BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8313_g2_i1 len=1893 path=[4303:0-293 576:294-317 600:318-1892]

Length=1893
                                                                      Score     E

ref|XP_009614398.1|  PREDICTED: galactose oxidase-like                  724   0.0      
ref|XP_004238618.1|  PREDICTED: galactose oxidase-like                  723   0.0      
emb|CDP07430.1|  unnamed protein product                                723   0.0      
ref|XP_010061250.1|  PREDICTED: galactose oxidase-like                  717   0.0      
ref|XP_006342233.1|  PREDICTED: galactose oxidase-like                  716   0.0      
ref|XP_004252835.1|  PREDICTED: galactose oxidase-like                  715   0.0      
ref|XP_011069751.1|  PREDICTED: galactose oxidase-like                  712   0.0      
ref|XP_007225625.1|  hypothetical protein PRUPE_ppa003824mg             712   0.0      
ref|XP_009794042.1|  PREDICTED: galactose oxidase-like                  712   0.0      
ref|XP_010061025.1|  PREDICTED: galactose oxidase-like                  712   0.0      
ref|XP_007017716.1|  Glyoxal oxidase-related protein                    712   0.0      
ref|XP_002280559.1|  PREDICTED: galactose oxidase                       711   0.0      Vitis vinifera
ref|XP_002510488.1|  Galactose oxidase precursor, putative              710   0.0      Ricinus communis
ref|XP_011069718.1|  PREDICTED: galactose oxidase-like                  711   0.0      
ref|XP_011069750.1|  PREDICTED: galactose oxidase-like                  710   0.0      
gb|AET97563.1|  galactose oxidase                                       709   0.0      
ref|XP_008387970.1|  PREDICTED: galactose oxidase-like                  709   0.0      
ref|XP_009797022.1|  PREDICTED: galactose oxidase-like                  707   0.0      
ref|XP_004238617.1|  PREDICTED: galactose oxidase-like                  707   0.0      
ref|XP_009797023.1|  PREDICTED: galactose oxidase-like                  707   0.0      
ref|XP_011092656.1|  PREDICTED: galactose oxidase-like                  705   0.0      
ref|XP_011083592.1|  PREDICTED: galactose oxidase-like                  704   0.0      
ref|XP_010263908.1|  PREDICTED: galactose oxidase-like                  704   0.0      
ref|XP_008221312.1|  PREDICTED: galactose oxidase-like                  703   0.0      
ref|XP_009774595.1|  PREDICTED: galactose oxidase-like                  703   0.0      
ref|XP_006342711.1|  PREDICTED: galactose oxidase-like                  704   0.0      
ref|XP_009335425.1|  PREDICTED: galactose oxidase-like                  702   0.0      
ref|XP_009791893.1|  PREDICTED: galactose oxidase-like                  702   0.0      
gb|KDP38596.1|  hypothetical protein JCGZ_04521                         701   0.0      
ref|XP_006342231.1|  PREDICTED: galactose oxidase-like                  702   0.0      
ref|XP_009600286.1|  PREDICTED: galactose oxidase-like                  701   0.0      
ref|XP_009603236.1|  PREDICTED: galactose oxidase-like                  701   0.0      
ref|XP_008221311.1|  PREDICTED: galactose oxidase-like                  692   0.0      
ref|XP_007017718.1|  Glyoxal oxidase-related protein                    691   0.0      
ref|XP_004499224.1|  PREDICTED: galactose oxidase-like                  690   0.0      
ref|XP_004238325.1|  PREDICTED: galactose oxidase-like                  689   0.0      
ref|XP_004500954.1|  PREDICTED: galactose oxidase-like                  688   0.0      
ref|XP_004291826.1|  PREDICTED: galactose oxidase-like                  688   0.0      
ref|XP_006342232.1|  PREDICTED: galactose oxidase-like                  687   0.0      
ref|XP_010271447.1|  PREDICTED: galactose oxidase-like                  686   0.0      
ref|XP_004289629.1|  PREDICTED: galactose oxidase-like                  684   0.0      
ref|XP_010271448.1|  PREDICTED: galactose oxidase-like                  682   0.0      
ref|XP_004291825.1|  PREDICTED: galactose oxidase-like                  682   0.0      
gb|EYU36763.1|  hypothetical protein MIMGU_mgv1a004035mg                682   0.0      
ref|XP_008367966.1|  PREDICTED: galactose oxidase-like                  681   0.0      
ref|XP_008338258.1|  PREDICTED: galactose oxidase-like                  681   0.0      
