BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83174_g1_i1 len=778 path=[1:0-777]

Length=778
                                                                      Score     E

ref|XP_011088260.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    478   2e-163   
prf||1908371C  nitrite reductase                                        465   8e-162
emb|CAA46941.1|  ferredoxin--nitrite reductase                          465   8e-162   Nicotiana tabacum [American tobacco]
ref|XP_004230820.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    473   1e-161   
emb|CAA46942.1|  ferredoxin--nitrite reductase                          468   1e-161   Nicotiana tabacum [American tobacco]
gb|KDP42275.1|  hypothetical protein JCGZ_01599                         471   1e-160   
ref|NP_001275023.1|  ferredoxin--nitrite reductase, chloroplastic...    470   1e-160   
prf||1908371B  nitrite reductase                                        464   4e-160
dbj|BAD15363.1|  nitrite reductase                                      469   6e-160   Nicotiana tabacum [American tobacco]
ref|XP_009776470.1|  PREDICTED: LOW QUALITY PROTEIN: ferredoxin--...    468   6e-160   
ref|XP_009628648.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    468   9e-160   
pdb|3B0G|A  Chain A, Assimilatory Nitrite Reductase (Nii3) From T...    467   3e-159   
gb|ABK95605.1|  unknown                                                 467   3e-159   Populus trichocarpa [western balsam poplar]
ref|XP_009628462.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    467   3e-159   
emb|CDY69481.1|  BnaCnng63770D                                          462   3e-159   
ref|XP_006384408.1|  Ferredoxin--nitrite reductase family protein       467   4e-159   
pdb|3B0N|A  Chain A, Q448k Mutant Of Assimilatory Nitrite Reducta...    467   4e-159   
ref|XP_009783559.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    466   8e-159   
dbj|BAD15364.1|  nitrite reductase                                      466   8e-159   Nicotiana tabacum [American tobacco]
pdb|3VLX|A  Chain A, Assimilatory Nitrite Reductase (Nii3) - N226...    465   2e-158   
emb|CDP17819.1|  unnamed protein product                                465   2e-158   
emb|CAA46940.1|  ferredoxin--nitrite reductase                          465   2e-158   Nicotiana tabacum [American tobacco]
ref|XP_006409539.1|  hypothetical protein EUTSA_v10022613mg             465   2e-158   
pdb|3B0H|A  Chain A, Assimilatory Nitrite Reductase (Nii4) From T...    465   2e-158   
ref|XP_010517336.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    464   3e-158   
pdb|3B0M|A  Chain A, M175k Mutant Of Assimilatory Nitrite Reducta...    464   4e-158   
ref|XP_006349625.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    464   5e-158   
ref|XP_010488973.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    464   6e-158   
emb|CBI32406.3|  unnamed protein product                                461   6e-158   
pdb|3B0J|A  Chain A, M175e Mutant Of Assimilatory Nitrite Reducta...    464   7e-158   
pdb|3B0L|A  Chain A, M175g Mutant Of Assimilatory Nitrite Reducta...    463   7e-158   
prf||1908371A  nitrite reductase                                        463   1e-157
emb|CDY37232.1|  BnaA09g08530D                                          463   1e-157   
ref|XP_011005977.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    463   1e-157   
ref|XP_006297287.1|  hypothetical protein CARUB_v10013302mg             462   2e-157   
ref|NP_179164.1|  Ferredoxin--nitrite reductase                         461   6e-157   Arabidopsis thaliana [mouse-ear cress]
emb|CDX71230.1|  BnaC07g05090D                                          461   6e-157   
gb|AAN31831.1|  putative ferredoxin--nitrite reductase                  461   7e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123250.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    462   9e-157   
emb|CDY36642.1|  BnaA07g04150D                                          461   9e-157   
gb|KFK40026.1|  hypothetical protein AALP_AA3G320500                    460   1e-156   
ref|XP_009119404.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    460   1e-156   
ref|XP_010467309.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    460   1e-156   
ref|XP_002883906.1|  hypothetical protein ARALYDRAFT_899777             460   2e-156   
ref|XP_010548020.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    460   2e-156   
gb|AGQ43559.1|  nitrite reductase                                       459   6e-156   
gb|EYU37674.1|  hypothetical protein MIMGU_mgv1a003340mg                459   7e-156   
gb|AAN31830.1|  putative ferredoxin--nitrite reductase                  458   1e-155   Arabidopsis thaliana [mouse-ear cress]
gb|KDO59703.1|  hypothetical protein CISIN_1g047572mg                   457   2e-155   
gb|ADJ68001.1|  nitrite reductase protein                               457   2e-155   
ref|XP_004140695.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    457   3e-155   
ref|NP_001274384.1|  nitrate reductase precursor                        457   4e-155   
gb|KHN37511.1|  Ferredoxin--nitrite reductase, chloroplastic            456   7e-155   
ref|XP_002518763.1|  Ferredoxin--nitrite reductase, chloroplast p...    456   7e-155   Ricinus communis
ref|XP_004248736.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    456   7e-155   
ref|XP_008456121.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    456   8e-155   
ref|XP_007201180.1|  hypothetical protein PRUPE_ppa003315mg             456   9e-155   
ref|XP_006423019.1|  hypothetical protein CICLE_v10028067mg             456   1e-154   
ref|XP_003529397.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    456   1e-154   
ref|XP_004163915.1|  PREDICTED: LOW QUALITY PROTEIN: ferredoxin--...    454   3e-154   
ref|XP_010107937.1|  Ferredoxin--nitrite reductase                      454   3e-154   
ref|XP_010028471.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    454   5e-154   
dbj|BAB55003.1|  nitrite reductase                                      452   5e-154   Prunus persica
ref|XP_007042430.1|  Ferredoxin--nitrite reductase, chloroplastic       452   5e-154   
gb|AAC17127.1|  nitrite reductase                                       454   6e-154   Capsicum annuum
ref|XP_006487107.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    454   8e-154   
ref|XP_008236500.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    452   1e-153   
gb|AIR07815.1|  nitrite reductase                                       446   2e-153   
gb|ABR13308.1|  putative nitrite reductase                              439   5e-153   Prunus dulcis [sweet almond]
ref|XP_010530781.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    450   2e-152   
gb|ACD13218.1|  nitrite reductase                                       450   2e-152   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009417626.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    449   4e-152   
ref|XP_009346246.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    447   1e-151   
ref|XP_010263547.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    448   1e-151   
gb|AAB50233.1|  nitrite reductase                                       447   2e-151   Glycine max [soybeans]
ref|XP_004505220.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    446   5e-151   
ref|XP_004294803.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    445   1e-150   
ref|XP_008373138.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    444   5e-150   
ref|XP_003607969.1|  Ferredoxin-nitrite reductase                       443   6e-150   
emb|CAC06095.1|  ferredoxin-nitrite reductase                           443   7e-150   Lotus japonicus
ref|XP_007156512.1|  hypothetical protein PHAVU_003G292100g             442   1e-149   
gb|AAA74456.1|  nitrite reductase                                       442   1e-149   Phaseolus vulgaris [French bean]
sp|P38500.1|NIR_BETPN  RecName: Full=Ferredoxin--nitrite reductas...    442   2e-149   Betula pendula [white birch]
gb|AGO67239.1|  ferredoxin--nitrite reductase                           441   5e-149   
ref|XP_008778364.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    436   9e-149   
gb|AEW90647.1|  nitrite reductase                                       434   2e-148   
sp|P05314.1|NIR_SPIOL  RecName: Full=Ferredoxin--nitrite reductas...    439   4e-148   Spinacia oleracea
pdb|2AKJ|A  Chain A, Structure Of Spinach Nitrite Reductase             439   5e-148   
ref|XP_010943064.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    436   8e-147   
ref|XP_010675576.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    435   1e-146   
gb|ADN97117.1|  nitrite reductase                                       434   3e-146   
ref|NP_001268194.1|  ferredoxin--nitrite reductase, chloroplastic...    434   5e-146   
emb|CDY72359.1|  BnaA07g36300D                                          427   8e-146   
gb|EMT07001.1|  putative Ferredoxin--nitrite reductase, chloropla...    426   7e-145   
gb|EPS71034.1|  hypothetical protein M569_03724                         430   1e-144   
gb|ACL13515.1|  ferredoxin-nitrite reductase precursor                  426   6e-143   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004954025.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    426   6e-143   
gb|ACL13516.1|  ferredoxin-nitrite reductase precursor                  426   7e-143   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK02992.1|  predicted protein                                      426   8e-143   
gb|AFW64354.1|  hypothetical protein ZEAMMB73_724678                    421   9e-143   
gb|AFW73584.1|  hypothetical protein ZEAMMB73_832658                    423   8e-142   
ref|XP_006647964.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    422   1e-141   
gb|AAA60450.1|  nitrite reductase                                       420   4e-141   Zea mays [maize]
ref|XP_003570568.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    421   4e-141   
gb|ACG29734.1|  ferredoxin--nitrite reductase                           421   5e-141   Zea mays [maize]
sp|P17847.1|NIR_MAIZE  RecName: Full=Ferredoxin--nitrite reductas...    420   5e-141   Zea mays [maize]
ref|XP_008679282.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    421   6e-141   
ref|XP_008646302.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    422   1e-140   
sp|Q42997.1|NIR_ORYSJ  RecName: Full=Ferredoxin--nitrite reductas...    419   3e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454602.1|  hypothetical protein SORBIDRAFT_04g034160          419   3e-140   Sorghum bicolor [broomcorn]
gb|EEC70619.1|  hypothetical protein OsI_01871                          419   4e-140   Oryza sativa Indica Group [Indian rice]
ref|NP_001043008.1|  Os01g0357100                                       415   7e-139   Oryza sativa Japonica Group [Japonica rice]
gb|EEE57859.1|  hypothetical protein OsJ_08501                          409   2e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002987413.1|  hypothetical protein SELMODRAFT_183174             410   7e-137   
ref|XP_002979935.1|  hypothetical protein SELMODRAFT_178021             410   1e-136   
gb|AHZ35168.1|  nitrite reductase                                       398   1e-136   
ref|XP_006826233.1|  hypothetical protein AMTR_s00132p00099120          404   8e-135   
dbj|BAD53072.1|  putative ferredoxin--nitrite reductase, chloropl...    404   7e-134   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74060.1|  hypothetical protein OsI_09059                          403   1e-133   Oryza sativa Indica Group [Indian rice]
ref|XP_001777025.1|  predicted protein                                  387   1e-127   
ref|XP_001775824.1|  predicted protein                                  382   1e-125   
gb|EMS54112.1|  Ferredoxin--nitrite reductase, chloroplastic            370   1e-124   
dbj|BAE46577.1|  nitrite reductase                                      345   2e-116   Solanum lycopersicum
dbj|BAE48314.1|  nitrite reductase                                      345   2e-115   Capsicum annuum
dbj|BAE46575.1|  nitrite reductase                                      341   7e-115   Physalis alkekengi [Chinese-lantern]
dbj|BAE46578.1|  nitrite reductase                                      332   3e-111   Solanum lycopersicum
ref|XP_001419920.1|  predicted protein                                  332   7e-106   Ostreococcus lucimarinus CCE9901
ref|XP_003081527.1|  Nii, plastid-targeted nitrite reductase apoe...    332   6e-103   
ref|WP_015179108.1|  assimilatory nitrite reductase (ferredoxin) ...    312   2e-98    
ref|WP_006632844.1|  ferredoxin-nitrite reductase                       310   2e-97    
ref|WP_009632002.1|  precorrin-3B synthase                              304   1e-96    
ref|WP_011057189.1|  ferredoxin-nitrite reductase                       304   2e-96    
ref|XP_009625017.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    293   3e-96    
ref|XP_002507511.1|  nadh-nitrite reductase                             315   3e-96    Micromonas commoda
ref|WP_009783247.1|  ferredoxin-nitrite reductase                       302   6e-96    
ref|WP_007355409.1|  MULTISPECIES: ferredoxin-nitrite reductase         303   6e-96    
gb|ABW80920.1|  ferredoxin--nitrite reductase                           302   7e-96    uncultured bacterium
ref|WP_011431706.1|  ferredoxin-nitrite reductase                       302   7e-96    
ref|WP_011429510.1|  ferredoxin-nitrite reductase                       302   1e-95    
ref|WP_015142945.1|  precorrin-3B synthase                              301   1e-95    
ref|WP_015196742.1|  assimilatory nitrite reductase (ferredoxin) ...    301   2e-95    
ref|XP_003057941.1|  nitrite reductase fusion with b5r chloroplas...    312   4e-95    
ref|WP_017288935.1|  hypothetical protein                               304   4e-95    
ref|WP_008189055.1|  ferredoxin-nitrite reductase                       300   7e-95    
ref|WP_015188381.1|  assimilatory nitrite reductase (ferredoxin) ...    299   1e-94    
ref|WP_023068951.1|  precorrin-3B synthase                              299   2e-94    
ref|WP_039741277.1|  ferredoxin--nitrite reductase                      298   3e-94    
ref|WP_015213651.1|  assimilatory nitrite reductase (ferredoxin) ...    298   5e-94    
ref|WP_010873675.1|  ferredoxin-nitrite reductase                       297   7e-94    
ref|WP_022609023.1|  precorrin-3B synthase                              297   8e-94    
ref|WP_015155568.1|  assimilatory nitrite reductase (ferredoxin) ...    297   1e-93    
ref|WP_017321046.1|  ferredoxin-nitrite reductase                       297   1e-93    
ref|WP_017324212.1|  ferredoxin-nitrite reductase                       296   2e-93    
ref|WP_015170815.1|  assimilatory nitrite reductase (ferredoxin) ...    296   2e-93    
ref|WP_009626422.1|  assimilatory nitrite reductase (ferredoxin) ...    296   3e-93    
ref|WP_009554639.1|  assimilatory nitrite reductase (ferredoxin) ...    296   3e-93    
gb|AIE74568.1|  Ferredoxin--nitrite reductase                           295   4e-93    
ref|WP_026093421.1|  ferredoxin--nitrite reductase                      295   5e-93    
ref|WP_015113079.1|  assimilatory nitrite reductase (ferredoxin) ...    295   5e-93    
ref|WP_017713849.1|  hypothetical protein                               294   1e-92    
ref|WP_027844528.1|  ferredoxin--nitrite reductase                      294   1e-92    
ref|WP_015180235.1|  assimilatory nitrite reductase (ferredoxin) ...    293   2e-92    
ref|WP_011610823.1|  ferredoxin-nitrite reductase                       293   2e-92    
ref|WP_017315401.1|  ferredoxin-nitrite reductase                       294   2e-92    
ref|WP_039730005.1|  ferredoxin--nitrite reductase                      293   3e-92    
ref|WP_035155292.1|  ferredoxin--nitrite reductase                      292   5e-92    
ref|WP_015204592.1|  assimilatory nitrite reductase (ferredoxin) ...    296   6e-92    
ref|WP_017301382.1|  hypothetical protein                               293   6e-92    
ref|WP_036030858.1|  ferredoxin--nitrite reductase                      293   6e-92    
ref|WP_017748019.1|  ferredoxin-nitrite reductase                       293   9e-92    
ref|WP_015165563.1|  assimilatory nitrite reductase (ferredoxin) ...    291   1e-91    
ref|WP_035994508.1|  ferredoxin--nitrite reductase                      291   1e-91    
ref|WP_011242624.1|  ferredoxin-nitrite reductase                       291   2e-91    
ref|WP_016861627.1|  ferredoxin-nitrite reductase                       291   2e-91    
ref|WP_010994783.1|  ferredoxin-nitrite reductase                       291   2e-91    
ref|WP_026732020.1|  ferredoxin--nitrite reductase                      291   3e-91    
ref|WP_024124217.1|  assimilatory ferredoxin-nitrite reductase NirA     290   3e-91    
ref|XP_007514721.1|  nitrite reductase                                  302   3e-91    
ref|WP_011321208.1|  ferredoxin-nitrite reductase                       291   4e-91    
ref|WP_021834814.1|  Ferredoxin--nitrite reductase                      290   4e-91    
ref|WP_029315006.1|  ferredoxin--nitrite reductase                      293   4e-91    
ref|WP_012163413.1|  ferredoxin-nitrite reductase                       293   6e-91    
ref|WP_039714131.1|  ferredoxin--nitrite reductase                      290   7e-91    
ref|WP_002781418.1|  Ferredoxin--nitrite reductase                      289   9e-91    
ref|WP_029633456.1|  ferredoxin--nitrite reductase [                    290   9e-91    
ref|WP_002760022.1|  ferredoxin-nitrite reductase                       289   9e-91    
ref|WP_006275773.1|  ferredoxin-nitrite reductase                       290   1e-90    
ref|WP_002797849.1|  ferredoxin-nitrite reductase                       289   1e-90    
ref|WP_012408235.1|  ferredoxin-nitrite reductase                       289   1e-90    
ref|WP_015230746.1|  precorrin-3B synthase                              288   2e-90    
ref|WP_006457363.1|  ferredoxin-nitrite reductase                       288   2e-90    
ref|WP_015166928.1|  sulfite reductase subunit beta (hemoprotein)       288   2e-90    
ref|WP_002775642.1|  ferredoxin-nitrite reductase                       288   2e-90    
ref|WP_012265139.1|  ferredoxin-nitrite reductase                       288   2e-90    
ref|WP_016868536.1|  ferredoxin-nitrite reductase                       289   3e-90    
ref|WP_007310897.1|  ferredoxin-nitrite reductase                       288   3e-90    
dbj|GAL93751.1|  ferredoxin--nitrite reductase                          288   3e-90    
ref|WP_002733445.1|  ferredoxin--nitrite reductase                      288   3e-90    
ref|WP_023076501.1|  ferredoxin-nitrite reductase                       291   3e-90    
ref|WP_009455119.1|  ferredoxin-nitrite reductase                       288   3e-90    
emb|CCQ65638.1|  Ferredoxin--nitrite reductase                          288   3e-90    
ref|WP_013323579.1|  ferredoxin-nitrite reductase                       288   3e-90    
ref|WP_008196112.1|  ferredoxin-nitrite reductase                       287   4e-90    
ref|WP_015224664.1|  assimilatory nitrite reductase (ferredoxin) ...    287   5e-90    
ref|WP_015140514.1|  sulfite reductase subunit beta (hemoprotein)       288   5e-90    
ref|WP_002752582.1|  ferredoxin-nitrite reductase                       287   5e-90    
ref|WP_026722911.1|  ferredoxin--nitrite reductase                      288   5e-90    
ref|WP_016515805.1|  Sulfite reductase [ferredoxin]                     287   5e-90    
ref|WP_024969723.1|  ferredoxin--nitrite reductase                      287   6e-90    
ref|WP_012599063.1|  ferredoxin-nitrite reductase                       287   6e-90    
ref|WP_027254353.1|  ferredoxin--nitrite reductase                      287   6e-90    
ref|WP_021829137.1|  Ferredoxin--nitrite reductase                      287   6e-90    
ref|WP_017653159.1|  ferredoxin-nitrite reductase                       288   7e-90    
ref|WP_018399279.1|  ferredoxin-nitrite reductase                       287   7e-90    
ref|WP_026787877.1|  ferredoxin--nitrite reductase                      287   7e-90    
ref|WP_006515230.1|  assimilatory nitrite reductase (ferredoxin) ...    290   7e-90    
ref|WP_006196192.1|  ferredoxin-nitrite reductase                       287   8e-90    
ref|WP_002749321.1|  ferredoxin--nitrite reductase                      286   9e-90    
ref|WP_012595745.1|  MULTISPECIES: ferredoxin-nitrite reductase         286   1e-89    
ref|WP_015152056.1|  assimilatory nitrite reductase (ferredoxin) ...    290   1e-89    
ref|WP_017304788.1|  ferredoxin-nitrite reductase                       286   1e-89    
ref|WP_017660780.1|  hypothetical protein                               286   1e-89    
ref|WP_015116722.1|  assimilatory nitrite reductase (ferredoxin) ...    286   1e-89    
ref|WP_016877347.1|  ferredoxin-nitrite reductase                       287   2e-89    
ref|WP_026795180.1|  MULTISPECIES: ferredoxin--nitrite reductase        286   2e-89    
ref|WP_002789471.1|  ferredoxin-nitrite reductase                       286   2e-89    
ref|WP_016871793.1|  ferredoxin-nitrite reductase                       286   2e-89    
ref|WP_004268302.1|  ferredoxin-nitrite reductase                       285   2e-89    
ref|WP_007305636.1|  ferredoxin-nitrite reductase                       285   3e-89    
ref|WP_002765435.1|  ferredoxin-nitrite reductase                       285   3e-89    
ref|WP_038087531.1|  ferredoxin--nitrite reductase                      286   3e-89    
ref|WP_015209003.1|  sulfite reductase, beta subunit (hemoprotein)      285   5e-89    
ref|WP_009344167.1|  ferredoxin-nitrite reductase                       285   6e-89    
ref|WP_015123833.1|  assimilatory nitrite reductase (ferredoxin) ...    285   7e-89    
ref|WP_012629926.1|  ferredoxin-nitrite reductase                       285   7e-89    
ref|WP_015081559.1|  ferredoxin-nitrite reductase                       284   8e-89    
ref|WP_015218171.1|  assimilatory nitrite reductase (ferredoxin) ...    284   9e-89    
ref|WP_002792330.1|  ferredoxin-nitrite reductase                       284   1e-88    
gb|KEI67697.1|  NirA                                                    283   2e-88    
ref|WP_015180229.1|  precorrin-3B synthase                              283   3e-88    
ref|WP_017720834.1|  ferredoxin                                         286   3e-88    
ref|XP_009790010.1|  PREDICTED: ferredoxin--nitrite reductase, ch...    277   3e-88    
ref|WP_006105894.1|  ferredoxin-nitrite reductase                       283   3e-88    
ref|WP_015192765.1|  precorrin-3B synthase                              282   4e-88    
ref|WP_015222811.1|  assimilatory nitrite reductase (ferredoxin) ...    282   4e-88    
ref|WP_015128366.1|  assimilatory nitrite reductase (ferredoxin) ...    282   8e-88    
ref|WP_019505972.1|  ferredoxin                                         285   8e-88    
ref|WP_008274143.1|  ferredoxin-nitrite reductase                       281   1e-87    
ref|WP_027400663.1|  ferredoxin--nitrite reductase                      281   2e-87    
ref|XP_006379199.1|  hypothetical protein POPTR_0009s10440g             278   4e-87    
ref|WP_017292467.1|  ferredoxin-nitrite reductase                       280   4e-87    
ref|WP_012361573.1|  MULTISPECIES: ferredoxin-nitrite reductase         280   5e-87    
ref|WP_028085072.1|  ferredoxin--nitrite reductase                      279   1e-86    
sp|Q51879.1|NIR_PHOLA  RecName: Full=Ferredoxin--nitrite reductase      278   2e-86    Phormidium laminosum
ref|WP_036480548.1|  ferredoxin--nitrite reductase                      278   3e-86    
dbj|BAE46576.1|  nitrite reductase                                      267   3e-86    Physalis alkekengi [Chinese-lantern]
ref|WP_016948949.1|  ferredoxin-nitrite reductase                       277   4e-86    
ref|WP_014275660.1|  ferredoxin--nitrite reductase                      277   4e-86    
ref|WP_006617804.1|  ferredoxin-nitrite reductase                       277   4e-86    
ref|WP_006508771.1|  precorrin-3B synthase                              279   1e-85    
ref|WP_028090043.1|  ferredoxin--nitrite reductase                      276   2e-85    
gb|EKD11740.1|  nitrite and sulphite reductase 4Fe-4S region            276   2e-85    
ref|WP_035758555.1|  ferredoxin--nitrite reductase                      275   2e-85    
ref|WP_008049634.1|  ferredoxin-nitrite reductase                       275   3e-85    
ref|WP_006669900.1|  ferredoxin-nitrite reductase                       276   4e-85    
ref|WP_015161463.1|  sulfite reductase, beta subunit (hemoprotein)      274   5e-85    
ref|WP_006528554.1|  precorrin-3B synthase                              274   5e-85    
dbj|BAG74298.1|  nitrite reductase                                      272   3e-84    Phormidium laminosum
ref|WP_019498141.1|  hypothetical protein                               272   5e-84    
ref|WP_015134937.1|  assimilatory nitrite reductase (ferredoxin) ...    271   1e-83    
ref|WP_039713492.1|  ferredoxin--nitrite reductase                      269   7e-83    
ref|WP_015157292.1|  assimilatory nitrite reductase (ferredoxin) ...    268   2e-82    
ref|WP_038021955.1|  ferredoxin--nitrite reductase                      268   3e-82    
ref|WP_024546340.1|  ferredoxin--nitrite reductase                      265   2e-81    
gb|AIU34485.1|  nitrite reductase                                       259   2e-80    
ref|WP_017310284.1|  ferredoxin-nitrite reductase                       264   2e-80    
gb|AEO22994.1|  nitrite reductase                                       262   8e-80    
ref|WP_036485313.1|  ferredoxin--nitrite reductase                      258   1e-78    
ref|WP_030006379.1|  ferredoxin--nitrite reductase                      257   2e-78    
ref|XP_005714928.1|  unnamed protein product                            259   2e-78    
ref|WP_023171581.1|  ferredoxin-nitrite reductase                       256   3e-78    
ref|WP_012307438.1|  ferredoxin-nitrite reductase                       256   5e-78    
gb|AFW64356.1|  hypothetical protein ZEAMMB73_724678                    243   3e-75    
gb|AAP79144.1|  ferredoxin nitrite reductase                            248   7e-74    
emb|CBJ25514.1|  ferredoxin nitrite reductase                           248   1e-73    
ref|WP_011361018.1|  ferredoxin-nitrite reductase                       244   2e-73    
gb|AII46522.1|  ferredoxin-nitrite reductase                            242   1e-72    
ref|WP_037987910.1|  ferredoxin--nitrite reductase                      241   2e-72    
gb|EAU71226.1|  ferredoxin--nitrite reductase                           241   2e-72    
ref|WP_010305963.1|  ferredoxin-nitrite reductase                       240   1e-71    
ref|WP_011934377.1|  ferredoxin-nitrite reductase                       239   1e-71    
ref|WP_011141556.1|  ferredoxin-nitrite reductase                       239   2e-71    
ref|WP_029626046.1|  ferredoxin--nitrite reductase                      239   2e-71    
ref|WP_006042731.1|  ferredoxin-nitrite reductase                       238   3e-71    
ref|WP_011936894.1|  ferredoxin-nitrite reductase                       238   3e-71    
gb|EJK78098.1|  nitrite reductase                                       241   4e-71    
ref|XP_005646410.1|  hypothetical protein COCSUDRAFT_29833              239   1e-70    
ref|WP_011365576.1|  ferredoxin-nitrite reductase                       236   2e-70    
ref|XP_002289265.1|  nitrite reductase-ferredoxin dependent             235   9e-70    
ref|WP_038552091.1|  ferredoxin--nitrite reductase                      234   1e-69    
gb|AHF65029.1|  Ferredoxin--nitrite reductase                           234   2e-69    
ref|XP_005844715.1|  hypothetical protein CHLNCDRAFT_26644              235   4e-69    
ref|WP_007101180.1|  ferredoxin-nitrite reductase                       231   2e-68    
ref|WP_035998667.1|  ferredoxin--nitrite reductase                      233   6e-68    
ref|WP_011131603.1|  ferredoxin-nitrite reductase                       231   6e-68    
gb|AET85053.1|  nitrite reductase                                       227   3e-67    
ref|WP_011827554.1|  ferredoxin-nitrite reductase                       228   4e-67    
ref|WP_007099389.1|  ferredoxin-nitrite reductase                       228   4e-67    
ref|WP_029960379.1|  ferredoxin--nitrite reductase                      227   5e-67    
gb|AIQ95302.1|  Ferredoxin--nitrite reductase                           226   2e-66    
ref|WP_036914886.1|  MULTISPECIES: ferredoxin--nitrite reductase        226   3e-66    
ref|XP_002955216.1|  hypothetical protein VOLCADRAFT_83067              226   7e-66    
ref|XP_002180496.1|  predicted protein                                  226   2e-65    
ref|WP_011620785.1|  ferredoxin-nitrite reductase                       223   2e-65    
ref|WP_032520384.1|  ferredoxin--nitrite reductase                      223   2e-65    
gb|AAC34043.1|  nitrite reductase                                       214   5e-65    
ref|WP_006854249.1|  ferredoxin-nitrite reductase                       222   7e-65    
ref|WP_011129330.1|  ferredoxin-nitrite reductase                       221   8e-65    
gb|AAC34042.1|  nitrite reductase                                       213   1e-64    
gb|AAC17122.1|  nitrite reductase                                       221   2e-64    
ref|WP_025782397.1|  ferredoxin--nitrite reductase                      218   2e-63    
ref|WP_036905949.1|  ferredoxin--nitrite reductase                      218   3e-63    
ref|WP_011824662.1|  ferredoxin-nitrite reductase                       218   5e-63    
ref|WP_011295642.1|  ferredoxin-nitrite reductase                       216   2e-62    
ref|XP_005791045.1|  ferredoxin-nitrite reductase precursor             218   5e-62    
ref|WP_028953197.1|  ferredoxin--nitrite reductase                      214   8e-62    
ref|XP_005777302.1|  putative nitrite reductase                         217   9e-62    
ref|XP_001696787.1|  nitrite reductase                                  214   2e-61    
emb|CAA70137.1|  nitrite reductase                                      214   2e-61    
ref|WP_006173161.1|  ferredoxin--nitrite reductase                      211   5e-61    
gb|AII41911.1|  ferredoxin-nitrite reductase                            211   6e-61    
ref|WP_038542357.1|  ferredoxin--nitrite reductase                      211   6e-61    
ref|WP_006911675.1|  ferredoxin--nitrite reductase                      210   2e-60    
ref|WP_035832431.1|  ferredoxin--nitrite reductase                      209   5e-60    
gb|KEF41486.1|  ferredoxin--nitrite reductase                           209   5e-60    
gb|AAT99257.1|  nitrite reductase                                       211   1e-59    
ref|XP_005704382.1|  ferredoxin-nitrite reductase                       202   6e-57    
gb|AAC34044.1|  nitrite reductase                                       185   3e-55    
gb|AAC34045.1|  nitrite reductase                                       184   4e-55    
gb|AAC34047.1|  nitrite reductase                                       184   5e-55    
gb|EWM20575.1|  nitrite reductase                                       193   6e-55    
gb|AAC34046.1|  nitrite reductase                                       184   7e-55    
gb|AAC34048.1|  nitrite reductase                                       183   2e-54    
ref|WP_015109994.1|  sulfite reductase subunit beta (hemoprotein)       194   4e-54    
ref|WP_026369947.1|  hypothetical protein                               184   1e-50    
ref|XP_005854645.1|  ferredoxin nitrite reductase                       173   9e-48    
ref|WP_018131623.1|  hypothetical protein                               176   2e-47    
ref|WP_003352911.1|  ferredoxin-nitrite reductase                       176   2e-47    
ref|WP_005536442.1|  ferredoxin-nitrite reductase                       175   5e-47    
ref|WP_028983528.1|  ferredoxin--nitrite reductase                      174   1e-46    
ref|WP_028975874.1|  ferredoxin--nitrite reductase                      174   1e-46    
ref|WP_025684170.1|  ferredoxin--nitrite reductase                      174   1e-46    
ref|WP_004964970.1|  ferredoxin-nitrite reductase                       174   1e-46    
ref|WP_007290358.1|  ferredoxin-nitrite reductase                       173   2e-46    
ref|WP_011224554.1|  ferredoxin--nitrite reductase                      174   2e-46    
ref|WP_007189699.1|  ferredoxin-nitrite reductase                       174   2e-46    
ref|WP_010278634.1|  ferredoxin-nitrite reductase                       173   2e-46    
ref|WP_008311374.1|  ferredoxin-nitrite reductase                       174   2e-46    
ref|WP_012875275.1|  ferredoxin--nitrite reductase                      173   2e-46    
ref|WP_004518246.1|  ferredoxin-nitrite reductase                       173   2e-46    
ref|WP_010023398.1|  ferredoxin-nitrite reductase                       173   3e-46    
ref|WP_014039257.1|  ferredoxin--nitrite reductase                      173   3e-46    
ref|WP_023510479.1|  ferredoxin-nitrite reductase                       172   7e-46    
ref|WP_025720482.1|  ferredoxin--nitrite reductase                      171   8e-46    
ref|WP_029214691.1|  hypothetical protein                               170   1e-45    
ref|WP_014278373.1|  ferredoxin-nitrite reductase                       171   2e-45    
ref|WP_019688753.1|  ferredoxin-nitrite reductase                       170   2e-45    
ref|WP_036582016.1|  ferredoxin--nitrite reductase                      170   3e-45    
ref|WP_027415625.1|  ferredoxin--nitrite reductase                      169   4e-45    
ref|WP_016314090.1|  MULTISPECIES: sulfite reductase (ferredoxin)       169   4e-45    
ref|WP_024092939.1|  ferredoxin--nitrite reductase NirA                 169   5e-45    
gb|AJE52180.1|  ferredoxin--nitrite reductase                           169   5e-45    
ref|WP_004594135.1|  ferredoxin-nitrite reductase                       169   9e-45    
ref|WP_007783804.1|  ferredoxin-nitrite reductase                       168   1e-44    
ref|WP_013373319.1|  ferredoxin-nitrite reductase                       168   1e-44    
ref|WP_009225398.1|  ferredoxin-nitrite reductase                       168   1e-44    
ref|WP_009677005.1|  MULTISPECIES: ferredoxin-nitrite reductase         168   2e-44    
ref|WP_013247942.1|  ferredoxin-nitrite reductase                       167   2e-44    
ref|WP_029514533.1|  ferredoxin--nitrite reductase                      167   2e-44    
ref|WP_016822965.1|  MULTISPECIES: ferredoxin-nitrite reductase         167   2e-44    
ref|WP_008383986.1|  sulfite reductase, subunit beta (hemoprotein)      168   2e-44    
ref|WP_019119859.1|  ferredoxin-nitrite reductase                       167   3e-44    
ref|WP_025707360.1|  ferredoxin--nitrite reductase                      167   3e-44    
ref|WP_023483130.1|  sulfite reductase subunit beta-like protein        167   3e-44    
ref|WP_010349610.1|  ferredoxin-nitrite reductase                       167   4e-44    
ref|WP_026676525.1|  ferredoxin--nitrite reductase                      167   4e-44    
ref|WP_039271414.1|  ferredoxin--nitrite reductase                      166   5e-44    
ref|WP_025723427.1|  ferredoxin--nitrite reductase                      166   6e-44    
ref|WP_007541508.1|  sulfite reductase, subunit beta (hemoprotein)      167   7e-44    
ref|WP_028542111.1|  ferredoxin--nitrite reductase                      166   7e-44    
ref|WP_007432639.1|  ferredoxin-nitrite reductase                       166   7e-44    
ref|WP_012189876.1|  ferredoxin--nitrite reductase                      165   7e-44    
ref|WP_006674723.1|  ferredoxin-nitrite reductase                       166   1e-43    
ref|WP_018256642.1|  ferredoxin--nitrite reductase                      166   1e-43    
ref|WP_005006448.1|  Ferredoxin-nitrite reductase                       165   1e-43    
ref|WP_023990601.1|  ferredoxin-nitrite reductase                       165   2e-43    
ref|WP_027451802.1|  hypothetical protein                               164   2e-43    
ref|WP_013312216.1|  ferredoxin-nitrite reductase                       165   2e-43    
ref|WP_011570411.1|  ferredoxin--nitrite reductase                      166   2e-43    
ref|WP_010880081.1|  nitrite reductase                                  168   2e-43    
ref|WP_019424774.1|  ferredoxin-nitrite reductase                       165   2e-43    
ref|WP_007504791.1|  ferredoxin-nitrite reductase                       165   2e-43    
ref|WP_037912178.1|  hypothetical protein                               164   2e-43    
ref|WP_012458789.1|  hypothetical protein                               164   2e-43    
ref|WP_031462327.1|  ferredoxin--nitrite reductase                      164   2e-43    
ref|WP_008326846.1|  sulfite reductase, subunit beta (hemoprotein)      165   3e-43    
ref|WP_018758707.1|  ferredoxin-nitrite reductase                       164   3e-43    
ref|WP_010632621.1|  ferredoxin-nitrite reductase                       164   3e-43    
ref|WP_036619411.1|  ferredoxin--nitrite reductase                      164   3e-43    
gb|AHG02628.1|  ferredoxin--nitrite reductase                           164   4e-43    
ref|WP_013489924.1|  ferredoxin-nitrite reductase                       164   4e-43    
ref|WP_012807962.1|  ferredoxin--nitrite reductase                      164   4e-43    
ref|WP_021049831.1|  sulfite reductase, beta subunit (hemoprotein)      164   4e-43    
ref|WP_028608209.1|  ferredoxin--nitrite reductase                      164   4e-43    
emb|CDK38954.1|  nitrite and sulfite reductase 4Fe-4S domain-cont...    164   6e-43    
ref|WP_007998749.1|  nitrite and sulfite reductase 4Fe-4S domain-...    164   7e-43    
ref|WP_003338958.1|  ferredoxin-nitrite reductase                       163   8e-43    
ref|WP_022584102.1|  ferredoxin-nitrite reductase                       163   8e-43    
ref|WP_021055584.1|  sulfite reductase, beta subunit (hemoprotein)      163   8e-43    
ref|WP_012963754.1|  nitrite reductase                                  166   9e-43    
ref|WP_008320820.1|  sulfite reductase, subunit beta (hemoprotein)      163   9e-43    
ref|WP_023394250.1|  ferredoxin--nitrite reductase                      163   9e-43    
ref|WP_029098657.1|  ferredoxin--nitrite reductase                      163   1e-42    
gb|AIG25430.1|  sulfite reductase                                       163   1e-42    
ref|WP_014256448.1|  ferredoxin-nitrite reductase [                     163   1e-42    
gb|AIQ14764.1|  ferredoxin--nitrite reductase                           163   1e-42    
ref|WP_006055386.1|  ferredoxin--nitrite reductase                      163   1e-42    
ref|WP_018671324.1|  ferredoxin-nitrite reductase                       162   1e-42    
ref|WP_017728242.1|  ferredoxin-nitrite reductase                       162   2e-42    
ref|WP_037994078.1|  ferredoxin--nitrite reductase                      162   2e-42    
ref|WP_006628584.1|  nitrite and sulfite reductase 4Fe-4S domain-...    162   2e-42    
ref|WP_025689830.1|  ferredoxin--nitrite reductase                      162   3e-42    
gb|AHE96069.1|  nitrite reductase                                       164   3e-42    
ref|WP_008586191.1|  nitrite and sulfite reductase 4Fe-4S domain-...    162   3e-42    
ref|WP_036601656.1|  ferredoxin--nitrite reductase                      161   3e-42    
ref|WP_035299812.1|  ferredoxin--nitrite reductase                      161   4e-42    
ref|WP_017436089.1|  ferredoxin-nitrite reductase                       161   4e-42    
ref|WP_008445524.1|  nitrite and sulfite reductase 4Fe-4S domain-...    161   6e-42    
ref|WP_013977033.1|  ferredoxin--nitrite reductase                      160   6e-42    
ref|WP_025694849.1|  ferredoxin--nitrite reductase                      160   6e-42    
ref|WP_006882149.1|  ferredoxin--nitrite reductase                      160   1e-41    
ref|WP_032496295.1|  nitrite reductase                                  163   1e-41    
ref|WP_025026237.1|  ferredoxin--nitrite reductase                      160   1e-41    
ref|WP_011563948.1|  ferredoxin--nitrite reductase                      160   1e-41    
gb|ABF46822.1|  putative nitrite reductase                              150   1e-41    
ref|WP_028551036.1|  ferredoxin--nitrite reductase                      160   1e-41    
ref|WP_038083284.1|  ferredoxin--nitrite reductase                      160   1e-41    
gb|EDP76479.1|  nitrite reductase (NAD(P)H) large subunit               163   1e-41    
ref|WP_021624882.1|  nitrite/sulfite reductase ferredoxin domain ...    160   1e-41    
ref|WP_027410740.1|  ferredoxin--nitrite reductase                      159   2e-41    
ref|XP_005820309.1|  nitrite reductase                                  156   2e-41    
ref|WP_012749143.1|  ferredoxin-nitrite reductase                       159   2e-41    
gb|AHV99287.1|  ferredoxin--nitrite reductase                           159   2e-41    
ref|WP_010612081.1|  ferredoxin-nitrite reductase                       160   2e-41    
ref|WP_022746468.1|  ferredoxin--nitrite reductase NirA                 159   2e-41    
ref|WP_007693600.1|  ferredoxin-nitrite reductase                       160   2e-41    
ref|WP_008420916.1|  Ferredoxin--nitrite reductase                      159   2e-41    
ref|WP_008419386.1|  sulfite reductase, beta subunit (hemoprotein)      159   2e-41    
ref|WP_034602382.1|  ferredoxin--nitrite reductase                      159   2e-41    
gb|EZP78488.1|  ferredoxin--nitrite reductase                           159   2e-41    
ref|WP_013401645.1|  MULTISPECIES: ferredoxin-nitrite reductase         159   3e-41    
ref|WP_003252991.1|  ferredoxin-nitrite reductase                       159   3e-41    
ref|WP_012992363.1|  nitrite reductase                                  162   3e-41    
ref|WP_025700992.1|  ferredoxin--nitrite reductase                      159   3e-41    
ref|WP_038699156.1|  ferredoxin--nitrite reductase                      159   3e-41    
ref|WP_005840006.1|  ferredoxin--nitrite reductase                      158   4e-41    
dbj|GAJ40899.1|  sulfite reductase                                      159   4e-41    
gb|AAA96730.1|  nitrate reductase                                       149   5e-41    
ref|WP_021258827.1|  sulfite reductase (ferredoxin)                     158   6e-41    
ref|WP_021257087.1|  sulfite reductase (ferredoxin)                     158   7e-41    
ref|WP_021061025.1|  sulfite reductase, beta subunit (hemoprotein)      158   7e-41    
ref|WP_004051943.1|  ferredoxin--nitrite reductase                      158   8e-41    
ref|WP_021041092.1|  sulfite reductase, beta subunit (hemoprotein)      158   8e-41    
ref|WP_019915121.1|  ferredoxin-nitrite reductase                       157   8e-41    
ref|WP_028533425.1|  ferredoxin--nitrite reductase                      157   8e-41    
ref|WP_021039273.1|  sulfite reductase, beta subunit (hemoprotein)      158   8e-41    
ref|WP_023504227.1|  sulfite reductase, beta subunit (hemoprotein)      157   1e-40    
ref|WP_007740592.1|  ferredoxin--nitrite reductase                      157   1e-40    
ref|WP_015909613.1|  ferredoxin--nitrite reductase                      157   1e-40    
dbj|BAD93723.1|  ferredoxin--nitrite reductase                          151   2e-40    
ref|WP_008849371.1|  nitrite and sulfite reductase 4Fe-4S domain-...    157   2e-40    
ref|WP_005828399.1|  MULTISPECIES: ferredoxin--nitrite reductase        156   2e-40    
gb|EJL46309.1|  sulfite reductase, beta subunit (hemoprotein)           156   2e-40    
ref|WP_018749951.1|  ferredoxin-nitrite reductase                       156   3e-40    
ref|WP_006078779.1|  ferredoxin--nitrite reductase                      156   3e-40    
ref|WP_003348082.1|  ferredoxin-nitrite reductase                       156   3e-40    
ref|WP_004050078.1|  nitrite and sulfite reductase 4Fe-4S domain-...    156   3e-40    
ref|WP_033099134.1|  ferredoxin--nitrite reductase                      156   3e-40    
ref|WP_015593407.1|  ferredoxin-nitrite reductase                       155   4e-40    
ref|WP_008004285.1|  nitrite and sulfite reductase 4Fe-4S domain-...    156   4e-40    
ref|WP_038674258.1|  ferredoxin--nitrite reductase                      155   4e-40    
ref|WP_023504525.1|  sulfite reductase, beta subunit (hemoprotein)      154   4e-40    
ref|WP_004063045.1|  ferredoxin--nitrite reductase                      155   5e-40    
ref|WP_009733083.1|  ferredoxin--nitrite reductase                      155   5e-40    
ref|WP_004041668.1|  ferredoxin--nitrite reductase                      155   5e-40    
ref|WP_005544656.1|  ferredoxin-nitrite reductase                       155   5e-40    
ref|WP_005044954.1|  ferredoxin--nitrite reductase                      155   6e-40    
ref|WP_019005272.1|  ferredoxin-nitrite reductase                       155   6e-40    
ref|WP_024040361.1|  Sulfite reductase Ferredoxin                       155   6e-40    
ref|WP_013879489.1|  ferredoxin--nitrite reductase                      157   6e-40    



