPCPSGDFLRCCFSCKKKLEEGKDI  337

Query  1190  FIYRGEKAFCSSSCRSEEIL  1249
             ++YRGEKAFCS  CR +EIL
Sbjct  338   YMYRGEKAFCSCDCRDQEIL  357



>ref|XP_008228506.1| PREDICTED: uncharacterized protein LOC103327911 [Prunus mume]
Length=382

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 154/391 (39%), Positives = 201/391 (51%), Gaps = 45/391 (12%)
 Frame = +2

Query  236   SGVFAQKHKVSSFFNVPALFVGL-NPKQSESDSVRSPTSPLEFRVFSTLSN--TLRSQR-  403
             S + + KH  +S F++P  F G  N   S+SDSVRSPTSPL+FRV   LSN  +L+S R 
Sbjct  4     SNMLSLKHTSNSLFSIPGFFTGFGNKGSSDSDSVRSPTSPLDFRVLYNLSNPFSLKSGRP  63

Query  404   -SSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQN----FL  568
              S  G+Q  W CS  GL I+++L D+TK    +    K KNIIFG Q+     N    + 
Sbjct  64    SSQNGNQTKWDCSIEGLGIVNSLGDETKATSEVIGSPKRKNIIFGSQVKTNVSNSSKIYY  123

Query  569   NHSDSFGAAKSLPKN-IPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsl  745
             +  D    +KSL +N I + P  +    N         FG    PLE    S N+ S  L
Sbjct  124   DSDDCPIKSKSLNRNYITLDPEHQADKVN-------GFFGSVGRPLESE-PSENIASFLL  175

Query  746   dsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVP--  919
             +S  S    + +     NL   S  +     S      R   ++ NS G K  S+PVP  
Sbjct  176   NSSGSSQSGSMY---DPNLRFKSLDSVDKTLSLSLLLGRSF-QVENSVGFKPSSLPVPIA  231

Query  920   -----AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNF--SKNGEEE  1078
                  A SIS  +IELSEDYTC+ +HGP PK THIF DCILECH NE  NF  +K   E 
Sbjct  232   STHQYASSISAREIELSEDYTCIISHGPKPKTTHIFGDCILECHTNELNNFDEAKLWIES  291

Query  1079  NGLSKGPG-CCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILID  1255
               ++K       EH+     + L FCYTCKK L+G+++++ RGEKAFCS  C SE+I  +
Sbjct  292   PRVAKYQDRLANEHW----DEALRFCYTCKKNLEGEELYMCRGEKAFCSFDCHSEKIFAE  347

Query  1256  EEKEKT--NKGGDDFEKPNSREEPYESSLFI  1342
              E E T  N  G       S  E Y   LF+
Sbjct  348   GEIESTCDNSAG-------SSSESYHEDLFL  371



>ref|XP_008793450.1| PREDICTED: uncharacterized protein LOC103709740 [Phoenix dactylifera]
 ref|XP_008793451.1| PREDICTED: uncharacterized protein LOC103709740 [Phoenix dactylifera]
 ref|XP_008793452.1| PREDICTED: uncharacterized protein LOC103709740 [Phoenix dactylifera]
 ref|XP_008793453.1| PREDICTED: uncharacterized protein LOC103709740 [Phoenix dactylifera]
 ref|XP_008793454.1| PREDICTED: uncharacterized protein LOC103709740 [Phoenix dactylifera]
 ref|XP_008793455.1| PREDICTED: uncharacterized protein LOC103709740 [Phoenix dactylifera]
Length=368

 Score =   191 bits (486),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 149/370 (40%), Positives = 207/370 (56%), Gaps = 32/370 (9%)
 Frame = +2

Query  284   PALFVGLNPKQS-ESDSVRSPTSPLEFRVFSTL-SNTLRSQRSS--EGHQKSWGCSKVGL  451
             P LFVG + K S +S+S RSPTSPL++++FS L S+ +RS RS   EG  +SW C +VGL
Sbjct  16    PGLFVGFSAKGSADSESARSPTSPLDYKLFSNLGSSFVRSPRSPGPEGQPRSWDCPRVGL  75

Query  452   SIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPC  631
              ++D+L+D++K  G +   S++KNI+ G Q+                 K+LP+ + +   
Sbjct  76    GLVDSLNDESKAGGRVLGFSETKNILLGSQLRINIPT----------PKTLPEIVWVSAQ  125

Query  632   TEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSG  811
                   +  +  S +  G   A LE G      RS S D GRS    A FA R S   S 
Sbjct  126   AHVGSPSSRSGCSKLAVGSEGAELEPG-EFGKTRSWSADIGRSSLPLARFAYR-SPKSSS  183

Query  812   SFGTEHGINSA--ISQNVRELSKLGNSSGAKLRSMPVPAGS-------ISTSKIELSEDY  964
              F      NSA   S+ V +     N SG    S+P+  GS       +S S+IELSEDY
Sbjct  184   EFFPSDSKNSAPDASRLVSKPINFDNLSG----SLPISLGSSHGFISSLSASEIELSEDY  239

Query  965   TCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKN--GEEENGLSKGPGCCEEHFSYPSSD  1138
             TC+ +HGPNPK THIF DC+LE H  +  + SKN  G+E  G S    C  +    PS+D
Sbjct  240   TCIISHGPNPKTTHIFGDCVLESHPIQSPD-SKNKLGKEGGGSSWLVKCPVDSPPCPSND  298

Query  1139  FLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREE  1318
             FLS C++C KKL+GKDI++YRGEKAFCS +CR +EILI+EE EK      D    +  E+
Sbjct  299   FLSHCFSCNKKLEGKDIYMYRGEKAFCSCNCREQEILIEEETEKPTADCYDASDSSFHED  358

Query  1319  PYESSLFIAT  1348
              + + + +A+
Sbjct  359   IFLAGMVVAS  368



>ref|XP_006465552.1| PREDICTED: uncharacterized protein LOC102619830 isoform X3 [Citrus 
sinensis]
Length=373

 Score =   191 bits (484),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 142/374 (38%), Positives = 203/374 (54%), Gaps = 42/374 (11%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DS+SE  + S  F  +   SS   +    VGL+ K  S+SD+V SPTSPL+FR F  L
Sbjct  1     MADSASEFSIQSDSFGIRQISSS---LSGFLVGLSSKGSSDSDTVWSPTSPLDFRAFVNL  57

Query  380   SN--TLRSQRS--SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN  +++S RS    G+QK W  S+VGL II++L ++ +    +    K KNI+FG Q+ 
Sbjct  58    SNPFSVKSPRSPPQNGYQKKWDSSEVGLGIINSLAEEKESTSAVCNSLKRKNIVFGSQVK  117

Query  548   ----CKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGI  715
                   +++F     SF  + SLP+N  I    + K      DSS  + G  + P + G 
Sbjct  118   NNIPYSSRHFYESVSSFMKSNSLPRNYMISQLPQTKNPKFPFDSSNSVVGNTEFPSQSGS  177

Query  716   SSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGA  895
              S++                + +++  +L S  F   +  +S I+ +   +  +      
Sbjct  178   FSSS---------------LTSSAQNQDLRSKMF---YSADSTITLSAPLV--IDRDLLV  217

Query  896   KLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN  1054
             K  S+P+P       AGS+S   IELSEDYTC+ +HGPNPK T IF DCIL+C  +E TN
Sbjct  218   KTSSLPIPIGSGHGHAGSLSARDIELSEDYTCIISHGPNPKTTRIFGDCILDCQAHELTN  277

Query  1055  FSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSC  1231
             F K  E+E  L++      +   Y S +FLSFCY+CKKKL+ G+DI+I  GEKAFCS  C
Sbjct  278   FDKQIEQEVELTQVSERPNDLSHYSSDEFLSFCYSCKKKLEKGEDIYI--GEKAFCSFDC  335

Query  1232  RSEEILIDEEKEKT  1273
             RS+EI  +EE  K 
Sbjct  336   RSDEIFTEEEMGKA  349



>gb|KDO51185.1| hypothetical protein CISIN_1g015987mg [Citrus sinensis]
Length=373

 Score =   190 bits (482),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 144/397 (36%), Positives = 212/397 (53%), Gaps = 47/397 (12%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DS+SE  + S  F  +   SS   +    VGL+ K  S+SD+V SPTSPL+FR F  L
Sbjct  1     MADSASEFSIQSDSFGIRQISSS---LSGFLVGLSSKGSSDSDTVWSPTSPLDFRAFVNL  57

Query  380   SN--TLRSQRS--SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN  +++S RS    G+QK W  S+VGL II++L ++ +    +    K KNI+FG Q+ 
Sbjct  58    SNPFSVKSPRSPPQNGYQKKWDSSEVGLGIINSLAEEKESTSAVCNSLKRKNIVFGSQVK  117

Query  548   ----CKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGI  715
                   +++F     SF  + SLP+N  I    + K      DSS  + G  + P + G 
Sbjct  118   NNIPYSSRHFYESVSSFMKSNSLPRNYMISQLPQTKNPKFPFDSSNSVVGNTEFPSQSGS  177

Query  716   SSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGA  895
              S++                + +++  +L S  F   +  +S I+ +   +  +      
Sbjct  178   FSSS---------------PTSSAQNQDLRSKMF---YSADSTITLSAPLV--IDRDLLV  217

Query  896   KLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN  1054
             K  S+P+P       AGS+S   IELSEDYTC+ +HGPNPK T IF DCIL+C  +E TN
Sbjct  218   KTSSLPIPIGSGHGHAGSLSARDIELSEDYTCIISHGPNPKTTRIFGDCILDCQAHELTN  277

Query  1055  FSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSC  1231
             F K  ++E  +++      +   Y S +FLSFCY+CKKKL+ G+DI+I  GEKAFCS  C
Sbjct  278   FDKKIDQEVEMTQVSERPNDLSQYSSDEFLSFCYSCKKKLEKGEDIYI--GEKAFCSFDC  335

Query  1232  RSEEILIDEEKEKTNKGGDDFEKPNSREEPYESSLFI  1342
             RS+EI  +EE +K  +        +SRE  Y   + +
Sbjct  336   RSDEIFAEEEMDKAYESAK-----SSRESSYHEDILL  367



>gb|KHM98768.1| hypothetical protein glysoja_030821 [Glycine soja]
Length=397

 Score =   190 bits (482),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 146/384 (38%), Positives = 198/384 (52%), Gaps = 39/384 (10%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DSSS   L     +   K  S F+    ++G+  K   +S+SV SPTSPL+ R+FS L
Sbjct  1     MADSSSNFSLPCDALSPTQKSFSIFHTSGSWLGVGAKGLPDSESVWSPTSPLDCRLFSNL  60

Query  380   SNTLRSQRS----SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN   ++ S      GH+K +  SKVGL II +L ++TK   ++    K K IIFGPQ+ 
Sbjct  61    SNPFSAKCSRPSFQTGHKKQFDGSKVGLGIISSLANETKLNNDILGKFKRKGIIFGPQVK  120

Query  548   CKTQNFLNHSDS----FGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGI  715
                  F N +      +  + S PKN  I   +E        D+ Y + G  D   E   
Sbjct  121   TGILKFSNKNHESLAPYLKSNSFPKNCVISLPSETTIPKSELDNFYDVSGKKDGNWESET  180

Query  716   SSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVREL---------  868
               + + S             SF+   S+L + +  ++ GIN    +N   L         
Sbjct  181   FKSTVTSLPD----------SFS--PSSLINSTQNSKMGINELGVENTSALMSLPQLTSR  228

Query  869   -SKLGNSSGAKLRSMPVPA-------GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCI  1024
              S++ N    K  S+P+         GS+S  +IELSEDYTC+ +HG NPK THIF DCI
Sbjct  229   GSQVDNCLKIKSNSLPISIDFSKGCIGSLSAREIELSEDYTCIISHGLNPKRTHIFGDCI  288

Query  1025  LECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKD-IFIYR  1201
             LECHNN+FT F+K  E     S+ P   +    YPS + LSFCY+C KKL  ++ I+ YR
Sbjct  289   LECHNNDFTEFNKKEEPAFSSSQVPAFSDGSAPYPSGNILSFCYSCNKKLVKEEGIYRYR  348

Query  1202  GEKAFCSSSCRSEEILIDEEKEKT  1273
             GEKAFCS  C SEEIL+ EE EKT
Sbjct  349   GEKAFCSFECGSEEILVGEELEKT  372



>ref|XP_003546353.1| PREDICTED: uncharacterized protein LOC100816165 isoform X1 [Glycine 
max]
 ref|XP_006597149.1| PREDICTED: uncharacterized protein LOC100816165 isoform X2 [Glycine 
max]
 ref|XP_006597150.1| PREDICTED: uncharacterized protein LOC100816165 isoform X3 [Glycine 
max]
 ref|XP_006597151.1| PREDICTED: uncharacterized protein LOC100816165 isoform X4 [Glycine 
max]
Length=397

 Score =   189 bits (480),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 145/384 (38%), Positives = 198/384 (52%), Gaps = 39/384 (10%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DSSS   L     +   K  S F+    ++G+  K   +S+SV SPTSPL+ R+FS L
Sbjct  1     MADSSSNFSLPCDALSPTQKSFSIFHTSGSWLGVGAKGLPDSESVWSPTSPLDCRLFSNL  60

Query  380   SNTLRSQRS----SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN   ++ S      GH+K +  SKVGL II +L ++TK   ++    K K IIFGPQ+ 
Sbjct  61    SNPFSAKSSRPSFQTGHKKQFDGSKVGLGIISSLANETKLNNDILGKFKRKGIIFGPQVK  120

Query  548   CKTQNFLNHSDS----FGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGI  715
                  F N +      +  + S PKN  I   +E        ++ Y + G  D   E   
Sbjct  121   TGILKFSNKNHESLAPYLKSNSFPKNCVISLPSETTIPKSELENFYDVSGKKDGNWESET  180

Query  716   SSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVREL---------  868
               + + S             SF+   S+L + +  ++ GIN    +N   L         
Sbjct  181   FKSTVTSLPD----------SFS--PSSLINSTQNSKMGINELGVENTSALMSLPQLTSR  228

Query  869   -SKLGNSSGAKLRSMPVPA-------GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCI  1024
              S++ N    K  S+P+         GS+S  +IELSEDYTC+ +HG NPK THIF DCI
Sbjct  229   GSQVDNCLKIKSNSLPISIDFSKGCIGSLSAREIELSEDYTCIISHGLNPKRTHIFGDCI  288

Query  1025  LECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKD-IFIYR  1201
             LECHNN+FT F+K  E     S+ P   +    YPS + LSFCY+C KKL  ++ I+ YR
Sbjct  289   LECHNNDFTEFNKKEEPAFSSSQVPAFSDGSAPYPSGNILSFCYSCNKKLVKEEGIYRYR  348

Query  1202  GEKAFCSSSCRSEEILIDEEKEKT  1273
             GEKAFCS  C SEEIL+ EE EKT
Sbjct  349   GEKAFCSFECGSEEILVGEELEKT  372



>ref|XP_010526125.1| PREDICTED: uncharacterized protein LOC104803775 [Tarenaya hassleriana]
Length=353

 Score =   188 bits (477),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 153/381 (40%), Positives = 199/381 (52%), Gaps = 68/381 (18%)
 Frame = +2

Query  152   MLRKRTRSQ-KDQQMGQ---LMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-Q  316
             MLR RTRS  KDQ M Q   L P S    H S              N   L +GLN K  
Sbjct  1     MLRTRTRSHNKDQAMSQFQFLDPQSDPLRHSSPKTIT---------NPLGLLIGLNNKGL  51

Query  317   SESDSVRSPTSPLEFRVFSTLSNT-LRSQRSSEGHQKSW---GCSKVGLSIIDALDDKTK  484
             S+ DSVRSPTSPLEFRV S +S   +RS RSS  +   W   G +KVGLSI+D+LDD   
Sbjct  52    SDCDSVRSPTSPLEFRVCSNVSELFVRSPRSSLQNGHLWNFLGPAKVGLSIVDSLDDDR-  110

Query  485   RLGNLPIPSKSKNIIFGPQM---SCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNL  655
                       S++++FGP M   SCK Q+     +     KSLP+  P+FP  +     +
Sbjct  111   --------CLSRDVVFGPAMRVKSCKNQD--KSPEFLQEPKSLPEGFPVFPIAQ----KI  156

Query  656   HNDSSYVLFGIGDAPLE---EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTE  826
              + +S ++F IGD P E    G+ + +    S  S  +GS+ +     KS+  S S    
Sbjct  157   KSAASGIVFEIGDDPFEPDPRGLKNRSFSLGSCRSFSTGSNLSLNGRTKSSSESDSLKKT  216

Query  827   HGINSAISQNVRELSKLG---NSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPK  997
                       V   SKLG   N+SG     +    GS S S IELSEDYTC+ +HGPNPK
Sbjct  217   R---------VLSRSKLGGECNNSGLDTGFL----GSPSASDIELSEDYTCIISHGPNPK  263

Query  998   VTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-  1174
              THI+ D +LECH       S   ++E  +       E    +PS DFLSFCY C KKL 
Sbjct  264   TTHIYGDRVLECH-------SLCDDKEKHIPT-----ESEAMFPSDDFLSFCYFCNKKLE  311

Query  1175  DGKDIFIYRGEKAFCSSSCRS  1237
             +G+DI++YRGE+AFCS+ CR+
Sbjct  312   EGEDIYMYRGERAFCSTECRT  332



>ref|XP_006427041.1| hypothetical protein CICLE_v10025884mg [Citrus clementina]
 ref|XP_006427042.1| hypothetical protein CICLE_v10025884mg [Citrus clementina]
 gb|ESR40281.1| hypothetical protein CICLE_v10025884mg [Citrus clementina]
 gb|ESR40282.1| hypothetical protein CICLE_v10025884mg [Citrus clementina]
Length=373

 Score =   188 bits (478),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 144/397 (36%), Positives = 212/397 (53%), Gaps = 47/397 (12%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DS+SE  + S  F  +   SS   +    VGL+ K  S+SD+V SPTSPL+FR F  L
Sbjct  1     MADSASEFSIQSDSFGIRQISSS---LSGFLVGLSSKGSSDSDTVWSPTSPLDFRAFVNL  57

Query  380   SN--TLRSQRS--SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN  +++S RS    G+QK W  S+VGL II++L ++ +    +    K KNI+FG Q+ 
Sbjct  58    SNPFSVKSPRSPPQNGYQKKWDSSEVGLGIINSLAEEKELTSEVCNSLKRKNIVFGSQVK  117

Query  548   ----CKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGI  715
                   +++F     SF  + SLP+N  I    + K      DSS  + G  + P + G 
Sbjct  118   NNIPYSSRHFNESVSSFMKSNSLPRNYMISQLPQTKNPKFPFDSSNSVVGNTEFPSQSGS  177

Query  716   SSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGA  895
              S++                + +++  +L S  F   +  +S I+ +   +  +      
Sbjct  178   FSSS---------------PTSSAQNQDLRSKMF---YSADSTITLSAPLV--IDRDLLI  217

Query  896   KLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN  1054
             K  S+P+P       AGS+S   IELSEDYTC+ +HGPNPK T IF DCIL+C  +E TN
Sbjct  218   KTSSLPIPIGSGHGHAGSLSARDIELSEDYTCIISHGPNPKTTRIFGDCILDCQAHELTN  277

Query  1055  FSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSC  1231
             F K  ++E  +++      +   Y S +FLSFCY+CKKKL+ G+DI+I  GEKAFCS  C
Sbjct  278   FDKKIDQEVEMTQVSERPNDLSQYSSDEFLSFCYSCKKKLEKGEDIYI--GEKAFCSFDC  335

Query  1232  RSEEILIDEEKEKTNKGGDDFEKPNSREEPYESSLFI  1342
             RS+EI  +EE +K  +        +SRE  Y   + +
Sbjct  336   RSDEIFAEEEMDKAYESAK-----SSRESSYHEDILL  367



>ref|XP_009385799.1| PREDICTED: uncharacterized protein LOC103973058 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385800.1| PREDICTED: uncharacterized protein LOC103973058 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385801.1| PREDICTED: uncharacterized protein LOC103973058 [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   188 bits (478),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 150/390 (38%), Positives = 203/390 (52%), Gaps = 21/390 (5%)
 Frame = +2

Query  152   MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SESD  328
             MLR   +  KD    QL+ DS S+S  SS    Q  + +S F VP +FVG + K  S SD
Sbjct  1     MLRAMNKIHKDHGTEQLVSDSPSDSCFSSKGLMQTARNTSLFGVPGVFVGFSTKGFSNSD  60

Query  329   SVRSPTSPLEFRVFSTLSNT-LRSQRSS--EGHQKSWGCSKVGLSIIDALDDKTKRLGNL  499
             +VRSPTSPL+ + FS L N+ L S RS+  +G  + W C++VGLS++DAL D+ +  G  
Sbjct  61    AVRSPTSPLDCKAFSGLGNSFLGSPRSASLDGKPRCWDCNRVGLSLVDALKDEAEPCGKF  120

Query  500   PIPSKSKNIIFGP----QMSCKTQNF--LNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHN  661
                S+S+   F P     +SC   +   L    S  A KSLPK+  I   T         
Sbjct  121   LGLSESRTSAFAPATRIDISCHKSHLAGLRDDSSCAAPKSLPKDYAISSHTLGGSVRPQL  180

Query  662   DSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINS  841
             D S +          E      +RS S D  R  S    F  R S   S  F ++   NS
Sbjct  181   DRSRMSALRSKVAESECGELGLLRSYSADISRPSSLKTDFVYRNSKSISDVFPSDS--NS  238

Query  842   AISQNVRELSKLGNSSGAKLRSMPVPAG---SISTSKIELSEDYTCVRTHGPNPKVTHIF  1012
             ++  + R + +  +       ++    G   S+S S+IE SEDYTC+ +HGPNPK THIF
Sbjct  239   SMVDSFRLVERSASFDKFSHETIGPSYGVITSLSASEIEQSEDYTCIISHGPNPKTTHIF  298

Query  1013  CDCILECHNNE---FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DG  1180
              DCILE H+     F N  +  +  +     P   E+     + DFL  C +CKKKL +G
Sbjct  299   GDCILESHSFPSLVFENKCRTDDCRSAWLLKPS--EDSPPCSTDDFLRSCLSCKKKLEEG  356

Query  1181  KDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             KDI++Y+GEKAFCSS CR  EILI+EE EK
Sbjct  357   KDIYMYKGEKAFCSSDCRDREILIEEEMEK  386



>ref|XP_009409337.1| PREDICTED: uncharacterized protein LOC103991566 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=417

 Score =   187 bits (474),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 145/382 (38%), Positives = 199/382 (52%), Gaps = 39/382 (10%)
 Frame = +2

Query  146   RTMLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SE  322
             R MLR   + QKD   GQL+ DS+S+S  SS    QK + ++ F+VP LFVG + K  SE
Sbjct  27    REMLRGMNKVQKDHCKGQLLSDSTSDSCFSSNGLIQKARNATLFSVPGLFVGFSAKGLSE  86

Query  323   SDSVRSPTSPLEFRVFSTLSNT-LRSQRSS--EGHQKSWGCSKVGLSIIDALDDKTKRLG  493
             SD+VRSPTSPL+++ FS L ++ L   RS+  +G  + W  ++VGL ++D L+D+TK  G
Sbjct  87    SDAVRSPTSPLDYKGFSNLGHSFLGFSRSASLDGKPRCWDRTRVGLRLVDTLNDETKPCG  146

Query  494   NLPIPSKSKNIIFGPQMSCKTQNFLNH-----SDSFGAAKSLPKNIPIFPCTEPKPFNLH  658
              L   S+S NI+F P+M     +   H      D  GAA   PK++P    T P+     
Sbjct  147   KLLGLSESSNILFAPRMRINISSPKPHLVGPGDDCTGAA---PKSLPKDYRTSPQTGR--  201

Query  659   NDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGIN  838
                             +G  S       L S       +S     S   S  F ++    
Sbjct  202   ---------------SKGAESECGEVGLLRSCSVVVSTSSSTPIDSKSESEVFASDS--K  244

Query  839   SAISQNVRELSKLGNSSGAKLRSMPVPA-GSISTSKIELSEDYTCVRTHGPNPKVTHIFC  1015
             S++++      KL  S    +   P     S+S S+IE SEDYTC+ +HGPNPK THIF 
Sbjct  245   SSMAEGSANFDKLSGSLPVSIGGSPCGVIASLSASEIEQSEDYTCIISHGPNPKTTHIFG  304

Query  1016  DCILECH---NNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGK  1183
             DCILE H   + +     +  EE +     P   E+    PS DFL  C++CKKKL +GK
Sbjct  305   DCILESHSFPSRDLRKKHRKDEERSAWMLKPS-EEDAPPCPSGDFLRCCFSCKKKLEEGK  363

Query  1184  DIFIYRGEKAFCSSSCRSEEIL  1249
             DI+I  GEKAFCS  CR +EIL
Sbjct  364   DIYI--GEKAFCSCDCRDQEIL  383



>gb|KDO51186.1| hypothetical protein CISIN_1g015987mg [Citrus sinensis]
Length=397

 Score =   184 bits (466),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 144/419 (34%), Positives = 213/419 (51%), Gaps = 67/419 (16%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DS+SE  + S  F  +   SS   +    VGL+ K  S+SD+V SPTSPL+FR F  L
Sbjct  1     MADSASEFSIQSDSFGIRQISSS---LSGFLVGLSSKGSSDSDTVWSPTSPLDFRAFVNL  57

Query  380   SN--TLRSQRS--SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN  +++S RS    G+QK W  S+VGL II++L ++ +    +    K KNI+FG Q+ 
Sbjct  58    SNPFSVKSPRSPPQNGYQKKWDSSEVGLGIINSLAEEKESTSAVCNSLKRKNIVFGSQVK  117

Query  548   ----CKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGI  715
                   +++F     SF  + SLP+N  I    + K      DSS  + G  + P + G 
Sbjct  118   NNIPYSSRHFYESVSSFMKSNSLPRNYMISQLPQTKNPKFPFDSSNSVVGNTEFPSQSGS  177

Query  716   SSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGA  895
              S++                + +++  +L S  F   +  +S I+ +   +  +      
Sbjct  178   FSSS---------------PTSSAQNQDLRSKMF---YSADSTITLSAPLV--IDRDLLV  217

Query  896   KLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN  1054
             K  S+P+P       AGS+S   IELSEDYTC+ +HGPNPK T IF DCIL+C  +E TN
Sbjct  218   KTSSLPIPIGSGHGHAGSLSARDIELSEDYTCIISHGPNPKTTRIFGDCILDCQAHELTN  277

Query  1055  FSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIY-----------  1198
             F K  ++E  +++      +   Y S +FLSFCY+CKKKL+ G+DI++Y           
Sbjct  278   FDKKIDQEVEMTQVSERPNDLSQYSSDEFLSFCYSCKKKLEKGEDIYMYGFVSNTFFHIF  337

Query  1199  -----------RGEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYESSLFI  1342
                         GEKAFCS  CRS+EI  +EE +K  +        +SRE  Y   + +
Sbjct  338   FLIPILALALTLGEKAFCSFDCRSDEIFAEEEMDKAYESAK-----SSRESSYHEDILL  391



>ref|XP_010526185.1| PREDICTED: uncharacterized protein LOC104803816 [Tarenaya hassleriana]
Length=371

 Score =   178 bits (452),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 155/399 (39%), Positives = 206/399 (52%), Gaps = 71/399 (18%)
 Frame = +2

Query  152   MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SESD  328
             ML+ RT S    +          ++ +S  +  +     +  N   L +GL+ K  S  D
Sbjct  1     MLKTRTSSLSQHK---------DQAAMSQFLDPKPEPPKTITNPLGLLIGLSKKDLSSYD  51

Query  329   SVRSPTSPLEFRVFSTLSNT-LRSQRSS--EGHQ-KSWGCSKVGLSIIDALDDKTKRLGN  496
             SVRSPTSPLEFRV S L+   +RS RSS   GHQ    G +KVGLSI+D+L +      N
Sbjct  52    SVRSPTSPLEFRVCSNLTEPFIRSPRSSWQNGHQFNCLGPAKVGLSIVDSLHNDQ----N  107

Query  497   LPIPSKSKNIIFGPQMSCKTQNFLNHSDSFG-AAKSLPKNIPIFPCTEPKPFNLHNDSSY  673
             L     S+++IFG  +  KT    + S  F    KSL +  P    T+     + N +S 
Sbjct  108   L-----SRDVIFGAAVRIKTLKNQDKSPEFDHEPKSLSEGFPALQTTK----EIKNATSG  158

Query  674   VLFGIGDAPLE-EGISSANMrsrsldsgrsgsHFASFASRKSNLHSGS----FGTEHGIN  838
             V+F IG+ P E E +   N              + S+ S +S L +GS     GT+    
Sbjct  159   VIFEIGEDPFEPEPVGLKN-------------RYFSWGSCRS-LPTGSGLALCGTDSSSG  204

Query  839   SAISQNVRELS--KLG---NSSGAKLRSMPVP-AGSI-----------STSKIELSEDYT  967
             S   +  R LS  KLG   ++S   L   P P +GS+           S + IEL EDYT
Sbjct  205   SDCLRKTRVLSRSKLGEELSNSSHLLDLKPEPKSGSVVPDTGLLGSYSSANDIELLEDYT  264

Query  968   CVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLS  1147
             C+ +HGPNPK THI+ D ILECHNN        G +E+ +   P        +PS DFLS
Sbjct  265   CIISHGPNPKTTHIYGDQILECHNN-LNKGGFCGNKEDHIPTEPDSL-----FPSDDFLS  318

Query  1148  FCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
             FCY C KKL DGKDI++YRGEKAFCS  CRSEE+L+DE+
Sbjct  319   FCYFCNKKLEDGKDIYMYRGEKAFCSVECRSEEMLMDED  357



>ref|XP_004151202.1| PREDICTED: uncharacterized protein LOC101221258 [Cucumis sativus]
 ref|XP_004157024.1| PREDICTED: uncharacterized LOC101221258 [Cucumis sativus]
 gb|KGN58057.1| hypothetical protein Csa_3G477700 [Cucumis sativus]
Length=400

 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 150/407 (37%), Positives = 209/407 (51%), Gaps = 41/407 (10%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQS-ESDSVRSPTSPLEFRVFSTL  379
             M  S S+S+L SG    KH  SS F++P  F GL  K S +SDS+RSPTSPL+FR+FS L
Sbjct  1     MAQSDSDSYLQSGSLG-KHISSSLFSIPGFFAGLGSKSSVDSDSLRSPTSPLDFRLFSNL  59

Query  380   SN-----TLRSQRSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKS---KNIIFG  535
             SN     ++ S  +  G Q  +  S+VGL II+++       G    P  S   KN+IFG
Sbjct  60    SNPFGFKSISSAETESGRQNKFVSSEVGLGIINSI--VVDDCGTTSEPRDSNWRKNVIFG  117

Query  536   PQMSCKTQNFLNHSDSFGAAK----SLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPL  703
             PQ+  K     NH   +  +     SLP N  I   ++ K  + ++ +   + G G+   
Sbjct  118   PQIKTKISKSSNHYIKYLGSSLKSYSLPSNYTISSLSKAKIPSSNSGAIDNICGNGE---  174

Query  704   EEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGI----NSAISQNVRELS  871
                 S+        ++    S+ ASF+S   +L   S  +        N+ I   +    
Sbjct  175   ---FSALESEPPFENNASFLSNAASFSSSGIDLTQNSDPSTENFPLESNNTIFPMINNSP  231

Query  872   KLGNSSGAKLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE  1030
             +  NS   K  S+P+         GS++  +IELSEDYTC+ +HGPNPK THIF DCILE
Sbjct  232   QRENSLPIKSCSLPITIGSSNAYVGSLTAREIELSEDYTCIISHGPNPKTTHIFGDCILE  291