ref|XP_011028961.1|  PREDICTED: galactose oxidase-like                  683   0.0      
ref|XP_010105252.1|  hypothetical protein L484_019394                   681   0.0      
ref|XP_003589379.1|  Galactose oxidase                                  681   0.0      
ref|XP_009797024.1|  PREDICTED: galactose oxidase-like                  681   0.0      
ref|XP_008221409.1|  PREDICTED: galactose oxidase-like                  681   0.0      
ref|XP_010105253.1|  hypothetical protein L484_019396                   681   0.0      
ref|XP_003527766.1|  PREDICTED: galactose oxidase-like                  680   0.0      
ref|XP_009337676.1|  PREDICTED: galactose oxidase-like                  679   0.0      
ref|XP_007017717.1|  Glyoxal oxidase-related protein                    679   0.0      
ref|XP_010111102.1|  hypothetical protein L484_008478                   678   0.0      
ref|XP_011045139.1|  PREDICTED: galactose oxidase-like                  678   0.0      
ref|XP_006342230.1|  PREDICTED: galactose oxidase-like                  677   0.0      
ref|XP_009607831.1|  PREDICTED: galactose oxidase-like                  677   0.0      
ref|XP_009337669.1|  PREDICTED: galactose oxidase-like                  676   0.0      
ref|XP_009625411.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    674   0.0      
ref|XP_007136064.1|  hypothetical protein PHAVU_009G014800g             674   0.0      
ref|XP_004238324.1|  PREDICTED: galactose oxidase-like                  672   0.0      
ref|XP_011074991.1|  PREDICTED: galactose oxidase-like                  672   0.0      
ref|XP_008347351.1|  PREDICTED: galactose oxidase-like                  671   0.0      
ref|XP_006304793.1|  hypothetical protein CARUB_v10012343mg             670   0.0      
ref|XP_010540180.1|  PREDICTED: galactose oxidase-like                  671   0.0      
ref|XP_007222145.1|  hypothetical protein PRUPE_ppa004709mg             666   0.0      
ref|XP_006416454.1|  hypothetical protein EUTSA_v10007284mg             668   0.0      
ref|XP_006383733.1|  hypothetical protein POPTR_0005s25690g             668   0.0      
emb|CDY62590.1|  BnaA08g31280D                                          667   0.0      
gb|KHN45905.1|  Galactose oxidase                                       665   0.0      
ref|XP_006473606.1|  PREDICTED: galactose oxidase-like                  666   0.0      
ref|XP_004486272.1|  PREDICTED: galactose oxidase-like                  666   0.0      
gb|KDO84767.1|  hypothetical protein CISIN_1g009420mg                   665   0.0      
ref|XP_010536366.1|  PREDICTED: galactose oxidase-like                  666   0.0      
ref|XP_003523554.1|  PREDICTED: galactose oxidase-like                  665   0.0      
gb|KEH36231.1|  glyoxal oxidase amino-terminal protein                  666   0.0      
ref|XP_009149487.1|  PREDICTED: galactose oxidase                       665   0.0      
ref|XP_008466509.1|  PREDICTED: galactose oxidase-like                  665   0.0      
ref|XP_008350495.1|  PREDICTED: galactose oxidase-like                  664   0.0      
ref|XP_010498415.1|  PREDICTED: galactose oxidase                       665   0.0      
ref|XP_008387971.1|  PREDICTED: galactose oxidase-like                  664   0.0      
ref|XP_009110252.1|  PREDICTED: galactose oxidase-like                  664   0.0      
ref|XP_002301997.2|  glyoxal oxidase-related family protein             662   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009103376.1|  PREDICTED: galactose oxidase-like                  664   0.0      
ref|XP_009337677.1|  PREDICTED: galactose oxidase-like                  663   0.0      
emb|CDY01391.1|  BnaA07g11640D                                          663   0.0      
gb|KGN60011.1|  hypothetical protein Csa_3G866440                       663   0.0      
ref|XP_004147869.1|  PREDICTED: galactose oxidase-like                  662   0.0      
ref|XP_006435123.1|  hypothetical protein CICLE_v10003275mg             661   0.0      
ref|XP_010536368.1|  PREDICTED: galactose oxidase-like                  662   0.0      
ref|XP_010477216.1|  PREDICTED: galactose oxidase-like                  662   0.0      
ref|XP_008377171.1|  PREDICTED: galactose oxidase-like                  660   0.0      