>ref|XP_011088260.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Sesamum 
indicum]
Length=588

 Score =   478 bits (1229),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/259 (89%), Positives = 248/259 (96%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPYNNLLS
Sbjct  171  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYNNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNPAF+NLPRKWNVCV+GSHDLYEHPHINDLAYMPA K+GRFGFNLLVGGFF
Sbjct  231  QYITANSRGNPAFTNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKNGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWVP DDI PVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFR E
Sbjct  291  STKRCAEAIPLDAWVPGDDILPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFREE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VV+RMP+Q+LERA++E+L+Q  WERRDYFGVHPQKQEGYSF+G+HIPVGR++ADDMDELA
Sbjct  351  VVRRMPQQQLERASSEDLVQSQWERRDYFGVHPQKQEGYSFVGIHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  411  RLADTYGSGELRLTVEQNI  429



>prf||1908371C nitrite reductase
Length=347

 Score =   465 bits (1196),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  9    WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  68

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TAN RGNPA +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  69   QYVTANFRGNPAVTNLPRKWNVCVIGSHDLYEHPHINDLAYMPASKDGRFGFNLLVGGFF  128

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVPADD+ PVCKAILEA+RDLG RGNRQK RMMWL+DELG+EGFRAE
Sbjct  129  SPKRCAEAVPLDAWVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDELGVEGFRAE  188

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+Q+L+R + E+L+QK WERR+Y GVHPQKQEGYSF+GLHIPVGR++ADDMDELA
Sbjct  189  VVKRMPQQKLDRESTEDLVQKQWERREYLGVHPQKQEGYSFVGLHIPVGRVQADDMDELA  248

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  249  RLADNYGSGELRLTVEQNI  267



>emb|CAA46941.1| ferredoxin--nitrite reductase [Nicotiana tabacum]
Length=348

 Score =   465 bits (1196),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  9    WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  68

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TAN RGNPA +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  69   QYVTANFRGNPAVTNLPRKWNVCVIGSHDLYEHPHINDLAYMPASKDGRFGFNLLVGGFF  128

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVPADD+ PVCKAILEA+RDLG RGNRQK RMMWL+DELG+EGFRAE
Sbjct  129  SPKRCAEAVPLDAWVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDELGVEGFRAE  188

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+Q+L+R + E+L+QK WERR+Y GVHPQKQEGYSF+GLHIPVGR++ADDMDELA
Sbjct  189  VVKRMPQQKLDRESTEDLVQKQWERREYLGVHPQKQEGYSFVGLHIPVGRVQADDMDELA  248

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  249  RLADNYGSGELRLTVEQNI  267



>ref|XP_004230820.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Solanum 
lycopersicum]
Length=587

 Score =   473 bits (1217),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 232/259 (90%), Positives = 246/259 (95%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GLE+VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILKGLEEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA+KDGRFGFNLLVGGFF
Sbjct  231  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPAIKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  291  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+QELERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMD+LA
Sbjct  351  VVKRMPQQELERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDDLA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  411  RLADEYGSGELRLTVEQNI  429



>emb|CAA46942.1| ferredoxin--nitrite reductase [Nicotiana tabacum]
Length=456

 Score =   468 bits (1205),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 229/259 (88%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  40   WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  99

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  100  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  159

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  160  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  219

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  220  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  279

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  280  RLADEYGSGEIRLTVEQNI  298



>gb|KDP42275.1| hypothetical protein JCGZ_01599 [Jatropha curcas]
Length=587

 Score =   471 bits (1211),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 229/259 (88%), Positives = 246/259 (95%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPYNNLLS
Sbjct  170  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYNNLLS  229

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT+NSRGNPA SNLPRKWNVCVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  230  QFITSNSRGNPAVSNLPRKWNVCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  289

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRCAEAIPLDAWVPADD+  VC+A+LEA+RDLG RGNRQK RMMWLIDELG+EGFR+E
Sbjct  290  SAKRCAEAIPLDAWVPADDVVLVCRAVLEAYRDLGFRGNRQKTRMMWLIDELGVEGFRSE  349

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QELERA++EEL+QK WERRDYFGVHPQ QEG+S++GLHIPVGRLEADDMDELA
Sbjct  350  VVKRMPSQELERASSEELVQKQWERRDYFGVHPQSQEGFSYVGLHIPVGRLEADDMDELA  409

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  410  RLADTYGSGELRLTVEQNI  428



>ref|NP_001275023.1| ferredoxin--nitrite reductase, chloroplastic-like [Solanum tuberosum]
 emb|CBL43265.1| nitrite reductase [Solanum tuberosum]
Length=587

 Score =   470 bits (1210),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 231/259 (89%), Positives = 245/259 (95%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GLE+VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILKGLEEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA+KDGRFGFNLLVGGFF
Sbjct  231  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPAIKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  291  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+QELERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMD+LA
Sbjct  351  VEKRMPQQELERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDDLA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  411  RLADEYGSGELRLTVEQNI  429



>prf||1908371B nitrite reductase
Length=456

 Score =   464 bits (1195),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 227/259 (88%), Positives = 241/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+A IDPEEIVDTRPY NLLS
Sbjct  40   WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAAIDPEEIVDTRPYTNLLS  99

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLP KWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  100  QFITGNSRGNPALSNLPSKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  159

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  160  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  219

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  220  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  279

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  280  RLADEYGSGEIRLTVEQNI  298



>dbj|BAD15363.1| nitrite reductase [Nicotiana tabacum]
Length=587

 Score =   469 bits (1206),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 229/259 (88%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  231  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  291  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  351  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  411  RLADEYGSGEIRLTVEQNI  429



>ref|XP_009776470.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--nitrite reductase, 
chloroplastic-like [Nicotiana sylvestris]
Length=578

 Score =   468 bits (1205),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 229/259 (88%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  231  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  291  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  351  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  411  RLADEYGSGEIRLTVEQNI  429



>ref|XP_009628648.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=587

 Score =   468 bits (1205),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 230/259 (89%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  231  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  291  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+QELERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  351  VEKRMPQQELERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  411  RLADEYGSGEIRLTVEQNI  429



>pdb|3B0G|A Chain A, Assimilatory Nitrite Reductase (Nii3) From Tobbaco Leaf
 pdb|3VKP|A Chain A, Assimilatory Nitrite Reductase (nii3) - No2 Complex 
From Tobbaco Leaf Analysed With Low X-ray Dose
 pdb|3VKQ|A Chain A, Assimilatory Nitrite Reductase (nii3) - No2 Complex 
From Tobbaco Leaf Analysed With Middle X-ray Dose
 pdb|3VKR|A Chain A, Assimilatory Nitrite Reductase (nii3) - No2 Complex 
From Tobbaco Leaf Analysed With High X-ray Dose
 pdb|3VKS|A Chain A, Assimilatory Nitrite Reductase (nii3) - No Complex From 
Tobbaco Leaf
 pdb|3VKT|A Chain A, Assimilatory Nitrite Reductase (nii3) - Nh2oh Complex 
From Tobbaco Leaf
Length=591

 Score =   467 bits (1202),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 228/259 (88%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  175  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  234

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  235  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  294

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVC+AILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  295  SAKRCDEAIPLDAWVPADDVVPVCRAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  354

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  355  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  414

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  415  RLADEYGSGEIRLTVEQNI  433



>gb|ABK95605.1| unknown [Populus trichocarpa]
Length=588

 Score =   467 bits (1202),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 226/259 (87%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEILRGL +VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILRGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP F+NLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF
Sbjct  231  QFITANSRGNPEFTNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWV ADD+ P CKA+LEA+RDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  291  SPKRCAEAIPLDAWVSADDVLPSCKAVLEAYRDLGTRGNRQKTRMMWLIDELGIEGFRSE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QELER ++E+L+QK WERRDYFGVHPQKQEG S+ GLHIPVGR++ADDMDELA
Sbjct  351  VVKRMPRQELERESSEDLVQKQWERRDYFGVHPQKQEGLSYAGLHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YG+GELRLTVEQNI
Sbjct  411  RLADIYGTGELRLTVEQNI  429



>ref|XP_009628462.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
 dbj|BAD15365.1| nitrite reductase [Nicotiana tabacum]
Length=587

 Score =   467 bits (1201),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TAN RGNPA +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  231  QYVTANFRGNPAVTNLPRKWNVCVIGSHDLYEHPHINDLAYMPASKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVPADD+ PVCKAILEA+RDLG RGNRQK RMMWL+DELG+EGFRAE
Sbjct  291  SPKRCAEAVPLDAWVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDELGVEGFRAE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+Q+L+R + E+L+QK WERR+Y GVHPQKQEGYSF+GLHIPVGR++ADDMDELA
Sbjct  351  VVKRMPQQKLDRESTEDLVQKQWERREYLGVHPQKQEGYSFVGLHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  411  RLADNYGSGELRLTVEQNI  429



>emb|CDY69481.1| BnaCnng63770D, partial [Brassica napus]
Length=460

 Score =   462 bits (1190),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 224/259 (86%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  43   WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLS  102

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              ITANSRGNP FSNLPRKWNVCVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  103  HFITANSRGNPDFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  162

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ P+C A+LEAFRDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  163  SAKRCEEAIPLDAWVPADDVLPLCGAVLEAFRDLGTRGNRQKTRMMWLIDELGIEGFRAE  222

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGVHPQKQEG S+IGLH PVGRL+ADDMDELA
Sbjct  223  VEKRMPSGKLERESSEDLVNKQWERRDYFGVHPQKQEGLSYIGLHCPVGRLQADDMDELA  282

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  283  RLADTYGSGELRLTVEQNI  301



>ref|XP_006384408.1| Ferredoxin--nitrite reductase family protein [Populus trichocarpa]
 gb|ERP62205.1| Ferredoxin--nitrite reductase family protein [Populus trichocarpa]
Length=588

 Score =   467 bits (1201),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 226/259 (87%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEILRGL +VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILRGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP F+NLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF
Sbjct  231  QFITANSRGNPEFTNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWV ADD+ P CKA+LEA+RDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  291  SPKRCAEAIPLDAWVSADDVLPSCKAVLEAYRDLGTRGNRQKTRMMWLIDELGIEGFRSE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QELER ++E+L+QK WERRDYFGVHPQKQEG S+ GLHIPVGR++ADDMDELA
Sbjct  351  VVKRMPRQELERESSEDLVQKQWERRDYFGVHPQKQEGLSYAGLHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YG+GELRLTVEQNI
Sbjct  411  RLADIYGTGELRLTVEQNI  429



>pdb|3B0N|A Chain A, Q448k Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   467 bits (1201),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 228/259 (88%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  175  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  234

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  235  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  294

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVC+AILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  295  SAKRCDEAIPLDAWVPADDVVPVCRAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  354

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  355  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  414

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  415  RLADEYGSGEIRLTVEQNI  433



>ref|XP_009783559.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana sylvestris]
Length=584

 Score =   466 bits (1199),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  168  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  227

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TAN RGNPA +NLPRKWNVCV+GSHDLYEHP INDLAYMPA KDGRFGFNLLVGGFF
Sbjct  228  QYVTANFRGNPAVTNLPRKWNVCVIGSHDLYEHPQINDLAYMPATKDGRFGFNLLVGGFF  287

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVPADD+ PVCKAILEA+RDLG RGNRQK RMMWL+DELG+EGFRAE
Sbjct  288  SPKRCAEAVPLDAWVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDELGVEGFRAE  347

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+Q+L+R + E+L+QK WERR+Y GVHPQKQEGYSF+GLHIPVGR++ADDMDELA
Sbjct  348  VVKRMPQQKLDRESTEDLVQKQWERREYLGVHPQKQEGYSFVGLHIPVGRVQADDMDELA  407

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  408  RLADEYGSGELRLTVEQNI  426



>dbj|BAD15364.1| nitrite reductase [Nicotiana tabacum]
Length=584

 Score =   466 bits (1199),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  168  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  227

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TAN RGNPA +NLPRKWNVCV+GSHDLYEHP INDLAYMPA KDGRFGFNLLVGGFF
Sbjct  228  QYVTANFRGNPAVTNLPRKWNVCVIGSHDLYEHPQINDLAYMPATKDGRFGFNLLVGGFF  287

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVPADD+ PVCKAILEA+RDLG RGNRQK RMMWL+DELG+EGFRAE
Sbjct  288  SPKRCAEAVPLDAWVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDELGVEGFRAE  347

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+Q+L+R + E+L+QK WERR+Y GVHPQKQEGYSF+GLHIPVGR++ADDMDELA
Sbjct  348  VVKRMPQQKLDRESTEDLVQKQWERREYLGVHPQKQEGYSFVGLHIPVGRVQADDMDELA  407

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  408  RLADEYGSGELRLTVEQNI  426



>pdb|3VLX|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- Ligand Free Form From Tobacco Leaf
 pdb|3VLY|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- So3 Partial Complex From Tobacco Leaf
 pdb|3VLZ|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- So3 Full Complex From Tobacco Leaf
 pdb|3VM0|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- No2 Complex From Tobacco Leaf
 pdb|3VM1|A Chain A, Assimilatory Nitrite Reductase (Nii3) - N226k Mutant 
- Hco3 Complex From Tobacco Leaf
Length=584

 Score =   465 bits (1196),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 227/259 (88%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  175  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  234

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKW  CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  235  QFITGNSRGNPAVSNLPRKWKPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  294

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVC+AILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  295  SAKRCDEAIPLDAWVPADDVVPVCRAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  354

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  355  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  414

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  415  RLADEYGSGEIRLTVEQNI  433



>emb|CDP17819.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   465 bits (1197),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 225/259 (87%), Positives = 245/259 (95%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GLE+VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  173  WQIRGVVLPDVPEILKGLEEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  232

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TANSRGNP+ SNLPRKWNVCV+GSHDLYEHPHINDLAYMPA K+GRFGFNLLVGGFF
Sbjct  233  QFVTANSRGNPSISNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKNGRFGFNLLVGGFF  292

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCA+AIPLDAWVP DDI PVCKAILE FRDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  293  SPKRCADAIPLDAWVPGDDIIPVCKAILETFRDLGTRGNRQKTRMMWLIDELGIEGFRSE  352

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VV+R+P+QELERA++E+L+QK WERRDY G+HPQKQEG SFIGLHIPVGR++ADDMDELA
Sbjct  353  VVQRIPQQELERASSEDLVQKQWERRDYLGIHPQKQEGCSFIGLHIPVGRVQADDMDELA  412

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  413  RLADEYGSGELRLTVEQNI  431



>emb|CAA46940.1| ferredoxin--nitrite reductase [Nicotiana tabacum]
Length=583

 Score =   465 bits (1196),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 229/259 (88%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDT PY NLLS
Sbjct  167  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTGPYTNLLS  226

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  227  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  286

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  287  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  346

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+QELERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  347  VEKRMPQQELERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  406

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  407  RLADEYGSGEIRLTVEQNI  425



>ref|XP_006409539.1| hypothetical protein EUTSA_v10022613mg [Eutrema salsugineum]
 gb|ESQ50992.1| hypothetical protein EUTSA_v10022613mg [Eutrema salsugineum]
Length=590

 Score =   465 bits (1196),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 239/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  172  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  231

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP F+NLPRKWNVCV+G+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  232  QFITANSRGNPDFTNLPRKWNVCVIGTHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  291

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  292  SPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  351

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGVHPQKQEG SF+GLH+PVGRL+ADDMDELA
Sbjct  352  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVHPQKQEGLSFVGLHVPVGRLQADDMDELA  411

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  412  RLADTYGSGELRLTVEQNI  430



>pdb|3B0H|A Chain A, Assimilatory Nitrite Reductase (Nii4) From Tobbaco Root
 pdb|3B0H|B Chain B, Assimilatory Nitrite Reductase (Nii4) From Tobbaco Root
Length=588

 Score =   465 bits (1196),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  172  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  231

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TAN RGNPA +NLPRKWNVCV+GSHDLYEHP INDLAYMPA KDGRFGFNLLVGGFF
Sbjct  232  QYVTANFRGNPAVTNLPRKWNVCVIGSHDLYEHPQINDLAYMPATKDGRFGFNLLVGGFF  291

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVPADD+ PVCKAILEA+RDLG RGNRQK RMMWL+DELG+EGFRAE
Sbjct  292  SPKRCAEAVPLDAWVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLVDELGVEGFRAE  351

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+Q+L+R + E+L+QK WERR+Y GVHPQKQEGYSF+GLHIPVGR++ADDMDELA
Sbjct  352  VVKRMPQQKLDRESTEDLVQKQWERREYLGVHPQKQEGYSFVGLHIPVGRVQADDMDELA  411

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  412  RLADEYGSGELRLTVEQNI  430



>ref|XP_010517336.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Camelina sativa]
Length=584

 Score =   464 bits (1195),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 239/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  167  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPEEIVDTRPYTNLLS  226

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS+GNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  227  QFITANSQGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  286

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPADD+ P+CKA+LEA+RDLG RG+RQK RMMWLIDELG+EGFRAE
Sbjct  287  SPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDLGTRGSRQKTRMMWLIDELGVEGFRAE  346

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGVHPQKQEG SFIGLH+PVGRL+ADDMDELA
Sbjct  347  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVHPQKQEGLSFIGLHVPVGRLQADDMDELA  406

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  407  RLADTYGSGELRLTVEQNI  425



>pdb|3B0M|A Chain A, M175k Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   464 bits (1194),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 227/259 (88%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSG DNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  175  WQIRGVVLPDVPEILKGLAEVGLTSLQSGKDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  234

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  235  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  294

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVC+AILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  295  SAKRCDEAIPLDAWVPADDVVPVCRAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  354

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  355  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  414

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  415  RLADEYGSGEIRLTVEQNI  433



>ref|XP_006349625.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Solanum tuberosum]
Length=584

 Score =   464 bits (1193),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 223/259 (86%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  168  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  227

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TAN RGN   +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  228  QYVTANFRGNVDVTNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  287

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWVPADD+ PVCKAILEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  288  SPKRCAEAIPLDAWVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  347

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+Q+LER +AE+L+QK WERR+Y GVHPQKQEGYSF+GLHIPVGR++ADDMDELA
Sbjct  348  VVKRMPQQKLERESAEDLVQKQWERREYLGVHPQKQEGYSFVGLHIPVGRVQADDMDELA  407

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  408  RLADEYGSGELRLTVEQNI  426



>ref|XP_010488973.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Camelina 
sativa]
Length=584

 Score =   464 bits (1193),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 239/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  167  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPEEIVDTRPYTNLLS  226

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS+GNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  227  QFITANSQGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  286

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPADD+ P+CKA+LEA+RDLG RG+RQK RMMWLIDELG+EGFRAE
Sbjct  287  SPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDLGTRGSRQKTRMMWLIDELGVEGFRAE  346

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGVHPQKQEG SFIGLH+PVGRL+ADDMDELA
Sbjct  347  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVHPQKQEGLSFIGLHVPVGRLQADDMDELA  406

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  407  RLADTYGSGELRLTVEQNI  425



>emb|CBI32406.3| unnamed protein product [Vitis vinifera]
Length=499

 Score =   461 bits (1185),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 244/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  76   WQIRGVVLPDVPEILKGLSEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  135

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITAN+RGN AF+NLPRKWNVCVVGSHDLYEHPHINDLAYMPA K GRFGFNLLVGGFF
Sbjct  136  QFITANARGNTAFTNLPRKWNVCVVGSHDLYEHPHINDLAYMPATKKGRFGFNLLVGGFF  195

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCA+AIPLDAW+PADD+ PVC+A+LEA+RDLG RGNRQK RMMWLIDELGIE FRAE
Sbjct  196  SPKRCADAIPLDAWIPADDVLPVCQAVLEAYRDLGTRGNRQKTRMMWLIDELGIEQFRAE  255

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+QELER+++E+L+QK WERRDY GVHPQKQEG+SF+G+HIPVGR++ADDMDELA
Sbjct  256  VVKRMPQQELERSSSEDLVQKQWERRDYLGVHPQKQEGFSFVGIHIPVGRVQADDMDELA  315

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  316  RLADEYGSGELRLTVEQNI  334



>pdb|3B0J|A Chain A, M175e Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   464 bits (1193),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 227/259 (88%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSG DNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  175  WQIRGVVLPDVPEILKGLAEVGLTSLQSGEDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  234

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  235  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  294

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVC+AILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  295  SAKRCDEAIPLDAWVPADDVVPVCRAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  354

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  355  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  414

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  415  RLADEYGSGEIRLTVEQNI  433



>pdb|3B0L|A Chain A, M175g Mutant Of Assimilatory Nitrite Reductase (Nii3) 
From Tobbaco Leaf
Length=584

 Score =   463 bits (1192),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 227/259 (88%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSG DNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  175  WQIRGVVLPDVPEILKGLAEVGLTSLQSGGDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  234

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  235  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  294

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVC+AILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  295  SAKRCDEAIPLDAWVPADDVVPVCRAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  354

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q+LERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  355  VEKRMPQQQLERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  414

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  415  RLADEYGSGEIRLTVEQNI  433



>prf||1908371A nitrite reductase
Length=583

 Score =   463 bits (1191),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 228/259 (88%), Positives = 241/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDT PY NLLS
Sbjct  167  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTGPYTNLLS  226

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVV SHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  227  QFITGNSRGNPAVSNLPRKWNPCVVASHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  286

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  287  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  346

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+QELERA+ E+L+QK WERRDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELA
Sbjct  347  VEKRMPQQELERASPEDLVQKQWERRDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELA  406

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  407  RLADEYGSGEIRLTVEQNI  425



>emb|CDY37232.1| BnaA09g08530D [Brassica napus]
Length=584

 Score =   463 bits (1191),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/259 (86%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  167  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLS  226

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS GNP FSNLPRKWNVCVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  227  QFITANSLGNPEFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  286

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ P+C A+LEAFRDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  287  SAKRCEEAIPLDAWVPADDVLPLCGAVLEAFRDLGTRGNRQKTRMMWLIDELGIEGFRAE  346

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGVHPQKQEG S+IGLH PVGRL+ADDMDELA
Sbjct  347  VEKRMPSGKLERESSEDLVNKQWERRDYFGVHPQKQEGLSYIGLHCPVGRLQADDMDELA  406

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  407  RLADTYGSGELRLTVEQNI  425



>ref|XP_011005977.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Populus 
euphratica]
Length=588

 Score =   463 bits (1191),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 225/259 (87%), Positives = 241/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEILRGL +V LTSLQSGMDNVRN VGNP+AGID +EIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILRGLAEVELTSLQSGMDNVRNPVGNPLAGIDTDEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNPAF+NLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF
Sbjct  231  QFITANSRGNPAFTNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWV ADD+ P CKA+LEA+RDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  291  SPKRCAEAVPLDAWVSADDVLPACKAVLEAYRDLGTRGNRQKTRMMWLIDELGIEGFRSE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QELER A+E+L+QK WERRDYFGVHPQKQEG S+ GLHIPVGR++ADDMDELA
Sbjct  351  VVKRMPRQELEREASEDLVQKQWERRDYFGVHPQKQEGLSYAGLHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YG+GELRLTVEQNI
Sbjct  411  RLADIYGTGELRLTVEQNI  429



>ref|XP_006297287.1| hypothetical protein CARUB_v10013302mg [Capsella rubella]
 gb|EOA30185.1| hypothetical protein CARUB_v10013302mg [Capsella rubella]
Length=588

 Score =   462 bits (1190),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 239/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  171  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPEEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITAN++GNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  231  QFITANAQGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  291  SPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDLGFRGNRQKTRMMWLIDELGVEGFRAE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGVHPQKQEG SFIGLH+PVGRL+ADDMDELA
Sbjct  351  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVHPQKQEGLSFIGLHVPVGRLQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  411  RLADTYGSGELRLTVEQNI  429



>ref|NP_179164.1| Ferredoxin--nitrite reductase [Arabidopsis thaliana]
 sp|Q39161.1|NIR_ARATH RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Short=NiR; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK26030.1|AF360320_1 putative ferredoxin-nitrite reductase [Arabidopsis thaliana]
 dbj|BAA03561.1| nitrite reductase [Arabidopsis thaliana]
 dbj|BAA21672.1| nitrite reductase [Arabidopsis thaliana]
 gb|AAD17406.1| ferredoxin--nitrite reductase [Arabidopsis thaliana]
 gb|AAK73966.1| At2g15620/F9O13.17 [Arabidopsis thaliana]
 gb|AAM16256.1| At2g15620/F9O13.17 [Arabidopsis thaliana]
 gb|AAN13223.1| putative ferredoxin-nitrite reductase [Arabidopsis thaliana]
 gb|AEC06424.1| Ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=586

 Score =   461 bits (1187),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  169  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPEEIVDTRPYTNLLS  228

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS+GNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  229  QFITANSQGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  288

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFR E
Sbjct  289  SPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRTE  348

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGV+PQKQEG SF+GLH+PVGRL+ADDMDELA
Sbjct  349  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVNPQKQEGLSFVGLHVPVGRLQADDMDELA  408

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  409  RLADTYGSGELRLTVEQNI  427



>emb|CDX71230.1| BnaC07g05090D [Brassica napus]
Length=586

 Score =   461 bits (1186),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 240/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  169  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLS  228

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFN+LVGGFF
Sbjct  229  QFITANSRGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNVLVGGFF  288

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPA+D+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  289  SPKRCEEAIPLDAWVPAEDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  348

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LERA++E+L+ K WERRDYFGVHPQKQEG S+IGLH+PVGRL+ADDMDELA
Sbjct  349  VEKRMPSGKLERASSEDLVNKQWERRDYFGVHPQKQEGLSYIGLHVPVGRLQADDMDELA  408

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YG+GELRLTVEQNI
Sbjct  409  RLADTYGTGELRLTVEQNI  427



>gb|AAN31831.1| putative ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=586

 Score =   461 bits (1186),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  169  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPEEIVDTRPYTNLLS  228

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS+GNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  229  QFITANSQGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  288

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFR E
Sbjct  289  SPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRTE  348

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGV+PQKQEG SF+GLH+PVGRL+ADDMDELA
Sbjct  349  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVNPQKQEGLSFVGLHVPVGRLQADDMDELA  408

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  409  RLADTYGSGELRLTVEQNI  427



>ref|XP_009123250.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Brassica rapa]
Length=628

 Score =   462 bits (1189),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 224/259 (86%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  211  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLS  270

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS GNP FSNLPRKWNVCVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  271  QFITANSLGNPEFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  330

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ P+C A+LEAFRDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  331  SAKRCEEAIPLDAWVPADDVLPLCGAVLEAFRDLGTRGNRQKTRMMWLIDELGIEGFRAE  390

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGVHPQKQEG S+IGLH PVGRL+ADDMDELA
Sbjct  391  VEKRMPSGKLERESSEDLVNKQWERRDYFGVHPQKQEGLSYIGLHCPVGRLQADDMDELA  450

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  451  RLADTYGSGELRLTVEQNI  469



>emb|CDY36642.1| BnaA07g04150D [Brassica napus]
Length=586

 Score =   461 bits (1185),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 218/259 (84%), Positives = 240/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  169  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLS  228

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFN+LVGGFF
Sbjct  229  QFITANSRGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNVLVGGFF  288

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPA+D+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  289  SPKRCEEAIPLDAWVPAEDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  348

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LERA++E+L+ K WERRDYFGVHPQKQEG S++GLH+PVGRL+ADDMDELA
Sbjct  349  VEKRMPSGKLERASSEDLVNKQWERRDYFGVHPQKQEGLSYVGLHVPVGRLQADDMDELA  408

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YG+GELRLTVEQNI
Sbjct  409  RLADTYGTGELRLTVEQNI  427



>gb|KFK40026.1| hypothetical protein AALP_AA3G320500 [Arabis alpina]
Length=583

 Score =   460 bits (1184),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  166  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLS  225

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  226  QFITANSRGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  285

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPADD+ P+CKA+LEA+RDLG RG+RQK RMMWLIDELG+EGFRAE
Sbjct  286  SPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDLGTRGSRQKTRMMWLIDELGVEGFRAE  345

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGVHPQKQEG S++GLH PVGRL+ADDMDELA
Sbjct  346  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVHPQKQEGLSYVGLHCPVGRLQADDMDELA  405

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  406  RLADTYGSGELRLTVEQNI  424



>ref|XP_009119404.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Brassica 
rapa]
Length=589

 Score =   460 bits (1184),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 218/259 (84%), Positives = 240/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  172  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLS  231

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFN+LVGGFF
Sbjct  232  QFITANSRGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNVLVGGFF  291

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPA+D+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  292  SPKRCEEAIPLDAWVPAEDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  351

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LERA++E+L+ K WERRDYFGVHPQKQEG S++GLH+PVGRL+ADDMDELA
Sbjct  352  VEKRMPSGKLERASSEDLVNKQWERRDYFGVHPQKQEGLSYVGLHVPVGRLQADDMDELA  411

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YG+GELRLTVEQNI
Sbjct  412  RLADAYGTGELRLTVEQNI  430



>ref|XP_010467309.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Camelina sativa]
Length=584

 Score =   460 bits (1184),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 239/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  167  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPEEIVDTRPYTNLLS  226

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITAN++GNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  227  QFITANAQGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  286

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPADD+ P+CKA+LEA+RDLG RG+RQK RMMWLIDELG+EGFRAE
Sbjct  287  SPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDLGTRGSRQKTRMMWLIDELGVEGFRAE  346

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGV+PQKQEG SFIGLH+PVGRL+ADDMDELA
Sbjct  347  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVNPQKQEGLSFIGLHVPVGRLQADDMDELA  406

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  407  RLADTYGSGELRLTVEQNI  425



>ref|XP_002883906.1| hypothetical protein ARALYDRAFT_899777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60165.1| hypothetical protein ARALYDRAFT_899777 [Arabidopsis lyrata subsp. 
lyrata]
Length=585

 Score =   460 bits (1183),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  168  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPEEIVDTRPYTNLLS  227

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS GNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  228  QFITANSVGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  287

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPAD++ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  288  SPKRCEEAIPLDAWVPADEVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  347

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGVHPQKQ+G SF+GLH+PVGRL+ADDMDELA
Sbjct  348  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVHPQKQDGLSFVGLHVPVGRLQADDMDELA  407

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  408  RLADTYGSGELRLTVEQNI  426



>ref|XP_010548020.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Tarenaya 
hassleriana]
Length=588

 Score =   460 bits (1183),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VG+P+AGIDP+EIVDTRPY NLLS
Sbjct  169  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGSPLAGIDPDEIVDTRPYTNLLS  228

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              ITANSRGNPAF+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  229  HYITANSRGNPAFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPAEKDGRFGFNLLVGGFF  288

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ P C+A+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  289  SAKRCEEAIPLDAWVPADDVLPSCRAVLEAYRDLGFRGNRQKTRMMWLIDELGLEGFRAE  348

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+ +LER ++E+LI+K WERRDYFGVHPQKQEG S++G+H+PVGRLEADDMDELA
Sbjct  349  VEKRMPDGKLERGSSEDLIKKQWERRDYFGVHPQKQEGLSYVGIHVPVGRLEADDMDELA  408

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA+ YGSGELRLTVEQNI
Sbjct  409  RLAETYGSGELRLTVEQNI  427



>gb|AGQ43559.1| nitrite reductase [Morus alba]
Length=587

 Score =   459 bits (1180),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  170  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  229

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  230  QFITANSRGNPIITNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  289

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWV  DD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  290  SPKRCEEAIPLDAWVSTDDVIPVCKAILEAFRDLGNRGNRQKTRMMWLIDELGIEGFRAE  349

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP + LERA++E+L+ K WERRDY GVHPQKQEG S++GLHIPVGR++ADDMDELA
Sbjct  350  VVKRMPGKSLERASSEDLVDKQWERRDYLGVHPQKQEGLSYVGLHIPVGRVQADDMDELA  409

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  410  RLADEYGTGELRLTVEQNI  428



>gb|EYU37674.1| hypothetical protein MIMGU_mgv1a003340mg [Erythranthe guttata]
Length=591

 Score =   459 bits (1180),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL+ VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTR Y NLLS
Sbjct  174  WQIRGVVLPDVPEILKGLDDVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRSYCNLLS  233

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNPAF+NLPRKWNVCV+GSHDLYEHPHINDLAYMPA K+GRFGFNLLVGGFF
Sbjct  234  QYITANSRGNPAFTNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKNGRFGFNLLVGGFF  293

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWVP DDI PVCKA+LE FRDLG RGNRQK RMMWLIDELGIEGFR E
Sbjct  294  SPKRCAEAIPLDAWVPGDDILPVCKAVLETFRDLGFRGNRQKTRMMWLIDELGIEGFREE  353

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            +VKRMP+  LERA++E+L+   WERRDYFG HPQKQEG SF+G+HIPVGR++ADDMDELA
Sbjct  354  IVKRMPQLSLERASSEDLVDAQWERRDYFGAHPQKQEGLSFVGIHIPVGRIQADDMDELA  413

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  414  RLADEYGSGELRLTVEQNI  432



>gb|AAN31830.1| putative ferredoxin--nitrite reductase [Arabidopsis thaliana]
Length=586

 Score =   458 bits (1178),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 218/259 (84%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGID EEIVDTRPY NLLS
Sbjct  169  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDQEEIVDTRPYTNLLS  228

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS+GNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  229  QFITANSQGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  288

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFR E
Sbjct  289  SPKRCEEAIPLDAWVPADDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRTE  348

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYFGV+PQKQEG SF+GLH+PVGRL+ADDMDELA
Sbjct  349  VEKRMPNGKLERGSSEDLVNKQWERRDYFGVNPQKQEGLSFVGLHVPVGRLQADDMDELA  408

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  409  RLADTYGSGELRLTVEQNI  427



>gb|KDO59703.1| hypothetical protein CISIN_1g047572mg [Citrus sinensis]
Length=595

 Score =   457 bits (1177),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 241/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL QVGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  179  WQIRGVVLPDVPEILKGLAQVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  238

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              ITAN++GNP  +NLPRKWNVCVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  239  HFITANAQGNPTVTNLPRKWNVCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  298

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWV ADD+ PVCKA+LEA+RDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  299  SPKRCAEAIPLDAWVAADDVIPVCKAVLEAYRDLGFRGNRQKTRMMWLIDELGIEGFRAE  358

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QEL+R ++E+L+Q+ W+RRDY GV+PQKQEG+S++GLHIPVGR++ADDMDELA
Sbjct  359  VVKRMPGQELDRGSSEDLVQRQWDRRDYLGVYPQKQEGFSYVGLHIPVGRVQADDMDELA  418

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  419  RLADAYGSGELRLTVEQNI  437



>gb|ADJ68001.1| nitrite reductase protein [Gossypium hirsutum]
Length=588

 Score =   457 bits (1176),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 241/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRG VLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  171  WQIRGAVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNPA +NLPRKWNVCVVGSHDLYEHPHINDLAYMPA K+GRFGFNLLVGGFF
Sbjct  231  QFITANSRGNPAVANLPRKWNVCVVGSHDLYEHPHINDLAYMPATKNGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWV ADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  291  SAKRCDEAIPLDAWVSADDVIPLCKAVLEAYRDLGYRGNRQKTRMMWLIDELGIEVFRSE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP++ELERA+ E L+QK WERRDY GVHPQKQEG+S+IG+HIPVGR++ADDMDELA
Sbjct  351  VAKRMPQKELERASDEGLVQKQWERRDYLGVHPQKQEGFSYIGIHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  411  RLADMYGSGELRLTVEQNI  429



>ref|XP_004140695.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57540.1| hypothetical protein Csa_3G207890 [Cucumis sativus]
Length=583

 Score =   457 bits (1175),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV+L DVP+IL+GL QVGLTSLQSGMDNVRN VGNP+AGIDPEEI+DTRPYNNLLS
Sbjct  166  WQIRGVLLSDVPDILKGLSQVGLTSLQSGMDNVRNPVGNPLAGIDPEEIIDTRPYNNLLS  225

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NS GNPAF+NLPRKWNVCV+GSHDLYEHPHINDLAYMPA K+GR GFN+LVGGFF
Sbjct  226  QFITGNSLGNPAFTNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKNGRMGFNVLVGGFF  285

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRCAEA+PLDAWVP +DI P+C AILEAFRDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  286  SAKRCAEAVPLDAWVPEEDIVPLCGAILEAFRDLGTRGNRQKCRMMWLIDELGIEGFRAE  345

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QELERA++E+L+ K WERRDYFGVHPQKQEG SF+G+HIPVGR++ADDMDELA
Sbjct  346  VVKRMPRQELERASSEDLVNKQWERRDYFGVHPQKQEGLSFVGIHIPVGRVQADDMDELA  405

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  406  RLADEYGTGELRLTVEQNI  424



>ref|NP_001274384.1| nitrate reductase precursor [Glycine max]
 gb|AGY36141.1| nitrite and sulphite reductase [Glycine max]
Length=605

 Score =   457 bits (1176),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPYNNLLS
Sbjct  188  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYNNLLS  247

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNPA SNLPRKWNVCVVGSHDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  248  QFITANSRGNPAMSNLPRKWNVCVVGSHDLFEHPHINDLAYMPANKDGRFGFNLLVGGFF  307

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRCAEAIPLDAWV ADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  308  SAKRCAEAIPLDAWVSADDVIPLCKAVLEAYRDLGFRGNRQKTRMMWLIDELGIEVFRSE  367

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP ++LERA+ EEL++K WERRDY GVHPQKQEG S++G+HIPVGR++ADDMDELA
Sbjct  368  VEKRMPGKKLERASKEELVKKQWERRDYLGVHPQKQEGLSYVGIHIPVGRVQADDMDELA  427

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+Y +GELRLTVEQNI
Sbjct  428  RLADEYATGELRLTVEQNI  446



>gb|KHN37511.1| Ferredoxin--nitrite reductase, chloroplastic [Glycine soja]
Length=591

 Score =   456 bits (1173),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPYNNLLS
Sbjct  174  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYNNLLS  233

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNPA SNLPRKWNVCVVGSHDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  234  QFITANSRGNPAMSNLPRKWNVCVVGSHDLFEHPHINDLAYMPANKDGRFGFNLLVGGFF  293

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRCAEAIPLDAWV ADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  294  SAKRCAEAIPLDAWVSADDVIPLCKAVLEAYRDLGFRGNRQKTRMMWLIDELGIEVFRSE  353

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP ++LERA+ EEL++K WERRDY GVHPQKQEG S++G+HIPVGR++ADDMDELA
Sbjct  354  VEKRMPGKKLERASKEELVKKQWERRDYLGVHPQKQEGLSYVGIHIPVGRVQADDMDELA  413

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+Y +GELRLTVEQNI
Sbjct  414  RLADEYATGELRLTVEQNI  432



>ref|XP_002518763.1| Ferredoxin--nitrite reductase, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF43688.1| Ferredoxin--nitrite reductase, chloroplast precursor, putative 
[Ricinus communis]
Length=587

 Score =   456 bits (1173),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 216/259 (83%), Positives = 244/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVL DVP+IL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLL+
Sbjct  170  WQIRGVVLSDVPDILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLT  229

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +T+NS+GNPA SNLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  230  QFLTSNSQGNPAVSNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  289

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRCAEAIPLDAWV ADD+ PVCKA+LEA+RDLG RGNRQK RMMWLIDE+G+EGFR+E
Sbjct  290  SAKRCAEAIPLDAWVSADDVIPVCKAVLEAYRDLGFRGNRQKTRMMWLIDEIGLEGFRSE  349

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V +RMP+Q+LERA++E+L+QK WERRDYFGVHPQ QEG+S++G+HIPVGR++ADDMDELA
Sbjct  350  VERRMPQQKLERASSEDLVQKQWERRDYFGVHPQSQEGFSYVGIHIPVGRVQADDMDELA  409