Query  1031  CHNNEFTNFSKNGEEENGLSKGP-GCCEEHFSYPSSDF-LSFCYTCKKKL-DGKDIFIYR  1201
             CH +E  N   +  EE G+   P G C E F +   D  L  CY+CKK L +  DI++ R
Sbjct  292   CHTDE--NIGSSTIEEPGIESSPLGSCPEGFDHGVVDANLQICYSCKKVLKEEHDIYLCR  349

Query  1202  GEKAFCSSSCRSEEILIDEEKEKTNKGGDDFEKPNSREEPYESSLFI  1342
               KAFCSS C SEEI  + +  KT+K  DD E  ++    +E  LFI
Sbjct  350   DGKAFCSSQCSSEEIFGEHKLNKTSK--DDSES-SAGSSYHEEDLFI  393



>ref|XP_010519921.1| PREDICTED: uncharacterized protein LOC104799214 [Tarenaya hassleriana]
 ref|XP_010519922.1| PREDICTED: uncharacterized protein LOC104799214 [Tarenaya hassleriana]
 ref|XP_010519923.1| PREDICTED: uncharacterized protein LOC104799214 [Tarenaya hassleriana]
 ref|XP_010519925.1| PREDICTED: uncharacterized protein LOC104799214 [Tarenaya hassleriana]
Length=384

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 194/391 (50%), Gaps = 46/391 (12%)
 Frame = +2

Query  152   MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGL-NPKQSESD  328
             MLRKR+RS +  QM         +S +S     + H+  SFF++P+LFVGL N   S++D
Sbjct  1     MLRKRSRSNQKHQMVSASESFPVQSEVSR---VKNHRKGSFFSIPSLFVGLSNKGTSDND  57

Query  329   SVRSPTSPLEFRVFSTLSNTLR--SQRSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLP  502
                SP SPL+FR+FS         S+ +   HQKSW   KVGLSI+D+L+D+T   G + 
Sbjct  58    PAWSPNSPLDFRLFSGFGAPFAGSSKAAHHVHQKSWDSGKVGLSIVDSLEDRTDESGKVL  117

Query  503   IPSKSKNIIFGPQMS-----CKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDS  667
               S+SKNI+F P M      C       H          PK+ P+FP T  K     +D 
Sbjct  118   RSSESKNILFAPGMRFGYPICPKGVEKAHEQK----NPCPKDYPVFPKTLAKT-PTKDDE  172

Query  668   SYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAI  847
                +F   D P+++    +                +S+ ++ S+  +   G +     AI
Sbjct  173   LGSVFETKDNPIKQDPVCS---------------LSSYGAKGSSSGNSEVGKD--TYQAI  215

Query  848   SQNVRELSKLGNSSGAKLR-SMPVPAGSI---STSKIELSEDYTCVRTHGPNPKVTHIFC  1015
             +     L  L +  G+ L+ S+   +G +   S S+IELSE YTC+ +HGPNPK TH + 
Sbjct  216   ASKPDILPHLPSLDGSPLKQSLESLSGCMDPNSESEIELSEAYTCIISHGPNPKTTHFYG  275

Query  1016  DCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFS-----YPSSDFLSFCYTCKKKLDG  1180
             D +LE  +    N     +E+ G +         F+      P   FLSFC +C K L G
Sbjct  276   DRVLENWDTNALNEGFRYKEQKGFA----VVSMPFTKLADVVPPETFLSFCTSCSKGLQG  331

Query  1181  KDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             K I++YRG  AFCS  CRS+EIL DE  ++ 
Sbjct  332   KAIYMYRGCIAFCSEECRSKEILADERMDEA  362



>ref|XP_004498618.1| PREDICTED: uncharacterized protein LOC101497948 [Cicer arietinum]
Length=357

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 139/367 (38%), Positives = 183/367 (50%), Gaps = 62/367 (17%)
 Frame = +2

Query  218   SESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESDSVRSPTSPLEFRVFSTLSNTLRS  397
             SESH+       + K  S F  P  FVGL     +SDS+ SPTSPL+  + S   N    
Sbjct  12    SESHVLEN---NEKKTKSIFKAPLQFVGLG---LDSDSLNSPTSPLDLTLLSNRGNPYEG  65

Query  398   QRSSEGHQKSWGCSKVGLSIIDALDDKT-----KRLGNLPIPSKSKNIIFGPQMSCKTQN  562
             Q+     Q+ + C+K+GLSIID+L D +     K+    P PS        PQM      
Sbjct  66    QQ-----QRIYDCTKLGLSIIDSLKDCSKFSVFKKASVNPTPS--------PQMIITKAP  112

Query  563   FLNHS-DSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsr  739
               NHS DS  A+KSLPK+    P T+      H   S V+F IG+  +E      +M   
Sbjct  113   NFNHSIDSVHASKSLPKDFFKLPYTQNNS-AFHKGESNVVFEIGETMIEPEPFGKSM---  168

Query  740   sldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVP  919
                       F S   + SN    S  + H I  + + N     +L  ++          
Sbjct  169   -----SCSLDFYS-PVKDSNFDLSS--SPHFIGGSKNPNTLVFDELNANT----------  210

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGL---  1087
               ++S S+IE SEDYTCV +HGPNPK THIFCDCILE C  ++        EE+ GL   
Sbjct  211   -LNLSASEIESSEDYTCVISHGPNPKKTHIFCDCILEICAADDVEKHQNKNEEKKGLFSH  269

Query  1088  ----SKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILI  1252
                 S+ P  C          FL+FCY C KKL +GKDI+IYRGEK+FCS +CR+ EI+I
Sbjct  270   VVDGSETPKQCPY-----GGKFLTFCYQCNKKLEEGKDIYIYRGEKSFCSLTCRALEIMI  324

Query  1253  DEEKEKT  1273
             DEE EK+
Sbjct  325   DEELEKS  331



>ref|XP_008447495.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Cucumis 
melo]
 ref|XP_008447496.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Cucumis 
melo]
 ref|XP_008447497.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Cucumis 
melo]
Length=400

 Score =   172 bits (436),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 140/384 (36%), Positives = 197/384 (51%), Gaps = 34/384 (9%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SESDSVRSPTSPLEFRVFSTL  379
             M  S S+S+L SG    KH  SS F++P  F GL  K   ESDS+RSPTSPL+FR+FS L
Sbjct  1     MAQSDSDSYLQSGSLG-KHISSSLFSIPGFFAGLGSKSLVESDSLRSPTSPLDFRLFSNL  59

Query  380   SN-----TLRSQRSSEGHQKSWGCSKVGLSIIDALD-DKTKRLGNLPIPSKSKNIIFGPQ  541
             SN     ++ S  +  G Q  +  S+VGL II+++  D           +  KN+IFGPQ
Sbjct  60    SNPFGFKSISSAETESGRQNKFVSSEVGLGIINSIVVDDCGTTSEARDSNWRKNVIFGPQ  119

Query  542   MSCKTQNFLNHSDSFGAAK----SLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEE  709
             +  K     NH   +  +     SLP N  I   ++ K  + ++ ++  + G G+     
Sbjct  120   IKTKISKSSNHYIKYLGSSLKSYSLPSNYTISSLSKAKIPSSNSGATDSVCGNGE-----  174

Query  710   GISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGI----NSAISQNVRELSKL  877
               S+        ++    S+ ASF+S   +L   S  +        N+ I   +    + 
Sbjct  175   -FSALESEPPFENNASFLSNAASFSSSGIDLTQNSDPSTENFPLESNNTIFPMINNSPQR  233

Query  878   GNSSGAKLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECH  1036
              NS   K  S+P+         GS++  +IELSEDYTC+ +HGPNPK THIF DCILECH
Sbjct  234   ENSLPIKSCSLPITIGSSNAYVGSLTAREIELSEDYTCIISHGPNPKTTHIFGDCILECH  293

Query  1037  NNEFTNFSKNGEEENGL-SKGPGCCEEHFSYPSSDF-LSFCYTCKKKL-DGKDIFIYRGE  1207
              +E  N   +  EE G  S   G C E F +   D  L  CY+CKK L +  DI++ R  
Sbjct  294   TDE--NIGSSTMEEPGTESSLLGSCPEGFGHGVVDANLQICYSCKKVLKEEHDIYLCRDG  351

Query  1208  KAFCSSSCRSEEILIDEEKEKTNK  1279
             KAFCSS C S+EI  + +  KT+K
Sbjct  352   KAFCSSQCSSQEIFGEHKINKTSK  375



>ref|XP_004486723.1| PREDICTED: uncharacterized protein LOC101503653 [Cicer arietinum]
Length=378

 Score =   168 bits (425),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 140/384 (36%), Positives = 192/384 (50%), Gaps = 56/384 (15%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESDSVRSPTSPLEFRVFSTLS  382
             M DSSS   L S   + +   SSFF+   L         +S+S  SPTSPL++++FS LS
Sbjct  1     MADSSSNFSLHSDTISTRQISSSFFHTSVL--------PDSESAWSPTSPLDYKLFSNLS  52

Query  383   NTLRSQRS----SEGHQKSWGCSKVGLSIIDALDDKTKR----LGNLPIPSKSKNIIFGP  538
             N   ++ S      GH+K +  SKVGL II +L ++ K     LG  P     KNII   
Sbjct  53    NVFSAKSSRPSYQTGHKKQFDGSKVGLGIITSLVNEAKLNNEILGKFP----RKNIILRS  108

Query  539   QMSCKTQNFL----NHSDSFGA---AKSLPKNIPIF---PCTEPKPFNLHNDSSYVLFGI  688
             Q+  K    L    N+ +S  +   + SLPKN  I    P +E + F+     S  L GI
Sbjct  109   QV--KKNGILKFSKNNHESLASCLKSNSLPKNYVISTESPKSEVESFDDIGRESKGLRGI  166

Query  689   GDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVREL  868
               +  +    S+ +      +  +   F    S  S+L   + G+               
Sbjct  167   VASLSDSSRPSSLINLNQNLNLGTDDLFVEDTSTVSSLPPVTKGS---------------  211

Query  869   SKLGNSSGAKLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCIL  1027
             S + NS      S+P+         GS+S  +IELSEDYTC+ +HGPNPK THIF DCIL
Sbjct  212   SLVDNSLKITASSLPISIDFSNGYVGSLSAKEIELSEDYTCIISHGPNPKRTHIFGDCIL  271

Query  1028  ECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD--GKDIFIYR  1201
             ECHNN+FT F    +     S+ P   EE   +   +  SFC++C KKLD   +DI+ Y 
Sbjct  272   ECHNNDFTEFCMKEDPPFRSSQVPMFSEESVPHHFDNVTSFCHSCNKKLDQGSEDIYDYS  331

Query  1202  GEKAFCSSSCRSEEILIDEEKEKT  1273
             GEKAFCS  C+SEEIL ++E EKT
Sbjct  332   GEKAFCSFKCQSEEILAEDEMEKT  355



>ref|XP_007150668.1| hypothetical protein PHAVU_005G171700g [Phaseolus vulgaris]
 gb|ESW22662.1| hypothetical protein PHAVU_005G171700g [Phaseolus vulgaris]
Length=393

 Score =   167 bits (422),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 140/385 (36%), Positives = 193/385 (50%), Gaps = 60/385 (16%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DSSS+  L      Q     S F +    +G+  K   +S+S+ SPTSPL+ R+FS L
Sbjct  16    MADSSSKFSLPCDALRQMS--FSNFCISGSRLGIGAKGLLDSESLWSPTSPLDCRLFSNL  73

Query  380   SN--TLRSQRSS--EGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN  +++S R S   GH+K    S+VGL II +L ++TK   ++    + K+IIFGPQ+ 
Sbjct  74    SNPFSVKSCRPSFQTGHKKQLDGSEVGLGIISSLVNETKHNNDILGKFQRKSIIFGPQVK  133

Query  548   CKTQNFLNHSDSFG---AAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGIS  718
                  F N+ + F     + SLPKN  +   +E K                  P  E  +
Sbjct  134   TGILKFSNNHEFFAPYLKSSSLPKNYVVSLPSETK-----------------TPKSEVEN  176

Query  719   SANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV------------R  862
               N+               SF  R S+L + +  +  G+N     N             R
Sbjct  177   FDNVSLP-----------GSF--RPSSLINSNQNSNLGMNELCLGNASTTLRSLPLVTSR  223

Query  863   ELSKLGNSSGAKLRSMPVPA-------GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDC  1021
             +  K+  S      S+P+         GS+S  +IELSEDYTC+ +HGPNPK THIF DC
Sbjct  224   DSQKVDKSLNINSNSLPISIDFSKGCLGSLSAREIELSEDYTCIISHGPNPKRTHIFGDC  283

Query  1022  ILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIY  1198
             +LECHN++FT FS   E     S+ P   E    Y S + LSFCY+C KKL   ++++ Y
Sbjct  284   VLECHNSDFTEFSMKEEPAFKASQVPTFSEGSSPYHSDNVLSFCYSCNKKLVREEELYRY  343

Query  1199  RGEKAFCSSSCRSEEILIDEEKEKT  1273
             RG KAFCS  C SEEIL+ EE EKT
Sbjct  344   RGGKAFCSFDCGSEEILVKEELEKT  368



>ref|XP_006844350.1| hypothetical protein AMTR_s00142p00035060 [Amborella trichopoda]
 gb|ERN06025.1| hypothetical protein AMTR_s00142p00035060 [Amborella trichopoda]
Length=416

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 147/378 (39%), Positives = 191/378 (51%), Gaps = 51/378 (13%)
 Frame = +2

Query  200   LMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFST  376
              M D +S S  S G    + K +SFF +P LFVGLN K  S+ DS+RSPTSPLE R FS 
Sbjct  53    FMRDQTSSSVSSDGSVVHRTKSNSFFTLPGLFVGLNTKLPSDIDSIRSPTSPLEPRTFS-  111

Query  377   LSNTLRSQRSS------EGHQKSWGCSK-VGLSIIDALDDKTKRLGNLPIPSKSKNIIFG  535
               N   S RS       + H K WG SK VGL I+D+L  +   +  +   S SKNI+ G
Sbjct  112   -GNPFWSPRSGPDGHGLQSHAKIWGDSKGVGLGIVDSLSLEKDPIKGV---SDSKNILLG  167

Query  536   PQMSCKTQNFLNHSDSFGAAKSL------PKNIPIFPCTEPKP-----FNLHNDSSYVLF  682
              Q+  +T   ++ S     +K+       PK++P +  +  K      FNL   SS +L 
Sbjct  168   SQL--RTAIPISSSQDHKQSKNTSLGSQSPKSLPNYVISPHKKIMSNYFNLR--SSQLLQ  223

Query  683   GIG-DAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNV  859
               G D  LE G   +                     +    HSGS    +  N  +  + 
Sbjct  224   DSGSDQCLERGEPRSGFLDSGKP-----------LPQSGMCHSGS--EVNLSNPQLDSSF  270

Query  860   RELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHN  1039
             REL       G K+ S     G +S S  ELSEDYT V +HGPNPK  HIF D + EC  
Sbjct  271   RELGSPKLGMGTKI-SFDCCNGFLSPSDFELSEDYTRVISHGPNPKTKHIFGDRVFECDT  329

Query  1040  NEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAF  1216
              E  +    G+ E   +K         SYPS++ LSFCY CKKKL +GKDI+IYRGEKAF
Sbjct  330   VELPD----GKPEIWEAKLSTISS---SYPSNEILSFCYACKKKLGNGKDIYIYRGEKAF  382

Query  1217  CSSSCRSEEILIDEEKEK  1270
             CS  CR+E+I++DE  EK
Sbjct  383   CSCQCRNEQIMVDERMEK  400



>ref|XP_008394004.1| PREDICTED: uncharacterized protein LOC103456137 [Malus domestica]
Length=155

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 101/143 (71%), Gaps = 6/143 (4%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP  1099
              GS+  S+IELSEDYTCV +HG  PK THIF DCILECH+ +  NF KN E+E G ++ P
Sbjct  13    VGSLPASEIELSEDYTCVISHGAKPKKTHIFGDCILECHSEDVXNFGKNEEKEIGFTR-P  71

Query  1100  GCCEEHFS-YPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
             G   ++F  YP  +FLSFCY C KKL +GKDI+IYRGE+AFCS SCRSEEILIDE  EK 
Sbjct  72    GSSLDNFGHYPLDNFLSFCYYCNKKLEEGKDIYIYRGEQAFCSLSCRSEEILIDEALEKC  131

Query  1274  NKGGDDFEKP-NSREEPYESSLF  1339
             N      EKP  S EE +E+ + 
Sbjct  132   NDQSS--EKPLESYEELFETGML  152



>emb|CDX83224.1| BnaA03g22820D [Brassica napus]
Length=326

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 135/380 (36%), Positives = 184/380 (48%), Gaps = 81/380 (21%)
 Frame = +2

Query  152   MLRKRTR-SQKDQQMGQ-LMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ--S  319
             ML+ RTR  Q+D+ M Q + P +    H ++        +S       L +GLN  +  S
Sbjct  1     MLKTRTRFHQQDETMSQSVDPQTDLVGHNNTKAITNPLTLS-------LLIGLNNNKCIS  53

Query  320   ESDSVRSPTSPLEFRVFSTLSNT--LRSQRSSEGHQKSWGC--SKVGLSIIDALDDKTKR  487
             +SD +RSP SPLEFRV S ++    LRS RSS     +  C  +KVGLSI+D+L D    
Sbjct  54    DSDILRSPKSPLEFRVLSKMAEPFFLRSPRSSLTAHLNCCCVPAKVGLSIVDSLGDD---  110

Query  488   LGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDS  667
              G L     S +++FGP +  K          F   K   K+  +FP  E K  ++    
Sbjct  111   -GVL-----SPDVVFGPALRLK----------FSEIKD--KHPSLFP--ETKSLDVEKKR  150

Query  668   SYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAI  847
             S V+F IGD     G+++ +                    RK+ + S S         AI
Sbjct  151   SGVIFEIGDETEPIGLTNRSFSEDD-------------CPRKARVLSQS--------KAI  189

Query  848   SQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCIL  1027
             ++       +G+ S A        +  +S   +E+SEDYTC+  HGPNPK THI+ D +L
Sbjct  190   AEEY--FPGIGSDSTAS-------SSCLSEDDMEMSEDYTCIIAHGPNPKTTHIYGDRVL  240

Query  1028  ECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRG  1204
             EC  NE  N  K  E E          E  F  P   FLS C  C KKL+ G DI++YRG
Sbjct  241   ECQKNEVINKEKQFERE---------LESMF--PVDHFLSVCNFCNKKLEVGYDIYMYRG  289

Query  1205  EKAFCSSSCRSEE-ILIDEE  1261
             EKAFCS  CRSEE ++IDEE
Sbjct  290   EKAFCSEECRSEEMMMIDEE  309



>ref|XP_006405241.1| hypothetical protein EUTSA_v10000253mg [Eutrema salsugineum]
 gb|ESQ46694.1| hypothetical protein EUTSA_v10000253mg [Eutrema salsugineum]
Length=316

 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 134/379 (35%), Positives = 186/379 (49%), Gaps = 89/379 (23%)
 Frame = +2

Query  152   MLRKRTR-SQKDQQMGQ-LMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSES  325
             ML  R +   KDQ M Q + P S    H ++    +   ++    + +L +GLN  +S S
Sbjct  1     MLNARAKFRHKDQTMSQSVDPQSDQIGHNNNNNNTKP--ITKPLAL-SLLIGLNNNKSIS  57

Query  326   DS--VRSPTSPLEFRVFSTLSNT--LRSQRSSEGHQKSWGCSKVGLSIIDAL-DDKTKRL  490
             DS  VRSP SPLEFRV ST++    LRS  ++  +    G +KVGLSI+D+L DD+    
Sbjct  58    DSDFVRSPKSPLEFRVLSTMAEPFFLRSSLTTPLNC-CCGPAKVGLSIVDSLGDDRVL--  114

Query  491   GNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSS  670
                     S +++FGP +  K+                 K+  +FP  EPK   +  + S
Sbjct  115   --------SPDVVFGPALRIKSSEIR------------AKDPKLFP--EPKSVKIEKERS  152

Query  671   YVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGS-FGTEHGINSAI  847
              V+F IG+    E I   N               A+   RK+ + S S FG+E       
Sbjct  153   GVVFEIGEP---EPIRLRNRSFS-----------ANDCPRKNRVLSPSKFGSE-------  191

Query  848   SQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCIL  1027
                       GNS  A          S+S  ++E+SEDYTCV +HGPNPK THI+ D +L
Sbjct  192   ----------GNSDIAL---------SLSEDEMEMSEDYTCVISHGPNPKTTHIYGDRVL  232

Query  1028  ECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRG  1204
             +CH     N      E + +            +PS +FLS C  C KKL+ GKDI++YRG
Sbjct  233   KCHKYVLKNEKHIETELDSM------------FPSDNFLSVCNFCNKKLEVGKDIYMYRG  280

Query  1205  EKAFCSSSCRSEEILIDEE  1261
             EKAFCS  CRSEE++IDEE
Sbjct  281   EKAFCSEECRSEEMMIDEE  299



>gb|KEH39566.1| DUF581 family protein [Medicago truncatula]
Length=389

 Score =   145 bits (366),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 137/377 (36%), Positives = 177/377 (47%), Gaps = 58/377 (15%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SESDSVRSPTSPLEFRVFSTL  379
             M DSSS   L     + +   SS F+     VG   K   +S+S  SPTSPL++R+FS L
Sbjct  1     MADSSSNLSLPPDTVSARQIRSSLFHTSGSRVGAGVKNLPDSESAWSPTSPLDYRLFSNL  60

Query  380   SNTLRSQRSSEGHQ----KSWGCSKVGLSIIDALDDKTKR----LGNLPIPSKSKNIIFG  535
             SN   ++ S    Q    K    SKVGL II +L ++TK     LG  P     KNIIFG
Sbjct  61    SNVFSAKSSRPSFQTENKKPLDGSKVGLGIITSLVNETKPNNEILGKFP----RKNIIFG  116

Query  536   PQMSCKTQNFL--NHSD--SFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPL  703
              Q+      F   NH     F    SLPKN  I   +E K        S  L     +P 
Sbjct  117   SQVKNHILQFSKNNHESLAPFLKTNSLPKNYVISLPSETK--------SPTLPSKTKSPK  168

Query  704   EEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSA---ISQNVRELSK  874
              E  S  +  +R     RS    +  +SR S+L + +  +  G N     ++     L  
Sbjct  169   SEVESFDDDVNRESKGLRSSVVSSPDSSRPSSLINSNQSSNLGTNDLFVDVTSTPLSLLP  228

Query  875   LGNSSGAKLRSMPVPAGSISTS--------------KIELSEDYTCVRTHGPNPKVTHIF  1012
             + N+S     S+ + + S+  S              +IELSEDYTC+ +HGPNPK THIF
Sbjct  229   VTNTSSQVDDSLKIISSSLPVSIDFSNGYVGSLSAKEIELSEDYTCIISHGPNPKRTHIF  288

Query  1013  CDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD--GKD  1186
              DCILECHNN+FT FSK               EE   +     +SFCYTC KK D  G+D
Sbjct  289   GDCILECHNNDFTEFSKK--------------EESAPHRFDSVMSFCYTCDKKFDEEGED  334

Query  1187  IFIYRGEKAFCSSSCRS  1237
             +  Y  EKAFCS  CRS
Sbjct  335   VHAYSDEKAFCSFKCRS  351



>ref|XP_002873514.1| hypothetical protein ARALYDRAFT_487982 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49773.1| hypothetical protein ARALYDRAFT_487982 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   144 bits (363),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 119/340 (35%), Positives = 163/340 (48%), Gaps = 67/340 (20%)
 Frame = +2

Query  281   VPALFVGLNPKQSESDSVRSPTSPLEFRVFSTLSNTLRSQRSS-----EGHQKSWGCSKV  445
             + +LF G +P  S+ +S  SPTSPL+FR+FSTL N   +  SS     +G QKSW   KV
Sbjct  31    ISSLFEGKSP--SDCESAWSPTSPLDFRLFSTLGNPFGASSSSLRSIWKGKQKSWDSGKV  88

Query  446   GLSIIDAL-DDKTKRLGNLPIPS-KSKNIIFGPQM-SCKTQNFLNHSDSFGAAKSLPKNI  616
             GLSI+ +L DD       + +PS  SK+IIFG  M S +  + L+               
Sbjct  89    GLSIVHSLVDDHNDSSSRIVLPSPDSKSIIFGSLMRSGQKPHLLSQ--------------  134

Query  617   PIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKS  796
             P+     PK     ND   V+F IG   L+            +   +     A++ S   
Sbjct  135   PLAKALMPK-----NDIPNVVFEIGQDVLD------------VVELQKSGSVAAYCSGAG  177

Query  797   NLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVR  976
             N                         + N++   ++  P      + S IE+SEDYTCV 
Sbjct  178   NF-----------------------SVNNNACQVIKQAPGSLNGGTGSNIEISEDYTCVI  214

Query  977   THGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSKGPGCCEEHFS-YPSSDFLSF  1150
             +HGPNPK TH + D +LE   NNE  N   + ++++  +  P          P  DFLSF
Sbjct  215   SHGPNPKTTHFYGDRVLESVENNELKNRCCSNKKKSIFAVAPLDLTTPVDVLPPKDFLSF  274

Query  1151  CYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             CY C KKL  GKDI++Y G KAFCSS CRS+EI  DE+ E
Sbjct  275   CYGCSKKLVMGKDIYMYSGYKAFCSSECRSKEIDRDEKME  314



>ref|XP_006288109.1| hypothetical protein CARUB_v10001342mg [Capsella rubella]
 gb|EOA21007.1| hypothetical protein CARUB_v10001342mg [Capsella rubella]
Length=343

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 119/339 (35%), Positives = 161/339 (47%), Gaps = 64/339 (19%)
 Frame = +2

Query  281   VPALFVGLNPKQSESDSVRSPTSPLEFRVFSTLSNTL---RSQRSSEGHQKSWGCSKVGL  451
             +  +F G  P  S+ DS  SPTSPL+FR+FS L N      S+   +G QKSW   KVGL
Sbjct  31    ISGVFEGKCP--SDYDSAWSPTSPLDFRLFSGLGNPFGGSSSRSIWKGKQKSWDSGKVGL  88

Query  452   SIIDALDDK----TKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIP  619
             SI+ +LDD     + R+  LP P  SKNIIFG  M  +T N              P+   
Sbjct  89    SILHSLDDDHHSDSSRIV-LPSPD-SKNIIFGSLM--RTGN--------------PQKPQ  130

Query  620   IFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSN  799
             +      K     ND   V+F I    ++                           RKS 
Sbjct  131   LLSQPFAKALLPKNDLPNVVFEIAHDVID-----------------------VVELRKSG  167

Query  800   LHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRT  979
                 ++    G NS+++ N  ++          ++  P      + S IE+SEDYTCV  
Sbjct  168   SVDAAYCLGAG-NSSVNNNACQV----------IKEAPGSLNERTESDIEISEDYTCVIQ  216

Query  980   HGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSKGPGCCEEHFS-YPSSDFLSFC  1153
             HGPNPK TH + D ++E   +NE  N     ++E+  +  P          P +DFLSFC
Sbjct  217   HGPNPKTTHFYGDQVMESVEHNELKNSCCRNKKESIFAIAPPDLTTPIDVLPLNDFLSFC  276

Query  1154  YTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             Y C KKL  GK+I++YRG KAFCSS CR+EE+  DEE E
Sbjct  277   YGCNKKLGLGKEIYMYRGYKAFCSSECRAEEVYRDEEME  315



>ref|XP_009133958.1| PREDICTED: uncharacterized protein LOC103858365 [Brassica rapa]
 ref|XP_009133959.1| PREDICTED: uncharacterized protein LOC103858365 [Brassica rapa]
Length=327

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 128/371 (35%), Positives = 177/371 (48%), Gaps = 80/371 (22%)
 Frame = +2

Query  152   MLRKRTR-SQKDQQMGQ-LMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ--S  319
             ML+ RTR  Q+D+ M Q + P +    H ++        +S       L +GLN  +  S
Sbjct  1     MLKTRTRFHQQDETMSQSVDPQTDLVGHNNTKAITNPLTLS-------LLIGLNNNKCIS  53

Query  320   ESDSVRSPTSPLEFRVFSTLSNT--LRSQRSSEGHQKSWGC--SKVGLSIIDALDDKTKR  487
             +SD +RSP SPLEFRV S ++    LRS RSS     +  C  +KVGLSI+D+L D    
Sbjct  54    DSDILRSPKSPLEFRVLSKMAEPFFLRSPRSSLTAHLNCCCVPAKVGLSIVDSLGDD---  110

Query  488   LGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDS  667
              G L     S +++FGP +  K          F   K   K+  +FP  E K  ++    
Sbjct  111   -GVL-----SPDVVFGPALRLK----------FSEIKD--KHPSLFP--ETKSLDVEKKR  150

Query  668   SYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAI  847
             S V+F IGD     G+++ +                    RK+ + S S         AI
Sbjct  151   SGVIFEIGDETEPIGLTNRSFSEDD-------------CPRKARVLSQS--------KAI  189

Query  848   SQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCIL  1027
             ++       +G+ S A        +  +S   +E+SEDYTC+  HGPNPK THI+ D +L
Sbjct  190   AEEY--FPGIGSDSTAS-------SSCLSEDDMEMSEDYTCIIAHGPNPKTTHIYGDRVL  240

Query  1028  ECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRG  1204
             EC+ NE  +  K  E E          E  F  P   FLS C  C KKL+ G DI++YRG
Sbjct  241   ECNKNEAIHKEKQFETE---------LESMF--PMDHFLSVCNFCNKKLEVGYDIYMYRG  289

Query  1205  EKAFCSSSCRS  1237
             EKAFCS  CRS
Sbjct  290   EKAFCSEECRS  300



>ref|NP_180140.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031415.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD31369.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAR24656.1| At2g25690 [Arabidopsis thaliana]
 dbj|BAD43195.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07736.1| uncharacterized protein AT2G25690 [Arabidopsis thaliana]
 gb|AEC07737.1| uncharacterized protein AT2G25690 [Arabidopsis thaliana]
Length=324

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 156/336 (46%), Gaps = 81/336 (24%)
 Frame = +2

Query  287   ALFVGLNPKQ---SESDSVRSPTSPLEFRVFSTLSNT--LRSQRSSEGHQKSWGC---SK  442
             +L +GLN K    S+SD VRSP SPLEFRV ST++++  LRS RSS     +  C   +K
Sbjct  42    SLLIGLNNKNKCISDSDFVRSPKSPLEFRVLSTMADSFFLRSPRSSLTAHLNCCCGPAAK  101

Query  443   VGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPI  622
             VGLSI+D+L D    L          +I+FGP +  K    ++                +
Sbjct  102   VGLSIVDSLGDDRCLL---------PDIVFGPALRIKCSEVMDKHPKL-----------L  141

Query  623   FPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNL  802
             FP    K   + N+ S V+F IGD   E                          +    L
Sbjct  142   FPVAN-KSKKIENERSGVVFEIGDNSSE--------------------------TEPVGL  174

Query  803   HSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTH  982
              + SF     +       V   SKLG          P      + S  +  EDYTC+  H
Sbjct  175   RNRSFSANDCLRKT---RVLSRSKLGQEG-----DFPGSGSDNAFSSEDDMEDYTCIIAH  226

Query  983   GPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFS--YPSSDFLSFCY  1156
             GPNPK THI+ D +LECH NE       G+E+N         +E F   +PS +FL  C 
Sbjct  227   GPNPKTTHIYGDRVLECHKNEL-----KGDEDN---------KEKFGSVFPSDNFLGICN  272

Query  1157  TCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
              C KKL  G DI++YR EK+FCS  CRSEE++IDEE
Sbjct  273   FCNKKLGGGDDIYMYR-EKSFCSEECRSEEMMIDEE  307



>gb|KHG28688.1| Inactive tyrosine-protein kinase 7 [Gossypium arboreum]
Length=299

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 98/139 (71%), Gaps = 9/139 (6%)
 Frame = +2