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  410  RLADTYGSGELRLTVEQNI  428



>ref|XP_004248736.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Solanum 
lycopersicum]
Length=584

 Score =   456 bits (1172),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 218/259 (84%), Positives = 241/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGID  EIVDTRPY NLLS
Sbjct  168  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDLHEIVDTRPYTNLLS  227

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TAN RGN   +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  228  QYVTANFRGNVDVTNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  287

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWVPADD+ PVCKAILEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  288  SPKRCAEAIPLDAWVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  347

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+++L+R ++E+L+ K WERR+Y GVHPQKQEGYSF+GLHIPVGR++ADDMDELA
Sbjct  348  VVKRMPQKKLDRESSEDLVLKQWERREYLGVHPQKQEGYSFVGLHIPVGRVQADDMDELA  407

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  408  RLADEYGSGELRLTVEQNI  426



>ref|XP_008456121.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Cucumis 
melo]
Length=583

 Score =   456 bits (1172),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVL DVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDPEEI+DTRPYNNLLS
Sbjct  166  WQIRGVVLADVPEILKGLAGVGLTSLQSGMDNVRNPVGNPLAGIDPEEIIDTRPYNNLLS  225

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NS GNPAF+NLPRKWNVCV+GSHDLYEHPHINDLAYMPA K+GR GFN+LVGGFF
Sbjct  226  QFITGNSLGNPAFTNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKNGRMGFNVLVGGFF  285

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRCAEA+PLDAWVP +DI P+C AILEAFRDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  286  SAKRCAEAVPLDAWVPEEDIAPLCGAILEAFRDLGTRGNRQKCRMMWLIDELGIEGFRAE  345

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QELERA++E+L++K WERRDYFGVHPQKQEG SF+G+HIPVGR++ADDMDELA
Sbjct  346  VVKRMPRQELERASSEDLVKKQWERRDYFGVHPQKQEGLSFVGIHIPVGRVQADDMDELA  405

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  406  RLADEYGTGELRLTVEQNI  424



>ref|XP_007201180.1| hypothetical protein PRUPE_ppa003315mg [Prunus persica]
 gb|EMJ02379.1| hypothetical protein PRUPE_ppa003315mg [Prunus persica]
 gb|AHM02308.1| nitrite reductase [Prunus persica]
Length=585

 Score =   456 bits (1172),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 240/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  168  WQIRGVVLPDVPEILKGLAKVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  227

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS GNP  +NLPRKWNVCVVGSHDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  228  QYITANSLGNPTVTNLPRKWNVCVVGSHDLFEHPHINDLAYMPATKDGRFGFNLLVGGFF  287

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWV ADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  288  SPKRCAEAVPLDAWVSADDVIPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGIEGFRAE  347

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP QELERA++E+L+QK WERRDY GVHPQKQEG S++GLHIPVGRL+ADDMDELA
Sbjct  348  VAKRMPFQELERASSEDLVQKQWERRDYVGVHPQKQEGLSYVGLHIPVGRLQADDMDELA  407

Query  57   RLADQYGSGELRLTVEQNI  1
             +AD+YG+GELRLTVEQNI
Sbjct  408  HVADKYGTGELRLTVEQNI  426



>ref|XP_006423019.1| hypothetical protein CICLE_v10028067mg [Citrus clementina]
 gb|ESR36259.1| hypothetical protein CICLE_v10028067mg [Citrus clementina]
Length=595

 Score =   456 bits (1173),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 242/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL QVGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  179  WQIRGVVLPDVPEILKGLAQVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  238

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              ITAN++GNP  +NLPRKWNVCVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  239  HFITANAQGNPTVTNLPRKWNVCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  298

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWV ADD+ PVCKA+LEA+RDLG+RGNRQK RMMWLIDELGIEGFRAE
Sbjct  299  SPKRCAEAIPLDAWVAADDVIPVCKAVLEAYRDLGSRGNRQKTRMMWLIDELGIEGFRAE  358

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VV+RMP QEL+RA++E+L+Q+ W+RRDY GVHPQKQEG++++GLHIPVGR++A DMDELA
Sbjct  359  VVRRMPGQELDRASSEDLVQRQWDRRDYLGVHPQKQEGFNYVGLHIPVGRVQAGDMDELA  418

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  419  RLADAYGSGELRLTVEQNI  437



>ref|XP_003529397.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Glycine max]
 gb|KHN43071.1| Ferredoxin--nitrite reductase, chloroplastic [Glycine soja]
Length=588

 Score =   456 bits (1172),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 243/259 (94%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPYNNLLS
Sbjct  171  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYNNLLS  230

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNPA SNLPRKWNVCVVGSHDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  231  QFITANSRGNPAMSNLPRKWNVCVVGSHDLFEHPHINDLAYMPANKDGRFGFNLLVGGFF  290

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRCAEAIPLDAWV ADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  291  SAKRCAEAIPLDAWVSADDVIPLCKAVLEAYRDLGFRGNRQKTRMMWLIDELGIEVFRSE  350

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP ++LERA+ EEL++K WERRDY GVHPQKQ+G S++G+HIPVGR++ADDMDELA
Sbjct  351  VEKRMPGKQLERASEEELVKKKWERRDYLGVHPQKQDGLSYVGIHIPVGRVQADDMDELA  410

Query  57   RLADQYGSGELRLTVEQNI  1
            RL D+YG+GELRLTVEQNI
Sbjct  411  RLVDKYGTGELRLTVEQNI  429



>ref|XP_004163915.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--nitrite reductase, 
chloroplastic-like [Cucumis sativus]
Length=583

 Score =   454 bits (1169),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 241/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV+L DVP+IL+GL QVGLTSLQSGMDNVRN VGNP+AGIDPEEI+DTRPYNNLLS
Sbjct  166  WQIRGVLLSDVPDILKGLSQVGLTSLQSGMDNVRNPVGNPLAGIDPEEIIDTRPYNNLLS  225

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NS GNPAF+NLPRKWNVCV+GSHDLYEHPHINDLAYMPA K+GR GFN+LVGGFF
Sbjct  226  QFITGNSLGNPAFTNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKNGRMGFNVLVGGFF  285

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRCAEA+PLDAWVP +DI P+C AILEAFRDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  286  SAKRCAEAVPLDAWVPEEDIVPLCGAILEAFRDLGTRGNRQKCRMMWLIDELGIEGFRAE  345

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QELERA++E+L+ K WERRDYFGVHP KQEG SF+G+HIPVGR++ADDMDELA
Sbjct  346  VVKRMPRQELERASSEDLVNKQWERRDYFGVHPXKQEGLSFVGIHIPVGRVQADDMDELA  405

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  406  RLADEYGTGELRLTVEQNI  424



>ref|XP_010107937.1| Ferredoxin--nitrite reductase [Morus notabilis]
 gb|EXC17337.1| Ferredoxin--nitrite reductase [Morus notabilis]
Length=583

 Score =   454 bits (1168),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 218/259 (84%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  166  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  225

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  226  QFITANSRGNPIITNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  285

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWV  DD+ PVC+A+LEAFRDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  286  SPKRCEEAIPLDAWVSTDDVIPVCRAVLEAFRDLGNRGNRQKTRMMWLIDELGIEGFRAE  345

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP + LERA++E+L+ K WERRDY GVHPQKQEG S++GLHIPVGR++ADDMDELA
Sbjct  346  VVKRMPGKSLERASSEDLVDKQWERRDYLGVHPQKQEGLSYVGLHIPVGRVQADDMDELA  405

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA++YG GELRLTVEQNI
Sbjct  406  RLAEEYGRGELRLTVEQNI  424



>ref|XP_010028471.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW55212.1| hypothetical protein EUGRSUZ_I01148 [Eucalyptus grandis]
Length=589

 Score =   454 bits (1167),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  172  WQIRGVVLPDVPEILKGLAGVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLS  231

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT N RGNPA +NLPRKWNVCV+GSHDLYEHPHINDLAYMPAMK+G+FGFNLLVGGFF
Sbjct  232  QFITGNFRGNPAITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAMKNGQFGFNLLVGGFF  291

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWV  DD+ PVCKAILEA+RDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  292  SPKRCEEAIPLDAWVSPDDVIPVCKAILEAYRDLGTRGNRQKTRMMWLIDELGIEGFRSE  351

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP Q LERA+ E+L+ K WERRDY GVHPQKQEG+SF+GLHIPVGR++ADDMDELA
Sbjct  352  VVKRMPHQILERASPEDLVHKQWERRDYLGVHPQKQEGFSFVGLHIPVGRVQADDMDELA  411

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD+YGSGELRLTVEQNI
Sbjct  412  RIADEYGSGELRLTVEQNI  430



>dbj|BAB55003.1| nitrite reductase [Prunus persica]
Length=532

 Score =   452 bits (1162),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 239/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  115  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  174

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS GNP  +NLPRKWNVCVVGSHDL+EHPHINDLAYMPA KDGR GFNLLVGGFF
Sbjct  175  QYITANSLGNPTVTNLPRKWNVCVVGSHDLFEHPHINDLAYMPATKDGRLGFNLLVGGFF  234

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWV ADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  235  SPKRCAEAVPLDAWVSADDVIPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGIEGFRAE  294

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP QELERA++E+L+QK WERRDY GVHPQKQEG S++GLHIPVGRL+ADDMDELA
Sbjct  295  VAKRMPFQELERASSEDLVQKQWERRDYVGVHPQKQEGLSYVGLHIPVGRLQADDMDELA  354

Query  57   RLADQYGSGELRLTVEQNI  1
             +AD+YG+GELRLTVEQNI
Sbjct  355  HVADKYGTGELRLTVEQNI  373



>ref|XP_007042430.1| Ferredoxin--nitrite reductase, chloroplastic [Theobroma cacao]
 gb|EOX98261.1| Ferredoxin--nitrite reductase, chloroplastic [Theobroma cacao]
Length=553

 Score =   452 bits (1164),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 215/259 (83%), Positives = 239/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVL DVP IL+GLE++GLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  167  WQIRGVVLSDVPRILKGLEEIGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  226

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP  +NLPRKWNVCVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  227  QFITANSRGNPTITNLPRKWNVCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  286

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWV  DD+ PVCKA+LEA+RDLG+RGNRQ+ RMMWLIDELG+E FR+E
Sbjct  287  SPKRCEEAIPLDAWVSTDDVIPVCKAVLEAYRDLGSRGNRQRTRMMWLIDELGLEVFRSE  346

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            + KRMP++ELERA++E+L+QK WERRDY GVHPQKQEG+S++G HIPVGR++ADDMDELA
Sbjct  347  IAKRMPQKELERASSEDLVQKQWERRDYLGVHPQKQEGFSYVGFHIPVGRVQADDMDELA  406

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  407  RLADTYGSGELRLTVEQNI  425



>gb|AAC17127.1| nitrite reductase [Capsicum annuum]
Length=588

 Score =   454 bits (1167),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 218/263 (83%), Positives = 243/263 (92%), Gaps = 4/263 (2%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPY----N  610
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY    +
Sbjct  169  WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPQEIVDTRPYANLLS  228

Query  609  NLLSQLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLV  430
            NLLSQ +TAN RGN +  NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLV
Sbjct  229  NLLSQYVTANFRGNLSVHNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKDGRFGFNLLV  288

Query  429  GGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEG  250
            GGFFS KRCAEAIPLDAWVPADD+ PVCK ILEA+RDLG RGNRQK RMMWLIDELG+EG
Sbjct  289  GGFFSPKRCAEAIPLDAWVPADDVVPVCKTILEAYRDLGTRGNRQKTRMMWLIDELGVEG  348

Query  249  FRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDM  70
            FRAEVVKRMP+++LER + E+L+QK WERR+Y GV+PQKQEGYSF+GLHIPVGR++ADDM
Sbjct  349  FRAEVVKRMPQKKLERESTEDLVQKQWERREYLGVNPQKQEGYSFVGLHIPVGRVQADDM  408

Query  69   DELARLADQYGSGELRLTVEQNI  1
            DELARLA++YGSGELRLTVEQNI
Sbjct  409  DELARLAEEYGSGELRLTVEQNI  431



>ref|XP_006487107.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Citrus sinensis]
Length=596

 Score =   454 bits (1167),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 240/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL QVGLTSLQSGMDNVRN VGNP+AGID EEIVDTRPY NLLS
Sbjct  180  WQIRGVVLPDVPEILKGLAQVGLTSLQSGMDNVRNPVGNPLAGIDLEEIVDTRPYTNLLS  239

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              ITAN++GNP  +NLPRKWNVCVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  240  HFITANAQGNPTVTNLPRKWNVCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  299

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWV ADD+ PVCKA+LEA+RDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  300  SPKRCAEAIPLDAWVAADDVIPVCKAVLEAYRDLGFRGNRQKTRMMWLIDELGIEGFRAE  359

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QEL+R ++E+L+Q+ W+RRDY GV+PQKQEG+S++GLHIPVGR++ADDMDELA
Sbjct  360  VVKRMPGQELDRGSSEDLVQRQWDRRDYLGVYPQKQEGFSYVGLHIPVGRVQADDMDELA  419

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  420  RLADAYGSGELRLTVEQNI  438



>ref|XP_008236500.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Prunus 
mume]
Length=585

 Score =   452 bits (1164),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 218/259 (84%), Positives = 239/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY N LS
Sbjct  168  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNFLS  227

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS GNP  +NLPRKWNVCVVGSHDL+EHPHINDLAYMPA K+GRFGFNLLVGGFF
Sbjct  228  QYITANSLGNPTVTNLPRKWNVCVVGSHDLFEHPHINDLAYMPATKNGRFGFNLLVGGFF  287

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWV ADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  288  SPKRCAEAVPLDAWVSADDVIPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGIEGFRAE  347

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP QELERA++E+L+QK WERRDY GVHPQKQEG S++GLHIPVGRL+ADDMDELA
Sbjct  348  VAKRMPFQELERASSEDLVQKQWERRDYVGVHPQKQEGLSYVGLHIPVGRLQADDMDELA  407

Query  57   RLADQYGSGELRLTVEQNI  1
             +AD+YG+GELRLTVEQNI
Sbjct  408  HVADKYGTGELRLTVEQNI  426



>gb|AIR07815.1| nitrite reductase, partial [Vitis labrusca x Vitis vinifera]
Length=413

 Score =   446 bits (1147),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 215/253 (85%), Positives = 238/253 (94%), Gaps = 0/253 (0%)
 Frame = -2

Query  759  VLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQLITAN  580
            VLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLSQ ITAN
Sbjct  1    VLPDVPEILKGLSEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLSQFITAN  60

Query  579  SRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFSAKRCA  400
            +RGN AF+NLPRKWNVCVVGSHDLYEHPHINDLAYMPA K GRFGFNLLVGGFFS KRCA
Sbjct  61   ARGNTAFTNLPRKWNVCVVGSHDLYEHPHINDLAYMPATKKGRFGFNLLVGGFFSPKRCA  120

Query  399  EAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEVVKRMP  220
            +AIPLDAW+PADD+ PVC+A+LEA+RDLG RGNRQK RMMWLIDELGIE FRAEVVKRMP
Sbjct  121  DAIPLDAWIPADDVLPVCQAVLEAYRDLGTRGNRQKTRMMWLIDELGIEQFRAEVVKRMP  180

Query  219  eqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELARLADQY  40
            +QELER+++E+L+QK WERRDY GVHPQKQEG+SF+G+HIPVGR++ADDMDELARLAD+Y
Sbjct  181  QQELERSSSEDLVQKQWERRDYLGVHPQKQEGFSFVGIHIPVGRVQADDMDELARLADEY  240

Query  39   GSGELRLTVEQNI  1
            GSGELRLTVEQNI
Sbjct  241  GSGELRLTVEQNI  253



>gb|ABR13308.1| putative nitrite reductase [Prunus dulcis]
Length=271

 Score =   439 bits (1130),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 214/253 (85%), Positives = 234/253 (92%), Gaps = 0/253 (0%)
 Frame = -2

Query  759  VLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQLITAN  580
            VLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLSQ ITAN
Sbjct  1    VLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLSQYITAN  60

Query  579  SRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFSAKRCA  400
            S GNP  +NLPRKWNVCVVGSHDL+EHPHINDLAYMPA KDGRFGFNLLVGGFFS KRCA
Sbjct  61   SLGNPTVTNLPRKWNVCVVGSHDLFEHPHINDLAYMPAAKDGRFGFNLLVGGFFSPKRCA  120

Query  399  EAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEVVKRMP  220
            EA+PLDAWV ADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELGIEGFRAEV KRMP
Sbjct  121  EAVPLDAWVSADDVIPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGIEGFRAEVAKRMP  180

Query  219  eqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELARLADQY  40
             QELERA++E+L+QK WERRDY GVHPQKQEG S++GLHIPVGRL+ADDMDELA +AD+Y
Sbjct  181  FQELERASSEDLVQKQWERRDYVGVHPQKQEGLSYVGLHIPVGRLQADDMDELAHVADKY  240

Query  39   GSGELRLTVEQNI  1
            G+GELRLTVEQNI
Sbjct  241  GTGELRLTVEQNI  253



>ref|XP_010530781.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Tarenaya hassleriana]
Length=590

 Score =   450 bits (1158),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 215/259 (83%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  172  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLS  231

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNP  +NLPRKWNVCVVG+HDLYEHPHINDLAY+PA KDGRFGFNLLVGGFF
Sbjct  232  QYITGNSRGNPGVTNLPRKWNVCVVGTHDLYEHPHINDLAYIPANKDGRFGFNLLVGGFF  291

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S +RC EAIPLDAWVPA+D+ P CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  292  SPRRCEEAIPLDAWVPAEDVLPSCKAVLEAYRDLGFRGNRQKTRMMWLIDELGLEGFRAE  351

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMPE++L RA +E+LI+K WERRDYFGVH QKQEG S++G+H+PVGRL+ADDMDELA
Sbjct  352  VEKRMPERKLRRAPSEDLIKKQWERRDYFGVHTQKQEGLSYVGIHVPVGRLQADDMDELA  411

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  412  RLADTYGSGELRLTVEQNI  430



>gb|ACD13218.1| nitrite reductase [Brassica rapa subsp. chinensis]
Length=593

 Score =   450 bits (1157),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 219/259 (85%), Positives = 233/259 (90%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  176  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLS  235

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS GNP FSNLPRKWNVCVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  236  QFITANSLGNPEFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPANKDGRFGFNLLVGGFF  295

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ P+C A+LEAFRDLG RG   + RMMWLIDELGIEGFRAE
Sbjct  296  SAKRCEEAIPLDAWVPADDVLPLCGAVLEAFRDLGTRGKLTETRMMWLIDELGIEGFRAE  355

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LER ++E+L+ K WERRDYF VHPQKQEG S+IGLH PVGRL+ADDMDELA
Sbjct  356  VEKRMPSGKLERESSEDLVNKQWERRDYFRVHPQKQEGLSYIGLHCPVGRLQADDMDELA  415

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGELRLTVEQNI
Sbjct  416  RLADTYGSGELRLTVEQNI  434



>ref|XP_009417626.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=597

 Score =   449 bits (1155),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 216/259 (83%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP I++GL +VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  173  WQIRGVTLPDVPAIMQGLGRVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  232

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              +TANSRGNPA +NLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF
Sbjct  233  AFVTANSRGNPAVTNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  292

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVP+DD+ PVCKAILEA+RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  293  SPKRCAEAVPLDAWVPSDDVIPVCKAILEAYRDLGTRGNRQKTRMMWLIDELGIEAFRSE  352

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V +RMP++ LERA+AEEL+QK+WERRDY GVHPQKQ G SF+GLHIPVGR++A DM ELA
Sbjct  353  VERRMPQELLERASAEELVQKEWERRDYLGVHPQKQPGLSFVGLHIPVGRVQASDMFELA  412

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQN+
Sbjct  413  RLADEYGSGELRLTVEQNV  431



>ref|XP_009346246.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Pyrus 
x bretschneideri]
Length=585

 Score =   447 bits (1151),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 218/259 (84%), Positives = 239/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  168  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPLEIVDTRPYTNLLS  227

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NS GNP  +NLPRKWNV VVG+HDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  228  QYITGNSLGNPNVTNLPRKWNVAVVGTHDLFEHPHINDLAYMPATKDGRFGFNLLVGGFF  287

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWV ADD+ PVCKAILEA+RDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  288  SPKRCAEAVPLDAWVSADDVIPVCKAILEAYRDLGFRGNRQKTRMMWLIDELGIEGFRSE  347

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP ++LERAA+E+L++K WERRDY GVHPQKQEG S++GLHIPVGRL+ADDMDELA
Sbjct  348  VVKRMPFEDLERAASEDLVKKQWERRDYMGVHPQKQEGLSYVGLHIPVGRLQADDMDELA  407

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  408  RLADEYGTGELRLTVEQNI  426



>ref|XP_010263547.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Nelumbo 
nucifera]
Length=592

 Score =   448 bits (1152),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 214/259 (83%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVPEI+  L +VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  174  WQIRGVELPDVPEIMEDLVRVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  233

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT NS GNPA +NLPRKWNVCVVGSHDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  234  HFITGNSGGNPAVTNLPRKWNVCVVGSHDLFEHPHINDLAYMPATKDGRFGFNLLVGGFF  293

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVPADD+ PVCKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  294  SPKRCAEAVPLDAWVPADDVVPVCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  353

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QELER++ E+L+QK WERRDY GVHPQKQEG+SF+GLH+PVGR++ ++MDELA
Sbjct  354  VVKRMPGQELERSSEEDLVQKQWERRDYLGVHPQKQEGFSFVGLHVPVGRVQGEEMDELA  413

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQN+
Sbjct  414  RLADEYGSGELRLTVEQNV  432



>gb|AAB50233.1| nitrite reductase [Glycine max]
Length=596

 Score =   447 bits (1150),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 216/259 (83%), Positives = 240/259 (93%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVV P+ PEIL+GL++VGLTSLQS MDNVRN VGNP+AGIDP+EIVDTRPYNNLLS
Sbjct  179  WQIRGVVHPECPEILKGLDEVGLTSLQSPMDNVRNPVGNPLAGIDPDEIVDTRPYNNLLS  238

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNPA SNLPRKWNVCVVGSHDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  239  QFITANSRGNPAMSNLPRKWNVCVVGSHDLFEHPHINDLAYMPANKDGRFGFNLLVGGFF  298

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRCAEAIPLDAWV ADD+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  299  SAKRCAEAIPLDAWVSADDVIPLCKAVLEAYRDLGFRGNRQKTRMMWLIDELGIEVFRSE  358

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP ++LERA+ EEL++K WERRDY GVHPQKQEG S++G+HIPVGR++ADDMDELA
Sbjct  359  VEKRMPGKKLERASKEELVKKQWERRDYLGVHPQKQEGLSYVGIHIPVGRVQADDMDELA  418

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+Y +GELRLTVEQNI
Sbjct  419  RLADEYATGELRLTVEQNI  437



>ref|XP_004505220.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Cicer arietinum]
Length=582

 Score =   446 bits (1147),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 212/259 (82%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AG DP+EIVDTRPY NLLS
Sbjct  165  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGFDPDEIVDTRPYTNLLS  224

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS GNP  +NLPRKWNVCVVGSHDL+EHPHINDLAYMPA K+GRFGFNLLVGGFF
Sbjct  225  QFITANSLGNPTITNLPRKWNVCVVGSHDLFEHPHINDLAYMPANKEGRFGFNLLVGGFF  284

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWV ADD+ P+CKA+LE +RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  285  SPKRCAEAVPLDAWVSADDVIPLCKAVLETYRDLGTRGNRQKTRMMWLIDELGIEVFRSE  344

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMPE++L RA+ E+LIQK WERRDY GVHPQKQEG S++G+HIPVGR++AD+MDELA
Sbjct  345  VEKRMPEKKLSRASQEDLIQKKWERRDYLGVHPQKQEGLSYVGIHIPVGRIQADEMDELA  404

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  405  RLADEYGTGELRLTVEQNI  423



>ref|XP_004294803.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=582

 Score =   445 bits (1145),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 214/259 (83%), Positives = 236/259 (91%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRG+VL DVP+IL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  165  WQIRGIVLADVPDILKGLAGVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  224

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NS GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDG+FGFNLLVGGFF
Sbjct  225  QYITGNSLGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKDGKFGFNLLVGGFF  284

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWV  +D+ PVCKAILEA+RDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  285  SPKRCAEAVPLDAWVSTEDMIPVCKAILEAYRDLGFRGNRQKTRMMWLIDELGIEGFRSE  344

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP +ELERA+ E+L+QK WERRDY GVHPQKQEG SF+GLHIPVGR++ADDMDELA
Sbjct  345  VVKRMPFKELERASTEDLVQKQWERRDYIGVHPQKQEGLSFVGLHIPVGRIQADDMDELA  404

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD+YG+GELRLTVEQNI
Sbjct  405  RIADEYGTGELRLTVEQNI  423



>ref|XP_008373138.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Malus 
domestica]
Length=585

 Score =   444 bits (1141),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 214/259 (83%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDV EIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP E+VDTRPY NLLS
Sbjct  168  WQIRGVVLPDVLEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPLEVVDTRPYTNLLS  227

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NS GNP  +NLPRKWNV VVG+HDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  228  QYITGNSLGNPNVTNLPRKWNVAVVGTHDLFEHPHINDLAYMPATKDGRFGFNLLVGGFF  287

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWV ADD+ PVCKAILEA+RDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  288  SPKRCAEAVPLDAWVSADDVIPVCKAILEAYRDLGFRGNRQKTRMMWLIDELGIEGFRSE  347

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP ++L RA++E+L++K WERRDY GVHPQKQEG S++GLHIPVGRL+ADDMDELA
Sbjct  348  VVKRMPFEDLVRASSEDLVKKQWERRDYMGVHPQKQEGLSYVGLHIPVGRLQADDMDELA  407

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  408  RLADEYGTGELRLTVEQNI  426



>ref|XP_003607969.1| Ferredoxin-nitrite reductase [Medicago truncatula]
 gb|AES90166.1| ferredoxin-nitrite reductase [Medicago truncatula]
Length=582

 Score =   443 bits (1140),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 210/259 (81%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  165  WQIRGVTLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLS  224

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANS GNP  +NLPRKWNVCV+GSHDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  225  QFITANSLGNPTITNLPRKWNVCVIGSHDLFEHPHINDLAYMPANKDGRFGFNLLVGGFF  284

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWV ADD+ P+CKA+LE +RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  285  SPKRCAEAVPLDAWVSADDVIPLCKAVLETYRDLGTRGNRQKTRMMWLIDELGIEVFRSE  344

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMPE++LERA+ EEL+QK WERRD  GVHPQKQEG S++G+H+PVGR++AD+MDELA
Sbjct  345  VEKRMPEKKLERASKEELVQKQWERRDILGVHPQKQEGLSYVGIHVPVGRIQADEMDELA  404

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD+YG+GELRLTVEQNI
Sbjct  405  RIADEYGTGELRLTVEQNI  423



>emb|CAC06095.1| ferredoxin-nitrite reductase [Lotus japonicus]
Length=582

 Score =   443 bits (1139),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 216/260 (83%), Positives = 238/260 (92%), Gaps = 1/260 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  164  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLS  223

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              ITANSRGNP  SNLPRKWNVCVVGSHDL+EHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  224  HFITANSRGNPTVSNLPRKWNVCVVGSHDLFEHPHINDLAYMPANKDGRFGFNLLVGGFF  283

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWV A+D+ PVCKAILE +RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  284  SPKRCAEAIPLDAWVSAEDVIPVCKAILEMYRDLGTRGNRQKTRMMWLIDELGIEVFRSE  343

Query  237  VVKRMPe-qeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            V KRMP  Q+LERA+ E+L+QK WERRDYFG +PQKQEG S++G+HIPVGR++AD+MDEL
Sbjct  344  VEKRMPLGQQLERASQEDLVQKQWERRDYFGANPQKQEGLSYVGIHIPVGRIQADEMDEL  403

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARLAD+YG+GELRLTVEQNI
Sbjct  404  ARLADEYGTGELRLTVEQNI  423



>ref|XP_007156512.1| hypothetical protein PHAVU_003G292100g [Phaseolus vulgaris]
 gb|ESW28506.1| hypothetical protein PHAVU_003G292100g [Phaseolus vulgaris]
Length=582

 Score =   442 bits (1138),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 215/260 (83%), Positives = 236/260 (91%), Gaps = 2/260 (1%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN+VGNP+AGIDP+EIVDTRPYNNLLS
Sbjct  165  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNSVGNPLAGIDPDEIVDTRPYNNLLS  224

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPA-MKDGRFGFNLLVGGF  421
            Q ITANS GNPA SNLPRKWNVCVVGSHDL+EHPHINDLAYMPA  KDGRFGFNLLVGGF
Sbjct  225  QFITANSLGNPAMSNLPRKWNVCVVGSHDLFEHPHINDLAYMPANNKDGRFGFNLLVGGF  284

Query  420  FSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            FSAKRCAEAIPLDAWV ADD+ PVCKA+LEA+RDLG RGNRQK RMMWLIDELGIE FR+
Sbjct  285  FSAKRCAEAIPLDAWVSADDVIPVCKAVLEAYRDLGFRGNRQKTRMMWLIDELGIEVFRS  344

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV KRM   +    A E+L++K WERRDY GVHPQKQEG S++G+HIPVGR++AD+MDEL
Sbjct  345  EVEKRM-AGKQLERAQEDLVKKQWERRDYLGVHPQKQEGLSYVGIHIPVGRIQADEMDEL  403

Query  60   ARLADQYGSGELRLTVEQNI  1
            A LAD+YGSGELRLTVEQNI
Sbjct  404  ALLADEYGSGELRLTVEQNI  423



>gb|AAA74456.1| nitrite reductase [Phaseolus vulgaris]
Length=582

 Score =   442 bits (1137),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 215/260 (83%), Positives = 236/260 (91%), Gaps = 2/260 (1%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN+VGNP+AGIDP+EIVDTRPYNNLLS
Sbjct  165  WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNSVGNPLAGIDPDEIVDTRPYNNLLS  224

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPA-MKDGRFGFNLLVGGF  421
            Q ITANS GNPA SNLPRKWNVCVVGSHDL+EHPHINDLAYMPA  KDGRFGFNLLVGGF
Sbjct  225  QFITANSLGNPAMSNLPRKWNVCVVGSHDLFEHPHINDLAYMPANNKDGRFGFNLLVGGF  284

Query  420  FSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            FSAKRCAEAIPLDAWV ADD+ PVCKA+LEA+RDLG RGNRQK RMMWLIDELGIE FR+
Sbjct  285  FSAKRCAEAIPLDAWVSADDVIPVCKAVLEAYRDLGFRGNRQKTRMMWLIDELGIEVFRS  344

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV KRM   +    A E+L++K WERRDY GVHPQKQEG S++G+HIPVGR++AD+MDEL
Sbjct  345  EVEKRM-AGKQLERAQEDLVKKQWERRDYLGVHPQKQEGLSYVGIHIPVGRIQADEMDEL  403

Query  60   ARLADQYGSGELRLTVEQNI  1
            A LAD+YGSGELRLTVEQNI
Sbjct  404  ALLADEYGSGELRLTVEQNI  423



>sp|P38500.1|NIR_BETPN RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor [Betula pendula]
 emb|CAA42690.1| ferredoxin--nitrite reductase [Betula pendula]
Length=583

 Score =   442 bits (1137),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 220/259 (85%), Positives = 238/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVL DVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGID  EIV TRPYNNLLS
Sbjct  166  WQIRGVVLSDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDIHEIVATRPYNNLLS  225

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGN AF+NLPRKWNVCVVGSHDL+EHPHINDLAYMPA+KDGRFGFNLLVGGFF
Sbjct  226  QFITANSRGNLAFTNLPRKWNVCVVGSHDLFEHPHINDLAYMPAIKDGRFGFNLLVGGFF  285

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S +RCAEA+PLDAWV ADDI  VCKAILEA+RDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  286  SPRRCAEAVPLDAWVSADDIILVCKAILEAYRDLGTRGNRQKTRMMWLIDELGIEGFRSE  345

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP QELERAA E+LI+K WERR+  GVHPQKQEG S++GLHIPVGR++ADDMDELA
Sbjct  346  VVKRMPNQELERAAPEDLIEKQWERRELIGVHPQKQEGLSYVGLHIPVGRVQADDMDELA  405

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YG GELRLTVEQNI
Sbjct  406  RLADTYGCGELRLTVEQNI  424



>gb|AGO67239.1| ferredoxin--nitrite reductase [Silene vulgaris]
Length=592

 Score =   441 bits (1135),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/259 (81%), Positives = 236/259 (91%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVL DVP+IL+GL+ VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRP+ NL+S
Sbjct  175  WQIRGVVLSDVPDILKGLDSVGLTSLQSGMDNVRNPVGNPLAGIDPLEIVDTRPFTNLIS  234

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TANSRGN + +NLPRKWN CV+GSHDLYEHPHINDLAYMPA K+G+FGFNLLVGGFF
Sbjct  235  QFVTANSRGNTSLTNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKNGQFGFNLLVGGFF  294

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWV A+D+ PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  295  SPKRCEEAIPLDAWVSAEDVVPVCKAVLEAFRDLGFRGNRQKTRMMWLIDELGLEGFRAE  354

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP Q LERA+ E+L++K WERR+Y GVHPQKQEG SF+GLHIPVGR++ADDMDELA
Sbjct  355  VEKRMPNQLLERASPEDLVKKQWERREYLGVHPQKQEGLSFVGLHIPVGRVQADDMDELA  414

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  415  RLADEYGSGELRLTVEQNI  433



>ref|XP_008778364.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Phoenix 
dactylifera]
Length=461

 Score =   436 bits (1121),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 212/259 (82%), Positives = 235/259 (91%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPD+P I++GL  VGLTSLQSGMDNVRN VGNP+AGIDP EI+DTRP+ NLLS
Sbjct  40   WQIRGVRLPDIPAIMQGLAGVGLTSLQSGMDNVRNPVGNPLAGIDPYEIIDTRPFTNLLS  99

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              ITANSRGNPA +NLPRKWNVCVVGSH+LYEHPHINDLAYMPAMK+G+ GFNLLVGGFF
Sbjct  100  AFITANSRGNPAVTNLPRKWNVCVVGSHELYEHPHINDLAYMPAMKNGKIGFNLLVGGFF  159

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVPADD+ PVCKA+LEA+RDLG RGNRQK RMMWLIDELGIE FR+E
Sbjct  160  SPKRCAEAVPLDAWVPADDVVPVCKAVLEAYRDLGNRGNRQKTRMMWLIDELGIEAFRSE  219

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP QELERA+AE+L+QK WERR+Y GVHPQKQ G SF+GLHIPVGR++A DM ELA
Sbjct  220  VEKRMPMQELERASAEDLVQKQWERRNYLGVHPQKQAGLSFVGLHIPVGRVQASDMFELA  279

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  280  RLADKYGSGELRLTVEQNI  298



>gb|AEW90647.1| nitrite reductase [Saponaria officinalis]
Length=426

 Score =   434 bits (1116),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 210/259 (81%), Positives = 233/259 (90%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVL DVP+IL+GL+ VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRP+ NL+S
Sbjct  60   WQIRGVVLSDVPDILKGLDSVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPFTNLIS  119

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TANSRGN + +NLPRKWN CV+GSHDLYEHPHINDLAYMPA KDG+FGFNLLVGGFF
Sbjct  120  QFVTANSRGNTSLTNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKDGKFGFNLLVGGFF  179

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EA+PLDAW  A+D+ PVCKA LEAFRDLG RGNRQK RMMWLIDELGIEGFRAE
Sbjct  180  SPKRCEEAMPLDAWCSAEDVVPVCKATLEAFRDLGFRGNRQKTRMMWLIDELGIEGFRAE  239

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP+Q LERA+ +EL+ K WERR+Y GVHPQKQEG SF+GLHIPVGR++ADDMDELA
Sbjct  240  VEKRMPDQLLERASPDELVNKQWERREYLGVHPQKQEGLSFVGLHIPVGRVQADDMDELA  299

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YG+GELRLTVEQNI
Sbjct  300  RLADVYGTGELRLTVEQNI  318



>sp|P05314.1|NIR_SPIOL RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor [Spinacia oleracea]
 emb|CAA34893.1| ferredoxin-nitrite reductase [Spinacia oleracea]
 emb|CAA30453.1| unnamed protein product [Spinacia oleracea]
Length=594

 Score =   439 bits (1129),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 212/259 (82%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEI++GLE VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRP+ NL+S
Sbjct  178  WQIRGVVLPDVPEIIKGLESVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPFTNLIS  237

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TANSRGN + +NLPRKWN CV+GSHDLYEHPHINDLAYMPA K+G+FGFNLLVGGFF
Sbjct  238  QFVTANSRGNLSITNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKNGKFGFNLLVGGFF  297

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWV A+D+ PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+E FR E
Sbjct  298  SIKRCEEAIPLDAWVSAEDVVPVCKAMLEAFRDLGFRGNRQKCRMMWLIDELGMEAFRGE  357

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMPEQ LERA++EEL+QKDWERR+Y GVHPQKQ+G SF+GLHIPVGRL+AD+M+ELA
Sbjct  358  VEKRMPEQVLERASSEELVQKDWERREYLGVHPQKQQGLSFVGLHIPVGRLQADEMEELA  417

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD YGSGELRLTVEQNI
Sbjct  418  RIADVYGSGELRLTVEQNI  436



>pdb|2AKJ|A Chain A, Structure Of Spinach Nitrite Reductase
Length=608

 Score =   439 bits (1130),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 212/259 (82%), Positives = 237/259 (92%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEI++GLE VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRP+ NL+S
Sbjct  192  WQIRGVVLPDVPEIIKGLESVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPFTNLIS  251

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TANSRGN + +NLPRKWN CV+GSHDLYEHPHINDLAYMPA K+G+FGFNLLVGGFF
Sbjct  252  QFVTANSRGNLSITNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKNGKFGFNLLVGGFF  311

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWV A+D+ PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+E FR E
Sbjct  312  SIKRCEEAIPLDAWVSAEDVVPVCKAMLEAFRDLGFRGNRQKCRMMWLIDELGMEAFRGE  371

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMPEQ LERA++EEL+QKDWERR+Y GVHPQKQ+G SF+GLHIPVGRL+AD+M+ELA
Sbjct  372  VEKRMPEQVLERASSEELVQKDWERREYLGVHPQKQQGLSFVGLHIPVGRLQADEMEELA  431

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD YGSGELRLTVEQNI
Sbjct  432  RIADVYGSGELRLTVEQNI  450



>ref|XP_010943064.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Elaeis 
guineensis]
Length=590

 Score =   436 bits (1120),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 210/259 (81%), Positives = 233/259 (90%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP I++GL  VGLTSLQSGMDNVRN VGNP+AGIDP EI+DTRP+ NLLS
Sbjct  169  WQIRGVQLPDVPAIMQGLAGVGLTSLQSGMDNVRNPVGNPLAGIDPHEIIDTRPFTNLLS  228

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              +TANSRGNPA +NLPRKWNVCVVGSHDLYEHPHINDLAYMPAMK+G+ GFNLLVGGFF
Sbjct  229  AFVTANSRGNPAVTNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKNGKIGFNLLVGGFF  288

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVPADD+ P CKA+LEA+RDLG+RGNRQK RMMWLIDELGIE FR+E
Sbjct  289  SPKRCAEAVPLDAWVPADDVIPACKAVLEAYRDLGSRGNRQKTRMMWLIDELGIEVFRSE  348

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP QELERA+  +L+QK WERRD+ GVHPQKQ G SF+GLHIPVGR++A DM ELA
Sbjct  349  VEKRMPMQELERASGGDLVQKQWERRDHLGVHPQKQAGLSFVGLHIPVGRVQASDMFELA  408

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  409  RLADEYGSGELRLTVEQNI  427



>ref|XP_010675576.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=601

 Score =   435 bits (1119),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 211/259 (81%), Positives = 235/259 (91%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEI++GLE VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRP+ NL+S
Sbjct  185  WQIRGVVLPDVPEIIKGLESVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPFTNLIS  244

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +T NSRGN   +NLPRKWN CV+GSHDLYEHPHINDLAYMPA K+G+ GFNLLVGGFF
Sbjct  245  QFVTDNSRGNLDITNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKNGKLGFNLLVGGFF  304

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWV A+D+ PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  305  SIKRCEEAIPLDAWVSAEDVVPVCKAMLEAFRDLGFRGNRQKCRMMWLIDELGMEGFRAE  364

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP Q LERA+AEEL+QK WERR+Y GVHPQKQEG SF+GLHIPVGRL+AD+M++LA
Sbjct  365  VEKRMPNQVLERASAEELVQKQWERREYLGVHPQKQEGLSFVGLHIPVGRLQADEMEDLA  424

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD+YGSGELRLTVEQNI
Sbjct  425  RIADEYGSGELRLTVEQNI  443



>gb|ADN97117.1| nitrite reductase [Beta vulgaris]
 gb|ADR71053.1| nitrite reductase [Beta vulgaris]
Length=599

 Score =   434 bits (1116),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 211/259 (81%), Positives = 234/259 (90%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEI++GLE VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRP+ NL+S
Sbjct  183  WQIRGVVLPDVPEIIKGLESVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPFTNLIS  242

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +T NSRGN   +NLPRKWN CV+GSHDLYEHPHINDLAYMPA K+G+ GFNLLVGGFF
Sbjct  243  QFVTDNSRGNLDITNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKNGKLGFNLLVGGFF  302

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWV A+D+ PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  303  SIKRCEEAIPLDAWVSAEDVVPVCKAMLEAFRDLGFRGNRQKCRMMWLIDELGMEGFRAE  362

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP Q LERA+AEEL+QK WERR+Y GVHPQKQEG SF+GLHIPVGR +ADDM++LA
Sbjct  363  VEKRMPNQVLERASAEELVQKQWERREYLGVHPQKQEGLSFVGLHIPVGRPQADDMEDLA  422

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD+YGSGELRLTVEQNI
Sbjct  423  RIADEYGSGELRLTVEQNI  441