Query  893   AKLRSMPVP----AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFS  1060
             +K  S+P P    +GS+S  +IELSEDYTC+ +HGPNPK T IF DCILECHN+E TNF 
Sbjct  145   SKPSSLPTPLGHTSGSLSAHEIELSEDYTCIISHGPNPKTTRIFGDCILECHNDELTNFD  204

Query  1061  KNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRS  1237
             K  E+    +K     E   +YPS +FLSFCY+CKKK +   DI++YRGEKAFCS+ CRS
Sbjct  205   KTAEQLPRFAKN---TETLTAYPSDEFLSFCYSCKKKFEKDDDIYMYRGEKAFCSTDCRS  261

Query  1238  EEILIDEEKEKT-NKGGDD  1291
             EEI  +EE EKT NK  DD
Sbjct  262   EEIFAEEEMEKTCNKTSDD  280


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 75/121 (62%), Gaps = 7/121 (6%)
 Frame = +2

Query  200  LMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFST  376
            LM D  SES   S     +H  SS FN+P   VG + K  S+SD+VRSPTSPL+ RVF+ 
Sbjct  5    LMADPDSESIFRSDALGLRHISSSLFNIPGFLVGFSAKGSSDSDAVRSPTSPLDLRVFAN  64

Query  377  LSN--TLRSQRS--SEGHQKSWGCSKVGLSIIDALDDKTKRLG-NLPIPSKSKNIIFGPQ  541
            LSN  +++S +S    G++K W C+K+ L I++ L D+ K  G  L  P K KNIIF P+
Sbjct  65   LSNPFSVKSPQSPSQNGYRKKWDCNKIDLGIVNLLADENKPNGEKLEFP-KRKNIIFRPR  123

Query  542  M  544
            M
Sbjct  124  M  124



>emb|CDY38508.1| BnaC03g26890D [Brassica napus]
Length=311

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 158/333 (47%), Gaps = 73/333 (22%)
 Frame = +2

Query  287   ALFVGLNPKQ--SESDSVRSPTSPLEFRVFSTLSNT--LRSQRSSEGHQKSWGC--SKVG  448
             +L +GLN  +  S+SD +RSP SPLEFRV S ++    LRS RSS     +  C   KVG
Sbjct  27    SLLIGLNNNKCISDSDFLRSPKSPLEFRVLSKMAEPFFLRSPRSSLTAHLNCCCVPDKVG  86

Query  449   LSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFP  628
             LSI+D+L D     G L     S +++FGP +  K          F   K   K+  +FP
Sbjct  87    LSIVDSLRDD----GVL-----SPDVVFGPALRLK----------FSEIKD--KHPRLFP  125

Query  629   CTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHS  808
               E K  ++    S V+F IGD     G+ + +                    RK+ + S
Sbjct  126   --ETKSLDVEKKRSGVIFEIGDETEPIGLRNRSFSEND-------------CPRKARVLS  170

Query  809   GSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGP  988
              S     G    I  +                     +  +S   +E+SEDYTC+  HGP
Sbjct  171   QSKVIAEGYFPGIGSDSAS------------------SSCLSEDHMEMSEDYTCIIAHGP  212

Query  989   NPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKK  1168
             NPK THI+ D +LEC  NE  N  K  E E          E  F  P+  FLS C  C K
Sbjct  213   NPKTTHIYGDRVLECQKNEAINKEKQFETE---------LESMF--PTDHFLSVCDFCNK  261

Query  1169  KLD-GKDIFIYRGEKAFCSSSCRSEE-ILIDEE  1261
             KL+ G DI++YRGEKAFCS  CRSEE ++IDEE
Sbjct  262   KLEVGYDIYMYRGEKAFCSEECRSEEMMMIDEE  294



>ref|XP_004138874.1| PREDICTED: uncharacterized protein LOC101212300 [Cucumis sativus]
Length=399

 Score =   139 bits (351),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S+IELSEDYTCV +HGPNPK THIF DCIL CH+N  ++ S+N  +E    +     
Sbjct  256   LSASEIELSEDYTCVISHGPNPKTTHIFGDCILGCHSNYLSSSSENEMKEMEFPRPLKSL  315

Query  1109  EEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
                 SY  +DFLS CY+C KKLD GKDI+IYRGEKAFCS +CRS+E+L+DEE EK+
Sbjct  316   NTSTSYSLTDFLSMCYSCHKKLDEGKDIYIYRGEKAFCSLTCRSQEMLMDEELEKS  371



>ref|XP_008777180.1| PREDICTED: uncharacterized protein LOC103697154 [Phoenix dactylifera]
Length=376

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 115/333 (35%), Positives = 161/333 (48%), Gaps = 52/333 (16%)
 Frame = +2

Query  326   DSVRSPTSPLEFRVFSTLSNTLRSQRSS---EGHQK-SWGCSKVGLSIIDALDDKTKRLG  493
             DS  SPTSPL+ +V S       S   S   +GH K S   +KVGL ++D+L D+   LG
Sbjct  39    DSSSSPTSPLDHKVLSNAGGPCVSSPRSPVLDGHPKNSTHRNKVGLGLVDSLTDEVMPLG  98

Query  494   NLPIPSKSKNIIFGPQMSCK--------TQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPF  649
             N+   S+SK ++ G ++  +         +N L  + S  A KSLP+N            
Sbjct  99    NVLRFSESKKVVLGSKIGIQIPGPKTLSVKNVLLDNPSITALKSLPEN-------NGSSL  151

Query  650   NLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEH  829
                 D  ++  G     LE  I+                           + S + G+  
Sbjct  152   QAPADCFHLRIGQQKTELESEIA--------------------------GMQSENGGSID  185

Query  830   GINSAISQNVRELSKLGNSSGAKLR----SMPVPAGSISTSKIELSEDYTCVRTHGPNPK  997
             G N   +  + E S+  NS+   L     S     GS+S S IE SEDYTC+ +HG NP+
Sbjct  186   GDNQKFNSEISE-SETKNSTSDSLTISNDSSCDFIGSLSISDIEQSEDYTCIISHGDNPR  244

Query  998   VTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP-GCCEEHFSYPSSDFLSFCYTCKKKL  1174
              THIF DCILE   +   +      E+ G S       EE   +  +DFLSFCY+CK+KL
Sbjct  245   TTHIFGDCILESQVDRSPDGKHKHREDRGESPWEVKPSEEVPLHSRTDFLSFCYSCKRKL  304

Query  1175  -DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
              +  DI+IYRGEKAFCS  CR++EILI+E+ +K
Sbjct  305   KEEDDIYIYRGEKAFCSCECRAQEILIEEKIDK  337



>gb|KGN62889.1| hypothetical protein Csa_2G379200 [Cucumis sativus]
Length=486

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S+IELSEDYTCV +HGPNPK THIF DCIL CH+N  ++ S+N  +E    +     
Sbjct  343   LSASEIELSEDYTCVISHGPNPKTTHIFGDCILGCHSNYLSSSSENEMKEMEFPRPLKSL  402

Query  1109  EEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
                 SY  +DFLS CY+C KKLD GKDI+IYRGEKAFCS +CRS+E+L+DEE EK+
Sbjct  403   NTSTSYSLTDFLSMCYSCHKKLDEGKDIYIYRGEKAFCSLTCRSQEMLMDEELEKS  458



>ref|XP_006465553.1| PREDICTED: uncharacterized protein LOC102619830 isoform X4 [Citrus 
sinensis]
Length=340

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 181/367 (49%), Gaps = 61/367 (17%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTL  379
             M DS+SE  + S  F  +   SS   +    VGL+ K  S+SD+V SPTSPL+FR F  L
Sbjct  1     MADSASEFSIQSDSFGIRQISSS---LSGFLVGLSSKGSSDSDTVWSPTSPLDFRAFVNL  57

Query  380   SN--TLRSQRS--SEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMS  547
             SN  +++S RS    G+QK W  S+VGL II++L ++ +    +    K KNI+FG Q+ 
Sbjct  58    SNPFSVKSPRSPPQNGYQKKWDSSEVGLGIINSLAEEKESTSAVCNSLKRKNIVFGSQVK  117

Query  548   ----CKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGI  715
                   +++F     SF  + SLP+N  I    + K      DSS  + G  + P + G 
Sbjct  118   NNIPYSSRHFYESVSSFMKSNSLPRNYMISQLPQTKNPKFPFDSSNSVVGNTEFPSQSGS  177

Query  716   SSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGA  895
              S+++ S               +++  +L S  F   +  +S I+ +   +  +      
Sbjct  178   FSSSLTS---------------SAQNQDLRSKMF---YSADSTITLSAPLV--IDRDLLV  217

Query  896   KLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEE  1075
             K  S+P+P GS                 HG      H       +C  +E TNF K  E+
Sbjct  218   KTSSLPIPIGS----------------GHG------HA------DCQAHELTNFDKQIEQ  249

Query  1076  ENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILI  1252
             E  L++      +   Y S +FLSFCY+CKKKL+ G+DI++Y GEKAFCS  CRS+EI  
Sbjct  250   EVELTQVSERPNDLSHYSSDEFLSFCYSCKKKLEKGEDIYMYGGEKAFCSFDCRSDEIFT  309

Query  1253  DEEKEKT  1273
             +EE  K 
Sbjct  310   EEEMGKA  316



>emb|CBI20951.3| unnamed protein product [Vitis vinifera]
Length=132

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 82/123 (67%), Gaps = 23/123 (19%)
 Frame = +2

Query  911   PVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLS  1090
             P   GS+S S+IELSEDYTCV +HGPNPK THI+ DCILE                    
Sbjct  8     PRLIGSLSASEIELSEDYTCVISHGPNPKTTHIYGDCILEFE------------------  49

Query  1091  KGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
                 C +    YPS+DFLS CY+CKKKL +GKDI++YRGEKAFCS +CRS+EILIDEE E
Sbjct  50    ----CSDNSTPYPSNDFLSICYSCKKKLEEGKDIYMYRGEKAFCSLNCRSQEILIDEEME  105

Query  1268  KTN  1276
             KT 
Sbjct  106   KTT  108



>ref|XP_004160865.1| PREDICTED: uncharacterized protein LOC101229906 [Cucumis sativus]
Length=399

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S+IELSEDYTCV +HG NPK THIF DCIL CH+N  ++ S+N  +E    +     
Sbjct  256   LSASEIELSEDYTCVISHGLNPKTTHIFGDCILGCHSNYLSSSSENEMKEMEFPRPLKSL  315

Query  1109  EEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
                 SY  +DFLS CY+C KKLD GKDI+IYRGEKAFCS +CRS+E+L+DEE EK+
Sbjct  316   NTSTSYSLTDFLSMCYSCHKKLDEGKDIYIYRGEKAFCSLTCRSQEMLMDEELEKS  371



>ref|XP_004297111.1| PREDICTED: uncharacterized protein LOC101295037 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=285

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 119/348 (34%), Positives = 162/348 (47%), Gaps = 95/348 (27%)
 Frame = +2

Query  269   SFFNVPALFVGLNPKQ-SESDSVRSPTSPLEFRVFSTLSNTLRSQRSS--------EGHQ  421
             SFF+ P LF     K  SE+++V SPTS LE + F  L N   S+ ++        + H 
Sbjct  15    SFFSTPRLFTSFTSKPFSETEAVMSPTSILETKPFFGLRNPFWSESNTPKTPEPETKRHW  74

Query  422   KSWGCSKVGLSIIDALDDKTKRLGNLPIPSK--SKNIIFGPQMSCKTQNFLNHSDSFGAA  595
                     GL+I+DAL D     G+ P PSK  ++ +IFG Q+  +              
Sbjct  75    DKLDSKGTGLAIVDALIDDD---GSDPKPSKPQTRMVIFGSQLKIQ--------------  117

Query  596   KSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFA  775
                   IP  P             S VL       LE                      A
Sbjct  118   ------IPPLP-------------SSVLPSSESPKLE----------------------A  136

Query  776   SFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGN-SSGAKLRSMP-VPAGSISTSKIE  949
              F   ++N H G       ++S +SQ+  + S  G  SSG +    P V  G +S S++E
Sbjct  137   VFGIERTNSHLGP------LSSGLSQSPAKKSPFGTVSSGNETPVSPQVFKGCLSVSEME  190

Query  950   LSEDYTCVRTHGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSK-GPGCCEEHFS  1123
             LSEDYTCV +HGPNPK THIF + ++E C               +G+ +  P   E   S
Sbjct  191   LSEDYTCVISHGPNPKTTHIFDNRVVESC---------------DGVPQLSPTRKENKSS  235

Query  1124  YPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEK  1264
             YPS  FLSFCY CK  +  GKDI++YRGEKAFCSS CR +E+L++EE+
Sbjct  236   YPSESFLSFCYHCKNNIGQGKDIYMYRGEKAFCSSECRYQEMLLEEEE  283



>ref|XP_010024261.1| PREDICTED: uncharacterized protein LOC104414788 [Eucalyptus grandis]
 ref|XP_010024262.1| PREDICTED: uncharacterized protein LOC104414788 [Eucalyptus grandis]
 gb|KCW60717.1| hypothetical protein EUGRSUZ_H03450 [Eucalyptus grandis]
 gb|KCW60718.1| hypothetical protein EUGRSUZ_H03450 [Eucalyptus grandis]
Length=295

 Score =   132 bits (331),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 89/138 (64%), Gaps = 10/138 (7%)
 Frame = +2

Query  869   SKLGNSSGAKLRSMP----VPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECH  1036
             S   N   A +R  P    V AGSIS S++ELSEDYTCV +HGPNPK THIF DCILE  
Sbjct  162   SPAANKQEAAIRPPPPGGVVLAGSISASEMELSEDYTCVISHGPNPKTTHIFDDCILESC  221

Query  1037  NNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKA  1213
                      +  ++NGL  G     +H  +PS  FLSFCYTCKK L DG+DI+IYRGEKA
Sbjct  222   CGSIQLSESDCGKDNGLFLG-----DHCRFPSESFLSFCYTCKKNLGDGEDIYIYRGEKA  276

Query  1214  FCSSSCRSEEILIDEEKE  1267
             FCS  CR+++I ++E  E
Sbjct  277   FCSGECRTQQIELEEGME  294



>ref|XP_010326674.1| PREDICTED: uncharacterized protein LOC101247367 [Solanum lycopersicum]
Length=296

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 164/347 (47%), Gaps = 84/347 (24%)
 Frame = +2

Query  257   HKVSSFFNVPALFVGLNPKQ-SESDSVRSPTSPLEFRVFSTLSNTLRSQR-----SSEGH  418
              K SSFF  P LF     K   +++S+ SPTS L+ + F+ L N   S+       S  H
Sbjct  15    RKTSSFFGSPRLFTCFAAKGFPDTESIMSPTSILDSKPFTVLRNPFWSEPKSPKPESRVH  74

Query  419   QKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAK  598
              +      VGL ++DAL D+  +  +  + S S+ ++ G Q+  +               
Sbjct  75    FQKLDSKGVGLGLVDALIDE--KSDSKEMNSVSRMVVLGSQLKIQ---------------  117

Query  599   SLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFAS  778
                  IP  P T    FN   DS         +P + GI + N            S   S
Sbjct  118   -----IPTLPPT----FNYPTDSP-------PSPGDFGIKTRN------------SQLGS  149

Query  779   FASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSE  958
              +  K +     FG+    NS I         + NS GA          S+S +++ELSE
Sbjct  150   LSPVKKS----PFGSS---NSNID--------IPNSPGA--------FSSLSAAEMELSE  186

Query  959   DYTCVRTHGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSS  1135
             +YTCV +HGPNP+ THIF DCILE C       +S + +E    +  P C      YPS 
Sbjct  187   EYTCVISHGPNPRTTHIFDDCILESCCG--VVKYSASRKENETFTSPPMC------YPSE  238

Query  1136  DFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
              FLSFC+ CKK L  GKDI++YRGEKAFCSS CR +E++++E  +K+
Sbjct  239   SFLSFCHNCKKNLGIGKDIYMYRGEKAFCSSDCRYKEMMLEEGMDKS  285



>ref|XP_009774582.1| PREDICTED: uncharacterized protein LOC104224595 [Nicotiana sylvestris]
Length=307

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 159/351 (45%), Gaps = 89/351 (25%)
 Frame = +2

Query  266   SSFFNVPALFVGLNPKQ-SESDSVRSPTSPLE-------FR---VFSTLSNTLRSQR-SS  409
             SSFF  P LF G   K   +++S+ SPTS L+       FR      + SNT RS +  S
Sbjct  19    SSFFGSPRLFTGFATKGFPDTESIMSPTSILDSSKPISAFRNPFWSDSNSNTPRSPKPDS  78

Query  410   EGHQKSWGCSKVGLSIIDALDDKTKRLGNL-PIPSKSKNIIFGPQMSCKTQNFLNHSDSF  586
               H +      VGL ++DAL D+      L P+   S+ ++FG Q+  +           
Sbjct  79    RVHWEKLDSKGVGLGLVDALIDEKSDSKELNPV---SRMVVFGSQLKIQ-----------  124

Query  587   GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgs  766
                          P T P  F+   DS          P   G                  
Sbjct  125   ------------IPTTLPPSFHSPTDS----------PPSPG------------------  144

Query  767   HFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKI  946
                 F  +  N H GSF   H   S    +   +  + NS GA          SIS +++
Sbjct  145   ---DFGIKTRNSHLGSFSPSHMKKSPFGSSNSNM-DIPNSPGA--------FSSISAAEM  192

Query  947   ELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSKGPGCCEEHF  1120
             ELSEDYTCV ++GPNP+ THIF DCI+E  C   +++   K  E    L          +
Sbjct  193   ELSEDYTCVISYGPNPRTTHIFDDCIVESCCGVVKYSASRKENEHFPSLPMS-------Y  245

Query  1121  SYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
              YPS  FLSFC++CKK L  GKDI++YRGEKAFCSS CR +E++++E  +K
Sbjct  246   PYPSESFLSFCHSCKKNLGLGKDIYMYRGEKAFCSSDCRYKEMMLEEGMDK  296



>emb|CDO99077.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   129 bits (325),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 159/344 (46%), Gaps = 78/344 (23%)
 Frame = +2

Query  266   SSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQKS-----  427
             SS F+ P LF G   K  ++S+S+ SPTS L+ + FS L N   S  S+    K+     
Sbjct  20    SSLFSSPRLFTGFASKGLTDSESLMSPTSILDSKPFSALRNPFWSDSSTPRTPKTENRLQ  79

Query  428   ---WGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAK  598
                     VGL ++DAL D+ K   N   P +++ +IFG Q+  +               
Sbjct  80    LEKLESRGVGLGLVDALTDE-KADSNACKP-ENRKVIFGSQLKIQI-------------P  124

Query  599   SLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFAS  778
              LP +  I P   PK                 +P + GI + N        G      + 
Sbjct  125   PLPPSAVISPADSPK-----------------SPADFGIKTRN-----SVVGSVSPGLSP  162

Query  779   FASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSE  958
              + RKS   S + G E       S + R  S L                  S S++E SE
Sbjct  163   SSVRKSPFGSSNSGLES------SNSPRVFSGL------------------SISEMERSE  198

Query  959   DYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSD  1138
             DYTCV ++GPNP+ THIF DCI+E  +      S  G  +NG        +   SYPS  
Sbjct  199   DYTCVISYGPNPRTTHIFDDCIVESWSGPVQISSSRG--QNGF-----FIDRSLSYPSES  251

Query  1139  FLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             FLSFC TCKK L  GKDI++YRGEKAFCSS CR +EI++++ ++
Sbjct  252   FLSFCCTCKKNLGQGKDIYMYRGEKAFCSSECRDKEIMLEKARK  295



>ref|XP_010491878.1| PREDICTED: uncharacterized protein LOC104769377 [Camelina sativa]
Length=337

 Score =   130 bits (326),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 115/332 (35%), Positives = 147/332 (44%), Gaps = 76/332 (23%)
 Frame = +2

Query  281   VPALFVGLNPKQSESDSVRSPTSPLEFRVFSTLSNTL---RSQRSSEGHQKSWGCSKVGL  451
             +  +F G  P  S+ +S  SPTSPL+FR+FS+  N      S+   +G QKSW   KVGL
Sbjct  32    ISGVFEGKCP--SDYESAWSPTSPLDFRLFSSFGNPFGGSSSRSIWKGKQKSWDSGKVGL  89

Query  452   SIIDALDDKTKRLG---NLPIPS-KSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIP  619
             SI+ +LDD          + +PS  SKNIIFG  M    QN    S  F  A  +PKN  
Sbjct  90    SILHSLDDDDHHTDSSSRIVLPSVDSKNIIFGSLMRSGNQNPHLLSQPFAKAL-MPKN--  146

Query  620   IFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSN  799
                           D S V+F IG   ++   +  N                        
Sbjct  147   --------------DMSNVVFEIGHDVIDVVDAVGN------------------------  168

Query  800   LHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRT  979
                                    S + N++   +   P      + S IE+SEDYTCV  
Sbjct  169   -----------------------SSVDNNACQVIEEAPGSVNGSTESDIEISEDYTCVIQ  205

Query  980   HGPNPKVTHIFCDCILEC--HNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFC  1153
             HGPNPK TH + D +LE   HN    +  +N +E       P         P SDFLS C
Sbjct  206   HGPNPKTTHFYGDQVLESVEHNESKNHCCRNKKESIFTIASPDLTTPIDVLPPSDFLSVC  265

Query  1154  YTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEI  1246
             Y C KKL  GK+I++YRG KAFCSS CRSEEI
Sbjct  266   YGCNKKLGLGKEIYMYRGYKAFCSSECRSEEI  297



>ref|XP_006360776.1| PREDICTED: uncharacterized protein LOC102602108 [Solanum tuberosum]
Length=302

 Score =   129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 116/359 (32%), Positives = 168/359 (47%), Gaps = 88/359 (25%)
 Frame = +2

Query  257   HKVSSFFNVPALFVGLNPKQ-SESDSVRSPTSPLEFRVFSTLSNTLRS-----QRSSEGH  418
              K SSFF  P LF   + K   +++S+ SPTS L+ + F+ L N   S     +  S  H
Sbjct  15    RKTSSFFGSPRLFTCFSAKGFPDTESIMSPTSILDSKPFTVLRNPFWSDPKSPKPESRVH  74

Query  419   QKSWGCSKVGLSIIDALDDK---TKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFG  589
              +      VGL ++DAL D+   +K + ++     S+ ++ G Q+  +            
Sbjct  75    FQKLDSKGVGLGLVDALIDEKSDSKEMNSI-----SRMVVLGSQLKIQ------------  117

Query  590   AAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsH  769
                     IP  P +    FN   DS         +P + GI + N            S 
Sbjct  118   --------IPTLPPS----FNYPTDSP-------PSPGDFGIKTRN------------SQ  146

Query  770   FASFAS--RKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSK  943
               SF+     S +    FG+    NS I         + NS GA          S+S ++
Sbjct  147   LGSFSPGFSPSPVKKSPFGSS---NSNI--------DIPNSPGA--------FSSLSAAE  187

Query  944   IELSEDYTCVRTHGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSKGPGCCEEHF  1120
             +ELSE+YTCV ++GPNP+ THIF DCILE C       +S + +E       P       
Sbjct  188   MELSEEYTCVISYGPNPRTTHIFDDCILESCCG--VVKYSASRKENETFPNPP------M  239

Query  1121  SYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDF  1294
             SYPS  FLSFC+ CKK L  GKDI++YRGEKAFCSS CR +E++++E  +K+    + F
Sbjct  240   SYPSESFLSFCHNCKKNLGIGKDIYMYRGEKAFCSSDCRYKEMMLEEGMDKSETDDNVF  298



>ref|XP_002880699.1| hypothetical protein ARALYDRAFT_481422 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56958.1| hypothetical protein ARALYDRAFT_481422 [Arabidopsis lyrata subsp. 
lyrata]
Length=319

 Score =   129 bits (324),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 114/339 (34%), Positives = 161/339 (47%), Gaps = 86/339 (25%)
 Frame = +2

Query  287   ALFVGLNPKQ---SESDSVRSPTSPLEFRVFSTLSNT--LRSQRSSEGHQKSWGC---SK  442
             +L +GLN  +   S+SD VRSP SPLEFR+ ST++++  LRS RSS     +  C   +K
Sbjct  42    SLLIGLNNNKKCISDSDFVRSPKSPLEFRILSTMADSFFLRSPRSSLTAHLNCCCGPAAK  101

Query  443   VGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPI  622
             VGLSI+D+L D    L          +++FGP +  K                    + +
Sbjct  102   VGLSIVDSLGDDRCLL---------PDVVFGPALRIKCSE-----------------VKL  135

Query  623   FPCTEPKPFNLHNDSSYVLFGIGDAPLE-EGISSANMrsrsldsgrsgsHFASFASRKSN  799
             FP    K   +  + S V+F IGD   E E I   N               A+   RK+ 
Sbjct  136   FPVA--KSMKIEKERSGVVFEIGDNSSEPEPIGLRNRSFS-----------ANDCLRKTR  182

Query  800   LHSGS-FGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVR  976
             + S S  G E     + S+N                     A S   S+ ++ EDYTC+ 
Sbjct  183   VLSRSKLGAEGDFQGSGSEN---------------------AFSSCLSEDDM-EDYTCII  220

Query  977   THGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCY  1156
              HGPNPK THI+ D +LECH N        G+++N         E+       +FLS C 
Sbjct  221   AHGPNPKTTHIYGDRVLECHKNGL-----KGDDDNK--------EKTIETEFDNFLSICN  267

Query  1157  TCKKKLDG-KDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
              C KKL G  DI++YR EK+FCS+ CRSEE++I+EE ++
Sbjct  268   FCNKKLGGDDDIYMYR-EKSFCSAECRSEEMMIEEEDQE  305



>ref|XP_007217267.1| hypothetical protein PRUPE_ppa011797mg [Prunus persica]
 gb|EMJ18466.1| hypothetical protein PRUPE_ppa011797mg [Prunus persica]
Length=195

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 96/169 (57%), Gaps = 23/169 (14%)
 Frame = +2

Query  872   KLGNSSGAKLRSMPVP-------AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE  1030
             ++ NS G K  S+PVP       A SIS  +IELSEDYTC+ +HGP PK THIF DCILE
Sbjct  29    QVENSVGFKPSSLPVPIASTHQYASSISAREIELSEDYTCIISHGPKPKTTHIFGDCILE  88

Query  1031  CHNNEFTNF--SKNGEEENGLSKGPG-CCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYR  1201
             CH  E  NF  +K   E   ++K       EH      + L  CYTCKK LDG+++++ R
Sbjct  89    CHTTELNNFDEAKLWIESPRVAKYQDRLANEHL----DEALRLCYTCKKNLDGEEMYMCR  144

Query  1202  GEKAFCSSSCRSEEILIDEEKEKT--NKGGDDFEKPNSREEPYESSLFI  1342
             GEKAFCS  C SE+I  +EE E T  N  G       S  E Y   LF+
Sbjct  145   GEKAFCSFDCHSEKIFAEEEIESTCENSAG-------SSSESYHEDLFL  186



>ref|XP_006294596.1| hypothetical protein CARUB_v10023632mg [Capsella rubella]
 gb|EOA27494.1| hypothetical protein CARUB_v10023632mg [Capsella rubella]
Length=325

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 117/340 (34%), Positives = 159/340 (47%), Gaps = 85/340 (25%)
 Frame = +2

Query  287   ALFVGLNPKQ-----SESDSVRSPTSPLEFRVFSTLSNT--LRSQRSSEGHQKSWGC---  436
             +L +GLN        S+SD VRSP SPLEFRV ST+++   LRS RSS        C   
Sbjct  39    SLLIGLNNNNKCCISSDSDFVRSPKSPLEFRVLSTMADPFFLRSPRSSLSLTAHLNCCCR  98

Query  437   ---SKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLP  607
                +KVGLSI+   DD+      LP      +++FGP +  K             +K   
Sbjct  99    VPAAKVGLSIVGGDDDRCL----LP------DVVFGPALRIK------------CSKVRV  136

Query  608   KNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFAS  787
             ++ P+      K   +  + S V+F IGD          N         R+ S  A+   
Sbjct  137   RDNPL-----AKSLKIEKERSGVVFEIGDG---------NSCEAEPVGLRNRSFSANDCL  182

Query  788   RKSNLHSGS-FGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDY  964
             RK+ + SGS FG E   + + S N                     A S   S+ ++ EDY
Sbjct  183   RKTRVLSGSKFGAEGDFSGSASDN---------------------AFSSCLSEDDM-EDY  220

Query  965   TCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFL  1144
             TC+  HGPNPK THI+ D +LECH NE    SK  ++  G        +      S +FL
Sbjct  221   TCIIAHGPNPKTTHIYGDRVLECHKNE----SKGDDDYEGT-------QSESMLASVNFL  269

Query  1145  SFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
             + C  C K L+ G DI++YR EK FCS  CRSEE++IDEE
Sbjct  270   NVCNFCNKNLEVGDDIYMYR-EKPFCSEECRSEEMMIDEE  308



>ref|XP_010256094.1| PREDICTED: uncharacterized protein LOC104596562 [Nelumbo nucifera]
 ref|XP_010256095.1| PREDICTED: uncharacterized protein LOC104596562 [Nelumbo nucifera]
Length=320

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 93/139 (67%), Gaps = 14/139 (10%)
 Frame = +2

Query  884   SSGAKLRSMP-VPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE-CHNNEFTNF  1057
             SSG +  + P +  GS+S S++ELSEDYTCV THGPNP+ THIF +CI+E C      + 
Sbjct  187   SSGLEAPASPKIFTGSLSPSEMELSEDYTCVITHGPNPRTTHIFDNCIVESCCG--VVSL  244

Query  1058  SKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCR  1234
             S + +E +  S       +  SYPS DFLSFCYTCKK L  GKDI++YRGEKAFCS  CR
Sbjct  245   SASRKENSFFS-------DRSSYPSEDFLSFCYTCKKNLGQGKDIYMYRGEKAFCSRECR  297

Query  1235  SEEILIDEEKEKTNKGGDD  1291
              +E+L DE  EK+  G DD
Sbjct  298   YQEMLFDEGMEKS--GLDD  314


 Score = 51.6 bits (122),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 19/142 (13%)
 Frame = +2

Query  152  MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SESD  328
            MLRKRTR+   +Q+  LM   S  S     +         FF+ P LF  L+ K  SE++
Sbjct  1    MLRKRTRAVTSKQV--LMDHGSLPSPKDKFI----RPTLPFFSSPRLFTALSGKGFSETE  54

Query  329  SVRSPTSPLEFRVFSTLSNTLRSQR----------SSEGHQKSWGCSKVGLSIIDALDDK  478
            +V SPTS L+ + FS L N   S R           S+   K      +GL I+DAL+D+
Sbjct  55   AVMSPTSILDSKPFSGLGNPFWSDRLSVKSPEPCLESKHPWKKLDSRGIGLGIVDALNDE  114

Query  479  TKRLGNLPIPSKSKNIIFGPQM  544
             K   N   P +S+ ++FG Q+
Sbjct  115  -KSENNFSKP-ESRMVLFGSQL  134



>dbj|BAK01330.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=351

 Score =   125 bits (315),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 77/119 (65%), Gaps = 4/119 (3%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             GS+S S++E SEDYTC+   GPNPK THIF DCILE             E ++G S    
Sbjct  204   GSVSASEVEQSEDYTCIIARGPNPKTTHIFGDCILEPQTTVGKGDEATMEPKDGASAKSY  263

Query  1103  C----CEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
                    E  + P  DFLS C+TC+KKL+GKDI+IYRGEKAFCS+ CR +EI+I+EE E
Sbjct  264   LVVKRATEAAAGPGEDFLSSCFTCRKKLEGKDIYIYRGEKAFCSAECRDQEIMIEEEAE  322



>ref|XP_009613879.1| PREDICTED: uncharacterized protein LOC104106921 [Nicotiana tomentosiformis]
Length=309