>ref|NP_001268194.1| ferredoxin--nitrite reductase, chloroplastic-like [Vitis vinifera]
 gb|AEO72336.1| nitrite reductase 1 [Vitis vinifera]
Length=594

 Score =   434 bits (1115),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/259 (81%), Positives = 235/259 (91%), Gaps = 1/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  177  WQIRGVVLPDVPEILKGLSEVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLS  236

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITAN+RGN AF+NLPRKWNVCVVGSHDLYEHPHINDLAYMPA K G    +     FF
Sbjct  237  QFITANARGNTAFTNLPRKWNVCVVGSHDLYEHPHINDLAYMPATKKGDLDSSA-SRRFF  295

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCA+AIPLDAW+PADD+ PVC+A+LEA+RDLG RGNRQK RMMWLIDELGIE FRAE
Sbjct  296  SPKRCADAIPLDAWIPADDVLPVCQAVLEAYRDLGTRGNRQKTRMMWLIDELGIEQFRAE  355

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VVKRMP+QELER+++E+L+QK WERRDY GVHPQKQEG+SF+G+HIPVGR++ADDMDELA
Sbjct  356  VVKRMPQQELERSSSEDLVQKQWERRDYLGVHPQKQEGFSFVGIHIPVGRVQADDMDELA  415

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  416  RLADEYGSGELRLTVEQNI  434



>emb|CDY72359.1| BnaA07g36300D, partial [Brassica napus]
Length=411

 Score =   427 bits (1097),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  172  WQIRGVVLPDVPEILKGLASVGLTSLQSGMDNVRNPVGNPIAGIDPDEIVDTRPYTNLLS  231

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITANSRGNP F+NLPRKWNVCVVG+HDLYEHPHINDLAYMPA KDGRFGFN+LVGGFF
Sbjct  232  QFITANSRGNPDFTNLPRKWNVCVVGTHDLYEHPHINDLAYMPANKDGRFGFNVLVGGFF  291

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC EAIPLDAWVPA+D+ P+CKA+LEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  292  SPKRCEEAIPLDAWVPAEDVLPLCKAVLEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  351

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP  +LERA++E+L+ K WERRDYFGVHPQKQEG S++GLH+PVGRL+ADDMDELA
Sbjct  352  VEKRMPSGKLERASSEDLVNKQWERRDYFGVHPQKQEGLSYVGLHVPVGRLQADDMDELA  411



>gb|EMT07001.1| putative Ferredoxin--nitrite reductase, chloroplastic [Aegilops 
tauschii]
Length=464

 Score =   426 bits (1095),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 210/259 (81%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVPEIL GL  VGLTSLQSGMDNVRN VG+P+AGIDP EIVDTRPY NLLS
Sbjct  48   WQIRGVTLPDVPEILEGLRSVGLTSLQSGMDNVRNPVGSPLAGIDPLEIVDTRPYTNLLS  107

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT NS GN A +NLPRKWNVCV+G+HDLYEHPHINDLAYMPA KDG+FGFNLLVGGF 
Sbjct  108  SYITNNSEGNLAITNLPRKWNVCVIGTHDLYEHPHINDLAYMPAEKDGKFGFNLLVGGFI  167

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  168  SPKRWGEALPLDAWVPGDDIIPVCKAVLEAFRDLGTRGNRQKTRMMWLIDELGMEAFRSE  227

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            + KRMP   LERAAAE+LI K WERRDY GVHPQKQEG SF+GLH+PVGRL+A DM ELA
Sbjct  228  IEKRMPNGVLERAAAEDLIDKKWERRDYLGVHPQKQEGLSFVGLHVPVGRLQAADMFELA  287

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  288  RLADEYGSGELRLTVEQNI  306



>gb|EPS71034.1| hypothetical protein M569_03724 [Genlisea aurea]
Length=591

 Score =   430 bits (1105),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 208/260 (80%), Positives = 231/260 (89%), Gaps = 1/260 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV+LPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  175  WQIRGVILPDVPEILKGLKEVGLTSLQSGMDNVRNPVGNPLAGIDPLEIVDTRPYTNLLS  234

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR-FGFNLLVGGF  421
              ITA+ +GNPAF+NLPRKWNVCVVGS DLYEHPHINDLAYMPA K+G  FGFNL+VGGF
Sbjct  235  HYITADDQGNPAFTNLPRKWNVCVVGSPDLYEHPHINDLAYMPAAKEGGGFGFNLMVGGF  294

Query  420  FSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            FS KRCAEAIPLDAWVP DDI PVC AILE FRDLG+RGNRQK RMMWLIDELGIE FR 
Sbjct  295  FSPKRCAEAIPLDAWVPGDDILPVCGAILETFRDLGSRGNRQKTRMMWLIDELGIEAFRE  354

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EVVKRMP+  LER++ + L+   W+RRDYFG HPQKQ GYSFIG+HIPVGR++AD+M EL
Sbjct  355  EVVKRMPQHHLERSSPQSLLPPKWDRRDYFGAHPQKQHGYSFIGIHIPVGRIQADEMFEL  414

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARL+D YGSGELRLTVEQN+
Sbjct  415  ARLSDAYGSGELRLTVEQNV  434



>gb|ACL13515.1| ferredoxin-nitrite reductase precursor [Triticum aestivum]
Length=597

 Score =   426 bits (1095),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 210/259 (81%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVPEIL GL  VGLTSLQSGMDNVRN VG+P+AGIDP EIVDTRPY NLLS
Sbjct  181  WQIRGVTLPDVPEILEGLRSVGLTSLQSGMDNVRNPVGSPLAGIDPLEIVDTRPYTNLLS  240

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT NS GN A +NLPRKWNVCV+G+HDLYEHPHINDLAYMPA KDG+FGFNLLVGGF 
Sbjct  241  SYITNNSEGNLAITNLPRKWNVCVIGTHDLYEHPHINDLAYMPAEKDGKFGFNLLVGGFI  300

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  301  SPKRWGEALPLDAWVPGDDIIPVCKAVLEAFRDLGTRGNRQKTRMMWLIDELGMEAFRSE  360

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            + KRMP   LERAAAE+LI K WERRDY GVHPQKQEG SF+GLH+PVGRL+A DM ELA
Sbjct  361  IEKRMPNGVLERAAAEDLIDKKWERRDYLGVHPQKQEGLSFVGLHVPVGRLQAADMFELA  420

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  421  RLADEYGSGELRLTVEQNI  439



>ref|XP_004954025.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Setaria italica]
Length=593

 Score =   426 bits (1094),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 209/259 (81%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  176  WQIRGVTLPDVPAILEGLRAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLS  235

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT NS+GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG+FGFNLLVGGF 
Sbjct  236  SYITNNSQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGKFGFNLLVGGFI  295

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKAILEAFRDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  296  SPKRWGEALPLDAWVPGDDIIPVCKAILEAFRDLGNRGNRQKTRMMWLIDELGMEVFRSE  355

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+LI   WERRDY GVHPQKQEG S++GLH+PVGRL+A DM ELA
Sbjct  356  VEKRMPNGVLERAAPEDLIDAKWERRDYLGVHPQKQEGLSYVGLHVPVGRLQASDMFELA  415

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  416  RLADEYGTGELRLTVEQNI  434



>gb|ACL13516.1| ferredoxin-nitrite reductase precursor [Triticum aestivum]
Length=597

 Score =   426 bits (1094),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 210/259 (81%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVPEIL GL  VGLTSLQSGMDNVRN VG+P+AGIDP EIVDTRPY NLLS
Sbjct  181  WQIRGVTLPDVPEILEGLRSVGLTSLQSGMDNVRNPVGSPLAGIDPLEIVDTRPYTNLLS  240

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT NS GN A +NLPRKWNVCV+G+HDLYEHPHINDLAYMPA KDG+FGFNLLVGGF 
Sbjct  241  SYITNNSEGNLAITNLPRKWNVCVIGTHDLYEHPHINDLAYMPAEKDGKFGFNLLVGGFV  300

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  301  SPKRWGEALPLDAWVPGDDIIPVCKAVLEAFRDLGTRGNRQKTRMMWLIDELGMEAFRSE  360

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            + KRMP   LERAAAE+LI K WERRDY GVHPQKQEG SF+GLH+PVGRL+A DM ELA
Sbjct  361  IEKRMPNGVLERAAAEDLIDKKWERRDYLGVHPQKQEGLSFVGLHVPVGRLQAADMFELA  420

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  421  RLADEYGSGELRLTVEQNI  439



>dbj|BAK02992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=599

 Score =   426 bits (1094),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 209/259 (81%), Positives = 225/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVPEIL GL  VGLTSLQSGMDNVRN VG+P+AGIDP EIVDTRPY NLLS
Sbjct  183  WQIRGVTLPDVPEILDGLRSVGLTSLQSGMDNVRNPVGSPLAGIDPLEIVDTRPYTNLLS  242

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT NS GN A +NLPRKWNVCV+G+HDLYEHPHINDLAYMPA KDG+FGFNLLVGGF 
Sbjct  243  SYITNNSEGNLAITNLPRKWNVCVIGTHDLYEHPHINDLAYMPAEKDGKFGFNLLVGGFI  302

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  303  SPKRWGEALPLDAWVPGDDIIPVCKAVLEAFRDLGTRGNRQKTRMMWLIDELGMEAFRSE  362

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            + KRMP   LERAA E+LI K WERRDY GVHPQKQEG SF+GLH+PVGRL+A DM ELA
Sbjct  363  IEKRMPNGVLERAAPEDLIDKKWERRDYLGVHPQKQEGLSFVGLHVPVGRLQAADMFELA  422

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  423  RLADEYGSGELRLTVEQNI  441



>gb|AFW64354.1| hypothetical protein ZEAMMB73_724678 [Zea mays]
 gb|AFW64355.1| hypothetical protein ZEAMMB73_724678 [Zea mays]
Length=458

 Score =   421 bits (1081),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 205/259 (79%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AG+DP EIVDTRPY NLLS
Sbjct  40   WQIRGVTLPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLS  99

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              +T NS+GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG FGFNLLVGGF 
Sbjct  100  SYVTNNSQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGEFGFNLLVGGFI  159

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR AEA+PLDAWV  DD+ PVCKAILEA+RDLG+RGNRQK RMMWLIDELG+E FR+E
Sbjct  160  SPKRWAEALPLDAWVAGDDVVPVCKAILEAYRDLGSRGNRQKTRMMWLIDELGMEVFRSE  219

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+L+ K WERRDY GVHPQKQEG S++GLH+PVGRL+A DM ELA
Sbjct  220  VEKRMPNGVLERAAPEDLVDKRWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELA  279

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  280  RLADEYGTGELRLTVEQNI  298



>gb|AFW73584.1| hypothetical protein ZEAMMB73_832658 [Zea mays]
Length=593

 Score =   423 bits (1087),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 206/259 (80%), Positives = 228/259 (88%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AG+DP EIVDTRPY NLLS
Sbjct  174  WQIRGVTLPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLS  233

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT+NS+GNPA +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG+FGFNLLVGGF 
Sbjct  234  SYITSNSQGNPAITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGKFGFNLLVGGFI  293

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR AEA+PLDAWV  DD+ P CKAILEA+RDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  294  SPKRWAEALPLDAWVAGDDVVPACKAILEAYRDLGFRGNRQKTRMMWLIDELGMEVFRSE  353

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAAAE+L+ K WERRDY GVHPQKQEG S++GLH+PVGRL+A DM ELA
Sbjct  354  VEKRMPNGVLERAAAEDLVDKKWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELA  413

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQN+
Sbjct  414  RLADEYGTGELRLTVEQNV  432



>ref|XP_006647964.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Oryza brachyantha]
Length=597

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 206/259 (80%), Positives = 225/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  181  WQIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLS  240

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT N RGNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG+ GFNLLVGGF 
Sbjct  241  SFITGNFRGNPTVTNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGKLGFNLLVGGFI  300

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR AEA+PLDAWVP DDI PVCKAILEA+RDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  301  SPKRWAEALPLDAWVPGDDIIPVCKAILEAYRDLGTRGNRQKTRMMWLIDELGMEVFRSE  360

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+L+ K W+RRDY GVHPQKQEG S++GLH+PVGR++A DM ELA
Sbjct  361  VEKRMPNGALERAAPEDLVDKKWQRRDYLGVHPQKQEGLSYVGLHVPVGRVQAADMFELA  420

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRL VEQNI
Sbjct  421  RLADEYGSGELRLAVEQNI  439



>gb|AAA60450.1| nitrite reductase, partial [Zea mays]
Length=567

 Score =   420 bits (1080),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 205/259 (79%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AG+DP EIVDTRPY NLLS
Sbjct  149  WQIRGVTLPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLS  208

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              +T NS+GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG FGFNLLVGGF 
Sbjct  209  SYVTNNSQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGEFGFNLLVGGFI  268

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR AEA+PLDAWV  DD+ PVCKAILEA+RDLG+RGNRQK RMMWLIDELG+E FR+E
Sbjct  269  SPKRWAEALPLDAWVAGDDVVPVCKAILEAYRDLGSRGNRQKTRMMWLIDELGMEVFRSE  328

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+L+ K WERRDY GVHPQKQEG S++GLH+PVGRL+A DM ELA
Sbjct  329  VEKRMPNGVLERAAPEDLVDKRWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELA  388

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  389  RLADEYGTGELRLTVEQNI  407



>ref|XP_003570568.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Brachypodium 
distachyon]
Length=598

 Score =   421 bits (1083),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 207/259 (80%), Positives = 227/259 (88%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP+IL GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTRPY NLLS
Sbjct  182  WQIRGVTLPDVPDILDGLHSVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRPYTNLLS  241

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT NS+GN A +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDG+FGFNLLVGGF 
Sbjct  242  SYITNNSQGNLAVTNLPRKWNVCVIGSHDLYEHPHINDLAYMPAEKDGKFGFNLLVGGFI  301

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKAILEA+RDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  302  SPKRWGEALPLDAWVPGDDIIPVCKAILEAYRDLGTRGNRQKTRMMWLIDELGMEVFRSE  361

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            + KRMP   LERAAAE++I K WERRDY GVHPQKQ+G SF+GLH+PVGR++A DM  LA
Sbjct  362  IEKRMPGGVLERAAAEDMIDKAWERRDYLGVHPQKQQGLSFVGLHVPVGRVQAADMYSLA  421

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  422  RLADEYGSGELRLTVEQNI  440



>gb|ACG29734.1| ferredoxin--nitrite reductase [Zea mays]
Length=597

 Score =   421 bits (1082),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 205/259 (79%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AG+DP EIVDTRPY NLLS
Sbjct  179  WQIRGVTLPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLS  238

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              +T NS+GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG FGFNLLVGGF 
Sbjct  239  SYVTNNSQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGEFGFNLLVGGFI  298

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR AEA+PLDAWV  DD+ PVCKAILEA+RDLG+RGNRQK RMMWLIDELG+E FR+E
Sbjct  299  SPKRWAEALPLDAWVAGDDVVPVCKAILEAYRDLGSRGNRQKTRMMWLIDELGMEVFRSE  358

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+L+ K WERRDY GVHPQKQEG S++GLH+PVGRL+A DM ELA
Sbjct  359  VEKRMPNGVLERAAPEDLVDKRWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELA  418

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  419  RLADEYGTGELRLTVEQNI  437



>sp|P17847.1|NIR_MAIZE RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor, partial [Zea mays]
Length=569

 Score =   420 bits (1079),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 205/259 (79%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AG+DP EIVDTRPY NLLS
Sbjct  151  WQIRGVTLPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLS  210

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              +T NS+GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG FGFNLLVGGF 
Sbjct  211  SYVTNNSQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGEFGFNLLVGGFI  270

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR AEA+PLDAWV  DD+ PVCKAILEA+RDLG+RGNRQK RMMWLIDELG+E FR+E
Sbjct  271  SPKRWAEALPLDAWVAGDDVVPVCKAILEAYRDLGSRGNRQKTRMMWLIDELGMEVFRSE  330

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+L+ K WERRDY GVHPQKQEG S++GLH+PVGRL+A DM ELA
Sbjct  331  VEKRMPNGVLERAAPEDLVDKRWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELA  390

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  391  RLADEYGTGELRLTVEQNI  409



>ref|XP_008679282.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic [Zea 
mays]
 gb|AFW64352.1| ferredoxin--nitrite reductase, Precursor [Zea mays]
Length=597

 Score =   421 bits (1082),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 205/259 (79%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AG+DP EIVDTRPY NLLS
Sbjct  179  WQIRGVTLPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLS  238

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              +T NS+GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG FGFNLLVGGF 
Sbjct  239  SYVTNNSQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGEFGFNLLVGGFI  298

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR AEA+PLDAWV  DD+ PVCKAILEA+RDLG+RGNRQK RMMWLIDELG+E FR+E
Sbjct  299  SPKRWAEALPLDAWVAGDDVVPVCKAILEAYRDLGSRGNRQKTRMMWLIDELGMEVFRSE  358

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+L+ K WERRDY GVHPQKQEG S++GLH+PVGRL+A DM ELA
Sbjct  359  VEKRMPNGVLERAAPEDLVDKRWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELA  418

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  419  RLADEYGTGELRLTVEQNI  437



>ref|XP_008646302.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Zea mays]
Length=666

 Score =   422 bits (1085),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/259 (80%), Positives = 228/259 (88%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AG+DP EIVDTRPY NLLS
Sbjct  247  WQIRGVTLPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLS  306

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT+NS+GNPA +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG+FGFNLLVGGF 
Sbjct  307  SYITSNSQGNPAITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGKFGFNLLVGGFI  366

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR AEA+PLDAWV  DD+ P CKAILEA+RDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  367  SPKRWAEALPLDAWVAGDDVVPACKAILEAYRDLGFRGNRQKTRMMWLIDELGMEVFRSE  426

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAAAE+L+ K WERRDY GVHPQKQEG S++GLH+PVGRL+A DM ELA
Sbjct  427  VEKRMPNGVLERAAAEDLVDKKWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELA  486

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQN+
Sbjct  487  RLADEYGTGELRLTVEQNV  505



>sp|Q42997.1|NIR_ORYSJ RecName: Full=Ferredoxin--nitrite reductase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAA09122.1| ferredoxin-nitrite reductase [Oryza sativa (japonica cultivar-group)]
 dbj|BAC10721.1| putative ferredoxin--nitrite reductase, chloroplast precursor 
[Oryza sativa Japonica Group]
 gb|EEE54549.1| hypothetical protein OsJ_01727 [Oryza sativa Japonica Group]
Length=596

 Score =   419 bits (1077),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 204/259 (79%), Positives = 225/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTR Y NLLS
Sbjct  180  WQIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRSYTNLLS  239

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT+N +GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+K G+FGFNLLVGGF 
Sbjct  240  SYITSNFQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKGGKFGFNLLVGGFI  299

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKA+LEA+RDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  300  SPKRWEEALPLDAWVPGDDIIPVCKAVLEAYRDLGTRGNRQKTRMMWLIDELGMEAFRSE  359

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+LI K W+RRDY GVHPQKQEG S++GLH+PVGR++A DM ELA
Sbjct  360  VEKRMPNGVLERAAPEDLIDKKWQRRDYLGVHPQKQEGMSYVGLHVPVGRVQAADMFELA  419

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  420  RLADEYGSGELRLTVEQNI  438



>ref|XP_002454602.1| hypothetical protein SORBIDRAFT_04g034160 [Sorghum bicolor]
 gb|EES07578.1| hypothetical protein SORBIDRAFT_04g034160 [Sorghum bicolor]
Length=593

 Score =   419 bits (1077),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/259 (80%), Positives = 226/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AG+DP EIVDTRPY NLLS
Sbjct  176  WQIRGVTLPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLS  235

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT NS+GN   +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG+FGFNLLVGGF 
Sbjct  236  SYITNNSQGNTTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGKFGFNLLVGGFI  295

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR AEA+PLDAWV  DD+ PVCKAILEA+RDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  296  SPKRWAEALPLDAWVAGDDVVPVCKAILEAYRDLGFRGNRQKTRMMWLIDELGMEVFRSE  355

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAAAE+L+ K WERRDY GVHPQKQEG S++GLH+PVGRL+A DM ELA
Sbjct  356  VEKRMPNGVLERAAAEDLVDKTWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELA  415

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YG+GELRLTVEQNI
Sbjct  416  RLADEYGTGELRLTVEQNI  434



>gb|EEC70619.1| hypothetical protein OsI_01871 [Oryza sativa Indica Group]
Length=596

 Score =   419 bits (1076),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/259 (78%), Positives = 225/259 (87%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTR Y NLLS
Sbjct  180  WQIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRSYTNLLS  239

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT+N +GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+K G+FGFNLLVGGF 
Sbjct  240  SYITSNFQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKGGKFGFNLLVGGFI  299

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKA+LEA+RDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  300  SPKRWEEALPLDAWVPGDDIIPVCKAVLEAYRDLGTRGNRQKTRMMWLIDELGMEAFRSE  359

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA ++LI K W+RRDY GVHPQKQEG S++GLH+PVGR++A DM ELA
Sbjct  360  VEKRMPNGVLERAAPDDLIDKKWQRRDYLGVHPQKQEGMSYVGLHVPVGRVQAADMFELA  419

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  420  RLADEYGSGELRLTVEQNI  438



>ref|NP_001043008.1| Os01g0357100 [Oryza sativa Japonica Group]
 dbj|BAF04922.1| Os01g0357100 [Oryza sativa Japonica Group]
Length=594

 Score =   415 bits (1067),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 203/258 (79%), Positives = 224/258 (87%), Gaps = 0/258 (0%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            QIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTR Y NLLS 
Sbjct  179  QIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRSYTNLLSS  238

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
             IT+N +GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+K G+FGFNLLVGGF S
Sbjct  239  YITSNFQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKGGKFGFNLLVGGFIS  298

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
             KR  EA+PLDAWVP DDI PVCKA+LEA+RDLG RGNRQK RMMWLIDELG+E FR+EV
Sbjct  299  PKRWEEALPLDAWVPGDDIIPVCKAVLEAYRDLGTRGNRQKTRMMWLIDELGMEAFRSEV  358

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             KRMP   LERAA E+LI K W+RRDY GVHPQKQEG S++GLH+PVGR++A DM ELAR
Sbjct  359  EKRMPNGVLERAAPEDLIDKKWQRRDYLGVHPQKQEGMSYVGLHVPVGRVQAADMFELAR  418

Query  54   LADQYGSGELRLTVEQNI  1
            LAD+YGSGELRLTVEQNI
Sbjct  419  LADEYGSGELRLTVEQNI  436



>gb|EEE57859.1| hypothetical protein OsJ_08501 [Oryza sativa Japonica Group]
Length=501

 Score =   409 bits (1050),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/259 (78%), Positives = 224/259 (86%), Gaps = 1/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTR Y NLLS
Sbjct  86   WQIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRSYTNLLS  145

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT+N +GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+KDG+FGFNLLVGGF 
Sbjct  146  -YITSNFQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGKFGFNLLVGGFI  204

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKA+LEA+ DLG RGNRQK RMMWLIDELG+E F +E
Sbjct  205  SPKRWEEALPLDAWVPGDDIIPVCKAVLEAYCDLGTRGNRQKTRMMWLIDELGMEVFWSE  264

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+LI K W+RRDY GVHPQKQEG S++GLH+PVGR++A DM ELA
Sbjct  265  VEKRMPNGVLERAAPEDLIDKKWQRRDYLGVHPQKQEGLSYVGLHVPVGRVQAADMFELA  324

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  325  RLADEYGSGELRLTVEQNI  343



>ref|XP_002987413.1| hypothetical protein SELMODRAFT_183174 [Selaginella moellendorffii]
 gb|EFJ11500.1| hypothetical protein SELMODRAFT_183174 [Selaginella moellendorffii]
Length=604

 Score =   410 bits (1055),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 197/259 (76%), Positives = 226/259 (87%), Gaps = 1/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVL DVP+IL+GLE+VGL+SLQSGMDNVRN VGNP+AGIDP EIVDTRPY   LS
Sbjct  196  WQIRGVVLSDVPQILKGLEEVGLSSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTKTLS  255

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              I +N RGNP+ +NLPRKWNVCVVGSHDLYEHPHINDLAY+PA KDGRFGFN+LVGGFF
Sbjct  256  DFIISNGRGNPSITNLPRKWNVCVVGSHDLYEHPHINDLAYIPATKDGRFGFNILVGGFF  315

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVP D++ PVC++ILE FRDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  316  SPKRCAEALPLDAWVPGDEVIPVCQSILETFRDLGFRGNRQKCRMMWLIDELGIEGFRSE  375

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRM  + L RAA  +L+   W+RRD FGVH QKQ+G +F+GLH+PVGR++A +M ELA
Sbjct  376  VEKRM-REPLARAAETDLLNPSWQRRDLFGVHRQKQDGLNFVGLHVPVGRVQAAEMIELA  434

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  435  RLADEYGSGEIRLTVEQNI  453



>ref|XP_002979935.1| hypothetical protein SELMODRAFT_178021 [Selaginella moellendorffii]
 gb|EFJ18805.1| hypothetical protein SELMODRAFT_178021 [Selaginella moellendorffii]
Length=604

 Score =   410 bits (1053),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/259 (76%), Positives = 226/259 (87%), Gaps = 1/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVL DVP+IL GLE+VGL+SLQSGMDNVRN VGNP+AGIDP EIVDTRPY   LS
Sbjct  196  WQIRGVVLSDVPQILEGLEEVGLSSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTKTLS  255

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              I +N RGNP+ +NLPRKWNVCVVGSHDLYEHPHINDLAY+PA+KDGRFGFN+LVGGFF
Sbjct  256  DFIISNGRGNPSITNLPRKWNVCVVGSHDLYEHPHINDLAYIPAIKDGRFGFNILVGGFF  315

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVP D++ PVC++ILE FRDLG RGNRQK RMMWLIDELGIEGFR+E
Sbjct  316  SPKRCAEALPLDAWVPGDEVIPVCQSILETFRDLGFRGNRQKCRMMWLIDELGIEGFRSE  375

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRM  + L RAA  +L+   W+RRD FGVH QKQ+G +F+GLH+PVGR++A +M ELA
Sbjct  376  VEKRM-REPLARAAETDLLNPSWQRRDLFGVHRQKQDGLNFVGLHVPVGRVQAAEMIELA  434

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGE+RLTVEQNI
Sbjct  435  RLADEYGSGEIRLTVEQNI  453



>gb|AHZ35168.1| nitrite reductase, partial [Lactuca dolichophylla]
Length=279

 Score =   398 bits (1023),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/238 (82%), Positives = 215/238 (90%), Gaps = 0/238 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV L DVP IL+GL++VGLTSLQSGMDNVRN VGNP+AGIDP EIVDTRPY NLLS
Sbjct  42   WQIRGVTLSDVPSILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDPYEIVDTRPYTNLLS  101

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q ITAN RGNP F+NLPRKWNVCV+GSHDLYEHPHINDLAYMPA K+ RFGFNLLVGGFF
Sbjct  102  QFITANPRGNPEFTNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKNDRFGFNLLVGGFF  161

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWVPA+D+ PVC AILEA+RDLG RGNRQK RMMWLIDELG+EGFR+E
Sbjct  162  SPKRCAEAIPLDAWVPAEDVVPVCGAILEAYRDLGTRGNRQKTRMMWLIDELGVEGFRSE  221

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDE  64
            VVKRM EQ LERA++E+L+   WERRD FGV+PQKQEG SF+GLH+PVGR++ADDMDE
Sbjct  222  VVKRMSEQALERASSEDLVDPKWERRDMFGVNPQKQEGLSFVGLHVPVGRVQADDMDE  279



>ref|XP_006826233.1| hypothetical protein AMTR_s00132p00099120 [Amborella trichopoda]
 gb|ERM93470.1| hypothetical protein AMTR_s00132p00099120 [Amborella trichopoda]
Length=580

 Score =   404 bits (1039),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 225/261 (86%), Gaps = 2/261 (1%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVL DVP++L GL  VGL+SLQSGMDNVRN VGNP+AG DP EIVDTRPY  LL+
Sbjct  165  WQIRGVVLEDVPDVLEGLRGVGLSSLQSGMDNVRNPVGNPLAGFDPHEIVDTRPYTKLLT  224

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              I AN +GNPA +NLPRKWNVCVVGSHDL+EHPHINDLAY+PA K+GRFGFNLLVGGFF
Sbjct  225  DFIIANDQGNPAITNLPRKWNVCVVGSHDLFEHPHINDLAYIPATKNGRFGFNLLVGGFF  284

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEA+PLDAWVP +D+ P+C+A+LEA+RDLG RGNRQK RMMWLIDELGIE FRAE
Sbjct  285  SPKRCAEAVPLDAWVPEEDVVPLCRAMLEAYRDLGTRGNRQKTRMMWLIDELGIEAFRAE  344

Query  237  VVKRMP--eqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDE  64
            V +RMP  E  LERAA ++L++  W RRDYFG HPQKQ G +++GL++PVGRL+A DM E
Sbjct  345  VAERMPRGESALERAAEKDLVEPTWSRRDYFGPHPQKQSGLNYVGLYVPVGRLQAPDMLE  404

Query  63   LARLADQYGSGELRLTVEQNI  1
            LAR+A+ YGSGELRLTVEQNI
Sbjct  405  LARIAETYGSGELRLTVEQNI  425



>dbj|BAD53072.1| putative ferredoxin--nitrite reductase, chloroplast precursor 
[Oryza sativa Japonica Group]
Length=627

 Score =   404 bits (1037),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 225/290 (78%), Gaps = 31/290 (11%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTR Y NLLS
Sbjct  180  WQIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRSYTNLLS  239

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT+N +GNP  +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA+K G+FGFNLLVGGF 
Sbjct  240  SYITSNFQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKGGKFGFNLLVGGFI  299

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDEL--------  262
            S KR  EA+PLDAWVP DDI PVCKA+LEA+RDLG RGNRQK RMMWLIDEL        
Sbjct  300  SPKRWEEALPLDAWVPGDDIIPVCKAVLEAYRDLGTRGNRQKTRMMWLIDELVNHFFLHS  359

Query  261  -----------------------GIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYF  151
                                   G+E FR+EV KRMP   LERAA E+LI K W+RRDY 
Sbjct  360  STPLTELRMSQCSYQLIAVLALQGMEAFRSEVEKRMPNGVLERAAPEDLIDKKWQRRDYL  419

Query  150  GVHPQKQEGYSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            GVHPQKQEG S++GLH+PVGR++A DM ELARLAD+YGSGELRLTVEQNI
Sbjct  420  GVHPQKQEGMSYVGLHVPVGRVQAADMFELARLADEYGSGELRLTVEQNI  469



>gb|EEC74060.1| hypothetical protein OsI_09059 [Oryza sativa Indica Group]
Length=640

 Score =   403 bits (1036),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 202/259 (78%), Positives = 223/259 (86%), Gaps = 1/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVP IL GL  VGLTSLQSGMDNVRN VGNP+AGIDP+EIVDTR Y NLLS
Sbjct  225  WQIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRSYTNLLS  284

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT+N +GNP  +NLPRK NVCV+GSHDLYEHPHINDLAYMPA+KDG+FGFNLLVGGF 
Sbjct  285  -YITSNFQGNPTITNLPRKRNVCVIGSHDLYEHPHINDLAYMPAVKDGKFGFNLLVGGFI  343

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKA+LEA+ DLG RGNRQK RMMWLIDELG+E F +E
Sbjct  344  SPKRWEEALPLDAWVPGDDIIPVCKAVLEAYCDLGTRGNRQKTRMMWLIDELGMEVFWSE  403

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V KRMP   LERAA E+LI K W+RRDY GVHPQKQEG S++GLH+PVGR++A DM ELA
Sbjct  404  VEKRMPNGVLERAAPEDLINKKWQRRDYLGVHPQKQEGLSYVGLHVPVGRVQAADMFELA  463

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD+YGSGELRLTVEQNI
Sbjct  464  RLADEYGSGELRLTVEQNI  482



>ref|XP_001777025.1| predicted protein [Physcomitrella patens]
 dbj|BAE06055.1| ferredoxin-nitrite reductase [Physcomitrella patens]
 dbj|BAF43438.1| nitrite reductase [Physcomitrella patens]
 gb|EDQ58139.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/259 (69%), Positives = 217/259 (84%), Gaps = 1/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRG+VL DVP +L+GLE VGL+SLQSGMDNVRN VGNP+AGIDP+EIVDT P+  +LS
Sbjct  193  WQIRGIVLEDVPALLKGLESVGLSSLQSGMDNVRNPVGNPLAGIDPDEIVDTAPFCKVLS  252

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              I    +GNP  +NLPRKWNVCVVG+HDL+EHPHINDLAYMPA K+G FGFN+LVGGFF
Sbjct  253  DYIINRGQGNPQITNLPRKWNVCVVGTHDLFEHPHINDLAYMPATKNGVFGFNILVGGFF  312

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIP+DAWVPADD+ P+CKAILE +RDLG RGNRQK RMMWLIDE+GIE FRAE
Sbjct  313  SPKRCAEAIPMDAWVPADDVVPLCKAILETYRDLGTRGNRQKTRMMWLIDEMGIEEFRAE  372

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V +RMP       A ++L+   W RR ++GV+PQKQ G +++GLHIPVGRL A +M ELA
Sbjct  373  VERRMP-GGSILRAGKDLVDPSWTRRSFYGVNPQKQPGLNYVGLHIPVGRLHAPEMFELA  431

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD+YG+GE+R++VEQN+
Sbjct  432  RIADEYGNGEIRISVEQNL  450



>ref|XP_001775824.1| predicted protein [Physcomitrella patens]
 dbj|BAB92078.1| ferredoxin-nitrite reductase [Physcomitrella patens]
 dbj|BAF43437.1| nitrite reductase [Physcomitrella patens]
 gb|EDQ59363.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/259 (69%), Positives = 217/259 (84%), Gaps = 1/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRG++L DVP +L+GLE VGL+SLQSGMDNVRNAVGNP+AGIDP+EIVDT P    L+
Sbjct  193  WQIRGIMLEDVPSLLKGLESVGLSSLQSGMDNVRNAVGNPLAGIDPDEIVDTIPICQALN  252

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              I    +GN   +NLPRKWNVCVVG+HDL+EHPHINDLAY+PA K+G FGFN+LVGGFF
Sbjct  253  DYIINRGKGNTEITNLPRKWNVCVVGTHDLFEHPHINDLAYVPATKNGVFGFNILVGGFF  312

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S+KRCAEAIP+DAWVP DD+ P+CKAILE +RDLG RGNRQK RMMWLIDE+G+E FRAE
Sbjct  313  SSKRCAEAIPMDAWVPTDDVVPLCKAILETYRDLGTRGNRQKTRMMWLIDEMGVEEFRAE  372

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V +RMP     R A ++LI   W+RR +FGV+PQKQ G +++GLH+PVGRL A +M ELA
Sbjct  373  VERRMP-SGTIRRAGQDLIDPSWKRRSFFGVNPQKQAGLNYVGLHVPVGRLHAPEMFELA  431

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD+YG+GE+R+TVEQN+
Sbjct  432  RIADEYGNGEIRITVEQNL  450



>gb|EMS54112.1| Ferredoxin--nitrite reductase, chloroplastic [Triticum urartu]
Length=335

 Score =   370 bits (949),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGV LPDVPEIL GL  VGLTSLQSGMDNVRN VG+P+AGIDP EIVDTRPY NLLS
Sbjct  39   WQIRGVTLPDVPEILEGLRSVGLTSLQSGMDNVRNPVGSPLAGIDPLEIVDTRPYTNLLS  98

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT NS GN A +NLPRKWNVCV+G+HDLYEHPHINDLAYMPA KDG+FGFNLLVGGF 
Sbjct  99   SYITNNSEGNLAITNLPRKWNVCVIGTHDLYEHPHINDLAYMPAEKDGKFGFNLLVGGFI  158

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KR  EA+PLDAWVP DDI PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+E FR+E
Sbjct  159  SPKRWGEALPLDAWVPGDDIIPVCKAVLEAFRDLGTRGNRQKTRMMWLIDELGMEAFRSE  218

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLH  103
            + KRMP   LERAAAE+LI K WERRDY GVHPQKQEG SF+GLH
Sbjct  219  IEKRMPNGVLERAAAEDLIDKKWERRDYLGVHPQKQEGLSFVGLH  263



>dbj|BAE46577.1| nitrite reductase [Solanum lycopersicum]
Length=234

 Score =   345 bits (885),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GLE+VGLTSLQSGMDNVRN VGNP+AGIDPEEIVDTRPY NLLS
Sbjct  55   WQIRGVVLPDVPEILKGLEEVGLTSLQSGMDNVRNPVGNPLAGIDPEEIVDTRPYTNLLS  114

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA+KDGRFGFNLLVGGFF
Sbjct  115  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPAIKDGRFGFNLLVGGFF  174

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKAILEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  175  SAKRCDEAIPLDAWVPADDVVPVCKAILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  234



>dbj|BAE48314.1| nitrite reductase [Capsicum annuum]
Length=310

 Score =   345 bits (886),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEI++GL +VGLTSLQSGMDNVRNAVGNP+AGIDPEEIVDTRPY NLLS
Sbjct  130  WQIRGVVLPDVPEIIKGLAEVGLTSLQSGMDNVRNAVGNPLAGIDPEEIVDTRPYTNLLS  189

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT N+RGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  190  QFITGNARGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  249

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD+ PVCKA+LEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  250  SAKRCDEAIPLDAWVPADDVVPVCKAMLEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  309

Query  237  V  235
            V
Sbjct  310  V  310



>dbj|BAE46575.1| nitrite reductase [Physalis alkekengi]
Length=235

 Score =   341 bits (875),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL +VGLTSLQSGMDNVRNAVGNP+AGIDPEEIVDTRPY NLL+
Sbjct  55   WQIRGVVLPDVPEILKGLAEVGLTSLQSGMDNVRNAVGNPLAGIDPEEIVDTRPYTNLLT  114

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q IT NSRGNPA SNLPRKWN CVVGSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  115  QFITGNSRGNPAVSNLPRKWNPCVVGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  174

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC EAIPLDAWVPADD  PVCKA LEAFRDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  175  SAKRCDEAIPLDAWVPADDGVPVCKAFLEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAE  234

Query  237  V  235
            V
Sbjct  235  V  235



>dbj|BAE46578.1| nitrite reductase [Solanum lycopersicum]
Length=234

 Score =   332 bits (851),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            WQIRGVVLPDVPEIL+GL++VGLTSLQSGMDNVRN VGNP+AGID  EIVDTRPY NLLS
Sbjct  55   WQIRGVVLPDVPEILKGLDEVGLTSLQSGMDNVRNPVGNPLAGIDLHEIVDTRPYTNLLS  114

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
            Q +TAN RGN   +NLPRKWNVCV+GSHDLYEHPHINDLAYMPA KDGRFGFNLLVGGFF
Sbjct  115  QYVTANFRGNVDVTNLPRKWNVCVIGSHDLYEHPHINDLAYMPATKDGRFGFNLLVGGFF  174

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRCAEAIPLDAWVPADD+ PVCKAILEA+RDLG RGNRQK RMMWLIDELG+EGFRAE
Sbjct  175  SPKRCAEAIPLDAWVPADDVVPVCKAILEAYRDLGTRGNRQKTRMMWLIDELGVEGFRAE  234



>ref|XP_001419920.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98213.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=633

 Score =   332 bits (850),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 156/258 (60%), Positives = 197/258 (76%), Gaps = 0/258 (0%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D PEILR LE++G+ SLQSG+DNVRNA GNP+AG DP+EIVDTRPY   +  
Sbjct  225  QLRGVELKDAPEILRKLEELGMCSLQSGLDNVRNATGNPLAGFDPQEIVDTRPYTLAIQD  284

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
             +T   RGNPA +NL RKWNVCVVGS D +EHP INDLA++PAMKDG+FGFN++VGGF S
Sbjct  285  YVTGGGRGNPAIANLGRKWNVCVVGSSDFFEHPDINDLAFIPAMKDGKFGFNMIVGGFIS  344

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            ++R AE++ LDAW+P +++     A+L  FRD G RGNRQK RMMWLIDE+G+E FR EV
Sbjct  345  SQRAAESVSLDAWIPENELVAATHAVLTTFRDYGHRGNRQKCRMMWLIDEMGLETFRTEV  404

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
              RMP  +L R A  +LI ++  RR Y GVH QKQEG S++   +P GR++ +D+ E+A 
Sbjct  405  ASRMPTGDLARGAEVDLIDRESPRRSYIGVHAQKQEGLSWVAAAVPGGRMQPEDLAEMAD  464

Query  54   LADQYGSGELRLTVEQNI  1
            LAD+YG GE+RLTVEQN 
Sbjct  465  LADKYGEGEIRLTVEQNF  482



>ref|XP_003081527.1| Nii, plastid-targeted nitrite reductase apoenzyme (IC) [Ostreococcus 
tauri]
 emb|CAL56050.1| Riboflavin synthase-like beta-barrel [Ostreococcus tauri]
Length=986

 Score =   332 bits (852),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 200/258 (78%), Gaps = 0/258 (0%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D PEILR LE++G+ SLQSG+DNVRNA GNP+AG DP+EIVDTRPY   + +
Sbjct  217  QLRGVELKDAPEILRKLEELGMCSLQSGLDNVRNATGNPLAGFDPQEIVDTRPYTLAIQE  276

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
             +T   RGNPA +NL RKWNVCVVGS D +EHP INDLA++PAMKDG+ GFN++VGGF S
Sbjct  277  YVTGGGRGNPAIANLGRKWNVCVVGSSDFFEHPDINDLAFIPAMKDGKMGFNIIVGGFIS  336

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            ++R AE+I LDAWVP  ++     A+L  FRD G RGNRQK RMMWLIDE+G++ FR EV
Sbjct  337  SQRAAESISLDAWVPEGEVVAATHAVLTTFRDYGHRGNRQKCRMMWLIDEMGLDNFRLEV  396

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
              RMP  EL RAA ++LI +D  RR Y GVH QKQ+G+S++   +P GR++ +D+ E+A 
Sbjct  397  ASRMPIGELARAAEKDLIDRDSPRRSYIGVHEQKQDGFSWVAAAVPGGRMQPEDLREMAD  456

Query  54   LADQYGSGELRLTVEQNI  1
            L+D+YG+GE+RLTVEQN 
Sbjct  457  LSDKYGTGEIRLTVEQNF  474



>ref|WP_015179108.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
nigro-viridis]
 ref|YP_007118319.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
nigro-viridis PCC 7112]
 gb|AFZ09903.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
nigro-viridis PCC 7112]
Length=644

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/258 (57%), Positives = 195/258 (76%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + DVP+I R L++ G+TS+QSGMDNVRN  G+PVAG+D +E++DTR   N +  
Sbjct  125  QLRGIRIEDVPDIFRRLKEAGMTSIQSGMDNVRNITGSPVAGLDADELIDTRELANQVQD  184

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            LIT +  GNPAFSNLPRK+N+ + G  D   H  IND+A++PA KDG  GFN+LVGGFFS
Sbjct  185  LITNSGEGNPAFSNLPRKFNIAIAGCRDNSVHAEINDIAFVPAYKDGNIGFNVLVGGFFS  244

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  AIPL+AW    D+  +CKAIL  FRD G R NRQK+R+MWLIDELGIE FR+EV
Sbjct  245  AKRCEAAIPLNAWASPSDVVDLCKAILTVFRDRGPRANRQKSRLMWLIDELGIEQFRSEV  304

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             + +       A  +E++   W++RD+ G++PQKQ G +++GLH+PVGRL+A D+ +LAR
Sbjct  305  EQELGRTLPAAAPKDEIV---WDKRDHIGIYPQKQSGLNYVGLHVPVGRLQASDLFDLAR  361

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGSGELRLTVE+N+
Sbjct  362  IAEVYGSGELRLTVEENV  379



>ref|WP_006632844.1| ferredoxin-nitrite reductase [Microcoleus vaginatus]
 gb|EGK88063.1| precorrin-3B synthase [Microcoleus vaginatus FGP-2]
Length=644

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 192/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + DVP+I R L++ G+TS+QSGMDNVRN  G+PVAG+D +E++DTR   N +  
Sbjct  124  QLRGIRIEDVPDIFRRLKEAGMTSIQSGMDNVRNITGSPVAGLDADELIDTRELANQVQD  183

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GNPAFSNLPRK+N+ + G  D   H  IND+A++PA KDG  GFN+LVGGFFS
Sbjct  184  MITNSGEGNPAFSNLPRKFNIAIAGCRDNSVHAEINDIAFVPAYKDGNIGFNVLVGGFFS  243

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  AIPL+AW    D+  +CKAIL  FRD G R NRQK+R+MWLIDELGIE FRAEV
Sbjct  244  AKRCEAAIPLNAWASPSDVVDLCKAILTVFRDRGPRANRQKSRLMWLIDELGIEQFRAEV  303

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             + +       A  +   +  W++RD+ G++PQKQ G +++GLH+PVGRL A D+ +LAR
Sbjct  304  EQELGRTLPAAALKD---EITWDKRDHIGIYPQKQSGLNYVGLHVPVGRLLASDLFDLAR  360

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGSGELRLTVE+N+
Sbjct  361  IAEVYGSGELRLTVEENV  378



>ref|WP_009632002.1| precorrin-3B synthase [Synechocystis sp. PCC 7509]
Length=517

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 194/258 (75%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV + D+P+I   ++QVGLTS+QSGMDNVRN  G+P+AG+D EE+ DTR   + +  
Sbjct  106  QLRGVRIEDLPDIFDQMQQVGLTSIQSGMDNVRNITGDPIAGLDAEELFDTRELASQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GN  F+NLPRK+N+ + G  D   H  INDLA++PA K+ +FGFN+LVGGFFS
Sbjct  166  MITRNGEGNAEFTNLPRKFNIAISGGRDNSIHAEINDLAFIPAYKNEQFGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  AIPL+AWV  +++  VC+A+LE +RD G R NRQK+R+MWLIDE GIE FRAEV
Sbjct  226  AKRCDAAIPLNAWVAPEEVVAVCRAVLEVYRDNGLRANRQKSRLMWLIDEWGIEKFRAEV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K++ +  +  A  + +   DWE+RD+ GV+ QKQ G +++GLHIPVGRLEA DM ELAR
Sbjct  286  EKQLGKTLINAAEKDAI---DWEKRDHIGVYSQKQPGLNYVGLHIPVGRLEAQDMFELAR  342

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGS E+R +VEQN+
Sbjct  343  VAEVYGSSEIRFSVEQNV  360



>ref|WP_011057189.1| ferredoxin-nitrite reductase [Thermosynechococcus elongatus]
 ref|NP_682139.1| ferredoxin-nitrite reductase [Thermosynechococcus elongatus BP-1]
 dbj|BAC08901.1| ferredoxin--nitrite reductase [Thermosynechococcus elongatus 
BP-1]
Length=519

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 192/259 (74%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            QIRG+ + D+PEI+  L+  G+TS+QSGMDNVRN  G+PVAGID  E++DTRP    L  
Sbjct  97   QIRGLPIEDIPEIIEQLQACGITSVQSGMDNVRNLTGSPVAGIDAAELIDTRPLIMKLQA  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N +GNP FSNLPRK+N+ + G  D   H  IND+A++PA + GR GFN+LVGGFFS
Sbjct  157  MITNNGQGNPEFSNLPRKFNIAIEGGRDNSVHAEINDVAFVPAYRQGRLGFNVLVGGFFS  216

Query  414  AKRCAEAIPLDAWVPADD-IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            A+RCA AIPLDAWVP DD +  + +AILE FRD G RGNRQKAR+ WLIDE GIE FRA 
Sbjct  217  ARRCAAAIPLDAWVPPDDAVVQLSRAILEIFRDHGPRGNRQKARLRWLIDEWGIEKFRAA  276

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            VV ++P + L  AA +   + DW++RD+ GVH QKQ   +++GLH+PVGRL A D  ELA
Sbjct  277  VVAKLPFELLSAAAKD---EIDWDKRDHLGVHRQKQRRLNYVGLHVPVGRLYATDFYELA  333

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA  YG  E+RLTVEQN+
Sbjct  334  RLAQVYGQSEVRLTVEQNV  352



>ref|XP_009625017.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=230

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  522  GSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCK  343
             SHDLYEHPHIN LAY PA KDGRFGFNLLVGGFFSAKRC EAIPLDAWVPADD+ PVCK
Sbjct  19   SSHDLYEHPHINILAYTPATKDGRFGFNLLVGGFFSAKRCNEAIPLDAWVPADDVVPVCK  78

Query  342  AILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWER  163
            AILEAFRDLG RGNRQK RMMWLIDELG+EGFRAEV KRMP+Q+LERA+ E+L++K+ ER
Sbjct  79   AILEAFRDLGFRGNRQKCRMMWLIDELGVEGFRAEVEKRMPQQQLERASPEDLVRKERER  138

Query  162  RDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            RDY GVHPQKQEGYSFIGLHIPVGR++ADDMDELARLAD+YGSGE+  T+EQNI
Sbjct  139  RDYLGVHPQKQEGYSFIGLHIPVGRVQADDMDELARLADEYGSGEILFTMEQNI  192



>ref|XP_002507511.1| nadh-nitrite reductase [Micromonas sp. RCC299]
 gb|ACO68769.1| nadh-nitrite reductase [Micromonas sp. RCC299]
Length=997

 Score =   315 bits (806),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 190/259 (73%), Gaps = 0/259 (0%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            +Q+RG+ L + P I++G+   G+ SLQSG+DNVRNA GNP+AG DP EI+DTRP+   + 
Sbjct  232  FQLRGIELKNAPGIIQGVMDHGMCSLQSGLDNVRNATGNPLAGFDPHEIIDTRPFTRAIQ  291

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              ++   RGN   +NL RKWNVCVVG  D YEHP INDLA++PA+++G  GFN+LVGGF 
Sbjct  292  DYVSGGGRGNSDIANLGRKWNVCVVGGPDFYEHPDINDLAFIPALREGVVGFNILVGGFI  351

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S+ R AEAIPLDAWVPA ++     A++  FRD G RGNRQK RMMWLI+E+GI+ FRAE
Sbjct  352  SSARAAEAIPLDAWVPASEVVEATAAVITTFRDYGHRGNRQKCRMMWLIEEMGIDKFRAE  411

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  RMP Q +  A+ ++LI     RR Y GVH QKQ G  ++G+ +P GRL+ADDM ++A
Sbjct  412  VASRMPSQSMACASEDDLIDTSVSRRSYLGVHEQKQNGLCWVGICVPGGRLQADDMQDMA  471

Query  57   RLADQYGSGELRLTVEQNI  1
             LAD YGSGE+RLTVEQN 
Sbjct  472  DLADIYGSGEIRLTVEQNF  490



>ref|WP_009783247.1| ferredoxin-nitrite reductase [Lyngbya sp. PCC 8106]
 gb|EAW38366.1| nitrite reductase [Lyngbya sp. PCC 8106]
Length=510

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 192/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L DVP+I   ++QVGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRLEDVPDIFNRMQQVGLTSVQSGMDNVRNITGSPVAGLDADELYDTRQLVQQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GNP F+NLPRK+N+ + G  D   H  IND+A++PA KD  FGFN+LVGGFFS
Sbjct  166  MITGNGEGNPEFTNLPRKFNIAIAGCRDNSVHAEINDIAFVPAFKDETFGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  AIPL+AWV  + +  +C+AILE FRD G R NRQK+R+MWLIDE GI+ FR EV
Sbjct  226  AKRCDAAIPLNAWVKPNQVVSLCRAILEVFRDNGLRENRQKSRLMWLIDEWGIDKFRREV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
              +M E     A  +E++   W++RD+ GV+ QKQ G++++GL++PVGRL A+DM ELAR
Sbjct  286  ETQMGETLEAEAEKDEIL---WDKRDHIGVYTQKQAGFNYVGLNVPVGRLYANDMFELAR  342

Query  54   LADQYGSGELRLTVEQNI  1
            LA+ YG GELRLTVEQN+
Sbjct  343  LAEVYGQGELRLTVEQNL  360



>ref|WP_007355409.1| MULTISPECIES: ferredoxin-nitrite reductase [Kamptonema]
 emb|CBN56197.1| ferredoxin-nitrite reductase [ [[Oscillatoria] sp. PCC 6506]
Length=517

 Score =   303 bits (775),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 191/257 (74%), Gaps = 3/257 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + DVP+I R L++ G+TS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDVPDIFRRLKEAGMTSIQSGMDNVRNITGSPVAGLDSDELYDTRELCRQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
             IT    GNPAF+NLPRK+N+ + G  D   H  IND+A++PA KDG FGFN+LVGGFFS
Sbjct  166  TITNGGEGNPAFTNLPRKFNIAIAGCRDNSVHAEINDIAFIPAFKDGTFGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  AIPL+AWV   D+  +C AIL  +RD G R NRQK+R+MWLIDELG++GFRAEV
Sbjct  226  AKRCDAAIPLNAWVEPSDVVDLCTAILIVYRDRGLRANRQKSRLMWLIDELGVDGFRAEV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
              ++       AA +E++   W++RD+ GV+ QKQ G +++GLHIPVGRL A DM +LAR
Sbjct  286  ETQLDRTLQTAAAKDEIL---WDKRDHIGVYAQKQPGLNYVGLHIPVGRLYAADMFDLAR  342

Query  54   LADQYGSGELRLTVEQN  4
            +AD YGSGE+RLTVEQN
Sbjct  343  MADVYGSGEIRLTVEQN  359



>gb|ABW80920.1| ferredoxin--nitrite reductase [uncultured bacterium]
Length=515

 Score =   302 bits (774),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 193/258 (75%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + ++P+IL  L++VGLTS+QSGMDNVRN  G+P+AGIDP+E++D R     +  
Sbjct  97   QLRGIPIEEMPQILGYLKEVGLTSIQSGMDNVRNITGSPLAGIDPDELIDVRGLTRKVQD  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GNP+FSNLPRK+N+ + G  D   H  INDLA++PA K+GR GFN+LVGGFFS
Sbjct  157  MITNNGEGNPSFSNLPRKFNIAICGCRDNSVHAEINDLAFVPAFKNGRLGFNVLVGGFFS  216

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            A+RCAEAI LD WV   D+ P+C+A+L  +RD G R NRQKAR+MWLIDE G+E FRA V
Sbjct  217  ARRCAEAIGLDVWVDPRDVVPLCEAVLLVYRDHGLRANRQKARLMWLIDEWGLEKFRAAV  276

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             +++       A  +E++   W +RD  GVH QKQ G +F+GLH+PVGRL A +M ELAR
Sbjct  277  ERQIGHPLPRAAEKDEVV---WHKRDLLGVHAQKQPGLNFVGLHVPVGRLNALEMMELAR  333

Query  54   LADQYGSGELRLTVEQNI  1
            LA+ YGSGELRLTVEQN+
Sbjct  334  LAEVYGSGELRLTVEQNV  351



>ref|WP_011431706.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_476298.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD01035.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=515

 Score =   302 bits (774),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 193/258 (75%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + ++P+IL  L++VGLTS+QSGMDNVRN  G+P+AGIDP+E++D R     +  
Sbjct  97   QLRGIPIEEMPQILGYLKEVGLTSIQSGMDNVRNITGSPLAGIDPDELIDVRGLTRKVQD  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GNP+FSNLPRK+N+ + G  D   H  INDLA++PA K+GR GFN+LVGGFFS
Sbjct  157  MITNNGEGNPSFSNLPRKFNIAICGCRDNSVHAEINDLAFVPAFKNGRLGFNVLVGGFFS  216

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            A+RCAEAI LD WV   D+ P+C+A+L  +RD G R NRQKAR+MWLIDE G+E FRA V
Sbjct  217  ARRCAEAIGLDVWVDPRDVVPLCEAVLLVYRDHGLRANRQKARLMWLIDEWGLEKFRAAV  276

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             ++     L  A  +E++   W +RD  GVH QKQ G +F+GLH+PVGRL A +M ELAR
Sbjct  277  ERQTGHPLLRAAEKDEVV---WHKRDLLGVHAQKQPGLNFVGLHVPVGRLNALEMMELAR  333

Query  54   LADQYGSGELRLTVEQNI  1
            LA+ YGSGELRLTVEQN+
Sbjct  334  LAEVYGSGELRLTVEQNV  351



>ref|WP_011429510.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-3-3Ab]
 ref|YP_474090.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-3-3Ab]
 gb|ABC98827.1| ferredoxin-nitrite reductase [Synechococcus sp. JA-3-3Ab]
Length=515

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 193/258 (75%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + ++P+IL  L++VGLTS+QSGMDNVRN  G+P+AGIDP+E++D R     +  
Sbjct  97   QLRGIPIEEMPQILGYLKEVGLTSIQSGMDNVRNITGSPLAGIDPDELIDVRGLTRKVQD  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            ++T N  GNP+FSNLPRK+N+ + G  D   H  INDLA++PA K+GR GFN+LVGGFFS
Sbjct  157  MVTNNGEGNPSFSNLPRKFNIAICGCRDNSVHAEINDLAFVPAFKNGRLGFNVLVGGFFS  216

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            A+RCAEAI LD WV   D+ P+C+A+L  +RD G R NRQKAR+MWLIDE G+E FRA V
Sbjct  217  ARRCAEAIGLDVWVDPRDVVPLCEAVLLVYRDHGLRANRQKARLMWLIDEWGLEKFRAAV  276

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             +++       A  +E++   W +RD  GVH QKQ G +F+GLH+PVGRL A +M ELAR
Sbjct  277  ERQIGHPLPRAAEKDEVV---WHKRDLLGVHAQKQPGLNFVGLHVPVGRLNALEMMELAR  333

Query  54   LADQYGSGELRLTVEQNI  1
            LA+ YGSGELRLTVEQN+
Sbjct  334  LAEVYGSGELRLTVEQNV  351



>ref|WP_015142945.1| precorrin-3B synthase [Pleurocapsa minor]
 ref|YP_007080194.1| precorrin-3B synthase [Pleurocapsa sp. PCC 7327]
 gb|AFY76637.1| precorrin-3B synthase [Pleurocapsa sp. PCC 7327]
Length=515

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/260 (57%), Positives = 193/260 (74%), Gaps = 4/260 (2%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            +Q+RG+ + DVP+I+R L+ VG+TS+QSGMDNVRN  G+PVAG+D +E++DTR     + 
Sbjct  107  FQLRGIRIEDVPDIVRRLKAVGMTSVQSGMDNVRNITGSPVAGLDTDELIDTRELVQKIQ  166

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
              IT +  GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G+ GFN+LVGGFF
Sbjct  167  DAITNSGEGNYEFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGQLGFNVLVGGFF  226

Query  417  SAKRCAEAIPLDAWVPA-DDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            SAKRC  AIPL+AWVP  DD+  +C+AIL  FRD G R NRQKAR+MWLIDE+GIE FR+
Sbjct  227  SAKRCEAAIPLNAWVPPNDDVVDLCRAILIVFRDHGLRANRQKARLMWLIDEVGIETFRS  286

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
             V K+        A  +   Q DWE+RD+ G+ PQKQ G +F+GLH+PVGRL A DM +L
Sbjct  287  MVEKQFGRPLATEAQKD---QIDWEKRDFIGIFPQKQPGLNFVGLHVPVGRLYAGDMLDL  343

Query  60   ARLADQYGSGELRLTVEQNI  1
            AR+A+ YGSGE+RLTVEQN+
Sbjct  344  ARMAEVYGSGEIRLTVEQNV  363



>ref|WP_015196742.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
parietina]
 ref|YP_007136061.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 6303]
 gb|AFZ00089.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 6303]
Length=515

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/261 (57%), Positives = 189/261 (72%), Gaps = 6/261 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI R  +QVGLT++QSGMDNVRN  G+ VAG+D  E+ DTR     +  
Sbjct  107  QLRGIRIEDLPEIFRHFQQVGLTTIQSGMDNVRNITGDAVAGLDAAELFDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR---FGFNLLVGG  424
            +IT N  GN  FSNLPRK+N+ + G  D   H  INDLA++PA K+     FGFN+LVGG
Sbjct  167  MITNNGEGNSEFSNLPRKFNIAITGGRDNSVHAEINDLAFIPAFKEDSSQTFGFNILVGG  226

Query  423  FFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFR  244
            FFSAKRC  AIPLD WV  +++  VC+AILE FRD G R NRQKAR+MWLIDE+GIE FR
Sbjct  227  FFSAKRCDAAIPLDVWVAPEEVVAVCRAILEVFRDHGLRANRQKARLMWLIDEMGIEVFR  286

Query  243  AEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDE  64
             +V  ++ +  L  AA +   + DWE+RD+ G+ PQKQ G++++GL IPVGRL AD M E
Sbjct  287  QQVETKIGKSLLPAAAKD---EIDWEKRDHLGIFPQKQPGFNYVGLQIPVGRLNADSMFE  343

Query  63   LARLADQYGSGELRLTVEQNI  1
            LARLA+ YGSGELR TVEQN+
Sbjct  344  LARLAEVYGSGELRFTVEQNV  364



>ref|XP_003057941.1| nitrite reductase fusion with b5r chloroplast precursor [Micromonas 
pusilla CCMP1545]
 gb|EEH57892.1| nitrite reductase fusion with b5r chloroplast precursor [Micromonas 
pusilla CCMP1545]
Length=1004

 Score =   312 bits (799),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/261 (59%), Positives = 191/261 (73%), Gaps = 2/261 (1%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            +Q+RG+ L D PE+L+G   VGL SLQSG+DNVRNA GNP+AG DP EIVDTRP    L 
Sbjct  233  FQLRGLQLKDAPEVLKGCADVGLCSLQSGLDNVRNATGNPLAGFDPHEIVDTRPITRALQ  292

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMK-DGRFGFNLLVGGF  421
              +T   RGN   +NLPRKWNVCVVG  D YEHP INDLA++PA+  +G FGFN LVGGF
Sbjct  293  DYVTGGGRGNALIANLPRKWNVCVVGGPDFYEHPDINDLAFIPAVNAEGVFGFNALVGGF  352

Query  420  FSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
             SA R AEA+PL+AWVP  D+  +  A+L  FRD G RGNRQK RMMWL++E+G+E F+A
Sbjct  353  ISASRAAEAVPLNAWVPESDVVAMTHAVLTTFRDYGHRGNRQKCRMMWLVEEMGLEKFKA  412

Query  240  EVVKRMPeqeleraaaeeLIQKD-WERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDE  64
            EV  RMP + L  AA ++LI+    ERR Y GVH QKQ G  ++G  +P GRL+A+D++E
Sbjct  413  EVKSRMPGERLADAAPKDLIEDSPIERRSYLGVHQQKQAGLKWVGACVPGGRLQAEDLEE  472

Query  63   LARLADQYGSGELRLTVEQNI  1
            LA L + YG+G++RLTVEQN 
Sbjct  473  LADLVETYGTGDVRLTVEQNF  493



>ref|WP_017288935.1| hypothetical protein [Leptolyngbya boryana]
 dbj|BAA06530.1| nitrite reductase [Leptolyngbya boryana]
Length=654

 Score =   304 bits (779),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 193/259 (75%), Gaps = 3/259 (1%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            +Q+RG+ + D+PEI R  +Q GLTS+QSGMDNVRN  G+PVAGID +E++DTR     + 
Sbjct  104  FQLRGIRIEDLPEIFRKFDQAGLTSIQSGMDNVRNITGSPVAGIDADELIDTRGLVRKVQ  163

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
             +IT N RGN +FSNLPRK+N+ + G  D   H  IND+A++PA KDG  GFN+LVGGFF
Sbjct  164  DMITNNGRGNSSFSNLPRKFNIAIAGCRDNSVHAEINDIAFVPAFKDGTLGFNILVGGFF  223

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            S KRC  AIPL+AWV   D+  VC+AIL  +R+LG R NRQKAR+MWLIDE+G+E FR  
Sbjct  224  SGKRCEAAIPLNAWVDPRDVVAVCEAILTVYRNLGLRANRQKARLMWLIDEMGLEPFREA  283

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V K++       AA +E++   W++RD+ G+H QKQ G +++GLH+PVGRL A D+ +LA
Sbjct  284  VEKQLGYAFTPAAAKDEIL---WDKRDHIGIHAQKQPGLNYVGLHVPVGRLYAQDLFDLA  340

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGE+RLTVEQN+
Sbjct  341  RIAEVYGSGEIRLTVEQNV  359



>ref|WP_008189055.1| ferredoxin-nitrite reductase [Moorea producens]
 gb|EGJ29689.1| assimilatory nitrite reductase/ferredoxin precursor [Moorea producens 
3L]
Length=533

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 193/259 (75%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I R  EQVGLTS+QSGMDNVRN  G+P+AGID +E++DTR     +  
Sbjct  128  QLRGIRIEDMPDIFRRFEQVGLTSVQSGMDNVRNITGSPMAGIDRDELIDTRDLVQKVQD  187

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT NS+GN  F+NLPRK+N+ + G  D   H  IND+A++PA KDG+ G N+LVGGFFS
Sbjct  188  MITNNSQGNYEFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKDGQLGLNVLVGGFFS  247

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  A+PL+AWV P DD+  +C+AILE +RD G+R NRQK+RMMWLIDE GI+ FR E
Sbjct  248  AKRCEAAVPLNAWVLPNDDVVDLCRAILEVYRDEGSRANRQKSRMMWLIDEWGIDKFREE  307

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V K+   +    A  +   + DWE+RD+ GV  QKQ G +++GLH+PVGRL A  M +LA
Sbjct  308  VSKQFGRELPTAAPHD---EIDWEKRDHIGVFAQKQPGLNYVGLHVPVGRLYAQQMFDLA  364

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGE+RLTVEQN+
Sbjct  365  RMAEAYGSGEIRLTVEQNV  383



>ref|WP_015188381.1| assimilatory nitrite reductase (ferredoxin) precursor [Gloeocapsa 
sp. PCC 7428]
 ref|YP_007127667.1| assimilatory nitrite reductase (ferredoxin) precursor [Gloeocapsa 
sp. PCC 7428]
 gb|AFZ30507.1| assimilatory nitrite reductase (ferredoxin) precursor [Gloeocapsa 
sp. PCC 7428]
Length=516

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/258 (57%), Positives = 188/258 (73%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + DVP+I        LTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  105  QLRGIRIEDVPDIFNRFRAAELTSVQSGMDNVRNITGDPVAGLDADELFDTRDLVRQVQD  164

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GNPAF+NLPRK+N+ + G  D   H  INDLA++PA KD  FGFN++VGGFFS
Sbjct  165  MITNNGEGNPAFTNLPRKFNIAITGGRDNSVHAEINDLAFIPAFKDNTFGFNVIVGGFFS  224

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  AIPL+AWVP + +  VCKA+LE FRD G R NRQK+R+MWLIDE GI+ FRAEV
Sbjct  225  AKRCDAAIPLNAWVPPEAVVAVCKAVLEIFRDRGLRANRQKSRLMWLIDEWGIDKFRAEV  284

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K++ ++    A  +   + DWE+RD+ GV  QKQ G +++GLHIPVGRL A DM ++AR
Sbjct  285  EKQLGQELQLAAEKD---EIDWEKRDHVGVFRQKQPGLNYVGLHIPVGRLYAQDMFDIAR  341

Query  54   LADQYGSGELRLTVEQNI  1
            LA+ YG GE+RLTVEQN+
Sbjct  342  LAEVYGDGEIRLTVEQNL  359



>ref|WP_023068951.1| precorrin-3B synthase [Lyngbya aestuarii]
 gb|ERT04799.1| precorrin-3B synthase [Lyngbya aestuarii BL J]
Length=514

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 191/262 (73%), Gaps = 7/262 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L DVP+I   ++QVGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRLEDVPDIFNRMQQVGLTSVQSGMDNVRNITGSPVAGLDADELYDTRELVQQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG----RFGFNLLVG  427
            +IT N  GNP F+NLPRK+N+ + G  D   H  IND+A++PA KD      FGFN+LVG
Sbjct  166  MITGNGEGNPEFTNLPRKFNIAIAGCRDNSVHAEINDIAFVPAFKDKTKDETFGFNVLVG  225

Query  426  GFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGF  247
            GFFSAKRC  AIPL AWV  D +  +C+AILE FRD G R NRQK+R+MWLIDE GI+ F
Sbjct  226  GFFSAKRCEAAIPLKAWVKPDQVVSLCRAILEVFRDNGPRANRQKSRLMWLIDEWGIDKF  285

Query  246  RAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMD  67
            R EV  +M E     A  +E++   W++RD+ GV+ QKQ G++++GL++P+GRL A+DM 
Sbjct  286  RQEVENQMGETLEAEAEKDEIL---WDKRDHIGVYTQKQAGFNYVGLNVPIGRLYANDMF  342

Query  66   ELARLADQYGSGELRLTVEQNI  1
            ELARLA+ YG GELRLTVEQN+
Sbjct  343  ELARLAEVYGKGELRLTVEQNL  364



>ref|WP_039741277.1| ferredoxin--nitrite reductase [Hassallia byssoidea]
 gb|KIF36286.1| ferredoxin--nitrite reductase [Hassallia byssoidea VB512170]
Length=522

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 192/264 (73%), Gaps = 9/264 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I    E VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDLPDIFNKFEAVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG------RFGFNLL  433
            +IT N  GN  F+NLPRK+N+ +    D   H  INDLA++PA K+G      +FGFN+L
Sbjct  166  MITNNGAGNSEFTNLPRKFNIAITAGRDNSVHAEINDLAFVPAFKEGQGESERQFGFNIL  225

Query  432  VGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIE  253
            VGGFFSAKRC  AIPL+AWVP +D+  VC+AILE FRD G R NRQK+R+MWLIDE G++
Sbjct  226  VGGFFSAKRCDAAIPLNAWVPPEDVVAVCRAILEVFRDRGLRANRQKSRLMWLIDEWGLD  285

Query  252  GFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADD  73
             FR EV  R+ +  +  AA +   + DWE+RD+ GV+ QKQ G +++GL++PVGRL ADD
Sbjct  286  KFRLEVENRLGKSLISAAAKD---EIDWEKRDHIGVYKQKQPGLNYVGLNVPVGRLFADD  342

Query  72   MDELARLADQYGSGELRLTVEQNI  1
            M E+ARLA+ YGS E+RLTVEQN+
Sbjct  343  MFEIARLAEVYGSSEIRLTVEQNV  366



>ref|WP_015213651.1| assimilatory nitrite reductase (ferredoxin) precursor [Anabaena 
cylindrica]
 ref|YP_007155911.1| assimilatory nitrite reductase (ferredoxin) precursor [Anabaena 
cylindrica PCC 7122]
 gb|AFZ57001.1| assimilatory nitrite reductase (ferredoxin) precursor [Anabaena 
cylindrica PCC 7122]
Length=516

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 183/257 (71%), Gaps = 4/257 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI      VGLT++QSGMDN+RN  G+ VAG+D  E  DTR     +  
Sbjct  106  QLRGIKIEDIPEIFNKFHTVGLTTIQSGMDNIRNITGDSVAGLDANEFYDTRELVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            ++T N  GNP FSNLPRK+N+ + G  D   H  INDLA++PA KDG FGFN+LVGGFFS
Sbjct  166  MLTNNGEGNPEFSNLPRKFNIAITGGRDNSVHAEINDLAFVPAFKDG-FGFNVLVGGFFS  224

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
             KRC  AIPL+ WV  D++  +C+AI+E FRD G R NRQKAR+MWLIDE G+E  R EV
Sbjct  225  GKRCEAAIPLNVWVKPDEVVSLCRAIVEIFRDHGLRANRQKARLMWLIDEWGLEKLRTEV  284

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             KR  +     A  +   + DWE+RD+ G++PQKQ G +++GL+IPVGRL ADDM ELAR
Sbjct  285  EKRWGKTFKTAAPKD---EIDWEKRDHIGIYPQKQPGLNYVGLNIPVGRLYADDMFELAR  341

Query  54   LADQYGSGELRLTVEQN  4
            LA+ YGSGE+R TVEQN
Sbjct  342  LAEVYGSGEIRFTVEQN  358



>ref|WP_010873675.1| ferredoxin-nitrite reductase [Synechocystis sp. PCC 6803]
 ref|NP_442378.1| ferredoxin-nitrite reductase [Synechocystis sp. PCC 6803]
 ref|YP_005384246.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 ref|YP_005387415.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 ref|YP_005410122.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 ref|YP_005652438.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803]
 ref|YP_007452254.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803]
 dbj|BAA10448.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803]
 dbj|BAK51233.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803]
 dbj|BAL30231.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL33400.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL36569.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM53957.1| ferredoxin-nitrite reductase [Bacillus subtilis BEST7613]
 gb|AGF52740.1| ferredoxin--nitrite reductase [Synechocystis sp. PCC 6803]
Length=502

 Score =   297 bits (760),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 191/259 (74%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I   LE  GLTS+QSGMDNVRN  G+PVAG++ +E++DTR     +  
Sbjct  97   QVRGIKIEDIPDIFSKLESCGLTSVQSGMDNVRNITGSPVAGLEKDELIDTRDLVQGVQD  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   RGNP F+NLPRK+N+ + GS D   H  IND+A++PA ++G  GFN++VGGFFS
Sbjct  157  MITNGGRGNPEFTNLPRKFNIAIEGSRDNSVHAEINDVAFVPAYREGILGFNVVVGGFFS  216

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            ++RC  AIPLDAWV P   +  +C++ILE +RD G R NRQK+R+MWLIDE G+  FR E
Sbjct  217  SRRCEAAIPLDAWVQPDQQVVDLCRSILEIYRDHGLRANRQKSRLMWLIDEWGVAKFREE  276

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++P   L  A  +   + DW++RD+ GVHPQKQ G +++GLH+PVGRL A+D  EL+
Sbjct  277  VAAKLPFPLLTAAPKD---ELDWDKRDHLGVHPQKQAGLNYVGLHVPVGRLYANDFFELS  333

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGE+RLTVEQN+
Sbjct  334  RLADTYGSGEVRLTVEQNL  352



>ref|WP_022609023.1| precorrin-3B synthase [Rubidibacter lacunae]
 gb|ERN40126.1| precorrin-3B synthase [Rubidibacter lacunae KORDI 51-2]
Length=516

 Score =   297 bits (761),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 187/259 (72%), Gaps = 5/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L DVPEI   L   G+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  105  QLRGIRLEDVPEIFARLHAAGMTSMQSGMDNVRNITGSPMAGLDADELIDTRALVKSVQD  164

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +ITA   GNPAF+NLPRK+N+ + G  D   H  IND+A++PA KDGR GFN+LVGGFFS
Sbjct  165  MITAAGSGNPAFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKDGRLGFNVLVGGFFS  224

Query  414  AKRCAEAIPLDAWVP--ADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            AKRCA A+P+D WVP   D +  +C+AIL A+RD G R NRQKAR+MWLIDE GIE FRA
Sbjct  225  AKRCAAAVPMDVWVPPKEDIVVSLCRAILLAYRDNGLRANRQKARLMWLIDEWGIEKFRA  284

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            E+           A  +E+    WE+RD  GVH QKQ G +++GLH+PVGRL+A DM EL
Sbjct  285  EIEGACGFALETAAPEDEIC---WEKRDCLGVHAQKQPGLNYVGLHVPVGRLQAQDMFEL  341

Query  60   ARLADQYGSGELRLTVEQN  4
            A++A+ YGS E+RLTVEQN
Sbjct  342  AQVAEVYGSSEVRLTVEQN  360



>ref|WP_015155568.1| assimilatory nitrite reductase (ferredoxin) precursor [Chroococcidiopsis 
thermalis]
 ref|YP_007092892.1| assimilatory nitrite reductase (ferredoxin) precursor [Chroococcidiopsis 
thermalis PCC 7203]
 gb|AFY89023.1| assimilatory nitrite reductase (ferredoxin) precursor [Chroococcidiopsis 
thermalis PCC 7203]
Length=538

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/277 (55%), Positives = 189/277 (68%), Gaps = 22/277 (8%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI +    VGLTS+QSGMDNVRN  G+P+AG+D EE+ DTR   + +  
Sbjct  106  QLRGIRIEDLPEIFQKFAAVGLTSIQSGMDNVRNITGDPLAGLDTEELFDTRDLVHQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG-------------  454
             IT    GNP F+NLPRK+N+ + G  D   H  INDLA++PA K G             
Sbjct  166  AITNYGEGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFKGGSRESVGAHGCAPV  225

Query  453  ------RFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQK  292
                   FGFN+LVGGFFSAKRC  A+PLDAWV  +D+  VCKA+LE +RD G R NRQK
Sbjct  226  QESQEKEFGFNILVGGFFSAKRCEAAVPLDAWVAPEDVVAVCKAVLEVYRDNGLRANRQK  285

Query  291  ARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFI  112
            AR+MWLIDE G+E FR  V  RM +     AA +   + DWE+RD+ GV+PQKQ G ++I
Sbjct  286  ARLMWLIDEWGMEKFRLAVETRMGKSLRSAAAKD---EIDWEKRDHIGVYPQKQPGLNYI  342

Query  111  GLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            GLH+PVGRL A DM E+ARLA+ YGSGE+RLTVEQNI
Sbjct  343  GLHVPVGRLYAQDMFEVARLAEVYGSGEIRLTVEQNI  379



>ref|WP_017321046.1| ferredoxin-nitrite reductase [cyanobacterium PCC 7702]
Length=526

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 190/267 (71%), Gaps = 12/267 (4%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I +    VGLTS+QSGMDNVRN  G+PVAG+D EE+ DTR     +  
Sbjct  106  QLRGIRIEDLPDIFQKFRTVGLTSVQSGMDNVRNITGDPVAGLDAEELFDTRELVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKD---------GRFGF  442
             IT    GNP F+NLPRK+N+ + G  D   H  INDLA++PA ++          RFGF
Sbjct  166  AITNKGEGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFIPAFREVSTQQGCQSRRFGF  225

Query  441  NLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDEL  262
            N+LVGGFFS+KRC  AIPL+AWVP +D+  +C+A+LE FRD G R NRQK+R+MWLIDE 
Sbjct  226  NVLVGGFFSSKRCEAAIPLNAWVPPEDVVALCRAVLEVFRDCGLRANRQKSRLMWLIDEW  285

Query  261  GIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLE  82
            G+E FR EV  R  +  L  A  +   + DWE+RD+ GV+ QKQ G +++GLH+PVGRL 
Sbjct  286  GLEKFRCEVENRFGKPLLSAAPKD---EIDWEKRDHIGVYKQKQPGLNYVGLHVPVGRLT  342

Query  81   ADDMDELARLADQYGSGELRLTVEQNI  1
            A+DM E+ARLA+ YG+GE+RLTVEQN+
Sbjct  343  AEDMFEIARLAEVYGNGEIRLTVEQNV  369



>ref|WP_017324212.1| ferredoxin-nitrite reductase [Synechococcus sp. PCC 7336]
Length=518

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 190/260 (73%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + DVPEI   ++ VGLTS+QSGMDNVRN  G+PVAGID  E++DTRP    +  
Sbjct  107  QLRGIRIEDVPEIFARIKAVGLTSIQSGMDNVRNITGSPVAGIDASELIDTRPLVKAVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT + +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN+LVGGFFS
Sbjct  167  MITNSGQGNYDFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVLVGGFFS  226

Query  414  AKRCAEAIPLDAWVP--ADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            A+RC  AIP+D WVP   + +  +C+AILE +RD G R NRQK+RMMWLIDE GI+ FRA
Sbjct  227  ARRCEAAIPMDVWVPPQIEPVVDLCRAILEVYRDNGPRANRQKSRMMWLIDEWGIDTFRA  286

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
             V++++       A  + +   DW++RD+ GVHPQ+ EG +F+GLH+PVGRL+A D  EL
Sbjct  287  NVMEQLGRDLPTAAPEDLI---DWDKRDHLGVHPQQGEGLNFVGLHVPVGRLQASDFFEL  343

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARL   YGSGE+RLTVEQN+
Sbjct  344  ARLCSVYGSGEVRLTVEQNV  363



>ref|WP_015170815.1| assimilatory nitrite reductase (ferredoxin) precursor [Geitlerinema 
sp. PCC 7407]
 ref|YP_007108299.1| assimilatory nitrite reductase (ferredoxin) precursor [Geitlerinema 
sp. PCC 7407]
 gb|AFY65247.1| assimilatory nitrite reductase (ferredoxin) precursor [Geitlerinema 
sp. PCC 7407]
Length=516

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 190/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I R +E  GLTS+QSGMDNVRN   +PVAGID +E++DTR     +  
Sbjct  106  QLRGIRLEDIPDIFRRIEGAGLTSVQSGMDNVRNITASPVAGIDADELIDTRGLVRKVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GNP+FSNLPRK+N+ + G  D   H  IND+A++PA +DG  GFN+LVGGFFS
Sbjct  166  MITNNGDGNPSFSNLPRKFNIAIAGCRDNSVHAEINDIAFVPAYRDGVLGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRCA AIPL+AWV   D+  +C+AIL  +RD G R NRQKAR+MWLIDE G++ FRA V
Sbjct  226  AKRCAAAIPLNAWVHPRDVVTLCEAILVVYRDRGLRANRQKARLMWLIDEWGLDAFRAAV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             +++       A  +E++   WE+RD+ G+H QKQ G +++GL IP+GRL A DM +LAR
Sbjct  286  EQQLGHALAPAAPKDEIL---WEKRDHVGIHAQKQPGLNYVGLLIPIGRLYAQDMFDLAR  342

Query  54   LADQYGSGELRLTVEQNI  1
            LA+ YGSGELRLTVEQN+
Sbjct  343  LAEVYGSGELRLTVEQNV  360



>ref|WP_009626422.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
biceps]
 gb|ELS33455.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
biceps PCC 7429]
Length=519

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 187/261 (72%), Gaps = 6/261 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L DVPE+      VGLTS+QS MDN+RN  G+PVAGID  E+ DTR     +  
Sbjct  97   QMRGIELADVPEMFEKFRAVGLTSVQSAMDNIRNITGSPVAGIDANELYDTRALAIQVQN  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR---FGFNLLVGG  424
            L+T N  GN AF+NLPRK+N+ + G  D   H  INDLA++PA K+     FGFN+LVGG
Sbjct  157  LLTNNGEGNAAFTNLPRKFNIAIAGCRDNSTHAEINDLAFIPAFKEDSSKAFGFNVLVGG  216

Query  423  FFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFR  244
            FFSAKR A AIPL+ WVP +D+  +C+A+L  FRD G R NRQKAR+M+LIDE GIE FR
Sbjct  217  FFSAKRIAAAIPLNVWVPPEDVVALCEALLIVFRDHGLRENRQKARLMYLIDEWGIEKFR  276

Query  243  AEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDE  64
             EV K+M +     AA +   +  WE+RD+ GVHPQKQEG ++IGL IPVGR+ A D+ E
Sbjct  277  IEVEKQMGKSLATAAAKD---EISWEKRDHIGVHPQKQEGLNYIGLQIPVGRMYASDLYE  333

Query  63   LARLADQYGSGELRLTVEQNI  1
            LARLAD YG+G++RLTVEQN+
Sbjct  334  LARLADTYGNGDIRLTVEQNL  354



>ref|WP_009554639.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ70221.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoriales 
cyanobacterium JSC-12]
Length=526

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 191/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + DVP+I +  E+ GLTS+QSGMDNVRN  G+PVAGID +E++DTR     +  
Sbjct  106  QLRGIRIEDVPDIFKQFEEAGLTSVQSGMDNVRNITGSPVAGIDADELIDTRGLCRKVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GNP+F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN+LVGGFFS
Sbjct  166  MITNNGEGNPSFTNLPRKFNIAIAGCRDNSVHAEINDIAFVPAYKNGLLGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRCA AIP++ WV   D+  +C+AIL  +R+ G R NRQKAR+MWLIDE G+E FR EV
Sbjct  226  AKRCAAAIPMNVWVDPRDVVALCEAILIVYRNHGLRANRQKARLMWLIDEWGVERFRREV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             +++       A  +E++   W++RD+ G+H QKQ G +++GLH+PVGRL A DM +LAR
Sbjct  286  EQQLGYTLQTAAPKDEIV---WDKRDHIGIHAQKQPGLNYVGLHVPVGRLYAPDMFDLAR  342