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 163/352 (46%), Gaps = 89/352 (25%)
 Frame = +2

Query  266   SSFFNVPALFVGLNPKQ-SESDSVRSPTSPLE-------FR-VFSTLSN--TLRSQR-SS  409
             SSFF  P LF G   K   +++S+ SPTS L+       FR  F + SN  T RS +  S
Sbjct  19    SSFFGSPRLFTGFATKGFPDTESIMSPTSILDSSKPISAFRNPFWSDSNSHTPRSPKPDS  78

Query  410   EGHQKSWGCSKVGLSIIDALDDKTKRLGNL-PIPSKSKNIIFGPQMSCKTQNFLNHSDSF  586
               H +      VGL ++DAL D+      L P+   S+ ++FG Q+  +           
Sbjct  79    RVHWEKLDSKGVGLGLVDALIDEKSDSKELNPV---SRMVVFGSQLKIQ-----------  124

Query  587   GAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgs  766
                  +P  +P F  +                 + D+P   G                  
Sbjct  125   -----IPTTLPPFSSS-----------------LTDSPPSPG------------------  144

Query  767   HFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNS-SGAKLRSMPVPAGSISTSK  943
                 F  +  N   GSF          S +  + S  G+S S   + + P    S+S ++
Sbjct  145   ---DFGIKTRNSQLGSF----------SPSPMKKSPFGSSNSNMDIPNSPGAFSSLSAAE  191

Query  944   IELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSKGPGCCEEH  1117
             +ELSEDYTCV ++GPNP+ THIF DCI+E  C   +++   K  E    L          
Sbjct  192   MELSEDYTCVISYGPNPRTTHIFDDCIVESCCGVVKYSASRKENEHFPSLP-----MSYP  246

Query  1118  FSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             + YPS  FLSFC++CKK L  GKDI++YRGEKAFCSS CR +E++++E  +K
Sbjct  247   YPYPSGSFLSFCHSCKKNLGLGKDIYMYRGEKAFCSSDCRYKEMMLEEGMDK  298



>gb|KDP40194.1| hypothetical protein JCGZ_02192 [Jatropha curcas]
Length=322

 Score =   124 bits (310),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 118/346 (34%), Positives = 158/346 (46%), Gaps = 87/346 (25%)
 Frame = +2

Query  284   PALFVGLNPKQ--SESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGH--------QKSWG  433
             P LF G   K     ++ V SPTS L+ + FS   N      +            +++W 
Sbjct  36    PRLFTGFTFKNLSETAEGVMSPTSILDSKPFSGFRNPFLPDPTPNPTPKTPEFETRRTWD  95

Query  434   ---CSKVGLSIIDALD-DKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKS  601
                   +GL I+DAL+ DKT+   NL  P +S+ ++FG Q+  +                
Sbjct  96    KLDSKGIGLGIVDALNGDKTE--PNLSKP-ESRMVLFGSQLKIQ----------------  136

Query  602   LPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASF  781
                 +P  P     PF    D S        +P + GI +                    
Sbjct  137   ----VPPLP-----PFLSPTDQS------PKSPADFGIKT--------------------  161

Query  782   ASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMP-VPAGSISTSKIELSE  958
               R S L S S G  H      S   + L    NS      S P V  G +S S++ELSE
Sbjct  162   --RNSQLGSFSSGLFH------SPVKKSLCSSANSGVDNTNSPPRVFTGCLSASEMELSE  213

Query  959   DYTCVRTHGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSS  1135
             DYTCV ++GPNP+ THIF DCI+E C       FS +  E N    G G      SYPS 
Sbjct  214   DYTCVISYGPNPRTTHIFDDCIVESCCG--VVGFSASMAEANRF-LGNGS-----SYPSE  265

Query  1136  DFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             +FLSFCY CKK L  GKDI++YRGEKAFCS  CR +E+L++E+ +K
Sbjct  266   NFLSFCYACKKNLGQGKDIYMYRGEKAFCSRECRYQEMLLEEQLDK  311



>ref|XP_007034793.1| NAD(P)H-quinone oxidoreductase subunit H, putative isoform 1 
[Theobroma cacao]
 ref|XP_007034794.1| NAD(P)H-quinone oxidoreductase subunit H, putative isoform 1 
[Theobroma cacao]
 gb|EOY05719.1| NAD(P)H-quinone oxidoreductase subunit H, putative isoform 1 
[Theobroma cacao]
 gb|EOY05720.1| NAD(P)H-quinone oxidoreductase subunit H, putative isoform 1 
[Theobroma cacao]
Length=289

 Score =   123 bits (308),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 134/269 (50%), Gaps = 41/269 (15%)
 Frame = +2

Query  509   SKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHN-DSSYVLFG  685
             S +  ++  P     ++ F    + F +  S+PK         P+P   H  ++  V  G
Sbjct  36    SDNTEVVMSPTSILDSKPFSAFRNPFWSESSIPKT--------PEPETRHKLETKGVGLG  87

Query  686   IGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQ----  853
             I DA L++  S +N+    L   +      S     S   S     E GI +  SQ    
Sbjct  88    IVDA-LKDDDSDSNLSKSVLFGSQLRIQIPSLPPVFSPAESPRTPPEFGIKTRNSQLSSF  146

Query  854   -------NVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIF  1012
                     VR+  +  NS G       V AGS+S +++ELSEDYTCV +HGPNP+ THIF
Sbjct  147   SSGMSPSPVRKSIETLNSPG-------VFAGSLSATEMELSEDYTCVISHGPNPRTTHIF  199

Query  1013  CDCILE--CHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGK  1183
              +CI+E  C    F++  +    ENG         +  SY S  FLSFCYTCKK L  GK
Sbjct  200   DNCIVESCCGVVGFSSLKR----ENGF------LADRSSYQSESFLSFCYTCKKNLGQGK  249

Query  1184  DIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             DI++YRGEKAFCS  CR +E++++E  +K
Sbjct  250   DIYMYRGEKAFCSRECRYQEMMLEEGIDK  278



>ref|XP_006489415.1| PREDICTED: uncharacterized protein LOC102612013 [Citrus sinensis]
Length=295

 Score =   123 bits (308),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 9/117 (8%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSK  1093
              G +S +++ELSEDYTCV +HGPNPK THIF +CI+E  C    F++  K  +E   +SK
Sbjct  172   TGCLSATEMELSEDYTCVISHGPNPKTTHIFDNCIVESCCGVAGFSSLRKESKE--FMSK  229

Query  1094  GPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
                  ++ FSYPS  FLSFCY CKK L  GKDI++YRGEKAFCS  CR +E++++EE
Sbjct  230   S----DDRFSYPSESFLSFCYNCKKNLGPGKDIYMYRGEKAFCSQECRFQEMMLEEE  282



>gb|KDO74541.1| hypothetical protein CISIN_1g022550mg [Citrus sinensis]
Length=295

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 9/117 (8%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSK  1093
              G +S +++ELSEDYTCV +HGPNPK THIF +CI+E  C    F++  K  +E   +SK
Sbjct  172   TGCLSATEMELSEDYTCVISHGPNPKTTHIFDNCIVESCCGVAGFSSLRKESKE--FMSK  229

Query  1094  GPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
                  ++ FSYPS  FLSFCY CKK L  GKDI++YRGEKAFCS  CR +E++++EE
Sbjct  230   S----DDRFSYPSESFLSFCYNCKKNLGPGKDIYMYRGEKAFCSQECRFQEMMLEEE  282



>ref|XP_006419965.1| hypothetical protein CICLE_v10005538mg [Citrus clementina]
 ref|XP_006419966.1| hypothetical protein CICLE_v10005538mg [Citrus clementina]
 gb|ESR33205.1| hypothetical protein CICLE_v10005538mg [Citrus clementina]
 gb|ESR33206.1| hypothetical protein CICLE_v10005538mg [Citrus clementina]
Length=295

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 9/117 (8%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSK  1093
              G +S +++ELSEDYTCV +HGPNPK THIF +CI+E  C    F++  K  +E   +SK
Sbjct  172   TGCLSATEMELSEDYTCVISHGPNPKTTHIFDNCIVESCCGVAGFSSLRKESKE--FMSK  229

Query  1094  GPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
                  ++ FSYPS  FLSFCY CKK L  GKDI++YRGEKAFCS  CR +E++++EE
Sbjct  230   S----DDRFSYPSESFLSFCYNCKKNLGPGKDIYMYRGEKAFCSQECRFQEMMLEEE  282



>ref|XP_009418943.1| PREDICTED: uncharacterized protein LOC103999034 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009418944.1| PREDICTED: uncharacterized protein LOC103999034 [Musa acuminata 
subsp. malaccensis]
Length=343

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 82/130 (63%), Gaps = 12/130 (9%)
 Frame = +2

Query  875   LGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN  1054
             LG+     + S  V  GSIS S++ELSEDYTCV +HGPNPK THIF +CI+E    EF  
Sbjct  187   LGHHHEVSVSSPRVFTGSISASEMELSEDYTCVISHGPNPKTTHIFDNCIVESCGEEFMP  246

Query  1055  FSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSC  1231
               K    +N      G       YP+ DF++FCY CKK L  GKDIF+YRGEKAFCS+ C
Sbjct  247   ARK----DNSFVPSQG-------YPADDFITFCYACKKILGHGKDIFMYRGEKAFCSNEC  295

Query  1232  RSEEILIDEE  1261
             R  E+LI EE
Sbjct  296   RYHEMLIYEE  305



>ref|XP_008786298.1| PREDICTED: uncharacterized protein LOC103704680 [Phoenix dactylifera]
 ref|XP_008786308.1| PREDICTED: uncharacterized protein LOC103704680 [Phoenix dactylifera]
 ref|XP_008786317.1| PREDICTED: uncharacterized protein LOC103704680 [Phoenix dactylifera]
Length=416

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 78/105 (74%), Gaps = 3/105 (3%)
 Frame = +2

Query  926   SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKN--GEEENGLSKGP  1099
             S+S S+IELSEDYTC+ +HGPNPK THIF DCILE H  +  + SKN  G E  G S   
Sbjct  275   SLSASEIELSEDYTCIISHGPNPKTTHIFGDCILESHTIQSPD-SKNKLGREGGGSSWLV  333

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCR  1234
              C E+    PS+DFLS C++CKKKL+GKDI++YRGEKAFCS +CR
Sbjct  334   KCPEDSPPCPSNDFLSNCFSCKKKLEGKDIYMYRGEKAFCSCNCR  378


 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 93/136 (68%), Gaps = 5/136 (4%)
 Frame = +2

Query  152  MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSES  325
            MLRKR+R  QK+Q  G LMPDS+S+S +S+    QK + +SFF+ P LFVGL+ K   +S
Sbjct  1    MLRKRSRPVQKEQSKGLLMPDSASDSIVSADGVVQKARSTSFFSAPGLFVGLSTKGMPDS  60

Query  326  DSVRSPTSPLEFRVFSTLSNTLRSQRSS---EGHQKSWGCSKVGLSIIDALDDKTKRLGN  496
            +S +SPTSPL+ +VFS   ++  S   S   EG  +SW C+KVGL ++D+L+D++K  G 
Sbjct  61   ESAKSPTSPLDSKVFSNRGSSFVSSPGSPGPEGQPRSWHCNKVGLGLVDSLNDESKVGGK  120

Query  497  LPIPSKSKNIIFGPQM  544
            +   S+SKNI+ G QM
Sbjct  121  VLRFSESKNILLGSQM  136



>emb|CDM81788.1| unnamed protein product [Triticum aestivum]
Length=352

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 4/121 (3%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             GS+S S++E SEDYTC+   GPNPK THIF DCILE       +     E ++G S    
Sbjct  205   GSVSASEVEQSEDYTCIIARGPNPKTTHIFGDCILEPQTTVGKSDEAAMEPKDGASAKSY  264

Query  1103  C----CEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                    E  + P  DFLS C+TC+KKL+G DI+IYRGEKAFCS+ CR +EI+I+EE E 
Sbjct  265   LVVKRATESAAGPGEDFLSSCFTCRKKLEGNDIYIYRGEKAFCSAECRDQEIMIEEEAEN  324

Query  1271  T  1273
             +
Sbjct  325   S  325



>ref|XP_010932772.1| PREDICTED: uncharacterized protein LOC105053366 [Elaeis guineensis]
 ref|XP_010932773.1| PREDICTED: uncharacterized protein LOC105053366 [Elaeis guineensis]
 ref|XP_010932774.1| PREDICTED: uncharacterized protein LOC105053366 [Elaeis guineensis]
 ref|XP_010932776.1| PREDICTED: uncharacterized protein LOC105053366 [Elaeis guineensis]
Length=307

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 77/117 (66%), Gaps = 11/117 (9%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             G ++ S++ELSEDYTCV +HGPNP+ THIF +CI+E   + F    K   E   L+   G
Sbjct  192   GCLTPSEMELSEDYTCVISHGPNPRTTHIFDNCIVESCGDGFVALRK---ENRSLADNSG  248

Query  1103  CCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                    Y S DFLSFCY C+K L  GKDIF+YRGEKAFCS  CR +E+L DEE EK
Sbjct  249   -------YTSDDFLSFCYACRKNLGQGKDIFMYRGEKAFCSRECRYQEMLFDEEMEK  298



>ref|XP_006645564.1| PREDICTED: uncharacterized protein LOC102712952 [Oryza brachyantha]
Length=226

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 81/149 (54%), Gaps = 16/149 (11%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHN--------NEFTNFSKNGEEE  1078
             GS+S S+IE SEDYTC+   GPNPK THIF  CILE            E T  +      
Sbjct  80    GSVSASEIEQSEDYTCIIARGPNPKTTHIFGGCILEPQTVDAGAATAMEVTEAAAESYWV  139

Query  1079  NGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDE  1258
                + G G           DFLS C+TCKKKL+G DI+IYRGEKAFCS++CR +EILI+E
Sbjct  140   VKCATGAG--------AGDDFLSSCFTCKKKLEGNDIYIYRGEKAFCSATCRDQEILIEE  191

Query  1259  EKEKTNKGGDDFEKPNSREEPYESSLFIA  1345
             E E T         P S        +F+A
Sbjct  192   EAENTTTTTTTMGSPRSSWSSLHDEIFMA  220



>ref|XP_010259075.1| PREDICTED: uncharacterized protein LOC104598615 [Nelumbo nucifera]
Length=321

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 83/123 (67%), Gaps = 11/123 (9%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSKGP  1099
             G +S S++ELSEDYTCV THGPNP+ THIF +CI+E C      + S+   +EN  S   
Sbjct  202   GCLSASEMELSEDYTCVITHGPNPRTTHIFDNCIVESCCGVVGLSASR---KENCFS---  255

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTN  1276
                 +  +YPS +FLSFCYTCKK L  GKDI+IYRGEKAFCS  CR +E+L DE  EK+ 
Sbjct  256   ---SDRSNYPSVNFLSFCYTCKKDLGQGKDIYIYRGEKAFCSRECRYQEMLFDEGMEKSE  312

Query  1277  KGG  1285
               G
Sbjct  313   LDG  315


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 70/142 (49%), Gaps = 18/142 (13%)
 Frame = +2

Query  152  MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SESD  328
            MLRKR+R+   +Q   LM D  S   L S         S FF+ P LF  L+ K  SE++
Sbjct  1    MLRKRSRAMTSKQ--ALMADHGS---LPSPKGKYIRPTSPFFSSPRLFTALSGKGFSETE  55

Query  329  SVRSPTSPLEFRVFSTLSNTLRSQRSSEG-------HQKSW---GCSKVGLSIIDALDDK  478
            +V SPTS L+ + FS   N + S R +         ++  W       +GL I+DAL D 
Sbjct  56   AVMSPTSILDTKPFSGFGNPIWSDRLTAKSPEPCPENRHPWEKLDSRGIGLGIVDALSD-  114

Query  479  TKRLGNLPIPSKSKNIIFGPQM  544
             +R  N     +S+ ++FG Q+
Sbjct  115  -ERSTNSFSKPESRMVLFGSQL  135



>ref|XP_010917764.1| PREDICTED: uncharacterized protein LOC105042310 [Elaeis guineensis]
 ref|XP_010917765.1| PREDICTED: uncharacterized protein LOC105042310 [Elaeis guineensis]
Length=334

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 11/115 (10%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S++ELSEDYTCV + GPNP+ THIF +CI+E   + F    K G             
Sbjct  221   LSPSEMELSEDYTCVISRGPNPRTTHIFDNCIVESCGDGFVALRKEGSS----------L  270

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
              +H  Y S DFLS+CY C+K L  GKDIF+YRGEKAFCS  CR +E+L DEE EK
Sbjct  271   ADHSGYTSDDFLSYCYACRKNLGQGKDIFMYRGEKAFCSRECRYQEMLFDEEMEK  325



>ref|XP_007034795.1| NAD(P)H-quinone oxidoreductase subunit H, putative isoform 3, 
partial [Theobroma cacao]
 gb|EOY05721.1| NAD(P)H-quinone oxidoreductase subunit H, putative isoform 3, 
partial [Theobroma cacao]
Length=240

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 92/244 (38%), Positives = 125/244 (51%), Gaps = 41/244 (17%)
 Frame = +2

Query  584   FGAAKSLPKNIPIFPCTEPKPFNLHN-DSSYVLFGIGDAPLEEGISSANMrsrsldsgrs  760
             F +  S+PK         P+P   H  ++  V  GI DA L++  S +N+    L   + 
Sbjct  12    FWSESSIPKT--------PEPETRHKLETKGVGLGIVDA-LKDDDSDSNLSKSVLFGSQL  62

Query  761   gsHFASFASRKSNLHSGSFGTEHGINSAISQ-----------NVRELSKLGNSSGAKLRS  907
                  S     S   S     E GI +  SQ            VR+  +  NS G     
Sbjct  63    RIQIPSLPPVFSPAESPRTPPEFGIKTRNSQLSSFSSGMSPSPVRKSIETLNSPG-----  117

Query  908   MPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEEN  1081
               V AGS+S +++ELSEDYTCV +HGPNP+ THIF +CI+E  C    F++  +    EN
Sbjct  118   --VFAGSLSATEMELSEDYTCVISHGPNPRTTHIFDNCIVESCCGVVGFSSLKR----EN  171

Query  1082  GLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDE  1258
             G         +  SY S  FLSFCYTCKK L  GKDI++YRGEKAFCS  CR +E++++E
Sbjct  172   GF------LADRSSYQSESFLSFCYTCKKNLGQGKDIYMYRGEKAFCSRECRYQEMMLEE  225

Query  1259  EKEK  1270
               +K
Sbjct  226   GIDK  229



>ref|XP_009402313.1| PREDICTED: uncharacterized protein LOC103986133 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402321.1| PREDICTED: uncharacterized protein LOC103986133 [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 125/396 (32%), Positives = 177/396 (45%), Gaps = 112/396 (28%)
 Frame = +2

Query  152   MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSESD  328
             MLRKRTRS  ++Q   LM D++S               +SFF  P  F G + K  ++ +
Sbjct  11    MLRKRTRSVSNKQ--GLMSDTAS---------LLSPTAASFFTSPRPFSGFSQKGTADPE  59

Query  329   SVRSPTSPLEFRVFSTL-------SNTLRSQRSSEGH-----------QKSWGCSKVGLS  454
             +  SPTS LE R FS +        N  R+  SS              Q++     +GL 
Sbjct  60    AGASPTSILETRPFSAIRNPSFFDGNPKRAILSSSVTPTIPNVSRPLPQENGDPRAIGLG  119

Query  455   IIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCT  634
             ++D L+++   + +   P K + ++FG Q+  +                    IP  P T
Sbjct  120   LLDVLNNE-DSVKSTSKPEK-RMVVFGSQLKIQ--------------------IPP-PPT  156

Query  635   EPKPFNLHNDSSYVLFGIGDA---PLEEGISSANMrsrsldsgrsgsHFASFASRKSNLH  805
              P  F     SS    G  ++   P+E GI + N            S  A ++ +KS L 
Sbjct  157   APTQF-----SSISTTGSTESLHSPIEFGIKTRN------------SKLALYSPQKSPLQ  199

Query  806   SGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMP-VPAGSISTSKIELSEDYTCVRTH  982
             +G  G++                        L S P V  G +  S++ELSEDYT V  H
Sbjct  200   TGYVGSDM-----------------------LNSSPRVFTGCLPQSEMELSEDYTRVILH  236

Query  983   GPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTC  1162
             GPNP+ THI+ +CI+E           NG  E G S       +  SY +  FLSFCY C
Sbjct  237   GPNPRTTHIYDNCIIES--------CGNGWNEKGAS------HDQPSYTADGFLSFCYGC  282

Query  1163  KKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             KKK+  G DI++YRGEKAFCS  CR +E+L +E KE
Sbjct  283   KKKIGPGDDIYMYRGEKAFCSHECRDQEMLSNEGKE  318



>ref|XP_006379838.1| hypothetical protein POPTR_0008s15440g [Populus trichocarpa]
 gb|ERP57635.1| hypothetical protein POPTR_0008s15440g [Populus trichocarpa]
Length=301

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 152/323 (47%), Gaps = 78/323 (24%)
 Frame = +2

Query  323   SDSVRSPTSPLEFRVFSTLSNTL---------RSQRSSEGHQKSWGCSKVGLSIIDALDD  475
             S+++ SPTS L+ + FS L N             +  +  H        +GL I+DALDD
Sbjct  36    SEAIMSPTSILDSKPFSGLKNPFWPDPNPSPKTPEPETRRHWDKLDSKGIGLGIVDALDD  95

Query  476   KTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNL  655
             + K   NL  P +S+ ++FG Q+  +                    IP FP +    F  
Sbjct  96    E-KTDSNLSKP-ESRTVLFGSQLKIQ--------------------IPPFPPS----FLS  129

Query  656   HNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGI  835
               D S        +P E GI                       +R S L  GSF + +  
Sbjct  130   TTDQS------PKSPGEFGI----------------------KTRNSQL--GSFSSGY--  157

Query  836   NSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFC  1015
               + S   + L    NS      S  V AG +S S++ELSEDYTCV THGP P+ THIF 
Sbjct  158   --SPSPVKKSLFGSANSGMETPNSPRVFAGCLSASEMELSEDYTCVITHGPVPRTTHIFD  215

Query  1016  DCILE-CHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDI  1189
             +CI+E C       FS + +++N    G G      SYP ++FLSFC  CK KL+ GKDI
Sbjct  216   NCIVESCCG--VVGFSTSLKKDNNRFLGDGS-----SYPPNNFLSFCSACKNKLEQGKDI  268

Query  1190  FIYRGEKAFCSSSCRSEEILIDE  1258
             ++YRGE+AFCSS CR + + ++E
Sbjct  269   YMYRGERAFCSSECRYQAMQLEE  291



>ref|XP_008778118.1| PREDICTED: uncharacterized protein LOC103697950 [Phoenix dactylifera]
Length=317

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 15/117 (13%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             GSIS S++ELSEDYTCV +HGPNPK THIF + I+              EE +G ++   
Sbjct  210   GSISASEMELSEDYTCVISHGPNPKTTHIFDNYIV--------------EESSGDARAAS  255

Query  1103  CCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                    Y S+DFLSFCY CKK L +G+DIF+YRGEKAFCS+ CR +E+L+DE  +K
Sbjct  256   KDNRFTGYHSNDFLSFCYACKKDLGEGEDIFMYRGEKAFCSNECRYQEMLLDERMDK  312



>ref|XP_003569894.1| PREDICTED: insulinoma-associated protein 1-like isoform X1 [Brachypodium 
distachyon]
Length=358

 Score =   120 bits (300),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 95/183 (52%), Gaps = 35/183 (19%)
 Frame = +2

Query  791   KSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVP----------AGSISTS  940
             + +L SG      G +S  S   R    LG   G    S+P P            S+S S
Sbjct  157   RGDLKSGPETAAAGAHS--SNGKRHSFDLGKLPGPGPLSLPAPTIAGGGPRRFVASVSAS  214

Query  941   KIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHF  1120
             ++E SEDYTC+   GPNPK THIF DCILE      +  +   E E G +K       + 
Sbjct  215   EVEQSEDYTCIIARGPNPKTTHIFGDCILEPQAVAKSGVAM--EVEQGAAK-------YS  265

Query  1121  SY--------------PSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDE  1258
             SY               + DFLS C+ C+KKL+G DI+IYRGEKAFCS+SCR ++ILIDE
Sbjct  266   SYLVVKCAAAEDGAPAAAEDFLSSCFACRKKLEGNDIYIYRGEKAFCSASCRDQQILIDE  325

Query  1259  EKE  1267
             E E
Sbjct  326   EAE  328



>ref|XP_004960849.1| PREDICTED: uncharacterized protein LOC101768494 isoform X1 [Setaria 
italica]
 ref|XP_004960850.1| PREDICTED: uncharacterized protein LOC101768494 isoform X2 [Setaria 
italica]
Length=362

 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 116/353 (33%), Positives = 155/353 (44%), Gaps = 76/353 (22%)
 Frame = +2

Query  272   FFNVPALFVGLN--------PKQSESDSVRSPTSPLEFRVFSTLSNT-LRSQRSSEGHQK  424
              F VP L VGL         P      + RSPTSPL+ R F+ L  + LRS RS     +
Sbjct  24    LFAVPRLLVGLGAARCGAAAPDCDSPTAARSPTSPLDLRPFAALGGSMLRSPRSP----R  79

Query  425   SWGCSKVGLSII---DALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAA  595
             SW   +VGL  +   DAL +           + ++N + G QM    +     S SF   
Sbjct  80    SWDSHRVGLGGLVDDDALAEPA---------AGARNRLLGTQMRQPFKLPQRLSKSF---  127

Query  596   KSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFA  775
              + P++     C +  P  L N  +    G    P+                        
Sbjct  128   TTQPRD-----CGQAAPPVLGNVGTAAGAGASGKPV------------------------  158

Query  776   SFASRK-SNLHSG-SFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVP---AGSISTS  940
                SR   ++ SG       G     S +  +L KL  +SG+   S+  P    GS+S +
Sbjct  159   -LCSRSYGDVKSGPEVTVPGGAQPGASSHPADLGKL-RASGSLPASIGGPRRYIGSVSAT  216

Query  941   KIELSEDYTCVRTHGPNPKVTHIFCDCILE-----CHNNEFTNFS--KNGEEENGLSKGP  1099
             ++E SEDYTC+  HGPNPK T I+ DCILE         E  N    K G E   L K  
Sbjct  217   EVEQSEDYTCIIAHGPNPKTTRIYGDCILEPCTVRVSGGESMNAMEVKEGAESYWLVK--  274

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDE  1258
              C ++  +    + LS C +CKKKLDG D  IYRGEKAFCS +CR  EIL +E
Sbjct  275   -CFDDGEA--GEEILSSCVSCKKKLDGNDSCIYRGEKAFCSGNCRDNEILTEE  324



>ref|XP_008775847.1| PREDICTED: uncharacterized protein LOC103696099 [Phoenix dactylifera]
 ref|XP_008775848.1| PREDICTED: uncharacterized protein LOC103696099 [Phoenix dactylifera]
Length=309

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 11/117 (9%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             G ++ S++ELSEDYTCV +HGPNP+ THIF +CI+E   +      K   E   L+   G
Sbjct  194   GCLTPSEMELSEDYTCVISHGPNPRTTHIFDNCIVESCGDGVVALRK---ENRPLANNSG  250

Query  1103  CCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                    Y S DFLSFCY C+K L  GKDIF+Y GEKAFCS  CR +E+L DEE EK
Sbjct  251   -------YTSDDFLSFCYACRKNLGQGKDIFVYTGEKAFCSRECRDQEMLFDEEMEK  300



>ref|XP_004139816.1| PREDICTED: uncharacterized protein LOC101210425 [Cucumis sativus]
 ref|XP_004159042.1| PREDICTED: uncharacterized LOC101210425 [Cucumis sativus]
 gb|KGN44236.1| hypothetical protein Csa_7G234090 [Cucumis sativus]
Length=294

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 110/332 (33%), Positives = 152/332 (46%), Gaps = 84/332 (25%)
 Frame = +2

Query  266   SSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRV-----FSTLSNTLRSQRSSEGHQKS  427
             SSFF  P LF   + K  SE+++V SPTS LE  +     F   SN+ R+Q +    ++ 
Sbjct  25    SSFFGSPRLFTSSSSKGLSETEAVMSPTSILEPFLGLRNSFWGESNSPRTQLTE--SKRP  82

Query  428   WGCSKVGLSIIDALDDKTKRLGNLPIPSK--SKNIIFGPQMSCKTQNFLNHSDSFGAAKS  601
             W    +GL+I+D L ++       P PSK  ++ ++ G Q+  +                
Sbjct  83    WDSKGIGLAIVDGLTEENSD----PKPSKPDTRMVVLGSQLKIQ----------------  122

Query  602   LPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASF  781
                 IP  P     PF    D S V      +P+E GI + N        G      +  
Sbjct  123   ----IPPLP-----PFVSPTDDSPV------SPIEFGIKTRN-----SHLGSLSPVSSLS  162

Query  782   ASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSED  961
              ++KS   S S G E   NS +                      V  G +S  +IE SED
Sbjct  163   PAKKSAFGSSSSGQETP-NSPL----------------------VFTGCLSAGEIEQSED  199

Query  962   YTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDF  1141
             YTCV +HGPNPK THIF DC++E     ++   K    ENG  +      +  S+   +F
Sbjct  200   YTCVISHGPNPKTTHIFGDCVIESGCGVYSPVRK----ENGFFR------DRTSFSPENF  249

Query  1142  LSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCR  1234
             LSFC  CKK L+ GKDI++YRGEKAFCS  CR
Sbjct  250   LSFCNNCKKNLEQGKDIYMYRGEKAFCSDECR  281



>gb|KDP21434.1| hypothetical protein JCGZ_21905 [Jatropha curcas]
Length=284

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 81/126 (64%), Gaps = 23/126 (18%)
 Frame = +2

Query  887   SGAKLRSMP-VPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSK  1063
             SG + +  P V  GS+S S++ELSEDYTCV ++GPNP+ THIF +C+L+       NF  
Sbjct  177   SGTQTKGFPQVLTGSLSMSEMELSEDYTCVISYGPNPRTTHIFDNCVLD-------NFYS  229

Query  1064  NGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSE  1240
             + ++ N   K              +FLSFCYTCKK L+ K DIFIYRGEKAFCS  CR +
Sbjct  230   SSDKSNSAPK--------------NFLSFCYTCKKNLEQKNDIFIYRGEKAFCSRECRYQ  275

Query  1241  EILIDE  1258
             E+LIDE
Sbjct  276   EMLIDE  281



>ref|XP_011071604.1| PREDICTED: uncharacterized protein LOC105157011 [Sesamum indicum]
Length=291

 Score =   117 bits (294),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 86/133 (65%), Gaps = 8/133 (6%)
 Frame = +2

Query  887   SGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKN  1066
             S + +R  P    S+S S++ELSEDYTCV ++GPNP+ THIF DCI+E         S++
Sbjct  158   SPSTVRKPPCGFSSLSASEMELSEDYTCVISYGPNPRTTHIFDDCIVESCCG-VVKISES  216

Query  1067  GEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEE  1243
              +E   LS  P       SYPS  FLSFCY CKK L  GKDI++YR EKAFCSS CR +E
Sbjct  217   RKENRSLSDQP------LSYPSERFLSFCYNCKKNLGHGKDIYMYRVEKAFCSSECRYKE  270

Query  1244  ILIDEEKEKTNKG  1282
             ++++EE   T++ 
Sbjct  271   MMLEEEGTGTSEA  283



>ref|XP_004968428.1| PREDICTED: uncharacterized protein LOC101762187 isoform X1 [Setaria 
italica]
 ref|XP_004968429.1| PREDICTED: uncharacterized protein LOC101762187 isoform X2 [Setaria 
italica]
Length=334

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 9/120 (8%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             GS+S S+IE S+DYT +   GPNPK THIF DCILE H    ++ +    EE       G
Sbjct  191   GSVSASEIEQSDDYTRIIARGPNPKTTHIFGDCILEPHTVGDSDEAAMEVEEGAA----G  246

Query  1103  C-----CEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             C     C    +  + DFLS C+TCKKKL+G DI+IYRGEKAFCS++CR +EI ++EE E
Sbjct  247   CYFVVKCAAGAAPAADDFLSTCFTCKKKLEGNDIYIYRGEKAFCSANCRDQEIQLEEEAE  306



>ref|XP_010912830.1| PREDICTED: uncharacterized protein LOC105038376 [Elaeis guineensis]
 ref|XP_010913555.1| PREDICTED: uncharacterized protein LOC105038376 [Elaeis guineensis]
Length=379

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 84/122 (69%), Gaps = 10/122 (8%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             GS+S S IE SE+YTC+ +HGPNP+ THIF DCILE H ++    S +G+ ++   +G  
Sbjct  223   GSLSISDIERSENYTCIISHGPNPRTTHIFGDCILESHKDQ----SPDGKHKDKGDRGES  278

Query  1103  CCEEHFS-----YPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEK  1264
               E   S     + S+DFLS+CY+CKKKL +  DI+IYRGEKAFCS  CR+ EIL +++ 
Sbjct  279   SWEVKPSEEVPLHSSTDFLSYCYSCKKKLKEEDDIYIYRGEKAFCSCECRAREILTEDKI  338

Query  1265  EK  1270
             +K
Sbjct  339   DK  340


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 70/148 (47%), Gaps = 13/148 (9%)
 Frame = +2

Query  152  MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQS-ES  325
            ML K +R+ QKDQ    L P         S   AQK + +S   V  L+  LN     + 
Sbjct  1    MLGKSSRNIQKDQNKASLFP--------LSNTLAQKTRSASIIGVSDLYARLNTMGLFDL  52

Query  326  DSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQ---KSWGCSKVGLSIIDALDDKTKRLGN  496
            DS  SPTSPL+ ++FS       S   S  H    K+   +KVGL ++D+L D+   LG 
Sbjct  53   DSSSSPTSPLDRKLFSNPGGPSVSSPGSPVHDGLPKNTNPNKVGLGLVDSLTDEVMPLGQ  112

Query  497  LPIPSKSKNIIFGPQMSCKTQNFLNHSD  580
            +   S+S+ ++ G +M  +      H D
Sbjct  113  VLRFSESRKVVLGSKMGIQIPGPKAHLD  140



>ref|XP_008447157.1| PREDICTED: uncharacterized protein LOC103489674 [Cucumis melo]
Length=294

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 110/336 (33%), Positives = 157/336 (47%), Gaps = 88/336 (26%)
 Frame = +2

Query  266   SSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRV-----FSTLSNTLRSQRSSEGHQKS  427
             SSFF  P LF   + K  SE+++V SPTS LE  +     F   SN+ R+Q +    ++ 
Sbjct  25    SSFFGSPRLFTSSSSKGLSETEAVMSPTSILEPFLGLRNSFWGESNSPRTQLTES--KRP  82

Query  428   WGCSKVGLSIIDALDDKTKRLGNLPIPSK--SKNIIFGPQMSCKTQNFLNHSDSFGAAKS  601
             W    +GL+I+D L ++       P PSK  ++ ++ G Q+  +                
Sbjct  83    WDSKGIGLAIVDGLTEENSD----PKPSKPDTRMVVLGSQLKIQ----------------  122

Query  602   LPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASF  781
                 IP  P     PF    D S +      +P+E GI                      
Sbjct  123   ----IPPLP-----PFVSTVDDSPI------SPIEFGI----------------------  145

Query  782   ASRKSNLHSGSFGTEHGINSAISQNVRELSKLG-NSSGAKLRSMP-VPAGSISTSKIELS  955
               +  N H GS      ++ A      + S  G +SSG +  + P V  G +S  +IE S
Sbjct  146   --KTRNSHLGSLSPVSSLSPA------KKSAFGFSSSGQETPNSPLVFTGCLSAGEIEQS  197

Query  956   EDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSS  1135
             EDYTCV +HGPNPK THIF DC++E  +  ++   K    ENG  +      +  S+   
Sbjct  198   EDYTCVISHGPNPKTTHIFGDCVIESGSGVYSPVRK----ENGYFR------DRTSFSPE  247

Query  1136  DFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSE  1240
             +FLSFC  CKK L +GKDI++YRGEKAFCS  CR +
Sbjct  248   NFLSFCNNCKKNLEEGKDIYMYRGEKAFCSHECRYQ  283



>ref|XP_008804956.1| PREDICTED: uncharacterized protein LOC103718086 [Phoenix dactylifera]
 ref|XP_008804957.1| PREDICTED: uncharacterized protein LOC103718086 [Phoenix dactylifera]
 ref|XP_008804958.1| PREDICTED: uncharacterized protein LOC103718086 [Phoenix dactylifera]
Length=334

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 76/118 (64%), Gaps = 11/118 (9%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP  1099
              G +S S++ELSEDYTCV + GPNP+ THIF +CI+      F    K   E   L+   
Sbjct  218   TGCLSPSEMELSEDYTCVISRGPNPRTTHIFDNCIVGSCGVGFLALRK---ENRSLA---  271

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                 +H SY S +FLS+CY C+K L  GKDIF+YRGEKAFCS  CR +E+L DEE EK
Sbjct  272   ----DHSSYTSDNFLSYCYACRKNLGQGKDIFMYRGEKAFCSRECRYQEMLFDEEMEK  325



>gb|ABK96022.1| unknown [Populus trichocarpa]
Length=120

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 85/135 (63%), Gaps = 24/135 (18%)
 Frame = +2

Query  863   ELSKLGN-SSGAKLRSMP-VPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECH  1036
             +LS  G+ +SG + +  P V  G +S S++ELSEDYTCV THGPNPK THIF +CI+E  
Sbjct  4     QLSASGSVNSGIQAKDSPQVFTGCMSMSEMELSEDYTCVITHGPNPKTTHIFDNCIVE--  61

Query  1037  NNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKA  1213
                + + S   +                S P S FLSFCYTCKK L+ K DI+IYRGEKA
Sbjct  62    --NYCSLSDTSK----------------SVPRS-FLSFCYTCKKNLEQKNDIYIYRGEKA  102

Query  1214  FCSSSCRSEEILIDE  1258
             FCS  CR +E+L+DE
Sbjct  103   FCSQECRYQEMLLDE  117



>ref|XP_011032681.1| PREDICTED: uncharacterized protein LOC105131415 [Populus euphratica]
Length=289

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 90/153 (59%), Gaps = 31/153 (20%)
 Frame = +2

Query  809   GSFGTEHGINSAISQNVRELSKLGN-SSGAKLRSMP-VPAGSISTSKIELSEDYTCVRTH  982
             G FG +  +NS       +LS  G+ +SG + +  P V  G +S S++ELSEDYTCV TH
Sbjct  162   GDFGIKTSMNS-------QLSASGSVNSGIQAKDSPQVFTGCMSMSEMELSEDYTCVITH  214

Query  983   GPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTC  1162
             GPNPK THIF +CI+E       N+    +    + +               FLSFCYTC
Sbjct  215   GPNPKTTHIFDNCIVE-------NYCPLSDTSKSVPRS--------------FLSFCYTC  253

Query  1163  KKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
             KK L+ K DI+IYRGEKAFCS  CR +E+L+DE
Sbjct  254   KKNLEQKNDIYIYRGEKAFCSQECRYQEMLLDE  286



>ref|XP_002307593.1| putative senescence-associated protein SAG102 [Populus trichocarpa]
 gb|EEE94589.1| putative senescence-associated protein SAG102 [Populus trichocarpa]
Length=274

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 90/153 (59%), Gaps = 31/153 (20%)
 Frame = +2

Query  809   GSFGTEHGINSAISQNVRELSKLGN-SSGAKLRSMP-VPAGSISTSKIELSEDYTCVRTH  982
             G FG +  +NS       +LS  G+ +SG + +  P V  G +S S++ELSEDYTCV TH
Sbjct  147   GDFGIKTSMNS-------QLSASGSVNSGIQAKDSPQVFTGCMSMSEMELSEDYTCVITH  199

Query  983   GPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTC  1162
             GPNPK THIF +CI+E       N+    +    + +               FLSFCYTC
Sbjct  200   GPNPKTTHIFDNCIVE-------NYCSLSDTSKSVPRS--------------FLSFCYTC  238

Query  1163  KKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
             KK L+ K DI+IYRGEKAFCS  CR +E+L+DE
Sbjct  239   KKNLEQKNDIYIYRGEKAFCSQECRYQEMLLDE  271



>gb|ACG39774.1| hypothetical protein [Zea mays]
Length=358

 Score =   115 bits (289),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 95/178 (53%), Gaps = 21/178 (12%)
 Frame = +2

Query  779   FASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVP-------------  919
             F  R  +L SG   T      A   + R    LG   G    S+PVP             
Sbjct  156   FQLRHGDLKSGPEATGSADTGAHLASKRHSFDLGKLPGPG--SLPVPASASASSNAARRF  213

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP  1099
              GS+S S+IE SEDYT +   GPNPK THIF DCILE       + SK  E   G   G 
Sbjct  214   VGSVSASEIEQSEDYTRIIARGPNPKTTHIFGDCILEPRTVGCGD-SKAVESGEG---GA  269

Query  1100  GC--CEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             GC    +  +  + DFLS C+ CKKKL+G DI+IYRGEKAFCS++CR +EI ++EE E
Sbjct  270   GCYFVVKRAAPGAGDFLSSCFACKKKLEGNDIYIYRGEKAFCSANCRDQEIQLEEEAE  327



>ref|NP_001146437.1| uncharacterized protein LOC100280020 [Zea mays]
 gb|ACL53973.1| unknown [Zea mays]
Length=210

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 77/126 (61%), Gaps = 15/126 (12%)
 Frame = +2

Query  905   SMPVPA-----GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNG  1069
             S+PVPA     GS+S S+IE SEDYT V   GPNPK THIF DCILE H    ++     
Sbjct  52    SLPVPASRRFVGSVSASEIEQSEDYTRVIARGPNPKTTHIFGDCILEPHTAGASDDEAAA  111

Query  1070  -EEENGLSKG----PGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCR  1234
              E E+G + G      C  E     +  FLS C+ C KKLDG DI+IYRGEKAFCS+ CR
Sbjct  112   VESEDGAAAGRYFVVKCAAE-----ADGFLSSCFACNKKLDGNDIYIYRGEKAFCSADCR  166

Query  1235  SEEILI  1252
              +E+ +
Sbjct  167   DQEMQL  172



>ref|XP_002455061.1| hypothetical protein SORBIDRAFT_03g003720 [Sorghum bicolor]
 gb|EES00181.1| hypothetical protein SORBIDRAFT_03g003720 [Sorghum bicolor]
Length=367

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 82/128 (64%), Gaps = 14/128 (11%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHN--NEFTNFSKNGEEENGLSKG  1096
             GS+S S+IE SEDYT +   GPNPK THIF DCILE         + +   E E G +  
Sbjct  223   GSVSASEIEQSEDYTRIIARGPNPKTTHIFGDCILEPRTVGGGGDHEAAAMESEEGAA--  280

Query  1097  PGCCEEHFSYPSS-----DFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
              GCC  +F   S+     DFLS C+ CKKKL+G DI+IYRGEKAFCS++CR +EI ++EE
Sbjct  281   -GCC--YFVVKSAAAGADDFLSSCFACKKKLEGNDIYIYRGEKAFCSANCRDQEIQLEEE  337

Query  1262  KEKTNKGG  1285
              E  NK G
Sbjct  338   AE--NKTG  343



>ref|NP_001143884.1| uncharacterized protein LOC100276685 [Zea mays]
 gb|ACG36201.1| hypothetical protein [Zea mays]
Length=225

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 78/126 (62%), Gaps = 15/126 (12%)
 Frame = +2

Query  905   SMPVPA-----GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNG  1069
             S+P PA     GS+S S+IE SEDYT V   GPNPK THIF DCILE H    ++     
Sbjct  68    SLPXPASRRFVGSVSASEIEQSEDYTRVIARGPNPKTTHIFGDCILEPHTAGASDDEAAA  127

Query  1070  -EEENGLSKGPGCCEEHF----SYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCR  1234
              E E+G + G      +F    +  +  FLS C+ CKKKLDG DI+IYRGEKAFCS+ CR
Sbjct  128   VESEDGAAAG-----RYFVVKCNAEADGFLSSCFACKKKLDGNDIYIYRGEKAFCSADCR  182

Query  1235  SEEILI  1252
              +EI +
Sbjct  183   DQEIQL  188



>gb|KEH39567.1| DUF581 family protein [Medicago truncatula]
Length=382

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 124/365 (34%), Positives = 164/365 (45%), Gaps = 60/365 (16%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SESDSVRSPTSPLEFRVFSTL  379
             M DSSS   L     + +   SS F+     VG   K   +S+S  SPTSPL++R+FS L
Sbjct  1     MADSSSNLSLPPDTVSARQIRSSLFHTSGSRVGAGVKNLPDSESAWSPTSPLDYRLFSNL  60

Query  380   SNTLRSQRSSEGHQ----KSWGCSKVGLSIIDALDDKTKR----LGNLPIPSKSKNIIFG  535
             SN   ++ S    Q    K    SKVGL II +L ++TK     LG  P     KNIIFG
Sbjct  61    SNVFSAKSSRPSFQTENKKPLDGSKVGLGIITSLVNETKPNNEILGKFP----RKNIIFG  116

Query  536   PQMSCKTQNFL--NHSD--SFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPL  703
              Q+      F   NH     F    SLPKN  I   +E K        S  L     +P 
Sbjct  117   SQVKNHILQFSKNNHESLAPFLKTNSLPKNYVISLPSETK--------SPTLPSKTKSPK  168

Query  704   EEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSA---ISQNVRELSK  874
              E  S  +  +R     RS    +  +SR S+L + +  +  G N     ++     L  
Sbjct  169   SEVESFDDDVNRESKGLRSSVVSSPDSSRPSSLINSNQSSNLGTNDLFVDVTSTPLSLLP  228

Query  875   LGNSSGAKLRSMPVPAGSISTSKIELSEDY---------------TCVRTHGPNPKVTHI  1009
             + N+S     S+ + + S+  S I+ S  Y               TC+ +HGPNPK THI
Sbjct  229   VTNTSSQVDDSLKIISSSLPVS-IDFSNGYVGSLSAKEIELSEDYTCIISHGPNPKRTHI  287

Query  1010  FCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD--GK  1183
             F DCILECHNN+FT FSK               EE   +     +SFCYTC KK D  G+
Sbjct  288   FGDCILECHNNDFTEFSKK--------------EESAPHRFDSVMSFCYTCDKKFDEEGE  333

Query  1184  DIFIY  1198
             D+  Y
Sbjct  334   DVHAY  338



>ref|XP_002517116.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45279.1| conserved hypothetical protein [Ricinus communis]
Length=319

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 81/121 (67%), Gaps = 12/121 (10%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSKG  1096
             GS+S  ++E SEDYTCV ++GPNPK THIF D I+E  C   +   FS +  + NG   G
Sbjct  198   GSLSAIEMEQSEDYTCVISYGPNPKTTHIFDDYIVESCC---DVVEFSTSRTQTNGF-LG  253

Query  1097  PGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
              G      SYPS +FLSFCY CKK L  GKDI++YRGEKAFCSS CR +E+L +E  +K 
Sbjct  254   DGS-----SYPSDNFLSFCYACKKNLGQGKDIYMYRGEKAFCSSECRYQEMLSEEGIDKL  308

Query  1274  N  1276
             +
Sbjct  309   D  309



>gb|AFW80215.1| hypothetical protein ZEAMMB73_719306 [Zea mays]
Length=353

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 77/126 (61%), Gaps = 15/126 (12%)
 Frame = +2

Query  905   SMPVPA-----GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNG  1069
             S+PVPA     GS+S S+IE SEDYT V   GPNPK THIF DCILE H    ++     
Sbjct  195   SLPVPASRRFVGSVSASEIEQSEDYTRVIARGPNPKTTHIFGDCILEPHTAGASDDEAAA  254

Query  1070  -EEENGLSKG----PGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCR  1234
              E E+G + G      C  E     +  FLS C+ C KKLDG DI+IYRGEKAFCS+ CR
Sbjct  255   VESEDGAAAGRYFVVKCAAE-----ADGFLSSCFACNKKLDGNDIYIYRGEKAFCSADCR  309

Query  1235  SEEILI  1252
              +E+ +
Sbjct  310   DQEMQL  315



>gb|EYU41472.1| hypothetical protein MIMGU_mgv1a010847mg [Erythranthe guttata]
Length=300

 Score =   112 bits (281),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 75/112 (67%), Gaps = 11/112 (10%)
 Frame = +2

Query  926   SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSKGP  1099
             S+S S+IELSEDYTCV ++GPNP+ THIF DCI+E  C       FS++ +E   +    
Sbjct  172   SLSASEIELSEDYTCVISYGPNPRTTHIFEDCIVESCCG---VVKFSESRKENVSIPHN-  227

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILI  1252
                    SYPS  FLSFCY CKK L  GKDI++YRGEKAFCSS CR  E+++
Sbjct  228   ----RSMSYPSESFLSFCYNCKKNLGQGKDIYMYRGEKAFCSSECRYTEMML  275



>ref|XP_011090704.1| PREDICTED: uncharacterized protein LOC105171329 [Sesamum indicum]
Length=302

 Score =   112 bits (281),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 96/163 (59%), Gaps = 23/163 (14%)
 Frame = +2

Query  779   FASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSE  958
             F  +  N H GSF      +  +S +  + S  G+S+   L        S+S S++ELSE
Sbjct  143   FGIKTRNSHVGSF------SPGLSTSPVKKSPFGSSNHGGL-------SSLSASEMELSE  189

Query  959   DYTCVRTHGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSS  1135
             DYTCV ++GPNP+ THIF D ++E C       FS++ +E    +          SYPS 
Sbjct  190   DYTCVISYGPNPRTTHIFDDSVVESCCG--VVKFSESRKENVFFAN------RSMSYPSE  241

Query  1136  DFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
              FLSFCY CKK L  GKDI++YRGEKAFCSS CR +E++++EE
Sbjct  242   SFLSFCYCCKKNLGQGKDIYMYRGEKAFCSSECRYKEMMLEEE  284



>ref|XP_008390911.1| PREDICTED: uncharacterized protein LOC103453139 [Malus domestica]
Length=286

 Score =   112 bits (279),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 117/357 (33%), Positives = 157/357 (44%), Gaps = 102/357 (29%)
 Frame = +2

Query  251   QKHK--VSSFFNVPALFVGLNPKQ-SESDSVRSPTSPLEFRVFSTLSNTLRSQ-------  400
             +KH    SSFF  P LF     K  SESD+V SPTS LE + F  L N   S+       
Sbjct  12    EKHTKLTSSFFANPRLFTSFTSKAVSESDAVMSPTSILETKPFLGLRNPFWSESNTPRTP  71

Query  401   --RSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNH  574
                S   H        +GL+I+DAL++                                 
Sbjct  72    EPESRRIHWDKLDSKGIGLAIVDALNE---------------------------------  98

Query  575   SDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFG----IGDAPLEEGISSANMrsrs  742
                                ++PKP N    +  V+FG    I   PL+  + S +   +S
Sbjct  99    -------------------SDPKPSN--PKTRMVIFGSQLKIQIPPLQPSVLSPSRSPKS  137

Query  743   ldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPA  922
                       A F+++  N H GSF      +S +SQ+  + S   + +   + S  V  
Sbjct  138   S---------ADFSTKTENSHLGSF------SSVLSQSPEKKSLFESET---MNSTRVFT  179

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
               +S S++ELSEDYTCV +HGPNPK THIF +CI+E         S +G  E      PG
Sbjct  180   SRLSVSEMELSEDYTCVISHGPNPKTTHIFDNCIVE---------SSDGVPEF----PPG  226

Query  1103  CCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                   S  S  FLSFC  C K L  GKDIF+YRGEKAFCS  CR +E+L++E  +K
Sbjct  227   RKSNGSSSLSESFLSFCDNCNKNLGHGKDIFMYRGEKAFCSRECRYQEMLLEEGVDK  283



>emb|CDX76742.1| BnaC08g33280D [Brassica napus]
Length=300

 Score =   112 bits (279),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 12/111 (11%)
 Frame = +2

Query  932   STSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCE  1111
             S  ++E+SEDYTC+ THGPNPK THI+ D +LECH N   N  K+ E E          +
Sbjct  183   SEDEMEMSEDYTCITTHGPNPKTTHIYGDQVLECHKNGDDNKDKSIETE---------LD  233

Query  1112  EHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
               F+    +FLS C  C KKL  GKDI++YRGEKAFCS+ CRSEE+ IDEE
Sbjct  234   SMFTL--DNFLSVCNLCNKKLVLGKDIYMYRGEKAFCSAECRSEEMTIDEE  282


 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 82/183 (45%), Gaps = 40/183 (22%)
 Frame = +2

Query  161  KRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ--SESDSV  334
            + T   KDQ M Q +     ++ L        +KV +     +L +GL   +  S+SD V
Sbjct  5    RATFRHKDQTMSQSV---DRQTDLVGHNNNNNNKVITNPLAMSLLIGLKNDKCISDSDFV  61

Query  335  RSPTSPLEFRVFSTLSNT---LRSQRSSEGHQKSWGC-SKVGLSIIDALDDKTKRLGNLP  502
            RSP SPLEF++ ST++     LRS RSS        C +KVGLSI+D+L D         
Sbjct  62   RSPKSPLEFKMLSTMAADPFFLRSPRSS--FTAHLNCPAKVGLSIVDSLGDDR-------  112

Query  503  IPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLF  682
              + S +++FGP +  K+ +  +                      PK   +  + S V+F
Sbjct  113  --ALSPDVVFGPALRIKSSDIKDK--------------------HPKSLKIEKERSGVIF  150

Query  683  GIG  691
             IG
Sbjct  151  EIG  153



>ref|XP_008654714.1| PREDICTED: uncharacterized protein LOC100276685 isoform X1 [Zea 
mays]
Length=455

 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 77/126 (61%), Gaps = 15/126 (12%)
 Frame = +2

Query  905   SMPVPA-----GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNG  1069
             S+PVPA     GS+S S+IE SEDYT V   GPNPK THIF DCILE H    ++     
Sbjct  297   SLPVPASRRFVGSVSASEIEQSEDYTRVIARGPNPKTTHIFGDCILEPHTAGASDDEAAA  356

Query  1070  -EEENGLSKGP----GCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCR  1234
              E E+G + G      C  E     +  FLS C+ C KKLDG DI+IYRGEKAFCS+ CR
Sbjct  357   VESEDGAAAGRYFVVKCAAE-----ADGFLSSCFACNKKLDGNDIYIYRGEKAFCSADCR  411

Query  1235  SEEILI  1252
              +E+ +
Sbjct  412   DQEMQL  417



>ref|XP_010417342.1| PREDICTED: uncharacterized protein LOC104703099 isoform X1 [Camelina 
sativa]
 ref|XP_010417343.1| PREDICTED: uncharacterized protein LOC104703099 isoform X1 [Camelina 
sativa]
Length=316

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 157/336 (47%), Gaps = 83/336 (25%)
 Frame = +2

Query  287   ALFVGLNPKQ-----SESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQKSWGC---SK  442
             +L +GLN        S+SD VRSP SPLEFR+ ST++       SS     +  C   +K
Sbjct  36    SLLIGLNNNNNNKCISDSDFVRSPKSPLEFRMLSTMAADPFLTSSSLTPHLNCCCRPSAK  95

Query  443   VGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPI  622
             VGLSI+D   D++     LP      +I+FGP +  K     +  +        PK   +
Sbjct  96    VGLSIVD---DRSL----LP------DIVFGPALRIKCSKVRDRDNH------RPK--LL  134

Query  623   FPCTEPKPFNLHNDSSYVLFGIGDAPLE-EGISSANMrsrsldsgrsgsHFASFASRKSN  799
             FP  + +        S V+F IGD   E E I   N               A+   RK+ 
Sbjct  135   FPVAKIE----KEKRSGVVFEIGDNSSESEQIWLRNRSFS-----------ANDCLRKTR  179

Query  800   LHSGS-FGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVR  976
             + SGS  G E                 G S G+        A S   S+ ++ EDYTC+ 
Sbjct  180   VLSGSKLGVE-----------------GESGGSD------NAFSSCLSEDDM-EDYTCII  215

Query  977   THGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCY  1156
              HGPNPK THI+ D +LECH NE    SK  E+  G        +      S +FLS C 
Sbjct  216   AHGPNPKTTHIYGDRVLECHKNE----SKGDEKHIGT-------QSDSMLASVNFLSVCN  264

Query  1157  TCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
              C KKL+ G+DI++Y GEK FCS  CRSEE++IDEE
Sbjct  265   FCNKKLEGGEDIYMY-GEKPFCSEECRSEEMMIDEE  299



>ref|XP_009117041.1| PREDICTED: uncharacterized protein LOC103842172 [Brassica rapa]
Length=296

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 73/111 (66%), Gaps = 15/111 (14%)
 Frame = +2

Query  932   STSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCE  1111
             S  ++E+SEDYTC+ THGPNPK THI+ D +LECHN+   N  K+ E E           
Sbjct  182   SEDEMEMSEDYTCIITHGPNPKTTHIYGDQVLECHND---NKEKSIETELD---------  229

Query  1112  EHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
                 +P  +FLS C  C KKL  GKDI++YRGEKAFCS+ CRSEE+ IDEE
Sbjct  230   --SMFPLDNFLSVCNFCNKKLVLGKDIYMYRGEKAFCSAECRSEEMTIDEE  278


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 69/142 (49%), Gaps = 39/142 (27%)
 Frame = +2

Query  287  ALFVGLNPKQ--SESDSVRSPTSPLEFRVFSTLSNT---LRSQRSS-EGHQKSWGCSKVG  448
            +L +GL   +  S+SD VRSP SPLEF++ ST++     LRS RSS   H  S   +KVG
Sbjct  43   SLLIGLKKDKCISDSDFVRSPKSPLEFKMLSTMAADPLFLRSPRSSLAAHLNSP--AKVG  100

Query  449  LSIIDAL-DDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIF  625
            LSI+D+L DD+            S +++FGP +  K+ +  +                  
Sbjct  101  LSIVDSLGDDRI----------LSPDVVFGPALRIKSSDIKDK-----------------  133

Query  626  PCTEPKPFNLHNDSSYVLFGIG  691
                PK   +  + S V+F IG
Sbjct  134  ---HPKSLKIEKERSGVIFEIG  152



>ref|XP_007223281.1| hypothetical protein PRUPE_ppa009460mg [Prunus persica]
 gb|EMJ24480.1| hypothetical protein PRUPE_ppa009460mg [Prunus persica]
Length=291

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 77/131 (59%), Gaps = 14/131 (11%)
 Frame = +2

Query  872   KLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFT  1051
             K  NS    + S  V    +S S++ELSEDYTCV +HGPNPK THIF +CI+E       
Sbjct  169   KSANSGLETMNSARVFTSCLSVSEMELSEDYTCVISHGPNPKTTHIFDNCIVESSEG-VP  227

Query  1052  NFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSS  1228
              FS  G+                SY S  FLSFC  CKK L  GKDIF+YRGEKAFCS  
Sbjct  228   EFSPGGKVNGS------------SYLSESFLSFCDNCKKNLGPGKDIFMYRGEKAFCSRE  275

Query  1229  CRSEEILIDEE  1261
             CR +E+L++EE
Sbjct  276   CRYQEMLLEEE  286


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 65/126 (52%), Gaps = 19/126 (15%)
 Frame = +2

Query  263  VSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTLSNTLRSQ----RSSEGHQKS  427
             SSFF  P LF     K  SE+D+V SPTS LE + F  L N   S+    R+ E   K 
Sbjct  18   TSSFFTSPRLFTSFTSKGYSETDAVMSPTSILETKPFFGLRNPFWSESNTPRTPEPETKR  77

Query  428  -W---GCSKVGLSIIDALDDKTKRLGNLPIPSK--SKNIIFGPQMSCKTQNF----LNHS  577
             W       +GL+I+DAL+D     G+ P PSK  S+ +IFG Q+  +  +     L+ S
Sbjct  78   PWDKLDPKGIGLAIVDALNDD----GSNPKPSKPESRMVIFGSQLKIQIPHLQPSVLSPS  133

Query  578  DSFGAA  595
            DS  +A
Sbjct  134  DSPKSA  139



>ref|XP_002440716.1| hypothetical protein SORBIDRAFT_09g005550 [Sorghum bicolor]
 gb|EES19146.1| hypothetical protein SORBIDRAFT_09g005550 [Sorghum bicolor]
Length=371

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 105/323 (33%), Positives = 147/323 (46%), Gaps = 62/323 (19%)
 Frame = +2

Query  329   SVRSPTSPLEFRV-FSTLS-----NTLRSQRSSEGHQKSWGCSKVGLSIIDALDDKTKRL  490
             + RSPTSPL+ R  F+ L      + LRS RS     +SW   ++GL     L D    L
Sbjct  51    AARSPTSPLDLRPPFAALGGGGGGSLLRSPRSP--RARSWDSHRLGLG---GLVDDALAL  105

Query  491   GNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFP-CTEPKPFNLHNDS  667
                     S+N + G                 GAA++  +   + P C   +P +  + +
Sbjct  106   AEPAGGGASRNPLLG----------------LGAAQARQQPFKLLPQCLATRPRDCAH-A  148

Query  668   SYVLFGIGDA-----PLEEGISSANMrsrsldsgrsgsHFASFAS-RKSNLHSGSFGTEH  829
             S VL  +G A     P+    S  +++S        G+     AS   ++L  G F    
Sbjct  149   SPVLGNVGTAVASYKPVPCSRSYGDVKSGPEGVTVPGAAAPPGASSHPADL--GKFPAAG  206

Query  830   GINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHI  1009
              + ++I    R                    GS+S +++E SEDYTC+  HGPNPK T I
Sbjct  207   SLPASIGGGPRRY-----------------VGSVSATEVEQSEDYTCIIAHGPNPKTTRI  249

Query  1010  FCDCILE-CHNNEFTNFS--KNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDG  1180
             F DCILE C   +  +    K G E   L K   C ++    P  +FLS C +CKKKLDG
Sbjct  250   FGDCILEPCTLGDGVDAMEVKEGAESYWLVK---CFDD--GEPGEEFLSSCVSCKKKLDG  304

Query  1181  KDIFIYRGEKAFCSSSCRSEEIL  1249
              D  IYRGEKAFCS +CR +E+L
Sbjct  305   NDSCIYRGEKAFCSRNCRDQEVL  327



>ref|XP_008224293.1| PREDICTED: uncharacterized protein LOC103324037 [Prunus mume]
 ref|XP_008224294.1| PREDICTED: uncharacterized protein LOC103324037 [Prunus mume]
Length=291

 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 77/131 (59%), Gaps = 14/131 (11%)
 Frame = +2

Query  872   KLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFT  1051
             K  NS    + S  V    +S S++ELSEDYTCV +HGPNPK THIF +CI+E       
Sbjct  169   KSANSGLETMNSARVFRSCLSVSEMELSEDYTCVISHGPNPKTTHIFDNCIVESSEG-VP  227

Query  1052  NFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSS  1228
              FS  G+                SY S  FLSFC  CKK L  GKDIF+YRGEKAFCS  
Sbjct  228   EFSPGGKVNGS------------SYLSESFLSFCDNCKKNLGPGKDIFMYRGEKAFCSRE  275

Query  1229  CRSEEILIDEE  1261
             CR +E+L++EE
Sbjct  276   CRYQEMLLEEE  286


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 61/115 (53%), Gaps = 17/115 (15%)
 Frame = +2