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGSGELRLTVEQNI
Sbjct  343  IAEVYGSGELRLTVEQNI  360



>gb|AIE74568.1| Ferredoxin--nitrite reductase [Synechocystis sp. PCC 6714]
Length=502

 Score =   295 bits (755),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 188/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            QIRG+ + D+P+I   LE  GLTS+QSGMDNVRN  G+PVAG++  E++DTR     +  
Sbjct  97   QIRGIKIEDIPDIFSKLESCGLTSVQSGMDNVRNITGSPVAGLEKHELIDTRDLVQRVQD  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GNP F+NLPRK+N+ + GS D   H  IND+A++PA ++G  GFN++VGGFFS
Sbjct  157  MITNGGQGNPEFTNLPRKFNIAIEGSRDNSVHAEINDVAFVPAYREGILGFNVVVGGFFS  216

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            ++RC  AIPLDAWV P   +  +C++ILE +RD G R NRQK+R+MWLIDE G+  FR E
Sbjct  217  SRRCEAAIPLDAWVQPDQQVVDLCRSILEVYRDHGLRANRQKSRLMWLIDEWGLTKFREE  276

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++P   L  A  +   + DW++RD+ GVHPQKQ G +++GLH+PVGRL A D  E A
Sbjct  277  VAAKLPFPLLTAAPED---ELDWDKRDHLGVHPQKQAGLNYVGLHVPVGRLYASDFFEFA  333

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YGSGE+RLTVEQN+
Sbjct  334  RLADTYGSGEVRLTVEQNL  352



>ref|WP_026093421.1| ferredoxin--nitrite reductase [Calothrix sp. PCC 7103]
Length=515

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 188/259 (73%), Gaps = 3/259 (1%)
 Frame = -2

Query  777  WQIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLS  598
            +Q+RGV + D+PEI    ++V LT++QSGMDNVRN  G+P+AG+D  E+ DTR   + + 
Sbjct  105  FQLRGVRIEDLPEIFNRFQEVELTTVQSGMDNVRNITGDPLAGLDASELYDTRELVDQIQ  164

Query  597  QLITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFF  418
             +IT N  GN  FSNLPRK+N+ + G  D   H  INDLA++PA KDG FGFN+LVGGFF
Sbjct  165  AMITNNGVGNAEFSNLPRKFNIAITGGRDNSVHAEINDLAFIPAFKDGNFGFNILVGGFF  224

Query  417  SAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            SAKRC  AIPL+AWV   D+  VC+AILE +RD G R NRQK+R+MWLIDE G+E FR E
Sbjct  225  SAKRCDAAIPLNAWVHPQDVVAVCRAILEVYRDNGLRANRQKSRLMWLIDEWGLERFREE  284

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  R+ +  L  AA +   + +WE+RD+ G+H QKQ    + GLHIPVGRL A+DM E+A
Sbjct  285  VELRLGKSLLPGAAHD---EINWEKRDHIGIHKQKQSDLYYAGLHIPVGRLYAEDMFEIA  341

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA+ YG+ E+RLTVEQNI
Sbjct  342  RLAEVYGTSEIRLTVEQNI  360



>ref|WP_015113079.1| assimilatory nitrite reductase (ferredoxin) precursor [Nostoc 
sp. PCC 7107]
 ref|YP_007050014.1| assimilatory nitrite reductase (ferredoxin) precursor [Nostoc 
sp. PCC 7107]
 gb|AFY42864.1| assimilatory nitrite reductase (ferredoxin) precursor [Nostoc 
sp. PCC 7107]
Length=524

 Score =   295 bits (756),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 192/264 (73%), Gaps = 9/264 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I      VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPDIFNKFHAVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRDLVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG------RFGFNLL  433
            ++T    GNP FSNLPRK+N+ + G  D   H  INDLA++PA+++       +FGFN+L
Sbjct  167  MLTNKGEGNPEFSNLPRKFNIAITGGRDNSVHAEINDLAFVPALRNNEEDSALQFGFNIL  226

Query  432  VGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIE  253
            VGGFFSAKRC  AIPL+AWV  +D+  VC+A+LE FRD G+R NR K+R+MWL+DE GI+
Sbjct  227  VGGFFSAKRCDAAIPLNAWVAPEDVVAVCRAVLEVFRDNGSRANRLKSRLMWLLDEWGID  286

Query  252  GFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADD  73
             FRAEV +R+ +  L  A  +   + DWE+RD+ G++ QKQ G++++G HIPVGR  A+D
Sbjct  287  KFRAEVEQRLGKSLLPAAPKD---EIDWEKRDHIGIYKQKQSGFNYVGFHIPVGRFYAED  343

Query  72   MDELARLADQYGSGELRLTVEQNI  1
            M E+ARLA+ YGSGE+RLTVEQNI
Sbjct  344  MFEIARLAEVYGSGEIRLTVEQNI  367



>ref|WP_017713849.1| hypothetical protein [Prochlorothrix hollandica]
Length=513

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 190/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L DVP I R LE+ G+TS+QSGMDNVRN   +PVAG++ +E++DTR     +  
Sbjct  106  QLRGIRLEDVPNIFRRLEEAGMTSMQSGMDNVRNITASPVAGLEADELLDTRELVQQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT    GNP F+NLPRK+N+ + GS D   H  IND+A++PA ++G  GFN+LVGGFFS
Sbjct  166  MITNGGEGNPEFTNLPRKFNIAIEGSRDNSVHAEINDIAFVPAYREGILGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            + RCA AIPL+AWV P   +  +C+AILE FRD G+R NRQ++R+MWLIDELG++GFRA 
Sbjct  226  STRCAPAIPLEAWVEPNQQVVDLCRAILEVFRDQGSRANRQRSRLMWLIDELGLDGFRAA  285

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++    L  AA +   +  WE+RD+ GVHPQKQ G +++GL +PVGRL A D  ELA
Sbjct  286  VAAKLSWDLLSGAAED---EITWEKRDHLGVHPQKQAGLNYVGLLVPVGRLNAADFLELA  342

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA+ YG GE+RLTVEQN+
Sbjct  343  RLAEVYGKGEVRLTVEQNV  361



>ref|WP_027844528.1| ferredoxin--nitrite reductase [Mastigocoleus testarum]
Length=515

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 186/258 (72%), Gaps = 4/258 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I R L+ VG+TS+QSGMDNVRN  G+PVAG+D +E++DTR     +  
Sbjct  108  QLRGIRLEDIPDIFRRLKAVGMTSMQSGMDNVRNITGSPVAGLDGDELIDTRDLVQRVQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT    GN AF+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN+LVGGFFS
Sbjct  168  MITNKGEGNYAFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGNLGFNVLVGGFFS  227

Query  414  AKRCAEAIPLDAWVPA-DDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRCA A+PLD WVP  +D+  +C AIL  +RDLG R NRQK+R+MWLIDELGIE FR  
Sbjct  228  AKRCAAAVPLDVWVPPNEDVVDLCWAILSVYRDLGLRANRQKSRLMWLIDELGIEKFRET  287

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V ++M       A  +   + DWE+RD  GV  QKQ   ++ GLHIPVGRL+A  M +LA
Sbjct  288  VEEKMARSLATAAEKD---EIDWEKRDCIGVFVQKQPNLNYAGLHIPVGRLDAQSMFDLA  344

Query  57   RLADQYGSGELRLTVEQN  4
            RLA+ YGSGE+RLTVEQN
Sbjct  345  RLAEVYGSGEIRLTVEQN  362



>ref|WP_015180235.1| assimilatory nitrite reductase (ferredoxin) precursor [Microcoleus 
sp. PCC 7113]
 ref|YP_007119477.1| assimilatory nitrite reductase (ferredoxin) precursor [Microcoleus 
sp. PCC 7113]
 gb|AFZ16071.1| assimilatory nitrite reductase (ferredoxin) precursor [Microcoleus 
sp. PCC 7113]
Length=517

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 186/258 (72%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I    EQVGLTS+QSGMDNVRN  G+PVAGID  E++DTR     +  
Sbjct  106  QLRGIRIEDIPDIFTRFEQVGLTSVQSGMDNVRNITGSPVAGIDAAELIDTRELVQQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GNP F+NLPRK+N+ + G  D   H  INDLA++PA KDG  GFN++VGGFFS
Sbjct  166  MITNQGKGNPEFTNLPRKFNIAIAGGRDNSVHAEINDLAFVPAYKDGILGFNVVVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  AIPL AWV  +D+  VC+A+LE +RD G R NRQKAR+MWLIDE GI+ FR E+
Sbjct  226  AKRCDAAIPLQAWVTPNDVVDVCRAVLEVYRDHGLRANRQKARLMWLIDEWGIDKFRREI  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
               +       A  +   + +W++RD+ GV PQKQ   +++GLHIP+GRL A DM +LAR
Sbjct  286  ENALGRTLQPEAEKD---EFNWDKRDHIGVFPQKQPELNYVGLHIPMGRLYAQDMFDLAR  342

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YG+GE+RLTVEQN+
Sbjct  343  IAEVYGNGEIRLTVEQNV  360



>ref|WP_011610823.1| ferredoxin-nitrite reductase [Trichodesmium erythraeum]
 ref|YP_720910.1| ferredoxin-nitrite reductase [Trichodesmium erythraeum IMS101]
 gb|AAF00916.1|AF178846_1 ferredoxin nitrite reductase [Trichodesmium sp. WH 9601]
 gb|ABG50437.1| assimilatory nitrite reductase (ferredoxin) precursor [Trichodesmium 
erythraeum IMS101]
Length=510

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 192/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I   LE+VGLTS+QSGMDNVRN  G+PVAGID  E+ DTR     +  
Sbjct  106  QLRGIAIEDIPDIFNRLEKVGLTSVQSGMDNVRNITGSPVAGIDATELYDTRELIKQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N++GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+ +FGFN+LVGGFFS
Sbjct  166  MITDNNKGNFEFTNLPRKFNIAIAGCRDNSVHAEINDIAFIPAYKNDKFGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  AIPL+AWV  + +  +C+AILE +RD G R NRQK+R+MWLIDE G+  FR++V
Sbjct  226  AKRCEAAIPLNAWVEPNQVIALCRAILEVYRDYGLRENRQKSRLMWLIDEWGLTKFRSQV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K++       A  +E++   WE+RD+ G++ QKQ G ++IGL+IPVGRL A DM +LAR
Sbjct  286  EKQIGLTLETEALKDEIL---WEKRDHIGIYKQKQPGLNYIGLNIPVGRLYAVDMFDLAR  342

Query  54   LADQYGSGELRLTVEQNI  1
            LA+ YG+GE+RLTVEQN+
Sbjct  343  LAEVYGNGEIRLTVEQNV  360



>ref|WP_017315401.1| ferredoxin-nitrite reductase [Mastigocladopsis repens]
Length=532

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 192/274 (70%), Gaps = 19/274 (7%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P I      VGLT++QSGMDNVRN  G+PVAG+D +E+ DTR     + +
Sbjct  107  QLRGIRIEDLPNIFDKFRAVGLTTVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQE  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMK---------------  460
            +IT N  GNP F+NLPRK+N+ + G  D   H  INDLA++PA +               
Sbjct  167  MITNNGVGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFQKERGSGGIGEGGKES  226

Query  459  -DGRFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARM  283
               RFGFN+LVGGFFSAKRC  AIPL+AWVP +D+  +C+A+LE FRD G R NRQK+R+
Sbjct  227  SSRRFGFNVLVGGFFSAKRCEAAIPLNAWVPPEDVVALCRAVLEVFRDHGLRANRQKSRL  286

Query  282  MWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLH  103
            MWLIDE GIE FRAEV K++ +  +  AA +   + DWE+RD+ GV+ QKQ G +++GLH
Sbjct  287  MWLIDEWGIEKFRAEVEKQLGKSLISAAAHD---EIDWEKRDHIGVYKQKQPGLNYVGLH  343

Query  102  IPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            +PVGRL A+DM E+ARLA+ YGSGE+R +VEQN 
Sbjct  344  VPVGRLYAEDMFEIARLAEVYGSGEIRFSVEQNF  377



>ref|WP_039730005.1| ferredoxin--nitrite reductase, partial [Lyngbya confervoides]
Length=510

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 190/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I    E VGL+S+QSGMDNVRN  G+PVAGID +E++DTR     L  
Sbjct  107  QLRGIRLEDIPDIFERFEAVGLSSIQSGMDNVRNITGSPVAGIDADELIDTRGLVKKLQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT    GNP F+NLPRK+N+ V G  D   H  IND+A++PA ++G+ GFN+LVGGFFS
Sbjct  167  MITDRGEGNPEFTNLPRKFNIAVEGGRDNAVHAEINDIAFVPAYREGKLGFNVLVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            A+RC  A+PL+AWV P DD+  + +AILE +RD G R NRQKAR+MWLIDE G++ FRAE
Sbjct  227  ARRCEAAVPLNAWVEPNDDVVALSRAILEVYRDNGLRVNRQKARLMWLIDEWGMDTFRAE  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V K   +  L  AA +   + DW++RD+ GV+PQ+Q G S++G H+PVGRL A DM + A
Sbjct  287  VEKAYGKPLLSAAAED---EIDWDKRDHVGVYPQQQPGLSYVGFHVPVGRLTAQDMFDFA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+AD YG GE+RLTVEQNI
Sbjct  344  RIADVYGDGEIRLTVEQNI  362



>ref|WP_035155292.1| ferredoxin--nitrite reductase [Calothrix sp. 336/3]
 gb|KFB84761.1| ferredoxin--nitrite reductase [Calothrix sp. 336/3]
Length=516

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 190/262 (73%), Gaps = 7/262 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI    + VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPEIFDKFQGVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKD----GRFGFNLLVG  427
            +IT +  GN  FSNLPRK+N+ + G  D   H  INDLA++PA+++      FGFN+LVG
Sbjct  167  MITNHGEGNAEFSNLPRKFNIAITGGRDNSVHAEINDLAFVPALQNLGESTSFGFNILVG  226

Query  426  GFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGF  247
            GFFSAKRC  AIPL+AWV  D++  VC+AILE +RD G R NRQKAR+MWLIDE G+E F
Sbjct  227  GFFSAKRCDAAIPLNAWVTPDEVVAVCRAILEVYRDYGLRANRQKARVMWLIDEWGLEKF  286

Query  246  RAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMD  67
            + E+ KR+ +  L  A  +   + DWE+RD+ GV+ QKQ G++++GL IPVGRL A D+ 
Sbjct  287  KVEIEKRLGKTLLPAAPKD---EIDWEKRDHVGVYKQKQPGFNYVGLQIPVGRLYASDLL  343

Query  66   ELARLADQYGSGELRLTVEQNI  1
            E+ARLA+ YGSGE+R TVEQN+
Sbjct  344  EIARLAEVYGSGEIRFTVEQNV  365



>ref|WP_015204592.1| assimilatory nitrite reductase (ferredoxin) precursor [Crinalium 
epipsammum]
 ref|YP_007143999.1| assimilatory nitrite reductase (ferredoxin) precursor [Crinalium 
epipsammum PCC 9333]
 gb|AFZ14489.1| assimilatory nitrite reductase (ferredoxin) precursor [Crinalium 
epipsammum PCC 9333]
Length=658

 Score =   296 bits (758),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 192/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            QIR + + D+PEI + L++ G+TS+QSGMDNVRN  G+PVAGID +E++DTR     +  
Sbjct  112  QIRSIRIEDLPEICKRLQEAGMTSIQSGMDNVRNITGSPVAGIDADELIDTRGIVRKVQD  171

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GNP+F+NLPRK+N+ + G  D   H  INDLA++PA K+G  GFN++VGGFFS
Sbjct  172  MITNNGEGNPSFTNLPRKFNIAIAGCRDNSVHAEINDLAFIPAYKNGVIGFNVIVGGFFS  231

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AK C EAIPL+AWV   D+  VC+A+L  +R+ G R NRQKAR+M+LI++ GIE FR+EV
Sbjct  232  AKACIEAIPLNAWVDPRDVVAVCEAVLLVYRNNGLRANRQKARIMYLIEDWGIEKFRSEV  291

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K++       A  +E++   W++RD+ G+H QKQ   ++IGLHIP+GR+ ADDM +LAR
Sbjct  292  EKQLGHSLQTAAEKDEIL---WDKRDHIGIHSQKQPALNYIGLHIPMGRMYADDMFDLAR  348

Query  54   LADQYGSGELRLTVEQNI  1
            LAD YGSGE+RLTVEQN+
Sbjct  349  LADVYGSGEIRLTVEQNV  366



>ref|WP_017301382.1| hypothetical protein [Nodosilinea nodulosa]
Length=532

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 196/259 (76%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG++L D+P+I R ++  GLTS+QSGMDNVRN  G+P+AG+D +E++DT+     +  
Sbjct  111  QLRGILLEDIPDIFRRMQAAGLTSVQSGMDNVRNITGSPIAGLDADELIDTQGLVRKVQD  170

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GNPAF+NLPRK+N+ + G  D   H  IND+A++PA ++G  GFN+LVGGFFS
Sbjct  171  MITNNGEGNPAFTNLPRKFNIAIEGGRDNSIHAEINDIAFVPAYREGVLGFNVLVGGFFS  230

Query  414  AKRCAEAIPLDAWVPADD-IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            A+RC  A+PLDAWVP DD +  +C+AILE +RD G R NRQKAR+MWLID+ G++ FRA 
Sbjct  231  ARRCEAAVPLDAWVPPDDSVVELCRAILEVYRDHGPRVNRQKARLMWLIDDWGMDRFRAA  290

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V     +  L  AA++   + DW++RD+ G +PQKQ G +++GLHIPVGRL+A D+ +LA
Sbjct  291  VEAAYGQPLLSAAASD---EMDWDKRDHIGWYPQKQVGLNYVGLHIPVGRLQATDLFDLA  347

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA+ YG+GELRLTVEQN+
Sbjct  348  RLAEVYGNGELRLTVEQNV  366



>ref|WP_036030858.1| ferredoxin--nitrite reductase [Leptolyngbya sp. PCC 6406]
Length=526

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 186/261 (71%), Gaps = 8/261 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I +  E VGLTS+QSGMDNVRN  G+PVAGID  E++DTR    L+  
Sbjct  106  QLRGIRLEDIPDIFQRFEAVGLTSIQSGMDNVRNITGSPVAGIDANELIDTRGLVRLVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GN  F+NLPRK+N+ + G  D   H  IND+A++PA ++GR GFN+LVGGFFS
Sbjct  166  MITGNGEGNADFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYREGRLGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            A+RC  AIPL AWV P +++  +C+AILE +RD G R NRQK+R+MWLI+E G+E FR+E
Sbjct  226  ARRCEAAIPLHAWVAPNEEVIDLCRAILEVYRDHGLRANRQKSRLMWLIEEWGMERFRSE  285

Query  237  V--VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDE  64
            V  V   P             + DW++RD+ G+H QKQ G  F+GLH+PVGRL A  M +
Sbjct  286  VEQVYGRPLPSAAPKD-----EVDWDKRDHIGIHSQKQPGLYFVGLHVPVGRLSASTMLD  340

Query  63   LARLADQYGSGELRLTVEQNI  1
            LARLA+ YG GELRLTVEQN+
Sbjct  341  LARLAEVYGDGELRLTVEQNV  361



>ref|WP_017748019.1| ferredoxin-nitrite reductase [Scytonema hofmanni]
Length=546

 Score =   293 bits (749),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 146/288 (51%), Positives = 191/288 (66%), Gaps = 33/288 (11%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I      VGLTS+QSGMDNVRN  G+PVAG+D EE+ DTR     +  
Sbjct  107  QLRGIRIEDLPDIFEKFHSVGLTSVQSGMDNVRNITGDPVAGLDAEELFDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKD--------------  457
            ++T N  GNP F+NLPRK+N+ + G  D   H  INDLA++PA K+              
Sbjct  167  MVTNNGEGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFKEDNGQWAMGNGEETV  226

Query  456  ----------------GRFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAF  325
                             RFGFN+LVGGFFSAKRC  AIPL+AWVP +D+  VC+A+LE F
Sbjct  227  TTSSSPTPHSLLTTPQKRFGFNILVGGFFSAKRCEAAIPLNAWVPPEDVVAVCRAVLEVF  286

Query  324  RDLGARGNRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGV  145
            RD G+R NR K+R+MWLIDE GIE FR EV +++       AA +   + DWE+RD+ GV
Sbjct  287  RDNGSRANRLKSRLMWLIDEWGIEKFRDEVERKLGTPLPSAAAKD---EIDWEKRDHIGV  343

Query  144  HPQKQEGYSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            H QKQ G +++GLH+PVGRL A+DM ++ARLA+ YGSGE+RLTVE+N 
Sbjct  344  HKQKQPGLNYVGLHVPVGRLYAEDMFDMARLAEVYGSGEIRLTVEENF  391



>ref|WP_015165563.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
sp. PCC 7367]
 ref|YP_007103035.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
sp. PCC 7367]
 gb|AFY70607.1| assimilatory nitrite reductase (ferredoxin) precursor [Pseudanabaena 
sp. PCC 7367]
Length=515

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 191/262 (73%), Gaps = 7/262 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+ +I + L++VGLTS+QSGMDNVRN  G+PVAG++  E++DTR     +  
Sbjct  105  QLRGIRLEDIVDIFKRLDKVGLTSVQSGMDNVRNITGSPVAGLEASELIDTRGLVRKVQD  164

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG----RFGFNLLVG  427
            +IT   +GNP+F+NLPRK+N+ + G  D   H  IND+A++PA K+G      GFN+LVG
Sbjct  165  MITNGGKGNPSFTNLPRKFNIAIGGCRDNSIHAEINDIAFIPAFKEGIEGAPIGFNVLVG  224

Query  426  GFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGF  247
            GFFSAKRCA A+PL+ W    D+  +C+AIL  +RD G R NRQK+R+MWLIDE GIE F
Sbjct  225  GFFSAKRCAAAVPLNVWADPRDVVAICEAILVIYRDYGLRANRQKSRLMWLIDEWGIEKF  284

Query  246  RAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMD  67
            RAEV + M    +  A  +   + +WE+RD+ G+H QKQ G +++GLHIPVGRL+AD M 
Sbjct  285  RAEVEQYMGHSLVAAAPRD---EIEWEKRDHIGIHAQKQPGLNYVGLHIPVGRLQADHMF  341

Query  66   ELARLADQYGSGELRLTVEQNI  1
            EL+RLA+ YGSGE+RLTVEQN+
Sbjct  342  ELSRLAEVYGSGEMRLTVEQNV  363



>ref|WP_035994508.1| ferredoxin--nitrite reductase [Leptolyngbya sp. KIOST-1]
Length=531

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 192/259 (74%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG++L D+P+I R +   GLTS+QSGMDNVRN  G+PVAG+D +E++DT+     +  
Sbjct  111  QLRGILLEDIPDIFRRMHAAGLTSVQSGMDNVRNITGSPVAGLDADELIDTQGLVRKVQD  170

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +ITAN  GNPAF+NLPRK+N+ + G  D   H  IND+A++PA ++G  GFN+LVGGFFS
Sbjct  171  MITANGEGNPAFTNLPRKFNIAIEGGRDNSIHAEINDIAFVPAYREGVLGFNVLVGGFFS  230

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            A+RC  AIPL+AWV P D +  +C+AILE +RD G R NRQKAR+MWLIDE G+E FRA 
Sbjct  231  ARRCEAAIPLNAWVTPDDSVVELCRAILEVYRDNGPRTNRQKARLMWLIDEWGLERFRAA  290

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V     +  L  A  +   + DW++RD+ GV+ QKQ G +++GLH+PVGRL A D+ +LA
Sbjct  291  VEAAYGQPLLSAAPTD---EMDWDKRDHIGVYRQKQVGLNYVGLHVPVGRLVASDLFDLA  347

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA+ YG+GELRLTVEQN+
Sbjct  348  RLAEVYGNGELRLTVEQNV  366



>ref|WP_011242624.1| ferredoxin-nitrite reductase [Synechococcus elongatus]
 ref|YP_171020.1| ferredoxin-nitrite reductase [Synechococcus elongatus PCC 6301]
 ref|YP_400257.1| ferredoxin-nitrite reductase [Synechococcus elongatus PCC 7942]
 sp|P39661.1|NIR_SYNE7 RecName: Full=Ferredoxin--nitrite reductase [Synechococcus elongatus 
PCC 7942]
 dbj|BAA02217.1| ferredoxin-nitrite reductase [Synechococcus elongatus PCC 7942]
 emb|CAA47912.1| ferredoxin--nitrite reductase [Synechococcus elongatus PCC 7942]
 dbj|BAD78500.1| ferredoxin-nitrite reductase [Synechococcus elongatus PCC 6301]
 gb|ABB57270.1| assimilatory nitrite reductase (ferredoxin) precursor [Synechococcus 
elongatus PCC 7942]
 gb|AJD58216.1| ferredoxin--nitrite reductase [Synechococcus sp. UTEX 2973]
 prf||2005377B nitrite reductase
Length=512

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 180/259 (69%), Gaps = 5/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG++L D PE L  L  VGLTS+QSGMDNVRN  G+PVAG+D  E+ DTR     L  
Sbjct  106  QLRGLLLEDTPEFLERLHAVGLTSVQSGMDNVRNITGSPVAGLDAAELFDTRSLIQALQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
             +TA  +GN  F+NLPRK+N+ + G  D   H  INDLA+ PA +DG  GFN+ VGGFFS
Sbjct  166  DLTAAGQGNSEFTNLPRKFNIAIEGGRDNSIHAEINDLAFTPAYQDGTLGFNVWVGGFFS  225

Query  414  AKRCAEAIPLDAWVPAD-DIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            + R A AIPL+AWVPAD  +  + +AILE FRD G+RGNRQK R+MWLIDE GIE FR  
Sbjct  226  STRVAPAIPLNAWVPADHSVIRLSRAILEVFRDNGSRGNRQKTRLMWLIDEWGIERFRQV  285

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V +         A        DWE+RD+ GVHPQKQ G +F+GLH+PVGRL  +D+ ELA
Sbjct  286  VSEAYGAPLAAAAPELM----DWEKRDFLGVHPQKQAGLNFVGLHVPVGRLTTEDLYELA  341

Query  57   RLADQYGSGELRLTVEQNI  1
            RLAD YG GE+RLTVEQN+
Sbjct  342  RLADTYGQGEVRLTVEQNV  360



>ref|WP_016861627.1| ferredoxin-nitrite reductase [Fischerella muscicola]
Length=534

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 190/274 (69%), Gaps = 19/274 (7%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI      VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPEIFNKFHTVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG-------------  454
            ++T    GNP F+NLPRK+N+ + G  D   H  INDLA++PA K+G             
Sbjct  167  MLTNKGEGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFKEGIGEQRLGIGQEFS  226

Query  453  ---RFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARM  283
                FGFN+LVGGFFSAKRC  AIPLDAWV   D+  VC+A+LE FRD G+R NR K+R+
Sbjct  227  RSPIFGFNILVGGFFSAKRCEAAIPLDAWVSPADVVAVCRAVLEVFRDYGSRANRLKSRL  286

Query  282  MWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLH  103
            MWLIDE G+E FR+EV +R+ +  L  A+ +   + DWE+RD+ GV+ QKQ   +++GLH
Sbjct  287  MWLIDEWGLEKFRSEVEQRLGKPFLPAASKD---EIDWEKRDHIGVYKQKQPELNYVGLH  343

Query  102  IPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            IPVGR+ A DM E+ARLAD YGSGE+RLT+EQN+
Sbjct  344  IPVGRMTAQDMFEIARLADVYGSGEIRLTLEQNV  377



>ref|WP_010994783.1| ferredoxin-nitrite reductase [Nostoc sp. PCC 7120]
 ref|NP_484651.1| ferredoxin-nitrite reductase [Nostoc sp. PCC 7120]
 gb|AAC46074.1|AAC46074 nitrite reductase [Nostoc sp. PCC 7120]
 dbj|BAB72565.1| nitrite reductase [Nostoc sp. PCC 7120]
Length=536

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/275 (53%), Positives = 191/275 (69%), Gaps = 20/275 (7%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P I      VGLTS+QSGMDN+RN  G+P+AG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPHIFNKFHAVGLTSVQSGMDNIRNITGDPIAGLDADELYDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG-------------  454
            ++T    GN  FSNLPRK+N+ + G  D   H  INDLA++PA K+G             
Sbjct  167  MLTNKGEGNREFSNLPRKFNIAIAGGRDNSVHAEINDLAFVPAFKEGIGDWVLGNGEESS  226

Query  453  ----RFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKAR  286
                 FGFN+LVGGFFSAKRC  AIPL+AWV  +++ P+C+AILE +RD G R NR K+R
Sbjct  227  TYQKVFGFNVLVGGFFSAKRCEAAIPLNAWVTPEEVLPLCRAILEVYRDNGLRANRLKSR  286

Query  285  MMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGL  106
            +MWLIDE GI+ FRAEV +R+ +  L  A  +   + DWE+RD+ GV+ QKQEG +++GL
Sbjct  287  LMWLIDEWGIDKFRAEVEQRLGKSLLPAAPKD---EIDWEKRDHIGVYKQKQEGLNYVGL  343

Query  105  HIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            HIPVGRL A+DM ELAR+AD YGSGE+R+TVEQNI
Sbjct  344  HIPVGRLYAEDMFELARIADVYGSGEIRMTVEQNI  378



>ref|WP_026732020.1| ferredoxin--nitrite reductase [Fischerella sp. PCC 9605]
Length=541

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/280 (51%), Positives = 191/280 (68%), Gaps = 26/280 (9%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI +    VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPEIFQKFHTVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG-------------  454
            ++T    GNP F+NLPRK+N+ + G  D   H  INDLA++PA ++G             
Sbjct  167  MLTNKGEGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFQEGIGDRRLGTGEEFS  226

Query  453  ----------RFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARG  304
                       FGFN+LVGGFFSAKRC  AIPL+AWVP +D+  VC+A+LE FRD G R 
Sbjct  227  QSPIANPQSPVFGFNILVGGFFSAKRCEAAIPLNAWVPPEDVVAVCRAVLEVFRDRGLRA  286

Query  303  NRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEG  124
            NR K+R+MWLIDE G+E FR+EV + + +  +  A  +   + DWE+RD+ GV+ QKQ G
Sbjct  287  NRLKSRLMWLIDEWGLEKFRSEVEQHLGKPLINAAPKD---EIDWEKRDHVGVYKQKQPG  343

Query  123  YSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQN  4
             +++GLH+PVGRL A+DM E+ARLAD YGSGE+RLTVEQN
Sbjct  344  LNYVGLHVPVGRLTAEDMFEIARLADVYGSGEIRLTVEQN  383



>ref|WP_024124217.1| assimilatory ferredoxin-nitrite reductase NirA [Thermosynechococcus 
sp. NK55a]
 ref|YP_008899317.1| assimilatory ferredoxin-nitrite reductase NirA [Thermosynechococcus 
sp. NK55a]
 gb|AHB87804.1| assimilatory ferredoxin-nitrite reductase NirA [Thermosynechococcus 
sp. NK55a]
Length=519

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 185/259 (71%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            QIRG+ + D+P++L  L   GLTS+QSGMDNVRN  G+PVAGID  E++DTRP    L  
Sbjct  97   QIRGLPIEDIPQVLEQLRACGLTSVQSGMDNVRNLTGSPVAGIDAAELIDTRPLLMKLQA  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N +GNP FSNLPRK+N+ + G  D   H  IND+A++PA + GR GFN+LVGG  S
Sbjct  157  MITNNGQGNPEFSNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYRQGRLGFNVLVGGLLS  216

Query  414  AKRCAEAIPLDAWVPADD-IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            A+RC  A+PLDAWVP D+ +  +C+AILE FRD G RGNRQKAR+ WLIDE G+E FRA 
Sbjct  217  ARRCTAAVPLDAWVPPDEAVVYLCRAILEIFRDHGLRGNRQKARLRWLIDEWGMEKFRAA  276

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++P   L  A  +   +  W+++D+ GVH QKQ   +++GLH+PVGRL A D  ELA
Sbjct  277  VAAKLPFALLSAAPKD---EIAWDKQDHLGVHRQKQRRLNYVGLHVPVGRLYAPDFCELA  333

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A  YG  E+RLTVEQN+
Sbjct  334  RIAQVYGQSEVRLTVEQNV  352



>ref|XP_007514721.1| nitrite reductase [Bathycoccus prasinos]
 emb|CCO14961.1| nitrite reductase [Bathycoccus prasinos]
Length=1060

 Score =   302 bits (773),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 191/262 (73%), Gaps = 4/262 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D  +I+  LE++ + SLQSG+DN RNA G+P+AGIDP EI+DTRP+ + + +
Sbjct  289  QMRGIQLKDAHDIMVNLERLKMCSLQSGLDNARNATGSPIAGIDPLEIIDTRPFTDKIQE  348

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKD--GRFGFNLLVGGF  421
             +T   RGNP  +NL RKWNVCVVGS D +EHP +NDLA++PA  +  G  GFN+LVGGF
Sbjct  349  YVTGGGRGNPEIANLGRKWNVCVVGSSDYFEHPELNDLAFVPAKNETTGEMGFNVLVGGF  408

Query  420  FSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
             S+ R AEAIPLDAWVP  D+  +  AIL  FRD G RGNRQKARMMWL+DE+G+E FR 
Sbjct  409  ISSARAAEAIPLDAWVPESDVVAMTHAILTTFRDYGHRGNRQKARMMWLVDEMGLEVFRT  468

Query  240  EVVKRMP--eqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMD  67
            EV  RMP     L RAA ++LI +   RR+  GVH QKQEG  ++G ++  GRL+ DDM 
Sbjct  469  EVESRMPGGANSLARAAKQDLIDRTQVRRNVIGVHDQKQEGLQWVGANVVGGRLQGDDMM  528

Query  66   ELARLADQYGSGELRLTVEQNI  1
             +A LA++YGSGE+RLTVEQN 
Sbjct  529  RIAELAEKYGSGEIRLTVEQNF  550



>ref|WP_011321208.1| ferredoxin-nitrite reductase [Anabaena variabilis]
 ref|YP_325032.1| ferredoxin-nitrite reductase [Anabaena variabilis ATCC 29413]
 gb|ABA24137.1| assimilatory nitrite reductase (ferredoxin) precursor [Anabaena 
variabilis ATCC 29413]
Length=536

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/275 (52%), Positives = 191/275 (69%), Gaps = 20/275 (7%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P I      VGLTS+QSGMDN+RN  G+P+AG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPHIFNKFHAVGLTSVQSGMDNIRNITGDPIAGLDADELYDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG-------------  454
            ++T    GN  FSNLPRK+N+ + G  D   H  INDLA++PA K+G             
Sbjct  167  MLTNKGEGNREFSNLPRKFNIAIAGGRDNSVHAEINDLAFVPAFKEGIGDWVLGGGEESS  226

Query  453  ----RFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKAR  286
                 FGFN+LVGGFFSAKRC  AIPL+AWV A+++  +C+A+LE +RD G R NR K+R
Sbjct  227  THQKVFGFNVLVGGFFSAKRCEAAIPLNAWVTAEEVVALCRAVLEVYRDNGLRANRLKSR  286

Query  285  MMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGL  106
            +MWLIDE GI+ FRAEV +R+ +  L  A  +   + DWE+RD+ GV+ QKQEG +++GL
Sbjct  287  LMWLIDEWGIDKFRAEVEQRLGKSLLYAAPKD---EIDWEKRDHIGVYKQKQEGLNYVGL  343

Query  105  HIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            HIPVGRL A+DM ELAR+AD YGSGE+R+TVEQNI
Sbjct  344  HIPVGRLYAEDMFELARIADVYGSGEIRMTVEQNI  378



>ref|WP_021834814.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii]
 emb|CCQ60545.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 0401]
Length=516

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 191/260 (73%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I   L++V LTS+QSGMDNVRN  G+P+AG+D +E++DTR     + +
Sbjct  108  QLRGIRLEDIPDIFNRLQEVNLTSMQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQE  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  168  MITNHGAGNYDFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKNGELGFNVVVGGFFS  227

Query  414  AKRCAEAIPLDAWVPADD--IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            A RC  AIPL+AWVP  +  +  +C+AIL  FRD G RGNRQKAR+MWLIDE G+  FRA
Sbjct  228  ASRCDAAIPLNAWVPPTEAAVIDLCRAILTIFRDNGLRGNRQKARLMWLIDEWGLNKFRA  287

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV +++  Q    A  + +   DWE+RD+ GV PQKQ G +++G+H+PVGRL A+DM + 
Sbjct  288  EVEQKLGYQLETEAEKDAI---DWEKRDHLGVFPQKQAGLNYVGMHVPVGRLYAEDMLDF  344

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARLA+ YG+GELRLTVEQN+
Sbjct  345  ARLAEVYGNGELRLTVEQNV  364



>ref|WP_029315006.1| ferredoxin--nitrite reductase [Acaryochloris sp. CCMEE 5410]
Length=645

 Score =   293 bits (751),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 188/258 (73%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I    +Q GLTS+QSGMDNVRN  G+PVAG+D +E++DTR     +  
Sbjct  106  QLRGIRIEDIPDIFNRFQQAGLTSVQSGMDNVRNITGSPVAGLDADELIDTRGLVRKVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT NS+GNPAF+NLPRK+N+ + G  D   H  IND+A++PA KDG+ GFN+LVGGFFS
Sbjct  166  MITNNSQGNPAFTNLPRKFNIAIAGGRDNSVHAEINDIAFVPAYKDGKLGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRCA AI ++ WV    +  + +AIL  +RD G+R NR ++RMMWLID+ G+E FRA V
Sbjct  226  AKRCAPAISMNVWVDHTQVVDISEAILIVYRDNGSRANRHQSRMMWLIDDWGVERFRAAV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
              +M       A  +   + DW++RD+ GVH QKQ G +F+G+H+PVGR  A+DM ELAR
Sbjct  286  EAQMGVTLQTAADKD---EFDWDKRDHLGVHAQKQPGLNFVGIHVPVGRFYANDMLELAR  342

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGSGE+RLTVEQN+
Sbjct  343  MAEVYGSGEIRLTVEQNV  360



>ref|WP_012163413.1| ferredoxin-nitrite reductase [Acaryochloris marina]
 ref|YP_001517296.1| ferredoxin-nitrite reductase [Acaryochloris marina MBIC11017]
 gb|ABW27980.1| ferredoxin-nitrite reductase [Acaryochloris marina MBIC11017]
Length=645

 Score =   293 bits (751),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 188/258 (73%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I    +Q GLTS+QSGMDNVRN  G+PVAG+D +E++DTR     +  
Sbjct  106  QLRGIRIEDIPDIFNRFQQAGLTSVQSGMDNVRNITGSPVAGLDADELIDTRGLVRKVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT NS+GNPAF+NLPRK+N+ + G  D   H  IND+A++PA KDG+ GFN+LVGGFFS
Sbjct  166  MITNNSQGNPAFTNLPRKFNIAIAGGRDNSVHAEINDIAFVPAYKDGKLGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRCA AI ++ WV    +  + +AIL  +RD G+R NR ++RMMWLID+ G+E FRA V
Sbjct  226  AKRCAPAISMNVWVDHTQVVDISEAILIVYRDNGSRANRHQSRMMWLIDDWGVERFRAAV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
              +M       A  +   + DW++RD+ GVH QKQ G +F+G+H+PVGR  A+DM ELAR
Sbjct  286  ETQMGVTLQAAADKD---EFDWDKRDHLGVHAQKQPGLNFVGIHVPVGRFYANDMLELAR  342

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGSGE+RLTVEQN+
Sbjct  343  MAEVYGSGEIRLTVEQNV  360



>ref|WP_039714131.1| ferredoxin--nitrite reductase [Scytonema millei]
 gb|KIF21842.1| ferredoxin--nitrite reductase [Scytonema millei VB511283]
Length=530

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 187/269 (70%), Gaps = 14/269 (5%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+ EI      VGLTS+QSGMDNVRN  G+P+AG+D EE+ DTR   + +  
Sbjct  106  QLRGIRMEDLLEIFHKFAAVGLTSVQSGMDNVRNITGDPLAGLDAEELFDTRDLVHQVQN  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG-----------RF  448
             IT    GNP F+NLPRK+N+ + G  D   H  INDLA++PA ++G            F
Sbjct  166  AITNYGEGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFQEGSRESGVGSREKEF  225

Query  447  GFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLID  268
            GFN+LVGGFFSAKRC  A+PLDAWV  +D+  VC+A+LE +RD G R NRQKAR+MWLID
Sbjct  226  GFNILVGGFFSAKRCEAAVPLDAWVAPEDVVAVCRAVLEVYRDNGLRANRQKARLMWLID  285

Query  267  ELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGR  88
            E G+E FR  V  ++ +     AA +   + DWE+RD+ G++PQKQ G  ++GLH+P+GR
Sbjct  286  EWGMEKFRLAVETQLGKSLRSAAAKD---EIDWEKRDHIGIYPQKQPGLHYVGLHVPIGR  342

Query  87   LEADDMDELARLADQYGSGELRLTVEQNI  1
            L A DM E+ARLA+ YGSGE+RLTVEQNI
Sbjct  343  LYAQDMFEVARLAEVYGSGEIRLTVEQNI  371



>ref|WP_002781418.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa]
 emb|CCI15840.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9806]
Length=513

 Score =   289 bits (740),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 188/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  FSNLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNYGQGNYQFSNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR +
Sbjct  227  AKRCEAAIPMNVWVKPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTQ  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANHLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_029633456.1| ferredoxin--nitrite reductase [[Scytonema hofmanni] UTEX B 1581]
Length=542

 Score =   290 bits (742),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 148/283 (52%), Positives = 191/283 (67%), Gaps = 28/283 (10%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I    E VGLTS+QSGMDNVRN  G+PVAG+D  E+ DTR     +  
Sbjct  106  QLRGIRIQDLPDIFNKFEAVGLTSVQSGMDNVRNITGDPVAGLDASELFDTRELVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR------------  451
            +IT N  GN  FSNLPRK+N+ + G  D   H  INDLA++PA K+G             
Sbjct  166  MITNNGVGNSEFSNLPRKFNIAITGGRDNSVHAEINDLAFVPAFKEGGQGGQRGHGEKDE  225

Query  450  -------------FGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGA  310
                         FGFN+LVGGFFSAKRC  AIPL+AWVP +D+  VC+AILE FRD G 
Sbjct  226  TASLSSPSSLSPIFGFNVLVGGFFSAKRCDAAIPLNAWVPPEDVVAVCRAILEVFRDRGL  285

Query  309  RGNRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQ  130
            R NRQK+R+MWLIDE G++ FR+EV  R+ +  +  AA +   + DWE+RD+ GV+ QKQ
Sbjct  286  RANRQKSRLMWLIDEWGLDKFRSEVENRLGKSLISAAAKD---EIDWEKRDHIGVYKQKQ  342

Query  129  EGYSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
             G +++GL+IPVGR  ADDM E+ARLA+ YGS E+RLTVEQN+
Sbjct  343  PGLNYVGLNIPVGRFFADDMFEIARLAEVYGSNEIRLTVEQNV  385



>ref|WP_002760022.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCH97466.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9717]
Length=513

 Score =   289 bits (740),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 187/259 (72%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  FSNLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFSNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV PQKQEG S++GL IPVGRL ADDM +LA
Sbjct  287  VANHLGYALATAAEKDAI---DWEKRDHLGVFPQKQEGLSYVGLCIPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_006275773.1| ferredoxin-nitrite reductase [Cylindrospermopsis raciborskii]
 gb|EFA71193.1| Nitrite/sulfite reductase, hemoprotein beta- component, ferrodoxin 
[Cylindrospermopsis raciborskii CS-505]
Length=545

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 184/257 (72%), Gaps = 4/257 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+   D+P+I     +VGLTS+QSGMDNVRN  G+P+AG+D  E+ DTR     +  
Sbjct  126  QLRGIDFSDIPDIFNKFHKVGLTSIQSGMDNVRNITGDPLAGLDANELYDTRELVQQIQD  185

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            L+T    GNP F+NLPRK+N+ V G  D   H  INDLA++PA K+G FGFN+LVGGFFS
Sbjct  186  LLTNGGEGNPEFTNLPRKFNIAVTGGKDNSIHAEINDLAFVPAFKEG-FGFNVLVGGFFS  244

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
             KRC  AIPL+ WV  +++  + KAI+E FRD G R NRQKAR+MWLIDE G+E FR EV
Sbjct  245  GKRCEAAIPLNVWVKPEEVVSLSKAIVEIFRDHGLRLNRQKARLMWLIDEWGLEKFRDEV  304

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K+  +     A  +   + DWE+RD+ GV+PQKQ G +++GL+IPVGRL ADDM ELAR
Sbjct  305  EKQWGKSLQTAAPKD---EIDWEKRDHIGVYPQKQLGLNYVGLNIPVGRLSADDMFELAR  361

Query  54   LADQYGSGELRLTVEQN  4
            LA+ YGSGE+R TVEQN
Sbjct  362  LAEVYGSGEIRFTVEQN  378



>ref|WP_002797849.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI26322.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9809]
Length=513

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 188/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  FSNLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNYGQGNYQFSNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANQLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_012408235.1| ferredoxin-nitrite reductase [Nostoc punctiforme]
 ref|YP_001865160.1| ferredoxin-nitrite reductase [Nostoc punctiforme PCC 73102]
 gb|ACC80217.1| nitrite and sulphite reductase 4Fe-4S subunit NirA [Nostoc punctiforme 
PCC 73102]
Length=527

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 189/267 (71%), Gaps = 12/267 (4%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I      VGLT++QSGMDN+RN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDLPDIFNRFHAVGLTTIQSGMDNIRNITGDPVAGLDADELYDTRELIQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR---------FGF  442
            ++T    GNP FSNLPRK+N+ + G  D   H  INDLA++PA K+           FGF
Sbjct  166  MLTNKGEGNPEFSNLPRKFNIAIAGGRDNSVHAEINDLAFVPAFKEANGQEFSKPPIFGF  225

Query  441  NLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDEL  262
            N+LVGGFFSAKRC  AIPL+AWV  +D+  VC+A+LE FRD G R NRQK+R+MWLIDE 
Sbjct  226  NILVGGFFSAKRCEAAIPLNAWVAPEDVVAVCRAVLEVFRDHGPRANRQKSRLMWLIDEW  285

Query  261  GIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLE  82
            G+E FRAEV  R+ +  L  AA +   + DWE+RD+ GV+ QKQ G ++ GL+IPVGRL 
Sbjct  286  GLEKFRAEVDTRLGKSLLPAAAKD---EIDWEKRDHIGVYKQKQPGLNYAGLNIPVGRLY  342

Query  81   ADDMDELARLADQYGSGELRLTVEQNI  1
            A+DM E+ARLA+ +GSGE+R TVEQNI
Sbjct  343  AEDMFEIARLAEVFGSGEIRFTVEQNI  369



>ref|WP_015230746.1| precorrin-3B synthase [Dactylococcopsis salina]
 ref|YP_007173126.1| precorrin-3B synthase [Dactylococcopsis salina PCC 8305]
 gb|AFZ51769.1| precorrin-3B synthase [Dactylococcopsis salina PCC 8305]
Length=512

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 185/260 (71%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+PEI   L   G+TS+QSGMDNVRN  G+PVAG+D EE++DTR     +  
Sbjct  106  QLRGIRLEDIPEIFSQLHATGMTSMQSGMDNVRNITGSPVAGLDGEELIDTRQLVKKVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GNP F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN+LVGGFFS
Sbjct  166  MITNSGEGNPEFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADD--IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            +KRC  AIPL+AW+P  +  +  V +AILE +RD G R NRQK+R+MWLIDE+G+E FR 
Sbjct  226  SKRCEAAIPLNAWIPPTEEAVVGVSRAILEVYRDRGLRANRQKSRLMWLIDEIGLEEFRT  285

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
             V     +     AA + +   DW++RD+ G+HPQKQ G SF+G++IPVGRL  DD  +L
Sbjct  286  LVETAFGQPLKSAAAEDVI---DWDKRDHIGIHPQKQAGKSFVGMNIPVGRLSTDDFFDL  342

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARLA+ YG  E+RLTVEQN+
Sbjct  343  ARLAEVYGGSEIRLTVEQNV  362



>ref|WP_006457363.1| ferredoxin-nitrite reductase [Synechococcus sp. PCC 7335]
 gb|EDX87543.1| Nitrite and sulphite reductase 4Fe-4S domain protein [Synechococcus 
sp. PCC 7335]
Length=522

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 189/262 (72%), Gaps = 7/262 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+P+I R  EQ GLTS+QSGMDNVRN  G+PVAGI   E+VDT+     +  
Sbjct  112  QLRGVRLEDIPDIFRRFEQAGLTSIQSGMDNVRNITGSPVAGIAANELVDTQGLVIKVQD  171

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG----RFGFNLLVG  427
            +IT NS GN  F+NLPRK+N+ + GS +   H  IND+A++PA KDG      GFN+LVG
Sbjct  172  MITNNSEGNYDFTNLPRKFNIAIEGSREDSIHSEINDIAFIPAFKDGDESSELGFNVLVG  231

Query  426  GFFSAKRCAEAIPLDAWVPADD-IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEG  250
            GFFSA+RC  AI LDAWVP DD +  +C+AIL  FRD G+RGNRQ+ R+MWLI+E+G++ 
Sbjct  232  GFFSARRCESAIALDAWVPVDDTVVEICRAILTVFRDKGSRGNRQQTRLMWLIEEMGLDA  291

Query  249  FRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDM  70
            FRA V + M    L  A  + + ++   + D+ GVHPQKQ G +++GLH+PVG + ADDM
Sbjct  292  FRAAVEEEMGTTLLPAAPEDAITEEG--KSDHLGVHPQKQPGLNYVGLHVPVGHIFADDM  349

Query  69   DELARLADQYGSGELRLTVEQN  4
             ELARLA+ YG+GE+RLTVEQN
Sbjct  350  FELARLAEVYGNGEIRLTVEQN  371



>ref|WP_015166928.1| sulfite reductase subunit beta (hemoprotein) [Synechococcus sp. 
PCC 7502]
 ref|YP_007104404.1| sulfite reductase subunit beta (hemoprotein) [Synechococcus sp. 
PCC 7502]
 gb|AFY72269.1| sulfite reductase, beta subunit (hemoprotein) [Synechococcus 
sp. PCC 7502]
Length=518

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 183/262 (70%), Gaps = 7/262 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L +VPEI R   + GLTS+QSGMDNVRN   +PVAGID  E++DTR     +  
Sbjct  97   QMRGIALSNVPEIFRKFSESGLTSIQSGMDNVRNITASPVAGIDANELIDTRGLARKIQD  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR----FGFNLLVG  427
            +IT N  GN +FSNLPRK+N+ + G  D   H  IND+A++PA K G      GFN+LVG
Sbjct  157  MITNNGDGNKSFSNLPRKFNIAIAGCRDNSVHAEINDIAFIPAYKGGEKGASIGFNVLVG  216

Query  426  GFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGF  247
            GFFS KR AEAIPL+AWV   D+  +C+AIL  FRD G R NRQK+R+MWLIDE GI  F
Sbjct  217  GFFSIKRVAEAIPLNAWVDPRDVVQLCEAILLVFRDHGLRENRQKSRLMWLIDEWGIAKF  276

Query  246  RAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMD  67
            R EV KR+    L  +  +   + +W +RD+ G+H QKQ G +++GLH+PVGRL A DM 
Sbjct  277  RDEVEKRLGYTLLPASPKD---EIEWNKRDHIGIHAQKQSGLNYVGLHVPVGRLYASDMF  333

Query  66   ELARLADQYGSGELRLTVEQNI  1
             LAR+AD YGSGE+RLTVEQNI
Sbjct  334  NLARMADVYGSGEVRLTVEQNI  355



>ref|WP_002775642.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI06091.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 7941]
Length=513

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 188/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANQLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_012265139.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 ref|YP_001656855.1| ferredoxin-nitrite reductase [Microcystis aeruginosa NIES-843]
 dbj|BAG01663.1| ferredoxin--nitrite reductase [Microcystis aeruginosa NIES-843]
Length=513

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 187/259 (72%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT    GN  FSNLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNYGEGNYQFSNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+AILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPINVWVRPNQEVVDLCRAILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++       A  + +   DWE+RD+ GV PQKQEG S+IG  +PVGRL ADDM +LA
Sbjct  287  VANQLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGFCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_016868536.1| ferredoxin-nitrite reductase [Fischerella muscicola]
Length=541

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/281 (52%), Positives = 190/281 (68%), Gaps = 26/281 (9%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI      VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPEIFHKFHTVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKD----GR--------  451
            ++T    GNP F+NLPRK+N+ + G  D   H  INDLA++PA  +    GR        
Sbjct  167  MLTNKGEGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFHEDGEVGRLGDGEKDF  226

Query  450  -----------FGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARG  304
                       FGFN+LVGGFFSAKRC  AIPLDAWVP  D+  VC+ +LE FRD G R 
Sbjct  227  TPTPYHSTSKVFGFNILVGGFFSAKRCEAAIPLDAWVPPSDVVAVCRVVLEVFRDHGLRA  286

Query  303  NRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEG  124
            NRQK+R+MWLIDE G+E FR+EV +R+ +  L  A  +   + DWE+RD+ G++ QKQ  
Sbjct  287  NRQKSRLMWLIDEWGLEKFRSEVEQRLGKPLLPAAPKD---EIDWEKRDHIGLYKQKQPE  343

Query  123  YSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
             +++GLHIPVGRL A+DM E+ARLAD YG+GE+RLTVEQN+
Sbjct  344  LNYVGLHIPVGRLTAEDMFEIARLADVYGNGEIRLTVEQNV  384



>ref|WP_007310897.1| ferredoxin-nitrite reductase [Crocosphaera watsonii]
 gb|EHJ12568.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 0003]
 emb|CCQ56529.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 0005]
Length=516

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 189/260 (73%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I   L++V LTS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  108  QLRGIRLEDIPDIFNRLQEVNLTSMQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  168  MITNHGAGNYDFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKNGELGFNVVVGGFFS  227

Query  414  AKRCAEAIPLDAWVPADD--IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            A RC  AIPL+AWVP  +  +  +C+AIL  FRD G RGNRQKAR+MWLIDE G+  FRA
Sbjct  228  ASRCDAAIPLNAWVPPTEAAVIDLCRAILTIFRDNGLRGNRQKARLMWLIDEWGLNKFRA  287

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV + +  Q    A  + +   DWE+RD+ GV PQKQ G +++G+H+PVGRL A+DM + 
Sbjct  288  EVEQELGYQLETEAEKDAI---DWEKRDHLGVFPQKQAGLNYVGMHVPVGRLYAEDMLDF  344

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARLA+ YG+GELRLTVEQN+
Sbjct  345  ARLAEVYGNGELRLTVEQNV  364



>dbj|GAL93751.1| ferredoxin--nitrite reductase [Microcystis aeruginosa NIES-44]
Length=513

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 187/259 (72%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNYGQGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV PQKQEG S+IGL IPVGRL ADDM +LA
Sbjct  287  VANHLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCIPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_002733445.1| ferredoxin--nitrite reductase [Microcystis aeruginosa]
 gb|ELP56496.1| ferredoxin--nitrite reductase [Microcystis aeruginosa TAIHU98]
Length=513

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 188/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANQLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_023076501.1| ferredoxin-nitrite reductase [Leptolyngbya sp. Heron Island J]
 gb|ESA32490.1| ferredoxin-nitrite reductase [Leptolyngbya sp. Heron Island J]
Length=621

 Score =   291 bits (744),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 189/260 (73%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+P+I   +  VGLTS+QSGMDNVRN  G+P+AGID  E++DTR     +  
Sbjct  108  QLRGVHLEDIPDIFSKMHAVGLTSMQSGMDNVRNITGSPIAGIDANELIDTRELVQAVQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT + +GN  F+NLPRK+N+ + GS D   H  IND+A++PA KDG  GFN+LVGGFFS
Sbjct  168  MITNSGQGNYDFTNLPRKFNIALEGSTDNSVHAEINDIAFVPAYKDGNLGFNVLVGGFFS  227

Query  414  AKRCAEAIPLDAWVPA--DDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            + RCA AIPLD WVPA  +D+  +C+AIL  +RD G+RGNRQK R+MWLID  G+E FR 
Sbjct  228  STRCAAAIPLDVWVPAEKEDVVELCRAILTVYRDNGSRGNRQKTRLMWLIDAWGLEKFRT  287

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV K + +     A  + L   D  ++D+ GV  QKQEG ++IGLHIPVGRL+AD M +L
Sbjct  288  EVEKSVGKSLTLAAPEDAL---DSNKKDHVGVFQQKQEGLNYIGLHIPVGRLQADHMFDL  344

Query  60   ARLADQYGSGELRLTVEQNI  1
            AR+A+ YG+G+LRLTVEQN+
Sbjct  345  ARVAEVYGNGDLRLTVEQNV  364



>ref|WP_009455119.1| ferredoxin-nitrite reductase [Fischerella sp. JSC-11]
 gb|EHC18905.1| Ferredoxin--nitrite reductase [Fischerella sp. JSC-11]
Length=541

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 191/281 (68%), Gaps = 26/281 (9%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI      VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPEIFHKFHTVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKD----GR--------  451
            ++T   +GNP F+NLPRK+N+ + G  D   H  INDLA++PA  +    GR        
Sbjct  167  MLTNKGQGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFHEYGEVGRLGDGEKDF  226

Query  450  -----------FGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARG  304
                       FGFN+LVGGFFSAKRC  AIPLDAWV   D+  VC+A+LE FRD G R 
Sbjct  227  TPTPYNSSSKVFGFNILVGGFFSAKRCEAAIPLDAWVSPADVVAVCRAVLEVFRDHGLRA  286

Query  303  NRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEG  124
            NRQK+R+MWLIDE G+E FR+EV +R+ +  L  A  +   + DWE+RD+ GV+ QKQ  
Sbjct  287  NRQKSRLMWLIDEWGLEKFRSEVEQRLGKPLLPAAPKD---EIDWEKRDHIGVYKQKQPE  343

Query  123  YSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
             +++GLHIPVGRL A+DM E+ARLAD YG+GE+RLTVEQN+
Sbjct  344  LNYVGLHIPVGRLTAEDMFEIARLADVYGNGEIRLTVEQNV  384



>emb|CCQ65638.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 0402]
Length=518

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 189/260 (73%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I   L++V LTS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  108  QLRGIRLEDIPDIFNRLQEVNLTSMQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  168  MITNHGAGNYDFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKNGELGFNVVVGGFFS  227

Query  414  AKRCAEAIPLDAWVPADD--IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            A RC  AIPL+AWVP  +  +  +C+AIL  FRD G RGNRQKAR+MWLIDE G+  FRA
Sbjct  228  ASRCDAAIPLNAWVPPTEAAVIDLCRAILTIFRDNGLRGNRQKARLMWLIDEWGLNKFRA  287

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV + +  Q    A  + +   DWE+RD+ GV PQKQ G +++G+H+PVGRL A+DM + 
Sbjct  288  EVEQELGYQLETEAEKDAI---DWEKRDHLGVFPQKQAGLNYVGMHVPVGRLYAEDMLDF  344

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARLA+ YG+GELRLTVEQN+
Sbjct  345  ARLAEVYGNGELRLTVEQNV  364



>ref|WP_013323579.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7822]
 ref|YP_003888785.1| nitrite and sulfite reductase 4Fe-4S region [Cyanothece sp. PCC 
7822]
 gb|ADN15510.1| nitrite and sulphite reductase 4Fe-4S region [Cyanothece sp. 
PCC 7822]
Length=519

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 192/262 (73%), Gaps = 8/262 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+PEI R LE VG+T++QSGMDNVRN  G+PVAGID +E++DTR     +  
Sbjct  106  QLRGVRLEDIPEIFRKLETVGITAVQSGMDNVRNITGSPVAGIDADELIDTRELGKKIED  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GN AF+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN+LVGG+ S
Sbjct  166  MITNSGEGNYAFTNLPRKFNIALEGGRDNSIHAEINDVAFVPAYKNGELGFNVLVGGYLS  225

Query  414  AKRCAEAIPLDAWVPA-DDIFPVCKAILEAFRD----LGARGNRQKARMMWLIDELGIEG  250
            A+RCAEAIP+D WV A DD+  +C+AIL  + +     G R NRQKAR+MWLID+ G E 
Sbjct  226  AQRCAEAIPMDVWVAANDDVVELCRAILTVYTENGLSEGLRANRQKARLMWLIDQWGTEK  285

Query  249  FRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDM  70
            FR+EV K   +     AAA+E+ +   +++DY GV+PQKQ GY ++GLH+PVGRL+A+ M
Sbjct  286  FRSEVEKEFGQPLARAAAADEITE---DKKDYIGVYPQKQAGYHYVGLHVPVGRLDAETM  342

Query  69   DELARLADQYGSGELRLTVEQN  4
             E+ARLAD YG+GE+R TVEQN
Sbjct  343  FEMARLADVYGNGEIRATVEQN  364



>ref|WP_008196112.1| ferredoxin-nitrite reductase [Microcystis sp. T1-4]
 emb|CCI30334.1| Ferredoxin--nitrite reductase [Microcystis sp. T1-4]
Length=513

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 187/259 (72%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNYGQGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANHLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_015224664.1| assimilatory nitrite reductase (ferredoxin) precursor [Halothece 
sp. PCC 7418]
 ref|YP_007167000.1| assimilatory nitrite reductase (ferredoxin) precursor [Halothece 
sp. PCC 7418]
 gb|AFZ42786.1| assimilatory nitrite reductase (ferredoxin) precursor [Halothece 
sp. PCC 7418]
Length=512

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 192/260 (74%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+P+I   + + G+TS+QSGMDNVRN  G+PVAG+D EE++DTR     +  
Sbjct  106  QLRGVRLEDIPDIFSRIHEAGMTSMQSGMDNVRNITGSPVAGLDAEELIDTRELVKKVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GNP F+NLPRK+N+ + G  D   H  IND+A++PA +DG  GFN+LVGGFFS
Sbjct  166  MITNSGEGNPEFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYRDGELGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPV--CKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            +KRC  AIPL+ W+P  + F V   +AILE +RD G R NRQK+R+MWLIDELGI+ FR 
Sbjct  226  SKRCESAIPLNVWIPPTENFVVGISRAILEVYRDRGLRANRQKSRLMWLIDELGIDPFR-  284

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            ++V+    Q L  A AE++I  DWE+RD+ GVHPQKQ G  ++GL++PVGRL ADD+ +L
Sbjct  285  QLVEETFGQTLLTAPAEDVI--DWEKRDHIGVHPQKQAGKFYVGLNVPVGRLTADDLFDL  342

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARLA+ YG  E+RLTVEQN+
Sbjct  343  ARLAEVYGGNEIRLTVEQNV  362



>ref|WP_015140514.1| sulfite reductase subunit beta (hemoprotein) [Nostoc sp. PCC 
7524]
 ref|YP_007077699.1| sulfite reductase subunit beta (hemoprotein) [Nostoc sp. PCC 
7524]
 gb|AFY50102.1| sulfite reductase, beta subunit (hemoprotein) [Nostoc sp. PCC 
7524]
Length=536

 Score =   288 bits (737),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 189/274 (69%), Gaps = 19/274 (7%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I      VGLTS+QSGMDN+RN  G+ VAG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPDIFNRFHSVGLTSVQSGMDNIRNITGDAVAGLDADELYDTRQLVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR------------  451
            ++T   +GNP FSNLPRK+N+ + G  D   H  INDLA++PA ++G             
Sbjct  167  MLTNKGQGNPEFSNLPRKFNIAIAGGRDNSVHAEINDLAFVPAFREGTGDWVLGTGQDFS  226

Query  450  ----FGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARM  283
                 GFN+LVGGFFSAKRC  AIPL+AWV  +++  VC+AILE +RD G R NR K+R+
Sbjct  227  ASSLLGFNILVGGFFSAKRCEAAIPLNAWVTPEEVVAVCRAILEVYRDNGLRANRLKSRL  286

Query  282  MWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLH  103
            MWLIDE GIE FR EV KR+ +  L  A  +   + DWE+RD+ GV+ QKQ G +++GLH
Sbjct  287  MWLIDEWGIEKFRLEVEKRLGKSLLPAAPKD---EIDWEKRDHIGVYKQKQAGLNYVGLH  343

Query  102  IPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            IPVG+L A+DM ELARLAD YGSGE+RLTVEQN+
Sbjct  344  IPVGKLYAEDMFELARLADVYGSGEMRLTVEQNV  377



>ref|WP_002752582.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCH91382.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9432]
Length=513

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 187/259 (72%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANHLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_026722911.1| ferredoxin--nitrite reductase [Fischerella sp. PCC 9431]
Length=538

 Score =   288 bits (737),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/281 (52%), Positives = 188/281 (67%), Gaps = 26/281 (9%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI      VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDLPEIFHKFHAVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRKLVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDG-------------  454
            ++T    GNP F+NLPRK+N+ + G  D   H  INDLA++PA ++G             
Sbjct  166  MLTNKGEGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFREGIGDQGSGIGKITA  225

Query  453  ----------RFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARG  304
                       FGFN+LVGGFFSAKRC  AIPLDAWV   D+  VC+A+LE FRD G+R 
Sbjct  226  QSSISDSQSPIFGFNILVGGFFSAKRCEAAIPLDAWVSPADVVAVCRAVLEVFRDHGSRA  285

Query  303  NRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEG  124
            NR K+R+MWLIDE G+E FR+EV +R+ +  L  A  +   + DWE+RD+ GV+ QKQ  
Sbjct  286  NRLKSRLMWLIDEWGLEKFRSEVEQRLGKPFLPAAPKD---EIDWEKRDHIGVYKQKQPE  342

Query  123  YSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
             +++GLHIPVGR+ A DM E+ARLAD YGSGE+R TVEQNI
Sbjct  343  LNYVGLHIPVGRMTAQDMFEIARLADVYGSGEIRFTVEQNI  383



>ref|WP_016515805.1| Sulfite reductase [ferredoxin] [Microcystis aeruginosa]
 gb|EPF21619.1| Sulfite reductase [ferredoxin] [Microcystis aeruginosa SPC777]
Length=513

 Score =   287 bits (735),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 188/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANQLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNL  362



>ref|WP_024969723.1| ferredoxin--nitrite reductase [Microcystis aeruginosa]
Length=513

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 187/259 (72%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANHLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_012599063.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7424]
 ref|YP_002376987.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7424]
 gb|ACK70119.1| Ferredoxin--nitrite reductase [Cyanothece sp. PCC 7424]
Length=516

 Score =   287 bits (735),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 191/262 (73%), Gaps = 8/262 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+PEI R LE VG+TS+QSGMDNVRN  G+PVAGID +E++DTR     +  
Sbjct  106  QLRGVRLEDIPEIFRKLETVGMTSIQSGMDNVRNITGSPVAGIDADELIDTRELVKKVED  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N +GN AF+NLPRK+N+ + G  D   H  IND+A++PA K G  GFN+LVGG+ S
Sbjct  166  MITNNGQGNYAFTNLPRKFNIAIEGGRDNSIHAEINDIAFVPAYKQGELGFNVLVGGYLS  225

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRD----LGARGNRQKARMMWLIDELGIEG  250
            A+RCAEA+ +D WV P DD+  +C+AIL  + +     G R NRQKAR+MWLID+ G+E 
Sbjct  226  AQRCAEAVKMDVWVAPNDDVVELCRAILTVYTENGLNEGLRTNRQKARLMWLIDKWGMEK  285

Query  249  FRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDM  70
            FR+EV K   +  +  A  +E+ Q   +++DY G++PQKQ GYS++GLH+PVGRL+A  M
Sbjct  286  FRSEVEKEFGKPLMRAALEDEITQ---DKKDYIGIYPQKQAGYSYVGLHVPVGRLDASAM  342

Query  69   DELARLADQYGSGELRLTVEQN  4
             E+ARLA+ YG+GE+R TVEQN
Sbjct  343  FEIARLAEVYGNGEIRATVEQN  364



>ref|WP_027254353.1| ferredoxin--nitrite reductase [Planktothrix agardhii]
Length=511

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 187/258 (72%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+ +I +  E+VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDLSDIFQRFERVGLTSIQSGMDNVRNITGSPVAGLDADELYDTRELVQQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GNP FSNLPRK+N+ + G  D   H  IND+A++PA K   FGFN+LVGGFFS
Sbjct  166  MITNEGKGNPEFSNLPRKFNIAIAGCRDNSIHAEINDIAFIPAFKQETFGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            A RC  AIPL+ WV  + +  +C+ ILE FRD G RG RQK R+MWLIDE GIE FR+EV
Sbjct  226  ATRCEAAIPLNVWVKPEQVVDLCRGILEVFRDNGPRGVRQKTRLMWLIDEWGIEKFRSEV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K++       A  +E++   WE+RD+ G++ QKQ G +++GL++PVGRL A++M EL+R
Sbjct  286  EKQIGYALEFEAEKDEIL---WEKRDHLGIYKQKQPGLNYVGLNVPVGRLYANEMLELSR  342

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGSGE+RLTVEQN+
Sbjct  343  IAEVYGSGEIRLTVEQNV  360



>ref|WP_021829137.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii]
 emb|CCQ48945.1| Ferredoxin--nitrite reductase [Crocosphaera watsonii WH 8502]
Length=516

 Score =   287 bits (734),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 189/260 (73%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I   L++V LTS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  108  QLRGIRLEDIPDIFNRLQEVNLTSMQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  168  MITNHGAGNYDFTNLPRKFNIALEGGRDNSVHAEINDIAFVPAYKNGELGFNVVVGGFFS  227

Query  414  AKRCAEAIPLDAWVPADD--IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            A RC  AIPL+AWVP  +  +  +C+AIL  FRD G RGNRQKAR+MWLIDE G+  FRA
Sbjct  228  ASRCDAAIPLNAWVPPTEAAVIDLCRAILTIFRDNGLRGNRQKARLMWLIDEWGLNKFRA  287

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV + +  Q    A  + +   DWE+RD+ GV PQKQ G +++G+H+PVGRL A+DM + 
Sbjct  288  EVEQELGYQLETEAEKDVI---DWEKRDHLGVFPQKQAGLNYVGMHVPVGRLYAEDMLDF  344

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARLA+ YG+GELRLTVEQN+
Sbjct  345  ARLAEVYGNGELRLTVEQNV  364



>ref|WP_017653159.1| ferredoxin-nitrite reductase [Microchaete sp. PCC 7126]
Length=539

 Score =   288 bits (736),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/277 (52%), Positives = 190/277 (69%), Gaps = 22/277 (8%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I      VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDLPDIFNRFHAVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKD--GR----------  451
            ++T    GN  F+NLPRK+N+ + G  D   H  INDLA++PA ++  GR          
Sbjct  166  MLTNKGEGNAEFTNLPRKFNIAIAGGRDNSVHAEINDLAFVPAFREEMGRWEDGETGGNP  225

Query  450  -------FGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQK  292
                   FGFN+LVGGFFSAKRC  AIPL+AWV   D+  VC+A+LE +RD G RGNRQK
Sbjct  226  VPTTQKIFGFNILVGGFFSAKRCEAAIPLNAWVTPTDVVAVCRAVLEVYRDHGLRGNRQK  285

Query  291  ARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFI  112
            AR+MWLIDE G+E FRAEV KR+ +     A  +   + DWE+RD+ GV+ QKQ G +++
Sbjct  286  ARLMWLIDEWGLEKFRAEVEKRLGKTLSPAAPKD---EIDWEKRDHIGVYKQKQSGLNYV  342

Query  111  GLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            G+HIPVGRL A+DM  +ARLA+ YGSGE+R+TVEQN+
Sbjct  343  GIHIPVGRLYAEDMFAIARLAEVYGSGEIRITVEQNL  379



>ref|WP_018399279.1| ferredoxin-nitrite reductase [filamentous cyanobacterium ESFC-1]
Length=513

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 187/259 (72%), Gaps = 5/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L DVP+I   L+ VGLTS+QSGMDNVRN  G+PVAGI+ +E++DTR     +  
Sbjct  106  QLRGIRLEDVPDIFAQLKAVGLTSMQSGMDNVRNITGSPVAGINGDELIDTRQLVKDVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GN  F+NLPRK+N+ + G  D   H  IND+A +PA KD + GFN+LVGGFFS
Sbjct  166  MITNSGEGNREFTNLPRKFNIAIEGGRDNAVHAEINDIALVPAYKDEKLGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVP--ADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            AKRC  AIPLDAWV   ++D+  +C+AILE +RD G R NRQK+R+MWLI+E G+E FR+
Sbjct  226  AKRCESAIPLDAWVEPQSEDVVGLCRAILEVYRDRGLRANRQKSRLMWLIEEWGVETFRS  285

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV K         A A    + +W++RD+ GVH Q Q GY+++GLH+PVGR  AD M EL
Sbjct  286  EVEK---VYGKPLATAAPEDEINWDKRDHIGVHQQVQPGYNYVGLHVPVGRFMADTMFEL  342

Query  60   ARLADQYGSGELRLTVEQN  4
            ARLA+ YGSGE+R+TVEQN
Sbjct  343  ARLAEVYGSGEIRVTVEQN  361



>ref|WP_026787877.1| ferredoxin--nitrite reductase [Planktothrix rubescens]
Length=511

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 187/258 (72%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+ +I +  E+VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDLSDIFQRFERVGLTSIQSGMDNVRNITGSPVAGLDADELYDTRELVQQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GNP FSNLPRK+N+ + G  D   H  IND+A++PA K   FGFN+LVGGFFS
Sbjct  166  MITNEGKGNPEFSNLPRKFNIAIAGCRDNSIHAEINDIAFIPAFKQETFGFNVLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            A RC  AIPL+ WV  + +  +C+ ILE FRD G RG RQK R+MWLIDE GIE FR+EV
Sbjct  226  ATRCEAAIPLNVWVKPEQVVDLCRGILEVFRDNGPRGVRQKTRLMWLIDEWGIEKFRSEV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K++       A  +E++   WE+RD+ G++ QKQ G +++GL++PVGRL A++M EL+R
Sbjct  286  EKQIGYALEFEAEKDEIL---WEKRDHLGIYKQKQPGLNYVGLNVPVGRLYANEMLELSR  342

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGSGE+RLTVEQN+
Sbjct  343  IAEVYGSGEIRLTVEQNV  360



>ref|WP_006515230.1| assimilatory nitrite reductase (ferredoxin) precursor [Leptolyngbya 
sp. PCC 7375]
 gb|EKV00824.1| assimilatory nitrite reductase (ferredoxin) precursor [Leptolyngbya 
sp. PCC 7375]
Length=622

 Score =   290 bits (742),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 189/260 (73%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+P+I   +  VGLTS+QSGMDNVRN  G+PVAGID  E++DTR     +  
Sbjct  108  QLRGVHLEDIPDIFSKMHAVGLTSMQSGMDNVRNITGSPVAGIDANELIDTRELVQAVQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT + +GN  F+NLPRK+N+ + GS D   H  IND+A++PA KDG  GFN+LVGGFFS
Sbjct  168  MITNSGQGNYDFTNLPRKFNIALEGSTDNSVHAEINDIAFVPAYKDGNLGFNVLVGGFFS  227

Query  414  AKRCAEAIPLDAWVPAD--DIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            + RCA AIPL  WV AD  D+  +C+AIL  +RD G+RGNRQK R+MWLIDE G++ FR 
Sbjct  228  STRCAAAIPLGVWVQADKEDVVELCRAILTVYRDNGSRGNRQKTRLMWLIDEWGMDKFRT  287

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV K + +     A  + L   D ++RD+ GV  QKQEG ++IGLHIPVGRL+A+ M +L
Sbjct  288  EVEKSVGKPLATAAPEDAL---DADKRDHVGVFQQKQEGLNYIGLHIPVGRLQAEQMLDL  344

Query  60   ARLADQYGSGELRLTVEQNI  1
            AR+A+ YGSG+LRLTVEQN+
Sbjct  345  ARVAEVYGSGDLRLTVEQNV  364



>ref|WP_006196192.1| ferredoxin-nitrite reductase [Nodularia spumigena]
 gb|EAW45499.1| nitrite reductase [Nodularia spumigena CCY9414]
 gb|AHJ28768.1| Ferredoxin--nitrite reductase [Nodularia spumigena CCY9414]
Length=535

 Score =   287 bits (735),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 188/280 (67%), Gaps = 25/280 (9%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I   L  VGLTS+QSGMDNVRN  GNPVAG+D +E+ DTR     +  
Sbjct  107  QLRGIRLEDLPDIFEKLHSVGLTSIQSGMDNVRNITGNPVAGLDADELFDTRELVQQVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR------------  451
            ++T    GNP FSNLPRK+N+ + G  D   H  INDLA++PA ++G             
Sbjct  167  MLTNKGEGNPEFSNLPRKFNIAIAGGRDNSVHAEINDLAFVPAFQEGSGEWGVGSGEWGV  226

Query  450  ----------FGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGN  301
                      FGFN+LVGGFFSAKRC  AIPL+AWV  +D+  VC+A+LE +RD G R N
Sbjct  227  GSGEKPEASVFGFNILVGGFFSAKRCEAAIPLNAWVSPEDVVAVCRAVLEVYRDNGLRAN  286

Query  300  RQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGY  121
            R K+R+MWL+DE G+E FRAEV  R+ +  L     +   + DWE+RD+ GV+ QKQ G 
Sbjct  287  RLKSRLMWLLDEWGVEKFRAEVETRLGKALLPATPKD---EIDWEKRDHIGVYKQKQAGL  343

Query  120  SFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            +++GL+IPVGRL A DM E+A LA+ YGSGE+RLTVEQNI
Sbjct  344  NYVGLNIPVGRLYAQDMFEIASLAEVYGSGEVRLTVEQNI  383



>ref|WP_002749321.1| ferredoxin--nitrite reductase [Microcystis aeruginosa]
 emb|CAO88688.1| nirA [Microcystis aeruginosa PCC 7806]
 gb|ELS44877.1| ferredoxin--nitrite reductase [Microcystis aeruginosa DIANCHI905]
Length=513

 Score =   286 bits (733),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 188/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++       A  + +   DWE+RD+ GV PQKQ+G S+IGL +PVGRL ADDM +LA
Sbjct  287  VANQLGYPLATAAEKDAI---DWEKRDHLGVFPQKQQGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_012595745.1| MULTISPECIES: ferredoxin-nitrite reductase [Cyanothece]
 ref|YP_002372634.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 8801]
 ref|YP_003139289.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 8802]
 gb|ACK66478.1| Ferredoxin--nitrite reductase [Cyanothece sp. PCC 8801]
 gb|ACV02454.1| Ferredoxin--nitrite reductase [Cyanothece sp. PCC 8802]
Length=513

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 185/259 (71%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I R L+ V +TS+QSGMDNVRN  G+P+AG+D  E++DTR     +  
Sbjct  108  QLRGIRLEDIPDIFRRLKAVSMTSMQSGMDNVRNITGSPMAGLDGNELIDTRDLVQKVQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GN  F+NLPRK+N+ + G  D   H  IND+A++PA KDG+ GFN+LVGGFFS
Sbjct  168  MITNHGEGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKDGQLGFNVLVGGFFS  227

Query  414  AKRCAEAIPLDAWVPA-DDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AI LD WVP  DD+  +C+AIL  +R+ G R NRQK+R+MWLIDE GIE FRA+
Sbjct  228  AKRCEAAIELDVWVPPNDDVVELCRAILTVYRNHGPRANRQKSRLMWLIDEWGIEEFRAK  287

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V           A  +   + DWE+RD+ GV  QKQ G +++GLHIPVGRL A+DM +LA
Sbjct  288  VAAEFGRPLATAAEKD---EIDWEKRDHIGVFAQKQPGLNYVGLHIPVGRLYAEDMIDLA  344

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA+ YG GE+RLTVEQN+
Sbjct  345  RLAEVYGGGEIRLTVEQNV  363



>ref|WP_015152056.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
acuminata]
 ref|YP_007089373.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
acuminata PCC 6304]
 gb|AFY85453.1| assimilatory nitrite reductase (ferredoxin) precursor [Oscillatoria 
acuminata PCC 6304]
Length=626

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 189/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I    +  G+TS+QSGMDNVRN  G+PV+GID  E++DT+     +  
Sbjct  107  QLRGIRIEDIPDIFNRFKAAGMTSVQSGMDNVRNITGSPVSGIDKHELIDTQELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT    GNPAF+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN+LVGGFFS
Sbjct  167  MITNTGEGNPAFTNLPRKFNIAIGGCPDNSIHAEINDIAFVPAYKNGEIGFNVLVGGFFS  226

Query  414  AKRCAEAIPLDAWVPA-DDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIPL+ WVP  DD+  +C+AILE +RD G R NRQK+R+MWLIDE G+E FRAE
Sbjct  227  AKRCEAAIPLNVWVPPNDDVVELCRAILEIYRDNGPRANRQKSRLMWLIDEWGLEKFRAE  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V K   +   E A  +E++   WE+RD+ GV PQKQ G +F+GL++PVGRL A DM ELA
Sbjct  287  VEKECGKPLAEAAEKDEIV---WEKRDHLGVFPQKQAGLNFVGLNVPVGRLFAPDMFELA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA+ YG+ E+RLTVEQN+
Sbjct  344  RLAEVYGNSEIRLTVEQNV  362



>ref|WP_017304788.1| ferredoxin-nitrite reductase [Spirulina subsalsa]
Length=517

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 192/263 (73%), Gaps = 8/263 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+P+I R LEQVGLTS+QSGMDNVRN  G+PVAG+D EE++DTR     L  
Sbjct  106  QLRGVRLEDIPDIFRKLEQVGLTSIQSGMDNVRNLTGSPVAGLDAEELIDTRELLQKLQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N +GN  FSNLPRK+N+ + G  D   H  IND+A++PA ++G+ GFN+L+GG+ S
Sbjct  166  VITNNGQGNYTFSNLPRKFNIAIEGGRDNSIHAEINDVAFIPAYREGQLGFNVLLGGYLS  225

Query  414  AKRCAEAIPLDAWVPA-DDIFPVCKAILEAFRDLGA----RGNRQKARMMWLIDELGIEG  250
            A+RCAEAIP+  WVPA D++  +  AIL+ + + GA    R  RQKAR+MWL+D+ G+E 
Sbjct  226  AQRCAEAIPMGVWVPANDEVIDLSCAILKVYTENGAAEGLRQTRQKARLMWLLDKWGMEK  285

Query  249  FRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDM  70
            FRAEV K +  +    A  +E+ Q   E++DY GVH QKQ GY ++GLH+PVGRL AD M
Sbjct  286  FRAEVAKVLGRELFPAAPEDEITQ---EKKDYLGVHAQKQPGYYYVGLHVPVGRLSADKM  342

Query  69   DELARLADQYGSGELRLTVEQNI  1
             E+ARLA  YG+GE+RLTVEQN+
Sbjct  343  FEIARLAQVYGNGEIRLTVEQNV  365



>ref|WP_017660780.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=516

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 177/257 (69%), Gaps = 3/257 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+   D P+I   L +VGLTS+QSGMDNVRN  G+PVAGID  E +DTRP    L  
Sbjct  106  QLRGLRFEDFPDIFEKLHRVGLTSMQSGMDNVRNITGSPVAGIDEAEFIDTRPLCQALQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
             IT    GN  F+NLPRK+N+ V GS D   H  IND+A++PA K   FGFNLLVGGFFS
Sbjct  166  AITHFGEGNAEFTNLPRKFNIAVAGSPDNSVHAEINDIAFVPAFKGETFGFNLLVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  A+PL+AWV    + P+  AIL  +RD G R NRQKAR+MWLIDE GIE FR  V
Sbjct  226  AKRCEAAVPLNAWVEPQHVVPLSCAILRVYRDRGLRSNRQKARLMWLIDEWGIEKFRDAV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
                 E   E A  +   +  WE+RD+ G+HPQKQ G  + GLH+PVGRL+A+ M ELAR
Sbjct  286  ETEFGETLAEAAPQD---EIAWEKRDHIGLHPQKQPGLFYAGLHVPVGRLQANQMFELAR  342