Query  248  AQKHK--VSSFFNVPALFVGLNPK-QSESDSVRSPTSPLEFRVFSTLSNTLRSQ----RS  406
            A+K+    SSFF  P LF     K  SE+D+V SPTS LE + F  L N   S+    R+
Sbjct  11   AEKYTKPTSSFFTSPRLFTSFTSKGYSETDAVMSPTSILETKPFFGLRNPFWSESNTPRT  70

Query  407  SEGHQKS-W---GCSKVGLSIIDALDDKTKRLGNLPIPSK--SKNIIFGPQMSCK  553
             E   K  W       +GL+I+DAL+D     G+ P PSK  S+ +IFG Q+  +
Sbjct  71   PEPETKRPWDKLDPKGIGLAIVDALNDD----GSNPKPSKPESRMVIFGSQLKIQ  121



>ref|XP_009393038.1| PREDICTED: uncharacterized protein LOC103978824 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=263

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 72/118 (61%), Gaps = 11/118 (9%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP  1099
              G +   ++ELSEDYT V  HGPNP+ THIF +CI+E   N    F+    E    S  P
Sbjct  155   TGRLPPPEMELSEDYTRVILHGPNPRTTHIFDNCIIESCTN---GFATPMSERRSSSDRP  211

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             G       Y   DFLSFCY CKKK   G+DI++YRG+KAFCS  CR  E+L+DE K+K
Sbjct  212   G-------YAVDDFLSFCYGCKKKFGSGEDIYMYRGDKAFCSHECRHHEMLLDEGKDK  262



>ref|XP_009393037.1| PREDICTED: uncharacterized protein LOC103978824 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=292

 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 72/118 (61%), Gaps = 11/118 (9%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP  1099
              G +   ++ELSEDYT V  HGPNP+ THIF +CI+E   N    F+    E    S  P
Sbjct  184   TGRLPPPEMELSEDYTRVILHGPNPRTTHIFDNCIIESCTN---GFATPMSERRSSSDRP  240

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             G       Y   DFLSFCY CKKK   G+DI++YRG+KAFCS  CR  E+L+DE K+K
Sbjct  241   G-------YAVDDFLSFCYGCKKKFGSGEDIYMYRGDKAFCSHECRHHEMLLDEGKDK  291



>ref|XP_006379837.1| hypothetical protein POPTR_0008s15440g [Populus trichocarpa]
 gb|ERP57634.1| hypothetical protein POPTR_0008s15440g [Populus trichocarpa]
Length=270

 Score =   109 bits (272),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 79/116 (68%), Gaps = 11/116 (9%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSK  1093
             AG +S S++ELSEDYTCV THGP P+ THIF +CI+E  C       FS + +++N    
Sbjct  153   AGCLSASEMELSEDYTCVITHGPVPRTTHIFDNCIVESCCG---VVGFSTSLKKDNNRFL  209

Query  1094  GPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDE  1258
             G G      SYP ++FLSFC  CK KL+ GKDI++YRGE+AFCSS CR + + ++E
Sbjct  210   GDGS-----SYPPNNFLSFCSACKNKLEQGKDIYMYRGERAFCSSECRYQAMQLEE  260



>gb|EEE53994.1| hypothetical protein OsJ_00627 [Oryza sativa Japonica Group]
Length=308

 Score =   109 bits (273),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 88/154 (57%), Gaps = 18/154 (12%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             GS+S S+IE SEDYTC+   GPNPK THIF DCILE      T  +        +++ P 
Sbjct  161   GSVSASEIEQSEDYTCIIARGPNPKTTHIFGDCILEPQ----TMDASASAAAMDVTEAP-  215

Query  1103  CCEEHFSY----------PSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILI  1252
               E ++               DFLS C+TCKKKL+G DI+IYRGEKAFCS++CR ++I I
Sbjct  216   -TESYWVVKCDAGAAPASGGGDFLSSCFTCKKKLEGNDIYIYRGEKAFCSANCRDQQIPI  274

Query  1253  DEEKEK--TNKGGDDFEKPNSREEPYESSLFIAT  1348
             +EE E   T          +  E+ + + +F+AT
Sbjct  275   EEEAENNTTIVSSPPSSCSSLHEDIFMAGMFVAT  308



>gb|EEC70052.1| hypothetical protein OsI_00649 [Oryza sativa Indica Group]
Length=390

 Score =   110 bits (276),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 78/131 (60%), Gaps = 22/131 (17%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             GS+S S+IE SEDYTC+   GPNPK THIF DCILE      T  +        +++ P 
Sbjct  237   GSVSASEIEQSEDYTCIIARGPNPKTTHIFGDCILEPQ----TMDASASAAAMDVTEAP-  291

Query  1103  CCEEHFSY----------------PSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCR  1234
               E ++                     +FLS C+TCKKKL+G DI+IYRGEKAFCS++CR
Sbjct  292   -TESYWVVKCDAGAAPASGGGGGGGGGNFLSSCFTCKKKLEGNDIYIYRGEKAFCSANCR  350

Query  1235  SEEILIDEEKE  1267
              ++ILI+EE E
Sbjct  351   DQQILIEEEAE  361



>ref|XP_009369861.1| PREDICTED: uncharacterized protein LOC103959236 [Pyrus x bretschneideri]
Length=288

 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 75/115 (65%), Gaps = 14/115 (12%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S++ELSEDYTCV +HGPNPK THIF +CI+E  +     FS  G + NG        
Sbjct  184   LSVSEMELSEDYTCVISHGPNPKTTHIFDNCIVESSDG-VPEFSP-GRKSNGS-------  234

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                 SY S  FLSFC  CKK L  GKDIF+YRGEKAFCS  CR +E+L++E  +K
Sbjct  235   ----SYLSESFLSFCDNCKKNLGHGKDIFMYRGEKAFCSRECRYQEMLLEEGADK  285



>ref|XP_009335321.1| PREDICTED: uncharacterized protein LOC103928038 [Pyrus x bretschneideri]
 ref|XP_009335322.1| PREDICTED: uncharacterized protein LOC103928038 [Pyrus x bretschneideri]
Length=290

 Score =   109 bits (272),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 156/352 (44%), Gaps = 101/352 (29%)
 Frame = +2

Query  251   QKHK--VSSFFNVPALFVGLNPKQ-SESDSVRSPTSPLEFRVFSTLSNTLRSQ-------  400
             +KH    SSFF  P LF     K  SESD+V SPTS LE + F  L N   S+       
Sbjct  12    EKHTKLTSSFFANPRLFTSFTSKAVSESDAVMSPTSILETKPFLGLRNPFWSESNTPRTP  71

Query  401   --RSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNH  574
                S   H     C  +GL+I+DAL++                                 
Sbjct  72    EPESRRIHWDKLDCKGIGLAIVDALNE---------------------------------  98

Query  575   SDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFG----IGDAPLEEGISSANMrsrs  742
                                ++PKP N    +  V+FG    I   PL+  + S +   +S
Sbjct  99    -------------------SDPKPSN--PKTRMVIFGSQLKIQIPPLQPSVLSPSRSPKS  137

Query  743   ldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNS-SGAKLR-SMPV  916
                       A F+++  N H GSF      +S +SQ+  + S   ++ SG + + S  V
Sbjct  138   S---------ADFSTKTENSHLGSF------SSVLSQSPEKKSLFESACSGLETKNSTRV  182

Query  917   PAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKG  1096
                 +S S++ELSEDYTCV +H PNPK THIF +CI++         S +G  E      
Sbjct  183   FTSCLSVSEMELSEDYTCVISHRPNPKTTHIFDNCIVD---------SSDGVPEF----S  229

Query  1097  PGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEIL  1249
             PG      S  S  FLSFC  CKK L  GKDIF+YRGEKAFCS  CR +E+L
Sbjct  230   PGRKSNGSSSLSESFLSFCDNCKKNLGQGKDIFMYRGEKAFCSRECRYQEML  281



>ref|XP_009398366.1| PREDICTED: uncharacterized protein LOC103982978 [Musa acuminata 
subsp. malaccensis]
Length=274

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 81/135 (60%), Gaps = 19/135 (14%)
 Frame = +2

Query  869   SKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEF  1048
             S+L   S A   S  V  GSI  S++ELSEDYTCV +HGPNP+ THIF +C++E      
Sbjct  149   SQLALLSPAPASSPRVFTGSIPMSEMELSEDYTCVISHGPNPRTTHIFDNCVVE------  202

Query  1049  TNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSS  1225
                 + G+  +   +G         Y   DFLS+C+ CKK L  GKD F+YRGEKAFCSS
Sbjct  203   ----RCGDGSSAADRG--------GYLLDDFLSYCHACKKNLGQGKDTFMYRGEKAFCSS  250

Query  1226  SCRSEEILIDEEKEK  1270
              CR++E+L D   EK
Sbjct  251   ECRNKEMLNDGGMEK  265



>ref|XP_002282784.1| PREDICTED: uncharacterized protein LOC100245904 [Vitis vinifera]
Length=307

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 120/395 (30%), Positives = 181/395 (46%), Gaps = 106/395 (27%)
 Frame = +2

Query  152   MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-SESD  328
             MLRKR+R+   +Q   LM D  S    +              + P LF G + K  SE++
Sbjct  1     MLRKRSRASTSKQ--ALMADCGSLPSPTDKYRRPPSSSFF--SSPRLFTGFSSKVFSETE  56

Query  329   SVRSPTSPLEFRVFS----TLSNTLRSQRSSE----GHQKSWGCSKVGLSIIDAL--DDK  478
             ++ SPTS L+ + FS      +NT  + + SE     H        +GL I+DAL  D+ 
Sbjct  57    TMMSPTSILDSKPFSGFRNPFTNTTSTIKPSEPEPRRHWDKLDSRMIGLGIVDALTHDES  116

Query  479   TKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLH  658
               +L       +S+ ++FG Q+  +                    IP  P          
Sbjct  117   DPKLSK----PESRMVLFGSQLKIQ--------------------IPPLP----------  142

Query  659   NDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGIN  838
                S VL     +P E   S A+                 F  +  N   G F      +
Sbjct  143   ---SSVL-----SPAESPKSPAD-----------------FGIKTRNSQLGPF------S  171

Query  839   SAISQNVRELSKLGNS-SGAKLRSMP-VPAGSISTSKIELSEDYTCVRTHGPNPKVTHIF  1012
               +SQ+  + S  G++ SG +  + P +  G +S +++ELSEDYTCV +HGPNP+ THIF
Sbjct  172   PCLSQSPAKKSGFGSANSGLEAPNSPRIFTGCLSATEMELSEDYTCVISHGPNPRTTHIF  231

Query  1013  CDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDI  1189
              +CI+         FS + +E +              +P S FL+FC++C+K +  GKDI
Sbjct  232   DNCIV--------GFSASRKEND-------------VFPES-FLNFCHSCRKNIGQGKDI  269

Query  1190  FIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDF  1294
             +IYRGEKAFCSS CR  EI++ EE+ +  +GGD +
Sbjct  270   YIYRGEKAFCSSECRQREIML-EERMEILEGGDVY  303



>ref|XP_002314686.2| senescence-associated family protein [Populus trichocarpa]
 gb|EEF00857.2| senescence-associated family protein [Populus trichocarpa]
Length=329

 Score =   109 bits (273),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 77/116 (66%), Gaps = 7/116 (6%)
 Frame = +2

Query  914   VPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSK  1093
             V  G +S S++ELSEDYTCV THGP PK THIF +CI+E        FS +  ++N    
Sbjct  197   VFTGCLSASEMELSEDYTCVITHGPVPKTTHIFDNCIVESCCGA-VGFSASSRKDNNRFL  255

Query  1094  GPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDE  1258
             G G      +Y S  FLSFC +CKK L+ GKDI+IYRGE+AFCS+ CR + +L++E
Sbjct  256   GDG-----LTYRSDSFLSFCSSCKKNLEQGKDIYIYRGERAFCSNECRYQVMLLEE  306



>ref|XP_008361364.1| PREDICTED: uncharacterized protein LOC103425066 [Malus domestica]
Length=266

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 14/115 (12%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S++ELSEDYTCV +HGPNPK THIF +CI+E         S +G  E      PG  
Sbjct  162   LSVSEMELSEDYTCVISHGPNPKTTHIFDNCIVE---------SSDGVPEF----SPGXK  208

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                 SY S  FLSFC  CKK L  GKDIF+YRGEKAFCS  CR +E+L++E  ++
Sbjct  209   SNGSSYLSESFLSFCDNCKKNLGHGKDIFMYRGEKAFCSRECRYQEMLLEEGADR  263



>ref|XP_008340997.1| PREDICTED: uncharacterized protein LOC103403932 [Malus domestica]
Length=288

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 75/115 (65%), Gaps = 14/115 (12%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S++ELSEDYTCV +HGPNPK THIF +CI+E  +     FS  G + NG        
Sbjct  184   LSVSEMELSEDYTCVISHGPNPKTTHIFDNCIVESSDG-VPEFSP-GRKSNGS-------  234

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                 SY S  FLSFC  CKK L  GKDIF+YRGEKAFCS  CR +E+L++E  ++
Sbjct  235   ----SYLSESFLSFCDNCKKNLGHGKDIFMYRGEKAFCSRECRYQEMLLEEGADR  285



>ref|XP_008362006.1| PREDICTED: uncharacterized protein LOC103425695 [Malus domestica]
Length=288

 Score =   108 bits (271),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 14/115 (12%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S++ELSEDYTCV +HGPNPK THIF +CI+E         S +G  E      PG  
Sbjct  184   LSVSEMELSEDYTCVISHGPNPKTTHIFDNCIVE---------SSDGVPEF----SPGXK  230

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                 SY S  FLSFC  CKK L  GKDIF+YRGEKAFCS  CR +E+L++E  ++
Sbjct  231   SNGSSYLSESFLSFCDNCKKNLGHGKDIFMYRGEKAFCSRECRYQEMLLEEGADR  285



>emb|CDY11512.1| BnaA09g40780D [Brassica napus]
Length=300

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (64%), Gaps = 12/111 (11%)
 Frame = +2

Query  932   STSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCE  1111
             S  ++E+SEDYTC+ THGPNPK THI+ D +L+CH N   N  K+ E E           
Sbjct  183   SEDEMEMSEDYTCIITHGPNPKTTHIYGDQVLDCHKNGDDNKEKSIETELD---------  233

Query  1112  EHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
                 +P  +FL  C  C KKL  GKDI++YRGEKAFCS+ CRSEE+ IDE+
Sbjct  234   --SMFPLDNFLRVCNFCNKKLVLGKDIYMYRGEKAFCSAECRSEEMTIDED  282


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 82/184 (45%), Gaps = 42/184 (23%)
 Frame = +2

Query  161  KRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ--SESDSV  334
            + T   KDQ M Q +     ++ L        +KV +     +L +GL   +  S+SD V
Sbjct  5    RATFRHKDQTMSQSV---DRQTDLVGHNNNNNNKVITNPLAMSLLIGLKKDKCISDSDFV  61

Query  335  RSPTSPLEFRVFSTLSNT---LRSQRSSEGHQKSWGC-SKVGLSIIDAL-DDKTKRLGNL  499
            RSP SPLEF++ ST++      RS RSS        C +KVGLSI+D+L DD+       
Sbjct  62   RSPKSPLEFKMLSTMAADPFFFRSPRSSLTAH--LNCPAKVGLSIVDSLGDDRV------  113

Query  500  PIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVL  679
                 S +++FGP +  K+ +  +                      PK   +  + S V+
Sbjct  114  ----LSPDVVFGPALRIKSSDIKDK--------------------HPKSLKIEKERSGVI  149

Query  680  FGIG  691
            F IG
Sbjct  150  FEIG  153



>ref|XP_009345875.1| PREDICTED: uncharacterized protein LOC103937650 [Pyrus x bretschneideri]
Length=287

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 74/115 (64%), Gaps = 14/115 (12%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S++ELSEDYTCV +HGPNPK THIF +CI+E  +     FS  G + NG        
Sbjct  183   LSVSEMELSEDYTCVISHGPNPKTTHIFDNCIVESSDG-VPEFSP-GRKSNGS-------  233

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                 SY S  FLSFC  CKK L  GKDIF+YRGEKAFCS  CR + +L+DE  +K
Sbjct  234   ----SYLSESFLSFCDNCKKNLGHGKDIFMYRGEKAFCSRECRYQGMLLDEGADK  284



>ref|XP_003536527.1| PREDICTED: uncharacterized protein LOC100776509 isoform X1 [Glycine 
max]
 ref|XP_006589592.1| PREDICTED: uncharacterized protein LOC100776509 isoform X2 [Glycine 
max]
 gb|KHN02724.1| hypothetical protein glysoja_015966 [Glycine soja]
Length=266

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 111/224 (50%), Gaps = 32/224 (14%)
 Frame = +2

Query  611   NIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASR  790
             N P  P +E K +    DS  V  G+ DA ++E      +                  S 
Sbjct  61    NSPRTPGSEHKRYWDKLDSKGVGLGLVDALVDEDKHGGEV------------------SS  102

Query  791   KSNLHSGSFGTEHGIN------SAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIEL  952
             KS      FG++  I       S  S+ V E  K  +       S  V  G +S S++EL
Sbjct  103   KSESRMVLFGSQLKIQIPPLSPSESSKFVAEKGKCASGVADANNSQRVFVGCLSASEMEL  162

Query  953   SEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPS  1132
             SEDYT V + GPNP+ THIF +CI+E    E    S +  +EN      GC  +H SY S
Sbjct  163   SEDYTRVISRGPNPRTTHIFDNCIIESSCFEL-GCSASSAKEN------GCFLDHTSYHS  215

Query  1133  SDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
               FLS C+ CKK L  GKDI++YRGE+AFCS+ CR + +L++EE
Sbjct  216   RSFLSVCFHCKKNLGQGKDIYMYRGERAFCSNECRYQGMLLEEE  259



>ref|XP_011026145.1| PREDICTED: uncharacterized protein LOC105126833 [Populus euphratica]
Length=291

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 87/152 (57%), Gaps = 29/152 (19%)
 Frame = +2

Query  809   GSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMP-VPAGSISTSKIELSEDYTCVRTHG  985
             G FG E   NS  S      +     SG + +  P V  G IS S++ELSEDYTCV THG
Sbjct  164   GDFGIETSKNSQFS------ASPSVHSGIQSKDSPRVFTGCISMSEMELSEDYTCVITHG  217

Query  986   PNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCK  1165
             PNP  THIF +C++E +++  ++ SK                   S P S FLS CYTCK
Sbjct  218   PNPTTTHIFDNCVVENYHS-LSDMSK-------------------SEPRS-FLSSCYTCK  256

Query  1166  KKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
             K L  K DI+IYRGEKAFCS  CR +E+L+DE
Sbjct  257   KNLQQKNDIYIYRGEKAFCSHECRYQEMLLDE  288



>ref|XP_006826248.1| hypothetical protein AMTR_s00004p00011050 [Amborella trichopoda]
 gb|ERM93485.1| hypothetical protein AMTR_s00004p00011050 [Amborella trichopoda]
Length=551

 Score =   111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 92/154 (60%), Gaps = 10/154 (6%)
 Frame = +2

Query  809   GSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGP  988
             GS G+   +   +  +   ++ +  SS   + S  V  G +S S++E SEDYTC+ +HGP
Sbjct  337   GSQGSSFQLEKRVIDSKDRVNSMEVSSPLSVGSPRVFTGCLSASEMEQSEDYTCIISHGP  396

Query  989   NPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKK  1168
             N + THIF +C++E   + F   S + ++EN         E   +YPS DFLS C+ CKK
Sbjct  397   NSRTTHIFDNCVVE---SPFVG-SFSTKKENW-----AVYENQSTYPSHDFLSICFACKK  447

Query  1169  KL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             KL  G+DIF+YRGEKAFCS  CRS E++ DE  E
Sbjct  448   KLGQGEDIFMYRGEKAFCSRECRSLEMMFDEGPE  481



>gb|KHN15761.1| hypothetical protein glysoja_012553 [Glycine soja]
Length=269

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 116/226 (51%), Gaps = 32/226 (14%)
 Frame = +2

Query  611   NIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSANMrsrsldsgrsgsHFASFASR  790
             N P  P +E K +    DS  V  G+ DA ++E                         S 
Sbjct  61    NSPRTPVSEHKRYWDKLDSKGVGLGLVDALVDEEKHGE-------------------VSS  101

Query  791   KSNLHSGSFGTEHGINS---AISQNVRELSKLGNSSG--AKLRSMPVPAGSISTSKIELS  955
             KS      FG++  I     + S++ + +++ GNSS   A   S  V  G +S S++ELS
Sbjct  102   KSESRMVVFGSQLKIQIPPLSPSESSKFVAEKGNSSSGVADANSQRVFMGCLSASEMELS  161

Query  956   EDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSS  1135
             EDYT V + GPNP+ THIF +CI+E    E    S +  +EN      GC  +  SY S 
Sbjct  162   EDYTRVISRGPNPRTTHIFDNCIIESSCFEL-GCSASSAKEN------GCFLDQTSYHSR  214

Query  1136  DFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
              FLS C+ CKK L  GKDI++YRGE+AFCS+ CR + +L++EE  K
Sbjct  215   SFLSVCFHCKKNLGQGKDIYMYRGERAFCSNECRYQGMLLEEEMSK  260



>ref|XP_002300834.2| hypothetical protein POPTR_0002s05170g [Populus trichocarpa]
 gb|EEE80107.2| hypothetical protein POPTR_0002s05170g [Populus trichocarpa]
Length=291

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 87/153 (57%), Gaps = 31/153 (20%)
 Frame = +2

Query  809   GSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMP-VPAGSISTSKIELSEDYTCVRTHG  985
             G FG E   NS  S      +     SG + +  P V  G IS S++ELSEDYTCV THG
Sbjct  164   GDFGIETSRNSQFS------ASPSVHSGIQSKDSPRVFTGCISMSEMELSEDYTCVITHG  217

Query  986   PNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTC  1162
             PNP  THIF +C++E C++   ++ SK                   S P S FLS CYTC
Sbjct  218   PNPTTTHIFDNCVVENCYS--LSDMSK-------------------SEPRS-FLSSCYTC  255

Query  1163  KKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
             KK L  K DI+IYRGEKAFCS  CR +E+L+DE
Sbjct  256   KKNLQQKNDIYIYRGEKAFCSQECRYQEMLLDE  288



>ref|XP_011026736.1| PREDICTED: uncharacterized protein LOC105127223 isoform X1 [Populus 
euphratica]
 ref|XP_011026745.1| PREDICTED: uncharacterized protein LOC105127223 isoform X1 [Populus 
euphratica]
Length=316

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 78/116 (67%), Gaps = 11/116 (9%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSK  1093
             AG +S S++ELSEDYTCV THGP P+ THIF +CI+E  C       FS + +++N    
Sbjct  199   AGCLSASEMELSEDYTCVITHGPVPRTTHIFDNCIVESCCG---VAGFSTSLKKDNNRFL  255

Query  1094  GPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDE  1258
             G G      SYP ++FLSFC  CK  L+ GKDI++YRGE+AFCSS CR + + ++E
Sbjct  256   GDGS-----SYPPNNFLSFCSACKSNLEQGKDIYMYRGERAFCSSECRYQAMQLEE  306



>gb|KHN10679.1| hypothetical protein glysoja_019110 [Glycine soja]
Length=283

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 72/116 (62%), Gaps = 16/116 (14%)
 Frame = +2

Query  911   PVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLS  1090
             P   G +S S++ELSE+YTCV +HGPNPK THIF +CI+         +    ++ N   
Sbjct  174   PRSGGVLSWSEMELSEEYTCVISHGPNPKATHIFNNCIV------VETYCSLPQKHN---  224

Query  1091  KGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILID  1255
                     H +  S +FLSFCYTCKK LD  KDIFIYRGEKAFCS  CR  E+++D
Sbjct  225   ------SHHSAATSGNFLSFCYTCKKHLDQTKDIFIYRGEKAFCSRECRHREMMLD  274



>ref|XP_011026754.1| PREDICTED: uncharacterized protein LOC105127223 isoform X2 [Populus 
euphratica]
Length=301

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE-CHNNEFTNFSKNGEEENGLSKG  1096
             AG +S S++ELSEDYTCV THGP P+ THIF +CI+E C       FS + +++N    G
Sbjct  184   AGCLSASEMELSEDYTCVITHGPVPRTTHIFDNCIVESCCG--VAGFSTSLKKDNNRFLG  241

Query  1097  PGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDE  1258
              G      SYP ++FLSFC  CK  L+ GKDI++YRGE+AFCSS CR + + ++E
Sbjct  242   DGS-----SYPPNNFLSFCSACKSNLEQGKDIYMYRGERAFCSSECRYQAMQLEE  291



>ref|XP_010551715.1| PREDICTED: uncharacterized protein LOC104822263 [Tarenaya hassleriana]
Length=252

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 11/118 (9%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP  1099
              GS+S S++ELSEDYTCV +HGPNP+  HIF + I+E  ++  +  S +   E     GP
Sbjct  145   TGSLSASEMELSEDYTCVTSHGPNPRTIHIFDNFIVESISDAASYRSSDPTRE----IGP  200

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             GCC  +       FLS C TCKK L  + DIF+YRGE+AFCS  CRSEE++++++  K
Sbjct  201   GCCSPNH------FLSTCCTCKKNLGPREDIFMYRGERAFCSRECRSEEMMLEDKNMK  252



>ref|XP_003556054.1| PREDICTED: uncharacterized protein LOC100807906 isoform X1 [Glycine 
max]
 ref|XP_006606057.1| PREDICTED: uncharacterized protein LOC100807906 isoform X2 [Glycine 
max]
 ref|XP_006606058.1| PREDICTED: uncharacterized protein LOC100807906 isoform X3 [Glycine 
max]
Length=269

 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 90/144 (63%), Gaps = 10/144 (7%)
 Frame = +2

Query  848   SQNVRELSKLGNSSG--AKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDC  1021
             S++ + +++ GNSS   A   S  V  G +S S++ELSEDYT V + GPNP+ THIF +C
Sbjct  124   SESSKFVAEKGNSSSGVADANSQRVFMGCLSASEMELSEDYTRVISRGPNPRTTHIFDNC  183

Query  1022  ILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIY  1198
             I+E    E    S +  +EN      GC  +  SY S  FLS C+ CKK L  GKDI++Y
Sbjct  184   IIESSCFEL-GCSASSVKEN------GCFLDQTSYHSRSFLSVCFHCKKNLGQGKDIYMY  236

Query  1199  RGEKAFCSSSCRSEEILIDEEKEK  1270
             RGE+AFCS+ CR + +L++EE  K
Sbjct  237   RGERAFCSNECRYQGMLLEEEMSK  260



>ref|XP_010417344.1| PREDICTED: uncharacterized protein LOC104703099 isoform X2 [Camelina 
sativa]
Length=314

 Score =   107 bits (266),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 117/336 (35%), Positives = 155/336 (46%), Gaps = 85/336 (25%)
 Frame = +2

Query  287   ALFVGLNPKQ-----SESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQKSWGC---SK  442
             +L +GLN        S+SD VRSP SPLEFR+ ST++       SS     +  C   +K
Sbjct  36    SLLIGLNNNNNNKCISDSDFVRSPKSPLEFRMLSTMAADPFLTSSSLTPHLNCCCRPSAK  95

Query  443   VGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPI  622
             VGLSI+D   D++     LP      +I+FGP +  K     +  +        PK   +
Sbjct  96    VGLSIVD---DRSL----LP------DIVFGPALRIKCSKVRDRDNH------RPK--LL  134

Query  623   FPCTEPKPFNLHNDSSYVLFGIGDAPLE-EGISSANMrsrsldsgrsgsHFASFASRKSN  799
             FP  + +        S V+F IGD   E E I   N               A+   RK+ 
Sbjct  135   FPVAKIE----KEKRSGVVFEIGDNSSESEQIWLRNRSFS-----------ANDCLRKTR  179

Query  800   LHSGS-FGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVR  976
             + SGS  G E                 G S G+        A S   S+ ++ EDYTC+ 
Sbjct  180   VLSGSKLGVE-----------------GESGGSD------NAFSSCLSEDDM-EDYTCII  215

Query  977   THGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCY  1156
              HGPNPK THI+ D +LECH NE    SK  E+  G        +      S +FLS C 
Sbjct  216   AHGPNPKTTHIYGDRVLECHKNE----SKGDEKHIGT-------QSDSMLASVNFLSVCN  264

Query  1157  TCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEE  1261
              C KKL+ G+DI+I   EK FCS  CRSEE++IDEE
Sbjct  265   FCNKKLEGGEDIYI---EKPFCSEECRSEEMMIDEE  297



>ref|XP_007143270.1| hypothetical protein PHAVU_007G058400g [Phaseolus vulgaris]
 ref|XP_007143271.1| hypothetical protein PHAVU_007G058400g [Phaseolus vulgaris]
 gb|ESW15264.1| hypothetical protein PHAVU_007G058400g [Phaseolus vulgaris]
 gb|ESW15265.1| hypothetical protein PHAVU_007G058400g [Phaseolus vulgaris]
Length=276

 Score =   105 bits (263),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 83/144 (58%), Gaps = 13/144 (9%)
 Frame = +2

Query  875   LGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN  1054
             +G S+     S  V  G +S S++ELSEDYT V +HGPNP+ THIF +CI+E    E   
Sbjct  145   MGKSASGGANSPRVFMGCLSASEMELSEDYTRVISHGPNPRTTHIFDNCIIESSCFELGC  204

Query  1055  FSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSC  1231
              +K            GC     SY S  FLS C+ CK+ L +GKDI++YRGE+AFCS+ C
Sbjct  205   SAKED----------GCFPHRTSYHSRSFLSVCFHCKRNLGEGKDIYMYRGERAFCSNEC  254

Query  1232  RSEEILIDEEKEKTNKGGDDFEKP  1303
             R + ++++EE  K    G D   P
Sbjct  255   RYQGMVLEEEMSKLE--GSDIYGP  276



>ref|XP_010096150.1| hypothetical protein L484_005429 [Morus notabilis]
 gb|EXB63466.1| hypothetical protein L484_005429 [Morus notabilis]
Length=275

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 84/141 (60%), Gaps = 10/141 (7%)
 Frame = +2

Query  869   SKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEF  1048
             S LG S   K  S     G+ ST  +ELSEDYTCV THGPNPK THIF +C++E      
Sbjct  142   SHLGFSPIEKSASGSASFGAEST-PMELSEDYTCVITHGPNPKTTHIFDNCVVEESCFGV  200

Query  1049  TNFSKNGEEENGLSKGPGCCEEHFS-YPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCS  1222
               FS       G  K  G  +  +S + S +FLSFC TCKK L  G DI++YRGEKAFCS
Sbjct  201   VGFS-------GARKEGGDDQIFYSTFRSENFLSFCCTCKKNLGQGNDIYMYRGEKAFCS  253

Query  1223  SSCRSEEILIDEEKEKTNKGG  1285
               CR EE+L++E ++K    G
Sbjct  254   HECRYEEMLLEESEDKMGFDG  274



>ref|XP_010545091.1| PREDICTED: uncharacterized protein LOC104817557 [Tarenaya hassleriana]
Length=288

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 70/112 (63%), Gaps = 18/112 (16%)
 Frame = +2

Query  926   SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGC  1105
             SI  S++ELSEDYTCV +HGPNP   HIF +C+        +N S +     GL      
Sbjct  191   SIPVSEMELSEDYTCVISHGPNPTTRHIFDNCVF-----VESNCSVSSSPPLGL------  239

Query  1106  CEEHFSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
                   YPS+ FLSFCYTCKK LD K +I+IYRGEKAFCS  CR +E+LID 
Sbjct  240   ------YPSNSFLSFCYTCKKILDQKHNIYIYRGEKAFCSCECRFQEMLIDR  285



>ref|XP_004496709.1| PREDICTED: uncharacterized protein LOC101512717 isoform X1 [Cicer 
arietinum]
Length=301

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 109/360 (30%), Positives = 154/360 (43%), Gaps = 74/360 (21%)
 Frame = +2

Query  203   MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQSESDSVRSPTSPLEFRVFSTLS  382
             M DS S +    G   +K   SSFFN P LF      ++E+  + SPTS L+ + FS L 
Sbjct  1     MEDSGSST--CCGEKYKKITSSSFFNSPKLFTQKGFHETET-MMMSPTSILDSKNFSGLK  57

Query  383   NTLRSQRSSEG------HQKSWGCSKVGLSIIDALDDKTKRLGNLPIPSKSKNIIFGPQM  544
             N   S+ +S        H++ W          D LD K   LG + +    KN     ++
Sbjct  58    NPFWSETNSPRTPNCGEHKRCW----------DKLDSKPVGLGLVDVLVDEKNGEVNSKL  107

Query  545   SCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYVLFGIGDAPLEEGISSA  724
               +T  F            L   IP F    P      +  S   F  G+  ++ G S  
Sbjct  108   ENRTVLF---------GSQLKIQIPPF---SPTTIFSSSSESESTFSRGEFSIKTGNSQ-  154

Query  725   NMrsrsldsgrsgsHFASFASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLR  904
                                 S   +L     G     +S     V E+    N+ G    
Sbjct  155   ------------------LGSSYGSLSHSPMGKS---SSGCENPVLEVETFNNTHG----  189

Query  905   SMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEF-TNFSKNGEEEN  1081
                V  G +S S++ELSEDYT V +HGPNP+ THIF +CI+E    EF   +S + +   
Sbjct  190   ---VFKGCLSASEMELSEDYTRVISHGPNPRTTHIFDNCIIESSCFEFDVGYSASAK---  243

Query  1082  GLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDE  1258
                      E  + +P   FLS C+ CKK L+ GKDI++YRGE AFCS  CR++ +L +E
Sbjct  244   ---------ESEYCFPCESFLSICFHCKKNLEQGKDIYMYRGEMAFCSHECRNQGMLFEE  294



>gb|ACU18819.1| unknown [Glycine max]
Length=215

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 113/206 (55%), Gaps = 29/206 (14%)
 Frame = +2

Query  152  MLRKRTRS-QKDQQ-MGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPK-QSE  322
            MLRKR RS QKDQ  M ++  +  S+SH + G      K  S FNVP LFVGL PK   +
Sbjct  1    MLRKRNRSVQKDQHLMCEVNSEHYSQSHHALG--RNNIKGHSIFNVPCLFVGLGPKGLLD  58

Query  323  SDSVRSPTSPL-EFRVFSTLS-NTLRSQRSSEGHQKSWGCSKVGLSIIDALDD--KTKRL  490
            SDSVRSPTSPL + RV S L  N +R  RSS  H++SW C KVGL I+++L+D   ++  
Sbjct  59   SDSVRSPTSPLDDARVLSNLGKNPVRKPRSSH-HERSWDCCKVGLGIVESLEDCSSSRFS  117

Query  491  GNLPIPSKSKNIIFGPQ-MSCKTQNFLNHSD-SFGAAKSLPKNIPIFPCTEPKPFNLHND  664
            G +    +SK +   PQ M  K  N   H D S   +KSLPK+     C  P P+  H +
Sbjct  118  GKILQSPESKRVSLSPQMMMIKAPNCQIHRDSSLEGSKSLPKDF----CKAP-PYYAHQN  172

Query  665  SSY------------VLFGIGDAPLE  706
             S             VLF IG++ LE
Sbjct  173  GSVVIHKGECESESTVLFEIGESGLE  198



>ref|XP_003536591.1| PREDICTED: uncharacterized protein LOC100811607 [Glycine max]
 gb|KHN03809.1| hypothetical protein glysoja_011038 [Glycine soja]
Length=270

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 73/117 (62%), Gaps = 22/117 (19%)
 Frame = +2

Query  908   MPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGL  1087
             + V  G +S S++ELSE+YTCV  HGPNP+ THIF +CI+E + +              L
Sbjct  165   LSVATGVLSLSEMELSEEYTCVIAHGPNPRTTHIFDNCIVESYCS--------------L  210

Query  1088  SKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILID  1255
                P         PS +FLSFC+TCKK L+  KDIFIYRGEKAFCS  CR +E+++D
Sbjct  211   PNTPNS-------PSLNFLSFCHTCKKHLEQTKDIFIYRGEKAFCSKECRHQEMVLD  260



>ref|XP_010419717.1| PREDICTED: uncharacterized protein LOC104705412 [Camelina sativa]
Length=339

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 73/129 (57%), Gaps = 3/129 (2%)
 Frame = +2

Query  869   SKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILEC--HNN  1042
             S + N++   +   P      + S IE+SEDYTCV  HGPNPK TH + D +LE   HN 
Sbjct  173   SIVNNNACQVIEEAPGSLNGRTESDIEISEDYTCVTQHGPNPKTTHFYGDQVLESVEHNE  232

Query  1043  EFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFC  1219
                   +N +E       P         P SDFLSFCY C KKL  GK+I++YRG KAFC
Sbjct  233   SNNRCCRNKKESIFAIASPDLTTPVDVLPPSDFLSFCYGCNKKLGLGKEIYMYRGYKAFC  292

Query  1220  SSSCRSEEI  1246
             SS CRSEEI
Sbjct  293   SSECRSEEI  301


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 51/94 (54%), Gaps = 8/94 (9%)
 Frame = +2

Query  281  VPALFVGLNPKQSESDSVRSPTSPLEFRVFSTLSNTLRSQRSS---EGHQKSWGCSKVGL  451
            +  +F G  P  S+ +S  SPTSPL+FR+FS+  N   S  S    +G QKSW   KVGL
Sbjct  31   ISGVFEGKCP--SDYESAWSPTSPLDFRLFSSFGNPFGSSSSRSIWKGKQKSWDSGKVGL  88

Query  452  SI--IDALDDKTKRLGNLPIPS-KSKNIIFGPQM  544
            SI      DD       + +PS  SKNIIFG  M
Sbjct  89   SILHSLDDDDHHTDSSRIVLPSVDSKNIIFGSLM  122



>ref|XP_011079875.1| PREDICTED: uncharacterized protein LOC105163284 [Sesamum indicum]
Length=306

 Score =   104 bits (259),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 86/154 (56%), Gaps = 34/154 (22%)
 Frame = +2

Query  848   SQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCIL  1027
             ++N + LS L  SS AK  S       +S  ++ELSEDYTCV +HGPNP+ THIF  CI+
Sbjct  168   TRNSQLLSPLTGSSPAKDFSR-----QLSLKEMELSEDYTCVISHGPNPRTTHIFDGCIV  222

Query  1028  EC------------HNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKK  1171
             E              N EFT+F      E  +S            PS++FLSFC+ CK  
Sbjct  223   ESCCGYDAKDSDHDKNREFTSF------ETDVSTS----------PSANFLSFCHNCKDI  266

Query  1172  L-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
             L  GKDI++YRGEKAFCS  CR +EIL +  K +
Sbjct  267   LGQGKDIYMYRGEKAFCSHECRCQEILYEGMKNQ  300



>ref|XP_010039726.1| PREDICTED: uncharacterized protein LOC104428433 [Eucalyptus grandis]
 gb|KCW45788.1| hypothetical protein EUGRSUZ_L00403 [Eucalyptus grandis]
Length=320

 Score =   104 bits (259),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             IS +++E SEDYTCV +HGPNPK THIF DCI+E    +F + S + +E   LS      
Sbjct  202   ISATEMESSEDYTCVISHGPNPKTTHIFDDCIVESCCGDFKSAS-DLKESGFLSD-----  255

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDE  1258
             E+     S  FLSFC TCKK L  G DI++YRGEKAFCS  CR +EIL++E
Sbjct  256   EQSSRSLSHSFLSFCCTCKKNLGQGSDIYMYRGEKAFCSGDCRYQEILLEE  306



>gb|KHN02567.1| hypothetical protein glysoja_002591 [Glycine soja]
Length=283

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 77/131 (59%), Gaps = 22/131 (17%)
 Frame = +2

Query  881   NSSGAKLRSM-----PVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
             NSSG+ + S      P   G +S S +ELSE+YTCV +HGP PK THIF +CI+      
Sbjct  156   NSSGSGICSKDCCDSPRSGGVLSWSAMELSEEYTCVISHGPIPKATHIFNNCIM------  209

Query  1046  FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCS  1222
                +     ++N           H +  S +FLSFCYTCKK LD  KDIFIYRGEKAFCS
Sbjct  210   VETYYSLPPKQN----------SHSAATSGNFLSFCYTCKKHLDQTKDIFIYRGEKAFCS  259

Query  1223  SSCRSEEILID  1255
               CR  E+++D
Sbjct  260   RECRHREMMLD  270



>gb|KHG29474.1| putative hect-type ubiquitin ligase-interacting cred [Gossypium 
arboreum]
Length=241

 Score =   102 bits (254),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 70/114 (61%), Gaps = 30/114 (26%)
 Frame = +2

Query  944   IELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCE----  1111
             +ELSEDYTCV +HGPNPK THIF DC++EC                       CC     
Sbjct  150   MELSEDYTCVISHGPNPKTTHIFHDCVVEC-----------------------CCSISNT  186

Query  1112  EHFSYP--SSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDEEK  1264
             +H S P  S++FLSFC+TCKK L  K DI+IYRG+KAFCS  CR +E++ D E+
Sbjct  187   QHKSAPSESNNFLSFCHTCKKNLRQKIDIYIYRGDKAFCSQECRYQEMVSDGEE  240



>ref|XP_007162449.1| hypothetical protein PHAVU_001G153200g [Phaseolus vulgaris]
 gb|ESW34443.1| hypothetical protein PHAVU_001G153200g [Phaseolus vulgaris]
Length=278

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 82/130 (63%), Gaps = 22/130 (17%)
 Frame = +2

Query  881   NSSGAKLRS----MPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEF  1048
             NSSG+++ +    +     ++S S++ELSE+YTCV +HGPNPK THIF +CI+      +
Sbjct  153   NSSGSEISAKDDCVSPSVRALSWSEMELSEEYTCVISHGPNPKTTHIFNNCIVV---ETY  209

Query  1049  TNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSS  1225
              +  +N              +   S  S++FLSFC+TCKK LD  KDIFIYRGEKAFCS 
Sbjct  210   YSLPQN--------------QNSHSATSANFLSFCHTCKKHLDQTKDIFIYRGEKAFCSR  255

Query  1226  SCRSEEILID  1255
              CR +E+++D
Sbjct  256   KCRHQEMVLD  265



>ref|XP_008368829.1| PREDICTED: uncharacterized protein LOC103432419 isoform X1 [Malus 
domestica]
 ref|XP_008368830.1| PREDICTED: uncharacterized protein LOC103432419 isoform X1 [Malus 
domestica]
Length=298

 Score =   103 bits (257),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 22/108 (20%)
 Frame = +2

Query  938   SKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEH  1117
             S++ELSEDYTCV + G NP+ THIF +CI+E ++               LS     C   
Sbjct  198   SEMELSEDYTCVISRGANPRTTHIFDNCIVESYHT--------------LSDQSSSC---  240

Query  1118  FSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
                 S++FLSFCYTCKK L+ K DI+IYRGEKAFCS  CR++E+L+DE
Sbjct  241   ----SANFLSFCYTCKKNLEQKIDIYIYRGEKAFCSRECRNQEMLLDE  284



>ref|NP_001241512.1| uncharacterized protein LOC100788456 [Glycine max]
 ref|XP_006603711.1| PREDICTED: uncharacterized protein LOC100788456 isoform X1 [Glycine 
max]
 gb|ACU17759.1| unknown [Glycine max]
Length=283

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 77/131 (59%), Gaps = 22/131 (17%)
 Frame = +2

Query  881   NSSGAKLRSM-----PVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNE  1045
             NSSG+ + S      P   G +S S +ELSE+YTCV +HGP PK THIF +CI+      
Sbjct  156   NSSGSGICSKDCCDSPRSGGVLSWSAMELSEEYTCVISHGPIPKATHIFNNCIM------  209

Query  1046  FTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCS  1222
                +     ++N           H +  S +FLSFCYTCKK LD  KDIFIYRGEKAFCS
Sbjct  210   VETYYSLPPKQN----------SHSAATSGNFLSFCYTCKKHLDQTKDIFIYRGEKAFCS  259

Query  1223  SSCRSEEILID  1255
               CR  E+++D
Sbjct  260   RECRHREMMLD  270



>ref|XP_010086615.1| hypothetical protein L484_002440 [Morus notabilis]
 gb|EXB22126.1| hypothetical protein L484_002440 [Morus notabilis]
Length=303

 Score =   103 bits (257),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 12/114 (11%)
 Frame = +2

Query  920   AGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP  1099
              G IS S +E SEDYTCV +HGP P+ THIF +CI+E     +   S + +  +     P
Sbjct  195   TGWISVSDVEHSEDYTCVISHGPVPRTTHIFDNCIVE----SYCCLSDDHDHNSVYINKP  250

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
               C       S +FLSFC+TC K L+ K DI+IYRGEKAFCS  CR +E+L+DE
Sbjct  251   KSC-------SKNFLSFCHTCNKNLEQKIDIYIYRGEKAFCSRECRYQEMLLDE  297



>ref|XP_008368831.1| PREDICTED: uncharacterized protein LOC103432419 isoform X2 [Malus 
domestica]
Length=278

 Score =   103 bits (256),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 22/108 (20%)
 Frame = +2

Query  938   SKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEH  1117
             S++ELSEDYTCV + G NP+ THIF +CI+E ++               LS     C   
Sbjct  178   SEMELSEDYTCVISRGANPRTTHIFDNCIVESYHT--------------LSDQSSSC---  220

Query  1118  FSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
                 S++FLSFCYTCKK L+ K DI+IYRGEKAFCS  CR++E+L+DE
Sbjct  221   ----SANFLSFCYTCKKNLEQKIDIYIYRGEKAFCSRECRNQEMLLDE  264



>ref|XP_002524763.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37606.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 87/161 (54%), Gaps = 33/161 (20%)
 Frame = +2

Query  779   FASRKSNLHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMP-VPAGSISTSKIELS  955
             F++  S +  G FG +           R     G+ SG + +  P V  G +  S++ELS
Sbjct  146   FSAADSPISPGDFGIK----------TRNAQLSGSGSGIQTKESPGVFTGCVPMSELELS  195

Query  956   EDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSS  1135
             EDYTCV ++GPNPK TH F +C+LE       N+    ++ N                 +
Sbjct  196   EDYTCVISYGPNPKTTHKFGNCVLE-------NYCSLSDKSNSA--------------PN  234

Query  1136  DFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILID  1255
             +FLSFC+ CKK L+ K DIFIYRGEKAFCS  CR +E+++D
Sbjct  235   NFLSFCHKCKKNLEQKIDIFIYRGEKAFCSQECRYQEMMLD  275



>gb|KHG19761.1| Phosphoenolpyruvate carboxykinase [ATP] [Gossypium arboreum]
Length=279

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 19/119 (16%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSKG  1096
             G++  S++ELSEDYTCV +HG NP+ THIF DCI+E  C    F++  +N          
Sbjct  166   GNLPASEMELSEDYTCVISHGSNPRTTHIFDDCIVESCCGVVGFSSPKRNWS--------  217

Query  1097  PGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDEEKEK  1270
                     SY S +FL++CY CKK L  GKDI++YR EKAFCS  CR +E++++E   K
Sbjct  218   --------SYQSENFLTYCYACKKNLSPGKDIYMYRSEKAFCSKECRYQEMMLEESTNK  268



>ref|XP_003590616.1| Senescence-associated protein SAG102 [Medicago truncatula]
 gb|AES60867.1| senescence-associated protein SAG102 [Medicago truncatula]
 gb|AFK41593.1| unknown [Medicago truncatula]
Length=237

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 21/111 (19%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S S++ELSE+YTCV +HGPNPK THIF +C++E             E    ++  P   
Sbjct  144   LSLSEMELSEEYTCVISHGPNPKTTHIFDNCVVE-------------ESYCSVTNSPHSF  190

Query  1109  EEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDE  1258
                    S +FLSFCYTCK  L+  KDIFIYRGEKAFCS  CR +E+++DE
Sbjct  191   -------SMNFLSFCYTCKNHLEHTKDIFIYRGEKAFCSQECRHKEMVLDE  234



>ref|XP_009370804.1| PREDICTED: uncharacterized protein LOC103960115 [Pyrus x bretschneideri]
 ref|XP_009370805.1| PREDICTED: uncharacterized protein LOC103960115 [Pyrus x bretschneideri]
Length=271

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 68/108 (63%), Gaps = 22/108 (20%)
 Frame = +2

Query  938   SKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEH  1117
             S++ELSEDYTCV + G NP+ THIF +CI+E +                LS     C E+
Sbjct  178   SEMELSEDYTCVISRGANPRTTHIFENCIVESYYT--------------LSDQSSSCSEN  223

Query  1118  FSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
                    FLSFCYTCKK L+ K DI+IYRGEKAFCS  CR++E+L+DE
Sbjct  224   -------FLSFCYTCKKNLEQKIDIYIYRGEKAFCSRECRNQEMLLDE  264



>gb|AAQ54554.1| putative senescence-associated protein SAG102 [Malus domestica]
Length=111

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 22/108 (20%)
 Frame = +2

Query  938   SKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEH  1117
             S++ELSEDYTCV + G NP+ THIF +CI+E ++               LS     C   
Sbjct  11    SEMELSEDYTCVISRGANPRTTHIFDNCIVESYHT--------------LSDQSSSC---  53

Query  1118  FSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
                 S++FLSFCYTCKK L+ K DI+IYRGEKAFCS  CR++E+L+DE
Sbjct  54    ----SANFLSFCYTCKKNLEQKIDIYIYRGEKAFCSRECRNQEMLLDE  97



>ref|XP_010034891.1| PREDICTED: uncharacterized protein LOC104424223 [Eucalyptus grandis]
 gb|KCW84193.1| hypothetical protein EUGRSUZ_B01058 [Eucalyptus grandis]
Length=320

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             IS +++E SEDYTCV +HGPNPK THIF DCI+E    +F + S + +E   LS      
Sbjct  202   ISATEMESSEDYTCVISHGPNPKTTHIFDDCIVESCCGDFKSAS-DLKESGFLSD-----  255

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDE  1258
             E+     S  FLSFC TC K L  G DI++YRGEKAFCS  CR +EIL++E
Sbjct  256   EQSSRSLSQSFLSFCCTCNKNLGQGSDIYMYRGEKAFCSGDCRYQEILLEE  306



>ref|XP_009367618.1| PREDICTED: uncharacterized protein LOC103957220 [Pyrus x bretschneideri]
 ref|XP_009367619.1| PREDICTED: uncharacterized protein LOC103957220 [Pyrus x bretschneideri]
 ref|XP_009367620.1| PREDICTED: uncharacterized protein LOC103957220 [Pyrus x bretschneideri]
 ref|XP_009367621.1| PREDICTED: uncharacterized protein LOC103957220 [Pyrus x bretschneideri]
 ref|XP_009367622.1| PREDICTED: uncharacterized protein LOC103957220 [Pyrus x bretschneideri]
Length=264

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 22/108 (20%)
 Frame = +2

Query  938   SKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEH  1117
             S++ELSEDYTCV + GP P+ THIF +CI+E ++   ++ S +G E              
Sbjct  174   SEMELSEDYTCVISRGPTPRTTHIFDNCIVESYHT-MSDQSSSGSE--------------  218

Query  1118  FSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
                   +FLSFCYTC+K L+ K DI+IYRGEKAFCS  CR +E+L+DE
Sbjct  219   ------NFLSFCYTCRKNLEQKIDIYIYRGEKAFCSQECRYQEMLLDE  260



>ref|XP_007050558.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOX94715.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=272

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 129/284 (45%), Gaps = 58/284 (20%)
 Frame = +2

Query  500   PIPSKSKNIIFG-PQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYV  676
             PIPS      FG P+    T   L  +++  +  S+  N P+FP   P  F+++   S  
Sbjct  17    PIPS-----FFGSPRFKAFTTKGLPDTEAVKSPTSILDNKPLFPFGSPFGFDINQPKSPR  71

Query  677   LF----------------GIG--------DAPLEEGISSANMrsrsldsgrsgsHFASF-  781
             +F                GIG        D P+E+  SS       L   +         
Sbjct  72    VFSPNNKQQHLPEKLDSKGIGLAIVDTLNDTPIEDKSSSETSNKMVLFGAKLRVQIPPLP  131

Query  782   ASRKSNLHSGSFGTEHGINSAISQNVRELSKLGN-SSGAKLRSMP-VPAGSISTSKIELS  955
             +S +S   S    T  GI +   +N    S  G+  S   ++  P V  G +   ++ELS
Sbjct  132   SSLRSPTTSPISPTYFGIKN---RNSHLSSPFGSPDSDIHVKDSPRVFTGCLPVREMELS  188

Query  956   EDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSS  1135
             EDYTCV +HGPNPK THIF +C++E +                L   P    E       
Sbjct  189   EDYTCVISHGPNPKTTHIFDNCVVESYCT--------------LPDKPKSAPE-------  227

Query  1136  DFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDEEK  1264
              FLSFC+TCKK L+ K DI++YRGEKAFCS  CR +E+L+D E+
Sbjct  228   SFLSFCHTCKKNLEQKIDIYMYRGEKAFCSQECRYQEMLLDGEE  271



>ref|XP_008223983.1| PREDICTED: uncharacterized protein LOC103323750 [Prunus mume]
Length=113

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 80/119 (67%), Gaps = 11/119 (9%)
 Frame = +2

Query  152  MLRKRTRS-QKDQ-QMGQL-MPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ-S  319
            M RKR+RS QK+Q QMG+L + D+ S       V     K + FF+V  LFVGL+ K  +
Sbjct  1    MPRKRSRSIQKNQHQMGRLPIADAGSN------VLGHNPKSNYFFSVHGLFVGLSSKGLT  54

Query  320  ESDSVRSPTSPLEFRVFSTLSNTLRSQRS-SEGHQKSWGCSKVGLSIIDALDDKTKRLG  493
            + DSV SPTSPL+FRVFS L N  RS RS ++G Q+SWG SKVGLSIID+L+D  K  G
Sbjct  55   DFDSVMSPTSPLDFRVFSNLGNPFRSPRSNNDGSQRSWGSSKVGLSIIDSLNDDVKVYG  113



>ref|XP_007050556.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94713.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=287

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 129/284 (45%), Gaps = 58/284 (20%)
 Frame = +2

Query  500   PIPSKSKNIIFG-PQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKPFNLHNDSSYV  676
             PIPS      FG P+    T   L  +++  +  S+  N P+FP   P  F+++   S  
Sbjct  32    PIPS-----FFGSPRFKAFTTKGLPDTEAVKSPTSILDNKPLFPFGSPFGFDINQPKSPR  86

Query  677   LF----------------GIG--------DAPLEEGISSANMrsrsldsgrsgsHFASF-  781
             +F                GIG        D P+E+  SS       L   +         
Sbjct  87    VFSPNNKQQHLPEKLDSKGIGLAIVDTLNDTPIEDKSSSETSNKMVLFGAKLRVQIPPLP  146

Query  782   ASRKSNLHSGSFGTEHGINSAISQNVRELSKLGN-SSGAKLRSMP-VPAGSISTSKIELS  955
             +S +S   S    T  GI +   +N    S  G+  S   ++  P V  G +   ++ELS
Sbjct  147   SSLRSPTTSPISPTYFGIKN---RNSHLSSPFGSPDSDIHVKDSPRVFTGCLPVREMELS  203

Query  956   EDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSS  1135
             EDYTCV +HGPNPK THIF +C++E +                L   P    E       
Sbjct  204   EDYTCVISHGPNPKTTHIFDNCVVESYCT--------------LPDKPKSAPE-------  242

Query  1136  DFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDEEK  1264
              FLSFC+TCKK L+ K DI++YRGEKAFCS  CR +E+L+D E+
Sbjct  243   SFLSFCHTCKKNLEQKIDIYMYRGEKAFCSQECRYQEMLLDGEE  286



>ref|XP_009408940.1| PREDICTED: uncharacterized protein LOC103991276 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408941.1| PREDICTED: uncharacterized protein LOC103991276 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408942.1| PREDICTED: uncharacterized protein LOC103991276 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408943.1| PREDICTED: uncharacterized protein LOC103991276 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408944.1| PREDICTED: uncharacterized protein LOC103991276 [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 4/120 (3%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNF-SKNGEEENGLSKGP  1099
             GS+S S+IE SEDYTC+ +HGPNP++THIF DCILE H+ E     +K+ +E+ G +   
Sbjct  253   GSLSASEIEQSEDYTCIISHGPNPRMTHIFGDCILESHSIESPKIKNKHRKEDEGSTWLS  312

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKL--DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKT  1273
                EE  S   +D LSFC++C+ K+  DGKDI ++RG+KA C   C     L+ EEKEKT
Sbjct  313   EPSEEMLSCFLNDSLSFCFSCRTKVDDDGKDICMHRGKKALCGCECCRNGTLL-EEKEKT  371


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 90/170 (53%), Gaps = 11/170 (6%)
 Frame = +2

Query  152  MLRKRTRS-QKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGLNPKQ--SE  322
            MLRKR+R  QKDQ  G LM   +S S   S   A++   +SF NV    VG + K+  SE
Sbjct  1    MLRKRSRPIQKDQSKGFLMSHPASGSCFPSDGVAKRTSCASFLNVHGHLVGFSNKKGLSE  60

Query  323  SDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLP  502
            S +V   TSPL+ +V S+++ +  +    +G  + W  S+VGL ++D L+D+ K    + 
Sbjct  61   SATVWGHTSPLD-KVLSSITRS--TTGIIDGRLRCWDSSRVGLGLVDTLNDEAKPCVKVL  117

Query  503  IPSKSKNIIFGPQMSC-----KTQNFLNHSDSFGAAKSLPKNIPIFPCTE  637
              S+S+NI+FG QM       K+       D  GAA  +  + P   C+E
Sbjct  118  GSSESRNIVFGSQMRLNFSTPKSHQVGPRDDPLGAAPQIGSSKPRSVCSE  167



>ref|XP_008386467.1| PREDICTED: uncharacterized protein LOC103448977 [Malus domestica]
 ref|XP_008386468.1| PREDICTED: uncharacterized protein LOC103448977 [Malus domestica]
 ref|XP_008386469.1| PREDICTED: uncharacterized protein LOC103448977 [Malus domestica]
 ref|XP_008386470.1| PREDICTED: uncharacterized protein LOC103448977 [Malus domestica]
Length=274

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 22/108 (20%)
 Frame = +2

Query  938   SKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEH  1117
             S++ELSEDYTCV + GP P+ THIF +CI+E ++   ++ S +G E              
Sbjct  174   SEMELSEDYTCVISRGPKPRTTHIFDNCIVESYHT-LSDQSSSGSE--------------  218

Query  1118  FSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
                   +FLSFCYTC+K L+ K DI+IYRGEKAFCS  CR +E+L+DE
Sbjct  219   ------NFLSFCYTCRKNLEQKIDIYIYRGEKAFCSQECRYQEMLLDE  260



>ref|XP_010679067.1| PREDICTED: GATA zinc finger domain-containing protein 14 [Beta 
vulgaris subsp. vulgaris]
Length=340

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 76/114 (67%), Gaps = 12/114 (11%)
 Frame = +2

Query  926   SISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILE--CHNNEFTNFSKNGEEENGLSKGP  1099
             ++S S +ELSEDYTCV +HGPNPK THIF +CI+E  C     ++FS N    NG     
Sbjct  231   NLSLSDMELSEDYTCVISHGPNPKTTHIFGNCIVESCCGVVGSSSFSAN---RNGYLSNF  287

Query  1100  GCCEEHFSYPSSD-FLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILID  1255
             G      S PS + FL FC  CKKKL +GKDI++YRGEKAFCS  CR +E+L+D
Sbjct  288   GN-----SIPSQENFLRFCNHCKKKLGEGKDIYMYRGEKAFCSQECRCQEMLLD  336



>gb|EPS72550.1| hypothetical protein M569_02210, partial [Genlisea aurea]
Length=252

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 70/111 (63%), Gaps = 17/111 (15%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S  ++ELSEDYTCV THGPNP+ THIF +CI+E  N      S++ +E   +       
Sbjct  158   LSLKEMELSEDYTCVITHGPNPRTTHIFDECIVESSNAP----SQSSDETKMMES-----  208

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDE  1258
                    SS FLSFC+ CK  L   KDI++YRGEKAFCS  CRS+E+++ E
Sbjct  209   -------SSSFLSFCHHCKDILRQDKDIYMYRGEKAFCSHECRSQEMMVLE  252



>gb|KEH43856.1| senescence-associated protein SAG102 [Medicago truncatula]
Length=289

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (65%), Gaps = 9/116 (8%)
 Frame = +2

Query  914   VPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSK  1093
             V  G +S S++ELSEDYT V +HGPNP+ THIF +CI+E   +   +   +  +ENG   
Sbjct  178   VFKGCLSASEMELSEDYTRVISHGPNPRTTHIFDNCIIE---SSCFDIGCSAVKENGY--  232

Query  1094  GPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDE  1258
                C     SYPS  FLS C+ CKK L+ GKDI++YRGE AFCS  CR + +L+++
Sbjct  233   ---CFPHPTSYPSESFLSVCFHCKKNLEQGKDIYMYRGEMAFCSHECRDQRMLLED  285



>ref|XP_007144648.1| hypothetical protein PHAVU_007G173400g [Phaseolus vulgaris]
 gb|ESW16642.1| hypothetical protein PHAVU_007G173400g [Phaseolus vulgaris]
Length=273

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 87/161 (54%), Gaps = 39/161 (24%)
 Frame = +2

Query  815   FGTEHGIN-----SAISQNVRELSKLGNSSG--AKLRSMPV--PAGSISTSKIELSEDYT  967
             FGT+H +           +  E +K  + +G  AK +  P+    G +S S++EL E+YT
Sbjct  128   FGTKHRVKIPPLPPPPPPSSPESTKTCDVAGFAAKTKDSPLSFATGVMSLSEMELFEEYT  187

Query  968   CVRTHGPNPKVTHIFCDCILECH----NNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSS  1135
             CV +HGPNP+ THIF +CI+E +    NN  +                         PS 
Sbjct  188   CVISHGPNPRTTHIFDNCIVESYCSLPNNTIS-------------------------PSL  222

Query  1136  DFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILID  1255
             +FLSFC+TCKK L    DIFIYRGEKAFCS  CR +E+++D
Sbjct  223   NFLSFCHTCKKHLKQTNDIFIYRGEKAFCSKECRHQEMMLD  263



>ref|XP_004290613.1| PREDICTED: uncharacterized protein LOC101301347 [Fragaria vesca 
subsp. vesca]
Length=278

 Score =   100 bits (248),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 73/113 (65%), Gaps = 21/113 (19%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
             +S  ++ELSEDYTCV + GPNP+ THIF +CI+E     +   S +G             
Sbjct  179   VSVREMELSEDYTCVISRGPNPRTTHIFDNCIVE----SYYTLSDSG-------------  221

Query  1109  EEHFSYPS-SDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDEE  1261
               HFS  +  +FLSFC+TCKK L+ K DI+IYRG+KAFCS  CR +E+L+D++
Sbjct  222   --HFSKSAPENFLSFCHTCKKNLEQKIDIYIYRGDKAFCSRECRYQEMLLDDK  272



>ref|XP_007157118.1| hypothetical protein PHAVU_002G044300g [Phaseolus vulgaris]
 gb|ESW29112.1| hypothetical protein PHAVU_002G044300g [Phaseolus vulgaris]
Length=266

 Score =   100 bits (248),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 88/160 (55%), Gaps = 16/160 (10%)
 Frame = +2

Query  827   HGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTH  1006
             H    + SQ++  +    NS+    +S  V  GS+S S++E+SEDYT V +HGPNP+ TH
Sbjct  116   HSTTVSPSQSLESVFGSANSALKPSKSSRVFMGSLSASEMEISEDYTRVISHGPNPRTTH  175