Query  54   LADQYGSGELRLTVEQN  4
            LA+ YGSG++RLTVEQN
Sbjct  343  LAEVYGSGDIRLTVEQN  359



>ref|WP_015116722.1| assimilatory nitrite reductase (ferredoxin) precursor [Rivularia 
sp. PCC 7116]
 ref|YP_007053691.1| assimilatory nitrite reductase (ferredoxin) precursor [Rivularia 
sp. PCC 7116]
 gb|AFY53144.1| assimilatory nitrite reductase (ferredoxin) precursor [Rivularia 
sp. PCC 7116]
Length=514

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 188/259 (73%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+P+I R L+   +TS+QSGMDNVRN  G+PVAGID  E+VDTR     +  
Sbjct  107  QLRGVRLEDIPDIFRRLDGAEMTSMQSGMDNVRNITGSPVAGIDGSELVDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N +GN AF+NLPRK+N+ + G  D   H  IND+A++PA K+ + GFN+LVGGFFS
Sbjct  167  MITNNGKGNYAFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKNEKLGFNVLVGGFFS  226

Query  414  AKRCAEAIPLDAWVPA-DDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            A+RC  AIPL+AWVP  DD+  + +AIL  FRD G+R NRQK+R+MWLIDELGI+ FR+ 
Sbjct  227  ARRCEAAIPLNAWVPPNDDVVDLSRAILSVFRDRGSRANRQKSRLMWLIDELGIDQFRSM  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V +         AA +   + DW++RD  G++ QKQ G +++GLH+PVGRL A DM +LA
Sbjct  287  VEQEFGRTLESAAAKD---EIDWDKRDCIGINKQKQPGLNYVGLHVPVGRLYAQDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            RLA+ YGS E+RLTVEQN+
Sbjct  344  RLAEVYGSCEVRLTVEQNV  362



>ref|WP_016877347.1| ferredoxin-nitrite reductase [Chlorogloeopsis fritschii]
Length=551

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/292 (50%), Positives = 188/292 (64%), Gaps = 37/292 (13%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI      VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDLPEIFNKFHTVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR------------  451
            +IT    GN  F+NLPRK+N+ + G  D   H  INDLA++PA K+G             
Sbjct  166  MITNKGEGNSEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFKEGTGDWGLETREKQG  225

Query  450  ----------------------FGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAI  337
                                  FGFN+LVGGFFS KRC  AIPL+AWV  +D+  +C+A+
Sbjct  226  SRGAEGQRSNVQSPIPDPQSPVFGFNVLVGGFFSGKRCEAAIPLNAWVSPEDVVALCRAV  285

Query  336  LEAFRDLGARGNRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRD  157
            LE FRD G R NRQK+R+MWLIDE G+E FR EV  R+ +  L  A  +   + DWE+RD
Sbjct  286  LEVFRDCGLRANRQKSRLMWLIDEWGLEKFRLEVENRLGKSLLPAAPKD---EIDWEKRD  342

Query  156  YFGVHPQKQEGYSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            + GVH QKQ G +++GLH+PVGRL ADDM E+ARLA+ YG+GE+RLTVEQN+
Sbjct  343  HIGVHKQKQPGLNYVGLHVPVGRLAADDMFEIARLAEVYGNGEIRLTVEQNV  394



>ref|WP_026795180.1| MULTISPECIES: ferredoxin--nitrite reductase [Planktothrix]
Length=511

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/258 (53%), Positives = 187/258 (72%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+ +I +  E+VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDLSDIFQRFERVGLTSIQSGMDNVRNITGSPVAGLDADELYDTRELVQQVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GNP FSNLPRK+N+ + G  D   H  IND+A++PA K   FGFN++VGGFFS
Sbjct  166  MITNEGKGNPEFSNLPRKFNIAIAGCRDNSIHAEINDIAFIPAFKQETFGFNVIVGGFFS  225

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            A RC  AIPL+ WV  + +  +C+ ILE FRD G RG RQK R+MWLIDE GIE FR+EV
Sbjct  226  ATRCEAAIPLNVWVKPEQVVGLCRGILEVFRDNGPRGVRQKTRLMWLIDEWGIEKFRSEV  285

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K++       A  +E++   WE+RD+ G++ QKQ G +++GL++PVGRL A++M EL+R
Sbjct  286  EKQIGYALELEAEKDEIL---WEKRDHLGIYKQKQPGLNYVGLNVPVGRLYANEMLELSR  342

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGSGE+RLTVEQN+
Sbjct  343  IAEVYGSGEIRLTVEQNV  360



>ref|WP_002789471.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI19458.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9807]
Length=513

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 186/259 (72%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  FSNLPRK+N+ + G  D   H  IND+A++ A K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFSNLPRKFNIAIEGGRDNSVHAEINDIAFVTAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANHLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_016871793.1| ferredoxin-nitrite reductase [Fischerella thermalis]
Length=541

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/281 (52%), Positives = 190/281 (68%), Gaps = 26/281 (9%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+PEI      VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPEIFHKFHTVGLTSVQSGMDNVRNITGDPVAGLDADELFDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKD----GR--------  451
            ++T   +GNP F+NLPRK+N+ + G  D   H  INDLA++PA  +    GR        
Sbjct  167  MLTNKGQGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFHEYGEVGRLGDGEKDF  226

Query  450  -----------FGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARG  304
                       FGFN+LVGGFFSAKRC  AIPLDAWV   D+  VC+A+LE FRD G R 
Sbjct  227  TPTPYNSSSKVFGFNILVGGFFSAKRCEAAIPLDAWVSPADVVAVCRAVLEVFRDHGLRA  286

Query  303  NRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEG  124
            NRQK+R+MWLIDE G+E FR+EV +R+ +  L  A  +   + DWE+RD+ GV+ QKQ  
Sbjct  287  NRQKSRLMWLIDEWGLEKFRSEVEQRLGKPLLPAAPKD---EIDWEKRDHIGVYKQKQPE  343

Query  123  YSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
             +++GLHIPVGRL A+DM E+ARLAD YG+ E+RLTVEQN+
Sbjct  344  LNYVGLHIPVGRLTAEDMFEIARLADVYGNSEIRLTVEQNV  384



>ref|WP_004268302.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI36406.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9701]
Length=513

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 186/259 (72%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  FSNLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNYGQGNYQFSNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV  QKQEG S+IGL +PVGRL ADDM +LA
Sbjct  287  VANHLGYPLATAAEKDAI---DWEKRDHLGVFTQKQEGLSYIGLCVPVGRLFADDMLDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_007305636.1| ferredoxin-nitrite reductase [Crocosphaera watsonii]
 gb|EAM50680.1| Nitrite/sulfite reductase, hemoprotein beta-component, ferrodoxin-like:Nitrite 
and sulphite reductase 4Fe-4S region [Crocosphaera 
watsonii WH 8501]
Length=516

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 189/260 (73%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I   L++V LTS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  108  QLRGIRLEDIPDIFNRLQEVNLTSMQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  168  MITNHGAGNYDFTNLPRKFNIALEGGRDNSVHAEINDIAFVPAYKNGELGFNVVVGGFFS  227

Query  414  AKRCAEAIPLDAWVPADD--IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            A RC  AIPL+AWVP  +  +  +C+AIL  FR+ G RGNRQKAR+MWLIDE G+  FRA
Sbjct  228  ASRCDAAIPLNAWVPPTEAAVIDLCRAILTIFRNNGLRGNRQKARLMWLIDEWGLNKFRA  287

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
            EV + +  Q    A  + +   DWE+RD+ GV PQKQ G +++G+H+PVGRL A+DM + 
Sbjct  288  EVEQELGYQLETEAEKDAI---DWEKRDHLGVFPQKQAGLNYVGMHVPVGRLYAEDMLDF  344

Query  60   ARLADQYGSGELRLTVEQNI  1
            ARLA+ YG+GELRLTVEQN+
Sbjct  345  ARLAEVYGNGELRLTVEQNV  364



>ref|WP_002765435.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI05310.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9443]
Length=513

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 185/259 (71%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  FSNLPRK+N+ + G  D   H  IND+A++P  K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFSNLPRKFNIAIEGGRDNSVHAEINDIAFVPGYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV PQKQEG S+IGL +PVGRL ADDM + A
Sbjct  287  VANHLGYPLATAAEKDAI---DWEKRDHLGVFPQKQEGLSYIGLCVPVGRLFADDMFDFA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>ref|WP_038087531.1| ferredoxin--nitrite reductase [Tolypothrix bouteillei]
 gb|KIE11676.1| ferredoxin--nitrite reductase [Tolypothrix bouteillei VB521301]
Length=540

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/282 (51%), Positives = 190/282 (67%), Gaps = 27/282 (10%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I      VGLTS+QSGMDNVRN  G+PVAG+D EE+ DTR     +  
Sbjct  107  QLRGIRIEDLPDIFEKFHAVGLTSIQSGMDNVRNITGDPVAGLDAEELFDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAM----------------  463
            ++T    GNP F+NLPRK+N+ + G  D   H  INDLA++PA                 
Sbjct  167  MVTNKGEGNPEFTNLPRKFNIAITGGRDNSVHAEINDLAFVPAFWEEKGSGDKGEGEQQT  226

Query  462  --------KDGRFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGAR  307
                    +  +FGFN+LVGGFFSAKRC  AIPL+AWVP +D+  VC+A+LE FRD G+R
Sbjct  227  AQSPTSGSQSRQFGFNILVGGFFSAKRCEAAIPLNAWVPPEDVVAVCRAVLEVFRDNGSR  286

Query  306  GNRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQE  127
             NR K+R+MWLIDE GIE FR EV  ++ +  L  AA +   + DWE+RD+ GV+ QKQ 
Sbjct  287  ANRLKSRLMWLIDEWGIEKFRNEVESKLGKPLLGAAAKD---EIDWEKRDHIGVYKQKQP  343

Query  126  GYSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            G +++GLH+PVGRL A+D+ E+ARLA+ YGSGE+RLTVE+N 
Sbjct  344  GLNYVGLHVPVGRLYAEDLFEMARLAEVYGSGEIRLTVEENF  385



>ref|WP_015209003.1| sulfite reductase, beta subunit (hemoprotein) [Cylindrospermum 
stagnale]
 ref|YP_007148435.1| sulfite reductase, beta subunit (hemoprotein) [Cylindrospermum 
stagnale PCC 7417]
 gb|AFZ25755.1| sulfite reductase, beta subunit (hemoprotein) [Cylindrospermum 
stagnale PCC 7417]
Length=523

 Score =   285 bits (729),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 188/263 (71%), Gaps = 8/263 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I +    VGLT++QSGMDNVRN  G+ VAG+D +E+ DTR     +  
Sbjct  107  QLRGIRIEDLPDIFQRFSAVGLTTVQSGMDNVRNITGDAVAGLDADELYDTRELVQQIQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR-----FGFNLLV  430
            +IT +  GN  F+NLPRK+N+ + G  D   H  INDLA++PA K+       FGFN+LV
Sbjct  167  MITNSGVGNAEFTNLPRKFNIAIAGGRDNSVHAEINDLAFVPAFKEESFQSPIFGFNVLV  226

Query  429  GGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEG  250
            GGFFSAKRC  AIPL+ WV  +++  +C+AIL  +RD G R NRQKAR+MWLIDE GIE 
Sbjct  227  GGFFSAKRCEAAIPLNVWVSPEEVVALCRAILFVYRDHGLRANRQKARLMWLIDEWGIEK  286

Query  249  FRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDM  70
            FRAEV KR+ +  L  AA +   + DWE+RD+ G++ QKQ G +++GLHIPVGRL A DM
Sbjct  287  FRAEVEKRLGKSLLPAAAKD---EIDWEKRDHIGIYAQKQPGLNYVGLHIPVGRLYAGDM  343

Query  69   DELARLADQYGSGELRLTVEQNI  1
             E+ARLA  YGSGE+RLT+EQN+
Sbjct  344  FEIARLAQVYGSGEIRLTIEQNV  366



>ref|WP_009344167.1| ferredoxin-nitrite reductase [Raphidiopsis brookii]
 gb|EFA72074.1| nirA (Nitrite/sulfite reductase, hemoprotein beta- component, 
ferrodoxin) [Raphidiopsis brookii D9]
Length=522

 Score =   285 bits (728),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 182/257 (71%), Gaps = 4/257 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+   D+P+I     +VGLTS+QSGMDNVRN  G+P+AG+D  E  DTR     +  
Sbjct  104  QLRGIDFSDIPDIFNKFHKVGLTSIQSGMDNVRNITGDPLAGLDANEFYDTRELVQQIQD  163

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            ++T    GNP F+NLPRK+N+ V G  D   H  INDLA++PA K+  FGFN+LVGGFFS
Sbjct  164  MLTNRGEGNPEFTNLPRKFNIGVTGGKDNSIHAEINDLAFVPAFKEA-FGFNVLVGGFFS  222

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
             KRC  AIPL+ WV  +++  + KAI+E FRD G R NRQKAR+MWLIDE G+E FR EV
Sbjct  223  GKRCEAAIPLNVWVKPEEVVNLSKAIVEIFRDHGLRLNRQKARLMWLIDEWGLEKFRDEV  282

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K+  +     A  +   + DWE+RD+ GV+PQKQ G +++GL+IPVGRL ADDM +LAR
Sbjct  283  EKQWGKSLQTAAPKD---EIDWEKRDHIGVYPQKQPGLNYVGLNIPVGRLTADDMFQLAR  339

Query  54   LADQYGSGELRLTVEQN  4
            LA+ YGSGE+R TVEQN
Sbjct  340  LAEVYGSGEIRFTVEQN  356



>ref|WP_015123833.1| assimilatory nitrite reductase (ferredoxin) precursor [Synechococcus 
sp. PCC 6312]
 ref|YP_007060832.1| assimilatory nitrite reductase (ferredoxin) precursor [Synechococcus 
sp. PCC 6312]
 gb|AFY60289.1| assimilatory nitrite reductase (ferredoxin) precursor [Synechococcus 
sp. PCC 6312]
Length=517

 Score =   285 bits (728),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 185/258 (72%), Gaps = 4/258 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            QIRG+ + D+P+I   L+  GLTS+QSGMDNVRN  G+PVAGI+ +E++DTRP    L  
Sbjct  97   QIRGIRIEDIPDIFDRLQACGLTSIQSGMDNVRNITGSPVAGIERDELIDTRPLVAQLQA  156

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N +GN  FSNLPRK+N+ + G  D   H  IND+A++PA ++G  GFN+LVGGFFS
Sbjct  157  MITNNGQGNSEFSNLPRKFNIALEGGRDNSVHAEINDIAFVPAYREGVLGFNVLVGGFFS  216

Query  414  AKRCAEAIPLDAWVPADD-IFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            ++RC  A+PLDAWV  D  +  +C+AILE FRD G R NRQK+R+MWLID+ G+  FR E
Sbjct  217  SRRCEAAVPLDAWVTPDQAVIDLCRAILELFRDHGPRTNRQKSRLMWLIDQWGLAKFRQE  276

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++    L  A  +   + +WE+RD+ GV+PQKQ G +++GLHIPVGRL A D   L 
Sbjct  277  VAAKLAFPLLNAAPED---EINWEKRDHLGVYPQKQPGLNYVGLHIPVGRLYASDFLGLG  333

Query  57   RLADQYGSGELRLTVEQN  4
            RLA  YGSGE+RLTVEQN
Sbjct  334  RLAQTYGSGEVRLTVEQN  351



>ref|WP_012629926.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7425]
 ref|YP_002485242.1| ferredoxin-nitrite reductase [Cyanothece sp. PCC 7425]
 gb|ACL46881.1| Ferredoxin--nitrite reductase [Cyanothece sp. PCC 7425]
Length=521

 Score =   285 bits (728),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 183/258 (71%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D P+I   L + G+TS+QSGMDNVRN   +PVAG+D  E++D R     L  
Sbjct  108  QLRGIRIEDTPDIFVRLAEAGMTSVQSGMDNVRNITASPVAGLDAGELIDVRDLVQQLQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GNP F+NLPRK+N+ + G  D   H  IND+A++PA ++ + GFN+LVGGFFS
Sbjct  168  MITNNGAGNPEFTNLPRKFNIAIEGGRDNAVHAEINDIAFVPAFREEQLGFNVLVGGFFS  227

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRC  AIPL+AWV  D + P+C+AILE +R+ G R NRQK+R+MWLID  G+E FRA V
Sbjct  228  AKRCEAAIPLNAWVMPDRVVPLCRAILEVYREHGLRANRQKSRLMWLIDAWGMERFRAAV  287

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
              ++ E  L  A    +   DWERRD+ G++ QKQ G  + GLHIPVGRL A DM ELAR
Sbjct  288  EVQLGEPLLSAAPTHAM---DWERRDHIGIYAQKQSGLYYAGLHIPVGRLYAADMFELAR  344

Query  54   LADQYGSGELRLTVEQNI  1
            LA+ YGSGE+RLTVEQN+
Sbjct  345  LAETYGSGEMRLTVEQNL  362



>ref|WP_015081559.1| ferredoxin-nitrite reductase [Anabaena sp. 90]
 ref|YP_006998241.1| ferredoxin-nitrite reductase [Anabaena sp. 90]
 gb|AFW96428.1| ferredoxin-nitrite reductase [Anabaena sp. 90]
Length=520

 Score =   284 bits (727),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 184/263 (70%), Gaps = 8/263 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+   D+P+I     +VGLT++QSGMDNVRN  G+PVAG+D +E  DTR     +  
Sbjct  106  QLRGINFEDIPDIFNKFHKVGLTTIQSGMDNVRNITGDPVAGLDADEFYDTRELVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR-----FGFNLLV  430
            ++T N  GNP FSNLPRK+N+ + G  D   H  INDLA++PA          FGFN++V
Sbjct  166  MLTNNGEGNPEFSNLPRKFNIAITGGRDNSVHAEINDLAFIPAFWRNENEVPIFGFNVIV  225

Query  429  GGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEG  250
            GG FSAKRC  AIPL+ WV   ++  +CK I+E FRD G R NR KAR+MWL+DE GIE 
Sbjct  226  GGLFSAKRCEAAIPLNVWVSPAEVVSLCKVIVEIFRDHGLRANRLKARLMWLLDEWGIEK  285

Query  249  FRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDM  70
            FRAEV KR+ +  L  AA +   + DWE+RD+ G++ QKQ G+++ GL+IPVGRL ADDM
Sbjct  286  FRAEVEKRVGKSLLPAAAKD---EIDWEKRDHVGIYKQKQPGFNYAGLNIPVGRLSADDM  342

Query  69   DELARLADQYGSGELRLTVEQNI  1
             E+ARLA+ YGSGE+R TVEQN+
Sbjct  343  LEIARLAEVYGSGEIRFTVEQNV  365



>ref|WP_015218171.1| assimilatory nitrite reductase (ferredoxin) precursor [Cyanobacterium 
aponinum]
 ref|YP_007160483.1| assimilatory nitrite reductase (ferredoxin) precursor [Cyanobacterium 
aponinum PCC 10605]
 gb|AFZ52439.1| assimilatory nitrite reductase (ferredoxin) precursor [Cyanobacterium 
aponinum PCC 10605]
Length=519

 Score =   284 bits (727),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 189/262 (72%), Gaps = 8/262 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+P+I R LE VG+TS+QSGMDNVRN  G+PVAGIDP E++DTR  N  L  
Sbjct  110  QLRGVHLQDIPDIFRKLEAVGMTSIQSGMDNVRNLTGSPVAGIDPHELIDTRELNQKLQD  169

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            LIT + +G+  FS+LPRK N+ + GS D   H  +ND+A++PA KDG  GFN++VGG+ S
Sbjct  170  LITNHGQGSYEFSSLPRKLNIAIEGSKDNSIHAELNDIAFLPAYKDGELGFNVVVGGYLS  229

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDL----GARGNRQKARMMWLIDELGIEG  250
            A+RCAE+IP+D WV P +++  +C AIL  + +     G R NR KAR+MWLID+ G+  
Sbjct  230  AQRCAESIPMDVWVRPNEEVLKLCAAILSVYSECALEEGLRENRAKARLMWLIDKWGMNR  289

Query  249  FRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDM  70
            FR EV K++ +     A  +   +   E+RD+ GV+PQKQEGYS+IG+HIPVG L+A+ +
Sbjct  290  FRIEVEKKLGQSLQFAAPKD---EITLEKRDHLGVNPQKQEGYSYIGIHIPVGHLDAEGL  346

Query  69   DELARLADQYGSGELRLTVEQN  4
             E+ARLAD YG+GE+R TVEQN
Sbjct  347  FEIARLADVYGNGEIRATVEQN  368



>ref|WP_002792330.1| ferredoxin-nitrite reductase [Microcystis aeruginosa]
 emb|CCI21907.1| Ferredoxin--nitrite reductase [Microcystis aeruginosa PCC 9808]
Length=513

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 186/259 (72%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I + L+ VG+TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  107  QLRGIRIEDIPDIFQRLKSVGMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  166

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  167  MITNCGQGNYQFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGELGFNVVVGGFFS  226

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIP++ WV P  ++  +C+ ILE +RD G R NRQK+R+MWLIDE GIE FR  
Sbjct  227  AKRCEAAIPMNVWVRPNQEVVDLCRGILEVYRDNGLRANRQKSRLMWLIDEWGIEEFRTR  286

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V   +       A  + +   DWE+RD+ GV PQKQE  S+IGL +PVGRL ADDM +LA
Sbjct  287  VANHLGYPLATAAEKDGI---DWEKRDHLGVFPQKQEVLSYIGLCVPVGRLFADDMFDLA  343

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YGSGELRLTVEQN+
Sbjct  344  RIAEVYGSGELRLTVEQNV  362



>gb|KEI67697.1| NirA [Planktothrix agardhii NIVA-CYA 126/8]
Length=528

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 185/258 (72%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+ +I +  E+VGLTS+QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  123  QLRGIRIEDLSDIFQRFERVGLTSIQSGMDNVRNITGSPVAGLDADELYDTRELVQQVQD  182

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GNP FSNLPRK+N+ + G  D   H  IND+A++PA K   FGFN+LVGGFFS
Sbjct  183  MITNEGKGNPEFSNLPRKFNIAIGGCRDNSIHAEINDIAFIPAFKQEAFGFNVLVGGFFS  242

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            A RC  AIPL+ W   + +  +C+ ILE FRD G RG RQK R+MWLIDE GIE FR+EV
Sbjct  243  ATRCEAAIPLNVWAKPEQVVDLCRGILEVFRDHGPRGVRQKTRLMWLIDEWGIEKFRSEV  302

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
             K++       A  +E++   WE+RD+ G++ QKQ G +++GL+I VGRL A+DM EL+R
Sbjct  303  EKQIGYALESEAEKDEIL---WEKRDHLGIYKQKQPGLNYVGLNILVGRLSANDMLELSR  359

Query  54   LADQYGSGELRLTVEQNI  1
            +A+ YGSGE+RLTVEQN+
Sbjct  360  IAEVYGSGEIRLTVEQNV  377



>ref|WP_015180229.1| precorrin-3B synthase [Microcoleus sp. PCC 7113]
 ref|YP_007119471.1| precorrin-3B synthase [Microcoleus sp. PCC 7113]
 gb|AFZ16065.1| precorrin-3B synthase [Microcoleus sp. PCC 7113]
Length=522

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 186/258 (72%), Gaps = 3/258 (1%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+  I+  L +  LTS+QSGMDNVRN  G+PVAGID +E++DTR     L  
Sbjct  110  QLRGIHLEDIAAIIERLRKADLTSVQSGMDNVRNLTGSPVAGIDADELIDTRDIVCQLQD  169

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
             IT    GN   SNLPRK+N+ V G  D   H  IND+A++PA KDG+ GFN++VGGFFS
Sbjct  170  AITNKGEGNFDLSNLPRKFNIAVAGCRDNSVHAEINDIAFIPAYKDGKLGFNVIVGGFFS  229

Query  414  AKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAEV  235
            AKRCA AIPLDAWV  DD+ P+  AIL  FRD G RGNRQK R+M+LI+E G+E FR EV
Sbjct  230  AKRCAAAIPLDAWVEPDDVVPLSLAILIVFRDHGERGNRQKTRLMYLIEEWGMEKFRTEV  289

Query  234  VKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELAR  55
              ++     + AA +E+I   WE+RD+ G++ QKQ G +++GLH+P+GRL A DM E++R
Sbjct  290  ETQLGYPLQKAAAKDEII---WEKRDHLGIYSQKQPGLNYVGLHVPIGRLYASDMFEVSR  346

Query  54   LADQYGSGELRLTVEQNI  1
            LA+ YG+GE+RLTVEQN+
Sbjct  347  LAEVYGNGEIRLTVEQNL  364



>ref|WP_017720834.1| ferredoxin [Oscillatoria sp. PCC 10802]
Length=629

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 185/258 (72%), Gaps = 4/258 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I R L+ VGLTS+QSGMDNVRN  G+PVA +D  E++DTR     L  
Sbjct  104  QLRGIRIQDIPDIFRRLKAVGLTSVQSGMDNVRNITGSPVADLDAGELIDTRGLVRQLQD  163

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
             IT N  GNP F+NLPRK+N+ + G  D   H  IND+A++PA K+G  GFN++VGGFFS
Sbjct  164  AITNNGEGNPEFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKNGELGFNVIVGGFFS  223

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIPL+ WV P  ++  +  AIL  +RD G R NRQKAR+MWLIDE G+E FRA+
Sbjct  224  AKRCEAAIPLNVWVKPNSEVVDLSLAILTVYRDSGLRANRQKARLMWLIDEWGVEKFRAQ  283

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V K++  +    A  +   + DWE+RD+ GV+ QKQ G ++ GLHIP+GRL A DM +LA
Sbjct  284  VEKQLGRELATAAPKD---EIDWEKRDHIGVYRQKQPGLNYAGLHIPIGRLYAPDMFDLA  340

Query  57   RLADQYGSGELRLTVEQN  4
            R+AD YGSGE+RLTVEQN
Sbjct  341  RMADVYGSGEIRLTVEQN  358



>ref|XP_009790010.1| PREDICTED: ferredoxin--nitrite reductase, chloroplastic-like, 
partial [Nicotiana sylvestris]
Length=329

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = -2

Query  504  EHPHINDLAYMPAMKDGRFGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAF  325
            ++ HINDLAYMPA KD RFGFNL VG FFSAKRC EAIPLDAWVPADD+ PVCKAILEAF
Sbjct  3    QYTHINDLAYMPATKDERFGFNLFVGRFFSAKRCDEAIPLDAWVPADDVVPVCKAILEAF  62

Query  324  RDLGARGNRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGV  145
            RDLG RGNRQK RMMWLIDELG+EGFRAEV KRMP+Q+LERA+ E+L+QK WERRDY GV
Sbjct  63   RDLGFRGNRQKCRMMWLIDELGVEGFRAEVEKRMPQQQLERASPEDLVQKQWERRDYLGV  122

Query  144  HPQKQEGYSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
            HPQKQEGY+FIGLHIPVGR++ADDMDELA LAD+YG GE+ LTVEQNI
Sbjct  123  HPQKQEGYNFIGLHIPVGRVQADDMDELAHLADEYGLGEIPLTVEQNI  170



>ref|WP_006105894.1| ferredoxin-nitrite reductase [Coleofasciculus chthonoplastes]
 gb|EDX71161.1| Nitrite and sulphite reductase 4Fe-4S domain protein [Coleofasciculus 
chthonoplastes PCC 7420]
Length=532

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 190/264 (72%), Gaps = 9/264 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+P+I   L+ V LTS+QSGMDNVRN  G+PVAGID +EI+DTR     L  
Sbjct  106  QLRGVRLEDIPDIFHQLQSVNLTSIQSGMDNVRNLTGSPVAGIDADEIIDTRDMLQKLQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GN AF+NLPRK+N+ + G  D   H  IND+A++PA +DG  GFN+LVGG+ S
Sbjct  166  MITNNGEGNYAFTNLPRKFNIAIEGGRDNSIHAEINDIAFVPAYRDGELGFNVLVGGYLS  225

Query  414  AKRCAEAIPLDAWVPAD--DIFPVCKAILEAFRD----LGARGNRQKARMMWLIDELGIE  253
            A+RC EAIPL+AWVPA+  D+  +  AIL  +       G R +RQKARMMWLID+ G++
Sbjct  226  AQRCVEAIPLNAWVPANEADVINLSGAILTVYTQNGLKEGLRKSRQKARMMWLIDKWGVD  285

Query  252  GFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADD  73
             FRAEV K   ++ L  A  +E+ Q   E++DY GV+PQKQ GYS++GL +PVGRL AD 
Sbjct  286  KFRAEVEKTYGKELLPAAPEDEITQ---EKKDYIGVYPQKQPGYSYVGLLVPVGRLSADT  342

Query  72   MDELARLADQYGSGELRLTVEQNI  1
            M ELARLAD YG+GE+RLTVEQN+
Sbjct  343  MFELARLADVYGNGEIRLTVEQNL  366



>ref|WP_015192765.1| precorrin-3B synthase [Stanieria cyanosphaera]
 ref|YP_007132060.1| precorrin-3B synthase [Stanieria cyanosphaera PCC 7437]
 gb|AFZ35094.1| precorrin-3B synthase [Stanieria cyanosphaera PCC 7437]
Length=512

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 185/259 (71%), Gaps = 4/259 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L DVP+I    + VGLTS+QSGMDNVRN  G+P+AGID +E++DTR     +  
Sbjct  105  QLRGIRLEDVPDIFLRFQAVGLTSVQSGMDNVRNITGSPMAGIDADELIDTRELVQQVQD  164

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT   +GN  F+NLPRK+N+ + G  D   H  IND+A++PA K+G+ GFN+LVGGFFS
Sbjct  165  MITNQGQGNYDFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKEGQLGFNVLVGGFFS  224

Query  414  AKRCAEAIPLDAWV-PADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRAE  238
            AKRC  AIPL+ WV P  D+  +C+AIL  +RD G R NRQKAR+MWLIDE GI+ FRA 
Sbjct  225  AKRCEAAIPLNVWVAPNQDVVELCRAILTVYRDHGLRSNRQKARLMWLIDEWGIDKFRAM  284

Query  237  VVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELA  58
            V  ++       A  + L   DWE+RD+ GV  QKQ G +++G+H+P+GR  A DM +LA
Sbjct  285  VEAQLGHTLDTAAPEDAL---DWEKRDHLGVFSQKQPGLNYVGMHVPIGRFYAQDMFDLA  341

Query  57   RLADQYGSGELRLTVEQNI  1
            R+A+ YG+GE+RLTVEQN+
Sbjct  342  RIAEVYGNGEIRLTVEQNV  360



>ref|WP_015222811.1| assimilatory nitrite reductase (ferredoxin) precursor [Cyanobacterium 
stanieri]
 ref|YP_007165143.1| assimilatory nitrite reductase (ferredoxin) precursor [Cyanobacterium 
stanieri PCC 7202]
 gb|AFZ47494.1| assimilatory nitrite reductase (ferredoxin) precursor [Cyanobacterium 
stanieri PCC 7202]
Length=516

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 185/263 (70%), Gaps = 9/263 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV+L D+P I   L++VGLTS+QSGMDNVRN  G+PVAGIDP E+ DTR  N  L  
Sbjct  106  QLRGVLLEDIPTIFGQLQEVGLTSIQSGMDNVRNLTGSPVAGIDPHELYDTREVNYKLQA  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT N  GN   SNLPRK+N+ V G  D   H  IND+A++PA K+G  GFN+L+GG+ S
Sbjct  166  MITNNGEGNYELSNLPRKFNIAVEGGKDNSIHAEINDVAFIPAYKNGELGFNVLIGGYLS  225

Query  414  AKRCAEAIPLDAWVPADD--IFPVCKAILEAFRDLG----ARGNRQKARMMWLIDELGIE  253
            A+RCAEAIP+D WV ADD  I  +C+AIL  +   G     R NR KAR+MWLID+  + 
Sbjct  226  AQRCAEAIPMDVWVKADDDEIVELCRAILTVYTTNGLEERLRENRGKARLMWLIDKWTMN  285

Query  252  GFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADD  73
             FR EV K + +     A  +   +   ++RD+ GVHPQKQEGY++IG+HIPVGRL+A+ 
Sbjct  286  RFRIEVEKELGKSLEFAAPED---EITMDKRDHLGVHPQKQEGYNYIGIHIPVGRLDAEG  342

Query  72   MDELARLADQYGSGELRLTVEQN  4
            M E+ARLAD YG+GE+R TVEQN
Sbjct  343  MFEIARLADVYGTGEIRATVEQN  365



>ref|WP_015128366.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 7507]
 ref|YP_007065386.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 7507]
 gb|AFY32552.1| assimilatory nitrite reductase (ferredoxin) precursor [Calothrix 
sp. PCC 7507]
Length=538

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/281 (50%), Positives = 188/281 (67%), Gaps = 26/281 (9%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ + D+P+I      VGLT++QSGMDNVRN  G+PVAG+D +E+ DTR     +  
Sbjct  106  QLRGIRIEDLPDIFNKFSAVGLTTVQSGMDNVRNITGDPVAGLDADELFDTRQLVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR------------  451
            ++T    GN  F+NLPRK+N+ + G  D   H  INDLA++PA K+G             
Sbjct  166  MLTNKGEGNAEFTNLPRKFNIAIAGGRDNSVHAEINDLAFVPAFKEGTRDWGLGTGEKSS  225

Query  450  -----------FGFNLLVGGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARG  304
                       FGFN+LVGGFFSAKRC  AIPL+AWV  +D+  +C+A+LE +RD G R 
Sbjct  226  QSPIPNPQSPIFGFNILVGGFFSAKRCEAAIPLNAWVSPEDVVALCRAVLEVYRDNGLRA  285

Query  303  NRQKARMMWLIDELGIEGFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEG  124
            NRQK+R+MWLIDE G+E FR EV  R+ +  L  AA +   + DWE+RD+ GV+ QKQ G
Sbjct  286  NRQKSRLMWLIDEWGVEKFRLEVENRLGKSLLPAAAKD---EIDWEKRDHIGVYKQKQAG  342

Query  123  YSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVEQNI  1
             ++ GLHIPVGRL ADDM E+AR+A+ YGS E+R+TVEQN+
Sbjct  343  LNYAGLHIPVGRLYADDMFEIARMAEVYGSSEIRITVEQNL  383



>ref|WP_019505972.1| ferredoxin [Pleurocapsa sp. PCC 7319]
Length=629

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 190/263 (72%), Gaps = 9/263 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RGV L D+P+I R  + VGLTS+QSGMDNVRN  G+PVAGIDP+E++DTR     +  
Sbjct  106  QLRGVRLEDIPDIFRQFKAVGLTSIQSGMDNVRNLTGSPVAGIDPDELIDTREMMKKVQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT NS GN AF+NLPRK+N+ + G+ D   H  +NDLA++PA KDG  GFN+LVGG+ S
Sbjct  166  MITNNSEGNYAFTNLPRKFNIAIEGARDNSIHAELNDLAFVPAYKDGVLGFNVLVGGYLS  225

Query  414  AKRCAEAIPLDAWVPA--DDIFPVCKAILEAFR----DLGARGNRQKARMMWLIDELGIE  253
            A+RCAE+IPL  W+PA  +D+  + +A+L  +       G R +R KARMMWLI+  G+E
Sbjct  226  AQRCAESIPLGVWIPANDEDVVELSRAVLTVYTVNGGKEGLRASRPKARMMWLIETWGLE  285

Query  252  GFRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADD  73
             FRAEV +   +     A  +E+ Q   +++D+ G+HPQKQ GYS++GLH+P+GRL AD 
Sbjct  286  KFRAEVEQEFGKTLASAAPKDEITQ---DKKDHLGIHPQKQAGYSYVGLHVPMGRLTADS  342

Query  72   MDELARLADQYGSGELRLTVEQN  4
            M +LARLA+ YG+GE+RLTVEQN
Sbjct  343  MFDLARLAEVYGNGEIRLTVEQN  365



>ref|WP_008274143.1| ferredoxin-nitrite reductase [Cyanothece sp. CCY0110]
 gb|EAZ92575.1| ferredoxin-nitrite reductase [Cyanothece sp. CCY0110]
Length=514

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 185/260 (71%), Gaps = 5/260 (2%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I   L+   +TS+QSGMDNVRN  G+P+AG+D +E++DTR     +  
Sbjct  108  QLRGIRLEDIPDIFNRLDAANMTSVQSGMDNVRNITGSPMAGLDADELIDTRELVQKVQD  167

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFS  415
            +IT +  GN  F+NLPRK+N+ + G  D   H  IND+A++PA KDG  GFN++VGGFFS
Sbjct  168  MITNHGEGNYDFTNLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKDGNLGFNVVVGGFFS  227

Query  414  AKRCAEAIPLDAWVP--ADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEGFRA  241
            AKRC  AIPL+AWVP   D +  +C+AIL  FRD G R NRQK+R+MWLIDE G+  FR 
Sbjct  228  AKRCEAAIPLNAWVPPTEDAVVELCRAILTVFRDHGLRSNRQKSRLMWLIDEWGLNKFRE  287

Query  240  EVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDEL  61
             V   +  +    A  + +   DWE+RD+ GV PQKQ G +++GLHIP+GRL A+DM +L
Sbjct  288  AVEAELGYKLTPEAEKDAI---DWEKRDHIGVFPQKQAGLNYVGLHIPIGRLYAEDMLDL  344

Query  60   ARLADQYGSGELRLTVEQNI  1
            AR+A+ YG+GE+RLTVEQN+
Sbjct  345  ARMAEVYGNGEIRLTVEQNV  364



>ref|WP_027400663.1| ferredoxin--nitrite reductase [Aphanizomenon flos-aquae]
Length=515

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 180/263 (68%), Gaps = 8/263 (3%)
 Frame = -2

Query  774  QIRGVVLPDVPEILRGLEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQ  595
            Q+RG+ L D+P+I     +VGLT++QSGMDNVRN  G+PVAG+D +E  DTR     +  
Sbjct  106  QLRGINLADIPDIFNKFHKVGLTTIQSGMDNVRNITGDPVAGLDADEFYDTRELVQQIQD  165

Query  594  LITANSRGNPAFSNLPRKWNVCVVGSHDLYEHPHINDLAYMPAMKDGR-----FGFNLLV  430
            ++T N  GNP FSNLPRK+N+ + G  D   H  INDLA++PA          FGFN++V
Sbjct  166  MLTNNGEGNPEFSNLPRKFNIAITGGRDNSVHAEINDLAFIPAFWGNEDQVPIFGFNVIV  225

Query  429  GGFFSAKRCAEAIPLDAWVPADDIFPVCKAILEAFRDLGARGNRQKARMMWLIDELGIEG  250
            GG FSAKRC  AIPL+ WV    +  + K I+E FRD G R NR KAR+MWL+DE GIE 
Sbjct  226  GGLFSAKRCEAAIPLNVWVLPAQVVLLSKVIVEIFRDHGLRANRLKARLMWLLDEWGIEK  285

Query  249  FRAEVVKRMPeqeleraaaeeLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDM  70
            FRAEV KR  +  L     +   Q DWE+RD+ G++ QKQ G+++ GL+IPVGRL ADDM
Sbjct  286  FRAEVEKRFGQSLLPAVDKD---QIDWEKRDHVGIYKQKQSGFNYAGLNIPVGRLSADDM  342

Query  69   DELARLADQYGSGELRLTVEQNI  1
             E+ARL++ YGSGE+R TVEQNI
Sbjct  343  FEIARLSEVYGSGEIRFTVEQNI  365



>ref|XP_006379199.1| hypothetical protein POPTR_0009s10440g, partial [Populus trichocarpa]
 gb|ERP56996.1| hypothetical protein POPTR_0009s10440g, partial [Populus trichocarpa]
Length=467

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/243 (61%), Positives = 166/243 (68%), Gaps = 54/243 (22%)
 Frame = -2

Query  726  LEQVGLTSLQSGMDNVRNAVGNPVAGIDPEEIVDTRPYNNLLSQLITANSRGNPAFSNLP  547
            + +VGLT LQSGMDNVRN VGNP+AGIDP+EIVDT PY NLLSQ IT+NSRGNPAF+NL 
Sbjct  168  IREVGLTGLQSGMDNVRNPVGNPLAGIDPDEIVDTGPYTNLLSQFITSNSRGNPAFTNL-  226

Query  546  RKWNVCVVGSHDLYEHPHINDLAYMPAMKDGRFGFNLLVGGFFSAKRCAEAIPLDAWVPA  367
             +WNVCVVGSHDLYEHPHINDLAY+P +KD RFGFN LVGG FS KR AEA+PLDAWV  
Sbjct  227  -EWNVCVVGSHDLYEHPHINDLAYVPPLKDLRFGFNFLVGGLFSPKRRAEAVPLDAWV--  283

Query  366  DDIFPVCKAILEAFRDLGARGNRQKARMM-WLIDELGIEGFRAEVVKRMPeqeleraaae  190
                PVC+A+LEA  DLG R NRQK RMM WLIDEL                        
Sbjct  284  ----PVCRAVLEACIDLGFRRNRQKTRMMWWLIDEL------------------------  315

Query  189  eLIQKDWERRDYFGVHPQKQEGYSFIGLHIPVGRLEADDMDELARLADQYGSGELRLTVE  10
                                  +S++GLHIPVGR++ADDMD LA LAD YG GELRLT E
Sbjct  316  ---------------------AFSYVGLHIPVGRVQADDMDGLAHLADIYGPGELRLTAE  354

Query  9    QNI  1
            QNI
Sbjct  355  QNI  357



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1389194222792