Query  1007  IFCDCILECHNNEFTNFSKNGEEENGLSKGPG---CCEEHFSYPSSDFLSFCYTCKKKL-  1174
             IF +CI+E    +F           G S  P        H SY +  F+SFC+ C K L 
Sbjct  176   IFDNCIVESGCFDF-----------GCSSSPMESVFLPPHTSYSTESFMSFCFCCNKNLG  224

Query  1175  DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDF  1294
                DI+IYRGE+AFCS  CR + +L++E   K  K GD +
Sbjct  225   QDMDIYIYRGERAFCSCECRDQGMLLEEGMCKL-KAGDVY  263



>ref|XP_003518913.1| PREDICTED: uncharacterized protein LOC100790354 [Glycine max]
 gb|KHN18871.1| hypothetical protein glysoja_028240 [Glycine soja]
Length=263

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 70/112 (63%), Gaps = 22/112 (20%)
 Frame = +2

Query  923   GSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPG  1102
             G ++ S++ELSE+YTCV  HGPNP+ THIF +CI+E + +              L   P 
Sbjct  163   GLMTLSEMELSEEYTCVIAHGPNPRTTHIFENCIVESYCS--------------LPNTPN  208

Query  1103  CCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILID  1255
                     PS +FLSFC+TCKK L+  KDIFIYRGEKAFCS  CR +E++ D
Sbjct  209   -------SPSLNFLSFCHTCKKHLEQTKDIFIYRGEKAFCSKECRHQEMVQD  253



>ref|XP_011030673.1| PREDICTED: uncharacterized protein LOC105130051 [Populus euphratica]
Length=329

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (65%), Gaps = 7/116 (6%)
 Frame = +2

Query  914   VPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSK  1093
             V  G +S S++ELSEDYTCV THGP PK THIF +CI+E        FS +  ++N    
Sbjct  197   VFTGCLSASEMELSEDYTCVITHGPVPKTTHIFDNCIVESCCGA-VGFSASSRKDNNRFL  255

Query  1094  GPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDE  1258
             G G      +Y S  FLSFC +CKK L+ GKD +IY G +AFCS+ CR++ ++++E
Sbjct  256   GDG-----LTYRSDSFLSFCSSCKKNLEQGKDNYIYGGGRAFCSNECRNQAMMLEE  306



>ref|XP_010541643.1| PREDICTED: uncharacterized protein LOC104815048 [Tarenaya hassleriana]
Length=373

 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 77/132 (58%), Gaps = 2/132 (2%)
 Frame = +2

Query  932   STSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTN--FSKNGEEENGLSKGPGC  1105
             S S+IELSEDYT V +HGPNPK TH + D ILE  +N   N  FS   E+++  +     
Sbjct  241   SESEIELSEDYTRVISHGPNPKTTHFYGDRILESLDNHGLNKGFSSFKEQKDLTTVSMPL  300

Query  1106  CEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGG  1285
              +    +P  +FLSFC  C K L G+DI++YRG  AFCS  CRS+ I+ DE+ ++     
Sbjct  301   TQPADGFPPENFLSFCNFCNKHLQGEDIYMYRGYIAFCSDECRSKGIIADEKTDEAALSA  360

Query  1286  DDFEKPNSREEP  1321
                    +R++P
Sbjct  361   KSVVSDKARKKP  372


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 95/168 (57%), Gaps = 11/168 (7%)
 Frame = +2

Query  152  MLRKRTRSQKDQQMGQLMPDSSSESHLSSGVFAQKHKVSSFFNVPALFVGL-NPKQSESD  328
            MLRKR RS +   M   + DS S    S     +  +  S F++P+LFV   N   SE+D
Sbjct  1    MLRKRNRSHQKHLM---VSDSDSCPGQSESSRLKNQRNGSIFSIPSLFVAFSNKGSSEND  57

Query  329  SVRSPTSPLEFRVFSTLSNTLR--SQRSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLP  502
            SV SPTSPL+FR+FS L N     S+   + HQKSW  +KVGLSI+D+LDD +   GN+ 
Sbjct  58   SVWSPTSPLDFRLFSGLRNPFAGSSKSVHQVHQKSWDSTKVGLSIVDSLDDAS---GNVL  114

Query  503  IPSKSKNIIFGPQMSCKTQNFLNHSDSFGAAKSLPKNIPIFPCTEPKP  646
              S+SKN++FG  M  K  N + ++          K+ P+FP +  KP
Sbjct  115  QSSESKNVLFGIGM--KFGNLIYNAPKVCELDHTLKDYPVFPQSLSKP  160



>ref|XP_004496710.1| PREDICTED: uncharacterized protein LOC101512717 isoform X2 [Cicer 
arietinum]
Length=262

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 79/136 (58%), Gaps = 21/136 (15%)
 Frame = +2

Query  857   VRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECH  1036
             V E+    N+ G       V  G +S S++ELSEDYT V +HGPNP+ THIF +CI+E  
Sbjct  139   VLEVETFNNTHG-------VFKGCLSASEMELSEDYTRVISHGPNPRTTHIFDNCIIESS  191

Query  1037  NNEF-TNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEK  1210
               EF   +S + +            E  + +P   FLS C+ CKK L+ GKDI++YRGE 
Sbjct  192   CFEFDVGYSASAK------------ESEYCFPCESFLSICFHCKKNLEQGKDIYMYRGEM  239

Query  1211  AFCSSSCRSEEILIDE  1258
             AFCS  CR++ +L +E
Sbjct  240   AFCSHECRNQGMLFEE  255



>gb|KDO68685.1| hypothetical protein CISIN_1g023402mg [Citrus sinensis]
 gb|KDO68686.1| hypothetical protein CISIN_1g023402mg [Citrus sinensis]
 gb|KDO68687.1| hypothetical protein CISIN_1g023402mg [Citrus sinensis]
 gb|KDO68688.1| hypothetical protein CISIN_1g023402mg [Citrus sinensis]
Length=282

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 82/141 (58%), Gaps = 24/141 (17%)
 Frame = +2

Query  866   LSKLGNSSGAKLRSMPVPAGSI------STSKIELSEDYTCVRTHGPNPKVTHIFCDCIL  1027
             LS  G+++ A   +   PA  I      S +++ELSE+YTCV  HGPNPK T IF +CI+
Sbjct  158   LSPSGSANSATQITKDPPAKVINCTECLSPTEMELSEEYTCVIAHGPNPKTTRIFDNCII  217

Query  1028  ECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRG  1204
             E     + + S +G              E  S P  +FLSFCYTCKK L+   DI+IYRG
Sbjct  218   E----SYCSVSDSG------------INESHSAP-ENFLSFCYTCKKNLEQTNDIYIYRG  260

Query  1205  EKAFCSSSCRSEEILIDEEKE  1267
             EKAFCS  CR +E+L D+E E
Sbjct  261   EKAFCSQECRYQEMLRDDEVE  281



>ref|XP_003632307.1| PREDICTED: uncharacterized protein LOC100855273 [Vitis vinifera]
 emb|CBI28710.3| unnamed protein product [Vitis vinifera]
Length=293

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 69/116 (59%), Gaps = 25/116 (22%)
 Frame = +2

Query  944   IELSEDYTCVRTHGPNPKVTHIFCDCILE-------CHNNEFTNFSKNGEEENGLSKGPG  1102
             +ELSE+YTCV +HGPNP+ THIF +CI+E          N +  F +N            
Sbjct  192   MELSEEYTCVISHGPNPRTTHIFDNCIVESCCGVSALSQNNYCTFPENPNS---------  242

Query  1103  CCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
                     P  +FLS C+TCKK L   +DI+IYRGEKAFCS  CRS+E+L DEE++
Sbjct  243   --------PPENFLSCCHTCKKNLSQERDIYIYRGEKAFCSHECRSQEMLFDEEED  290



>emb|CDY65610.1| BnaC05g51730D [Brassica napus]
Length=268

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 83/152 (55%), Gaps = 16/152 (11%)
 Frame = +2

Query  806   SGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHG  985
             S  FG +   N  +S +  E+ K    SG+ L S  +  G  STS++ELSEDYTCV  HG
Sbjct  129   SSDFGIKTK-NPPVSPSPEEMKK--TVSGSGLASPRIFTGYFSTSEMELSEDYTCVTCHG  185

Query  986   PNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCK  1165
             PNP+  HIF +CI+E         S +   E+               PS  FLS C  CK
Sbjct  186   PNPRTIHIFDNCIIESQPGVVLFRSSDPVNESDC------------LPSDSFLSTCCNCK  233

Query  1166  KKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
             K L  + DIF+YRG++AFCSS CRS E++ +E
Sbjct  234   KDLGPRDDIFMYRGDRAFCSSECRSLEMMSEE  265



>gb|KFK39549.1| hypothetical protein AALP_AA3G258500 [Arabis alpina]
Length=258

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 75/127 (59%), Gaps = 13/127 (10%)
 Frame = +2

Query  890   GAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNG  1069
             G+ L S  V  G  STS +ELSEDYTCV  HGPNP+  HIF +CI+E        F ++ 
Sbjct  142   GSGLGSGRVLPGYFSTSDMELSEDYTCVTCHGPNPRTIHIFDNCIVESQPG--VVFFRSS  199

Query  1070  EEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEI  1246
             +            E  +S P S FLS C  CKK L  + DIF+YRG++AFCSS CRS E+
Sbjct  200   DP---------ITESDYSQPDS-FLSSCCNCKKTLGPRDDIFMYRGDRAFCSSECRSLEM  249

Query  1247  LIDEEKE  1267
             + DEE +
Sbjct  250   MSDEEND  256



>ref|XP_002516241.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46243.1| conserved hypothetical protein [Ricinus communis]
Length=258

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 80/141 (57%), Gaps = 14/141 (10%)
 Frame = +2

Query  884   SSGAKLRSMPVPAG---SISTSKIELS--EDYTCVRTHGP-NPKVTHIFCDCILECHNNE  1045
             SS    RS P+P     S+    +E+   +DYT V THGP N  +T ++ D   + H   
Sbjct  91    SSNNTTRSDPIPVKIGLSLHKEMLEIDSLDDYTYVTTHGPDNKSMTKVYYDHGQKGHRR-  149

Query  1046  FTNFSKNGEEENGL------SKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGKDIFIYRGE  1207
                F    +   G+      +  P    +  +YP+SDFLS C+ CKKKL GKDI++YRGE
Sbjct  150   -IGFDSTTDNSFGVVSVIKETPAPARFVDEVAYPTSDFLSSCHLCKKKLHGKDIYMYRGE  208

Query  1208  KAFCSSSCRSEEILIDEEKEK  1270
             KAFCS+ CRS +I+IDE KE+
Sbjct  209   KAFCSAECRSRQIMIDERKEQ  229



>gb|ACU18495.1| unknown [Glycine max]
Length=249

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 82/132 (62%), Gaps = 10/132 (8%)
 Frame = +2

Query  848   SQNVRELSKLGNSSG--AKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDC  1021
             S++ + +++ GNSS   A   S  V  G +S S++ELSEDYT V + GPNP+ THIF +C
Sbjct  124   SESSKFVAEKGNSSSGVADANSQRVFMGCLSASEMELSEDYTRVISRGPNPRTTHIFDNC  183

Query  1022  ILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIY  1198
             I+E    E    S +  +EN      GC  +  SY S  FLS C+ CKK L  GKDI++Y
Sbjct  184   IIESSCFEL-GCSASSVKEN------GCFLDQTSYHSRSFLSVCFHCKKNLGQGKDIYMY  236

Query  1199  RGEKAFCSSSCR  1234
             RGE+AFCS+ CR
Sbjct  237   RGERAFCSNECR  248



>ref|XP_006444040.1| hypothetical protein CICLE_v10021541mg [Citrus clementina]
 ref|XP_006479696.1| PREDICTED: uncharacterized protein LOC102608049 isoform X1 [Citrus 
sinensis]
 ref|XP_006479697.1| PREDICTED: uncharacterized protein LOC102608049 isoform X2 [Citrus 
sinensis]
 gb|ESR57280.1| hypothetical protein CICLE_v10021541mg [Citrus clementina]
Length=282

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 82/141 (58%), Gaps = 24/141 (17%)
 Frame = +2

Query  866   LSKLGNSSGAKLRSMPVPAGSI------STSKIELSEDYTCVRTHGPNPKVTHIFCDCIL  1027
             LS  G+++ A   +   PA  I      S +++ELSE+YTCV  HGPNPK T IF +CI+
Sbjct  158   LSPSGSANSATQITKDPPAKVINCTECLSPTEMELSEEYTCVIAHGPNPKTTRIFDNCII  217

Query  1028  ECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRG  1204
             E     + + S +G              E  S P  +FLSFCYTCK+ L+   DI+IYRG
Sbjct  218   E----SYCSVSDSG------------INESHSTP-ENFLSFCYTCKRNLEQTNDIYIYRG  260

Query  1205  EKAFCSSSCRSEEILIDEEKE  1267
             EKAFCS  CR +E+L D+E E
Sbjct  261   EKAFCSQECRYQEMLRDDEVE  281



>emb|CDX93919.1| BnaC04g20780D [Brassica napus]
Length=239

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 83/154 (54%), Gaps = 28/154 (18%)
 Frame = +2

Query  800   LHSGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRT  979
             + S  FGT+ G  S +     +LS    +              ++ S+I+ +EDYTCV +
Sbjct  110   IPSADFGTKTGPTSQMRHPPGQLSPCLQTK------------VLTVSEIDQTEDYTCVIS  157

Query  980   HGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYT  1159
             HGPNP +THIF        N+ F       EE       P   E   +  ++DFLS CYT
Sbjct  158   HGPNPTITHIF-------DNSVFV------EEATPPCSLPLPQETKKT--NTDFLSNCYT  202

Query  1160  CKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
             CKKKLD K DI+IYRGEK FCSS CR +E+L+D+
Sbjct  203   CKKKLDQKQDIYIYRGEKGFCSSECRYQEMLLDQ  236



>ref|XP_004496711.1| PREDICTED: uncharacterized protein LOC101512717 isoform X3 [Cicer 
arietinum]
Length=267

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 74/120 (62%), Gaps = 14/120 (12%)
 Frame = +2

Query  905   SMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEF-TNFSKNGEEEN  1081
             S  V  G +S S++ELSEDYT V +HGPNP+ THIF +CI+E    EF   +S + +   
Sbjct  153   SQLVFKGCLSASEMELSEDYTRVISHGPNPRTTHIFDNCIIESSCFEFDVGYSASAK---  209

Query  1082  GLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILIDE  1258
                      E  + +P   FLS C+ CKK L+ GKDI++YRGE AFCS  CR++ +L +E
Sbjct  210   ---------ESEYCFPCESFLSICFHCKKNLEQGKDIYMYRGEMAFCSHECRNQGMLFEE  260



>gb|KHN35172.1| hypothetical protein glysoja_004938 [Glycine soja]
Length=259

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 72/121 (60%), Gaps = 16/121 (13%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCC  1108
              S S++ELSEDYT V +HGPNP+ THIF +CI+E  +  F     +   EN         
Sbjct  148   FSASEMELSEDYTRVISHGPNPRTTHIFDNCIIE--SRCFDVGCSSSPLENVF------L  199

Query  1109  EEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGG  1285
               H SYPS  F+SFC+ C K L  G DI++YRGE+AFCS  CR + ++++E       GG
Sbjct  200   PPHISYPSETFMSFCFYCNKNLGQGMDIYMYRGERAFCSRECRDQGMMLEE-------GG  252

Query  1286  D  1288
             D
Sbjct  253   D  253



>emb|CDX98213.1| BnaC07g08850D [Brassica napus]
Length=262

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 83/152 (55%), Gaps = 20/152 (13%)
 Frame = +2

Query  806   SGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHG  985
             S  FGT+   NS ++    E  K G      + S  +  G  STS++ELSEDYTCV  HG
Sbjct  127   SSDFGTKTK-NSPVAPPPEETKKAG------IGSTRIFTGYFSTSEMELSEDYTCVTCHG  179

Query  986   PNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCK  1165
             PNPK  HIF +CI+E  N     F ++ +  N          E    P   FLS C  CK
Sbjct  180   PNPKTIHIFGNCIVE--NQPGVVFFRSSDPVN----------ESDCIPPDSFLSSCCNCK  227

Query  1166  KKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
             K L  + DIF+YRG++AFCSS CRS E++ +E
Sbjct  228   KNLGPRDDIFMYRGDRAFCSSECRSLEMMSEE  259



>gb|EPS61768.1| hypothetical protein M569_13027 [Genlisea aurea]
Length=228

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 64/126 (51%), Gaps = 40/126 (32%)
 Frame = +2

Query  935   TSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEE  1114
             T  I+ SEDYTCVRTHGPNPKV HI+ D ILEC                           
Sbjct  136   TEMIQSSEDYTCVRTHGPNPKVVHIYRDRILECRRV------------------------  171

Query  1115  HFSYPSSDFLSFCYTCKKKLDGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTNKGGDDF  1294
                     FL FC +C KKLDG+D+++YRGEKAFCS  CR E +   E        GDD 
Sbjct  172   --------FLKFCDSCDKKLDGEDVYMYRGEKAFCSCGCRREAMKKFE--------GDDR  215

Query  1295  EKPNSR  1312
              KP +R
Sbjct  216   SKPTTR  221


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = +2

Query  266  SSFFNVPALFVGLNP-KQSESDSVRSPTSPLEFRVFSTLSNTLRSQRSSEGHQKSWGCS-  439
            ++   VP LFV  N    SE+DSVRSPTS L+FR+   LS T      S  H K+W CS 
Sbjct  12   AALLKVPGLFVAFNTSNNSEADSVRSPTSTLDFRI---LSRTPFPATGSSSH-KNWDCSE  67

Query  440  KVGLSIIDALDD  475
            KVGL I+D+LDD
Sbjct  68   KVGLGIVDSLDD  79



>gb|EEE62544.1| hypothetical protein OsJ_17342 [Oryza sativa Japonica Group]
Length=227

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 79/150 (53%), Gaps = 27/150 (18%)
 Frame = +2

Query  833   INSAISQNVRELSKL---GNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVT  1003
             +N  +     +L K    G+   +  R +P   GS+S +++E SEDYT +   GPNPK T
Sbjct  62    VNGGVHAAAADLGKFPATGSLPASIGRPLPQYIGSVSATEVEQSEDYTRIIARGPNPKTT  121

Query  1004  HIFCDCILE-CHNNEF-TNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD  1177
             HIF DCILE C  + +    S +G+E                         C +C KKLD
Sbjct  122   HIFGDCILEPCTESYWLVKLSGSGDE---------------------LRRLCSSC-KKLD  159

Query  1178  GKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             G D+  YRGEKAFCS  CR +EILI++E+E
Sbjct  160   GSDLCFYRGEKAFCSGDCREQEILIEDEEE  189



>gb|AAW57809.1| unknown protein [Oryza sativa Japonica Group]
Length=327

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 79/150 (53%), Gaps = 27/150 (18%)
 Frame = +2

Query  833   INSAISQNVRELSKL---GNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVT  1003
             +N  +     +L K    G+   +  R +P   GS+S +++E SEDYT +   GPNPK T
Sbjct  162   VNGGVHAAAADLGKFPATGSLPASIGRPLPQYIGSVSATEVEQSEDYTRIIARGPNPKTT  221

Query  1004  HIFCDCILE-CHNNEF-TNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD  1177
             HIF DCILE C  + +    S +G+E                         C +C KKLD
Sbjct  222   HIFGDCILEPCTESYWLVKLSGSGDE---------------------LRRLCSSC-KKLD  259

Query  1178  GKDIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             G D+  YRGEKAFCS  CR +EILI++E+E
Sbjct  260   GSDLCFYRGEKAFCSGDCREQEILIEDEEE  289



>ref|XP_009145313.1| PREDICTED: uncharacterized protein LOC103869027 [Brassica rapa]
 ref|XP_009145314.1| PREDICTED: uncharacterized protein LOC103869027 [Brassica rapa]
Length=268

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 83/152 (55%), Gaps = 16/152 (11%)
 Frame = +2

Query  806   SGSFGTEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHG  985
             S  FG +   N  +S    E+ K    SG+ L S  +  G  STS +ELSEDYTCV  HG
Sbjct  129   SSDFGIKTK-NHPVSPPPEEMKK--TVSGSGLASPRIFTGYFSTSDMELSEDYTCVTCHG  185

Query  986   PNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCK  1165
             PNP+  HIF +CI+E        F ++ +  N          E    PS  FLS C  CK
Sbjct  186   PNPRTIHIFDNCIVESQPG--VVFFRSSDPLN----------ESDCLPSDSFLSTCCNCK  233

Query  1166  KKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
             K L  + DIF+YRG++AFCSS CRS E++ +E
Sbjct  234   KNLGPRDDIFMYRGDRAFCSSECRSLEMMSEE  265



>ref|XP_004495187.1| PREDICTED: uncharacterized protein LOC101500639 [Cicer arietinum]
Length=240

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 64/105 (61%), Gaps = 22/105 (21%)
 Frame = +2

Query  944   IELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFS  1123
             +ELSE+YTCV +HGPNP+ THIF +C++E                         C    S
Sbjct  153   MELSEEYTCVISHGPNPRTTHIFDNCVVEME---------------------SYCYVPNS  191

Query  1124  YPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEILID  1255
             + S +FL+FCYTCK  L+  KDIFIYRGEKAFCS  CR +E+++D
Sbjct  192   HSSMNFLNFCYTCKNHLEHTKDIFIYRGEKAFCSQECRHQEMVLD  236



>ref|XP_006399652.1| hypothetical protein EUTSA_v10014059mg [Eutrema salsugineum]
 gb|ESQ41105.1| hypothetical protein EUTSA_v10014059mg [Eutrema salsugineum]
Length=335

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 66/106 (62%), Gaps = 3/106 (3%)
 Frame = +2

Query  938   SKIELSEDYTCVRTHGPNPKVTHIFCDCILEC--HNNEFTNFSKNGEEENGLSKGPGCCE  1111
             S IE+SEDYTCV +HGPNPK TH + D +LE   H     +  +N +E   +        
Sbjct  192   SDIEISEDYTCVISHGPNPKTTHFYGDLVLESLEHYGIKKDCCENKKESIFVISPLDLTT  251

Query  1112  EHFSYPSSDFLSFCYTCKKKLD-GKDIFIYRGEKAFCSSSCRSEEI  1246
                  PS+DFLSFC  C KKLD GKDI++YRG KAFCSS CRSE I
Sbjct  252   TDDVLPSNDFLSFCCFCSKKLDMGKDIYMYRGYKAFCSSECRSEVI  297


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 59/109 (54%), Gaps = 7/109 (6%)
 Frame = +2

Query  236  SGVFAQKHKVSSFFNVPALFVGLNPKQSESDSVRSPTSPLEFRVFSTLSNTL-----RSQ  400
            S +++ K  +S   N   +      K    ++  SPTSPL+FR+FS+L N       RS 
Sbjct  13   SDIYSTKPGLSGLKNHKMISGVFEAKSPSDETAWSPTSPLDFRLFSSLGNPFGGSSSRSI  72

Query  401  RSSEGHQKSWGCSKVGLSIIDALDDKTKRLGNLPIPS-KSKNIIFGPQM  544
            R    HQKSW   KVGLSI+D+LDD       + +PS  SKN+IFG  M
Sbjct  73   RKVV-HQKSWDSGKVGLSIVDSLDDHHTDSSRILLPSPDSKNMIFGSWM  120



>ref|XP_006406148.1| hypothetical protein EUTSA_v10021330mg [Eutrema salsugineum]
 ref|XP_006406149.1| hypothetical protein EUTSA_v10021330mg [Eutrema salsugineum]
 gb|ESQ47601.1| hypothetical protein EUTSA_v10021330mg [Eutrema salsugineum]
 gb|ESQ47602.1| hypothetical protein EUTSA_v10021330mg [Eutrema salsugineum]
Length=267

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 80/142 (56%), Gaps = 15/142 (11%)
 Frame = +2

Query  836   NSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFC  1015
             NS IS +  E  K+   SG+ L S  +  G  STS +ELSE+YTCV  HGPNP+  HIF 
Sbjct  137   NSPISPSPEETMKM--VSGSGLGSPRIFTGYFSTSDMELSEEYTCVTCHGPNPRTIHIFD  194

Query  1016  DCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGK-DIF  1192
             +CI+E        F ++ +  N          E    P   FLS C  CKK L  + DIF
Sbjct  195   NCIVESQPG--VVFFRSSDPVN----------ESDYLPPESFLSTCCNCKKNLGPRDDIF  242

Query  1193  IYRGEKAFCSSSCRSEEILIDE  1258
             +YRG++AFCSS CRS E++ +E
Sbjct  243   MYRGDRAFCSSECRSLEMMSEE  264



>gb|KHN30484.1| hypothetical protein glysoja_033222 [Glycine soja]
Length=261

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 76/126 (60%), Gaps = 16/126 (13%)
 Frame = +2

Query  929   ISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENGLSKGP---  1099
              S S++ELSEDYT V +HGPNP+ THI+ +CI+E           +G  + G S  P   
Sbjct  144   FSASEMELSEDYTRVISHGPNPRTTHIYDNCIVE-----------SGCFDVGCSSSPLEN  192

Query  1100  GCCEEHFSYPSSDFLSFCYTCKKKL-DGKDIFIYRGEKAFCSSSCRSEEILIDEEKEKTN  1276
                  H SYPS  F+SFC+ C K L    DI++YRGE+AFCS  CR++ +L++E   K  
Sbjct  193   VFLPPHISYPSESFMSFCFYCNKNLGQDMDIYMYRGERAFCSRECRNQGMLLEEGMIKL-  251

Query  1277  KGGDDF  1294
             +GGD +
Sbjct  252   EGGDMY  257



>ref|XP_007200454.1| hypothetical protein PRUPE_ppa008958mg [Prunus persica]
 gb|EMJ01653.1| hypothetical protein PRUPE_ppa008958mg [Prunus persica]
Length=312

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 66/119 (55%), Gaps = 22/119 (18%)
 Frame = +2

Query  905   SMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNGEEENG  1084
             S   P G  S S++ELSEDYTCV + GPNP+ THIF +CI+E   +     S        
Sbjct  201   SAQAPTGCASVSEMELSEDYTCVISRGPNPRTTHIFDNCIVESFYSLSDQSSSASVSFL-  259

Query  1085  LSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEILIDE  1258
                                 SFCYTCKK L+ K DI+IYRGEKAFCS  CR +E+L+DE
Sbjct  260   --------------------SFCYTCKKNLEQKNDIYIYRGEKAFCSRECRYQEMLLDE  298



>ref|XP_006651664.1| PREDICTED: uncharacterized protein LOC102710774 [Oryza brachyantha]
Length=326

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 81/141 (57%), Gaps = 13/141 (9%)
 Frame = +2

Query  839   SAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCD  1018
             +A+S   R L ++ +S  A++ +     G++S  ++ +SEDYTCV + GPNP+ THIF D
Sbjct  192   AALSPARRFLPEVVSSPSARVFA----GGAVSPGEMAMSEDYTCVISRGPNPRTTHIFDD  247

Query  1019  CILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLD-GKDIFI  1195
             CI+E   +           E           +  +  ++ FL+ CY C K+L  G DIFI
Sbjct  248   CIVESCGDVLV--------EKMDGVAGAGAGDGDAVRTNGFLNSCYACNKRLGHGNDIFI  299

Query  1196  YRGEKAFCSSSCRSEEILIDE  1258
             YRG+KAFCSS CR +E+L DE
Sbjct  300   YRGDKAFCSSECRYQEMLFDE  320



>ref|XP_006298348.1| hypothetical protein CARUB_v10014416mg [Capsella rubella]
 gb|EOA31246.1| hypothetical protein CARUB_v10014416mg [Capsella rubella]
Length=263

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 83/147 (56%), Gaps = 12/147 (8%)
 Frame = +2

Query  821   TEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKV  1000
             ++ GI +  SQ     +K+  + G+ L S  + +G  S S +ELSEDYTCV  HGPNP+ 
Sbjct  124   SDFGIKTRNSQPETTTTKIP-TPGSGLGSPRIISGYFSASDMELSEDYTCVTCHGPNPRT  182

Query  1001  THIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDG  1180
              HIF +CI+E        F ++ +  N          +  S+P   FLS C  CKK L  
Sbjct  183   IHIFDNCIVESQPG--VVFFRSSDPVNE--------SDSDSFPPDSFLSSCCNCKKSLGP  232

Query  1181  K-DIFIYRGEKAFCSSSCRSEEILIDE  1258
             + DIF+YRG++AFCSS CR  E++ +E
Sbjct  233   RDDIFMYRGDRAFCSSECRELEMMTEE  259



>ref|NP_188894.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM20565.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91275.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76652.1| uncharacterized protein AT3G22550 [Arabidopsis thaliana]
Length=267

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 85/150 (57%), Gaps = 15/150 (10%)
 Frame = +2

Query  821   TEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKV  1000
             ++ GI +  SQ   E  K G+ SG  L S  + +G    S +ELSEDYTCV  HGPNP+ 
Sbjct  130   SDFGIKTRNSQP--ETKKPGSESG--LGSPRIISGYFPASDMELSEDYTCVTCHGPNPRT  185

Query  1001  THIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDG  1180
              HIF +CI+E         S +   E+         +  +S P S FLS C  CKK L  
Sbjct  186   IHIFDNCIVESQPGVVFFRSSDPVNES---------DSDYSPPDS-FLSCCCNCKKSLGP  235

Query  1181  K-DIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             + DIF+YRG++AFCSS CRS E+++ EE +
Sbjct  236   RDDIFMYRGDRAFCSSECRSIEMMMSEEND  265



>dbj|BAB01470.1| unnamed protein product [Arabidopsis thaliana]
Length=255

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 85/150 (57%), Gaps = 15/150 (10%)
 Frame = +2

Query  821   TEHGINSAISQNVRELSKLGNSSGAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKV  1000
             ++ GI +  SQ   E  K G+ SG  L S  + +G    S +ELSEDYTCV  HGPNP+ 
Sbjct  118   SDFGIKTRNSQP--ETKKPGSESG--LGSPRIISGYFPASDMELSEDYTCVTCHGPNPRT  173

Query  1001  THIFCDCILECHNNEFTNFSKNGEEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDG  1180
              HIF +CI+E         S +   E+         +  +S P S FLS C  CKK L  
Sbjct  174   IHIFDNCIVESQPGVVFFRSSDPVNES---------DSDYSPPDS-FLSCCCNCKKSLGP  223

Query  1181  K-DIFIYRGEKAFCSSSCRSEEILIDEEKE  1267
             + DIF+YRG++AFCSS CRS E+++ EE +
Sbjct  224   RDDIFMYRGDRAFCSSECRSIEMMMSEEND  253



>ref|XP_009135815.1| PREDICTED: uncharacterized protein LOC103859963 [Brassica rapa]
Length=264

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 71/124 (57%), Gaps = 13/124 (10%)
 Frame = +2

Query  890   GAKLRSMPVPAGSISTSKIELSEDYTCVRTHGPNPKVTHIFCDCILECHNNEFTNFSKNG  1069
             G+ L S  +  G  STS +ELSEDYTCV  HGPNP+  HIF +CI+E         SK G
Sbjct  150   GSGLGSARIFTGYFSTSDMELSEDYTCVTCHGPNPRTIHIFDNCIVE---------SKPG  200

Query  1070  EEENGLSKGPGCCEEHFSYPSSDFLSFCYTCKKKLDGK-DIFIYRGEKAFCSSSCRSEEI  1246
                    +      E +  P   FLS C  CKK L  + DIFIYRG++AFCSS CRS E+
Sbjct  201   V---VFFRRSDPVHESYHLPPDSFLSTCCNCKKNLGPRDDIFIYRGDRAFCSSECRSLEM  257

Query  1247  LIDE  1258
             + +E
Sbjct  258   MSEE  261



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5097750019822