ref|XP_009335433.1|  PREDICTED: galactose oxidase-like                  660   0.0      
ref|XP_010459669.1|  PREDICTED: galactose oxidase-like                  657   0.0      
ref|XP_008444780.1|  PREDICTED: galactose oxidase-like                  657   0.0      
gb|KGN62661.1|  hypothetical protein Csa_2G365680                       655   0.0      
ref|XP_007160695.1|  hypothetical protein PHAVU_001G009200g             653   0.0      
ref|XP_004164439.1|  PREDICTED: galactose oxidase-like                  654   0.0      
ref|XP_008348975.1|  PREDICTED: galactose oxidase-like                  652   0.0      
ref|XP_004152661.1|  PREDICTED: galactose oxidase-like                  653   0.0      
ref|XP_009103375.1|  PREDICTED: galactose oxidase-like                  653   0.0      
ref|XP_008350494.1|  PREDICTED: galactose oxidase-like                  651   0.0      
ref|XP_009336713.1|  PREDICTED: galactose oxidase-like                  650   0.0      
ref|XP_009337697.1|  PREDICTED: galactose oxidase-like                  649   0.0      
emb|CDY44191.1|  BnaC05g15480D                                          658   0.0      
ref|XP_010536365.1|  PREDICTED: galactose oxidase-like                  649   0.0      
ref|XP_006390288.1|  hypothetical protein EUTSA_v10018361mg             647   0.0      
ref|XP_008377179.1|  PREDICTED: galactose oxidase-like                  645   0.0      
ref|NP_177692.1|  glyoxal oxidase-related protein                       644   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011045140.1|  PREDICTED: galactose oxidase-like                  641   0.0      
emb|CDY29385.1|  BnaA06g14110D                                          639   0.0      
ref|XP_010670864.1|  PREDICTED: galactose oxidase-like                  643   0.0      
gb|KFK37635.1|  hypothetical protein AALP_AA3G008700                    637   0.0      
ref|XP_003544396.1|  PREDICTED: uncharacterized protein LOC100791340    636   0.0      
ref|XP_002889034.1|  hypothetical protein ARALYDRAFT_895435             635   0.0      
ref|XP_002893079.1|  hypothetical protein ARALYDRAFT_472215             634   0.0      
ref|XP_010670858.1|  PREDICTED: galactose oxidase-like                  634   0.0      
ref|XP_010471675.1|  PREDICTED: galactose oxidase-like isoform X1       630   0.0      
ref|XP_010471676.1|  PREDICTED: galactose oxidase-like isoform X2       630   0.0      
ref|XP_009388162.1|  PREDICTED: galactose oxidase-like                  628   0.0      
emb|CDY47509.1|  BnaAnng09070D                                          628   0.0      
ref|XP_009106212.1|  PREDICTED: galactose oxidase isoform X1            628   0.0      
ref|XP_009106213.1|  PREDICTED: galactose oxidase isoform X2            627   0.0      
ref|NP_173419.1|  glyoxal oxidase-related protein                       627   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300296.1|  hypothetical protein CARUB_v10021300mg             627   0.0      
emb|CDY39045.1|  BnaA02g17340D                                          627   0.0      
ref|XP_010428587.1|  PREDICTED: galactose oxidase-like                  626   0.0      
ref|XP_010533609.1|  PREDICTED: galactose oxidase-like                  627   0.0      
ref|XP_003527665.1|  PREDICTED: galactose oxidase-like                  625   0.0      
gb|KEH24796.1|  glyoxal oxidase amino-terminal protein                  624   0.0      
ref|XP_008775019.1|  PREDICTED: galactose oxidase-like                  624   0.0      
ref|XP_007136065.1|  hypothetical protein PHAVU_009G014900g             624   0.0      
ref|XP_009128116.1|  PREDICTED: galactose oxidase-like                  623   0.0      
ref|XP_010916153.1|  PREDICTED: galactose oxidase-like                  621   0.0      
ref|XP_010416450.1|  PREDICTED: galactose oxidase-like isoform X1       621   0.0      
emb|CDX73183.1|  BnaC06g36310D                                          618   0.0      
ref|XP_010670846.1|  PREDICTED: galactose oxidase-like                  617   0.0      
ref|XP_010539855.1|  PREDICTED: galactose oxidase-like                  613   0.0      
emb|CDY13556.1|  BnaC02g23670D                                          615   0.0      
gb|KGN60010.1|  hypothetical protein Csa_3G865940                       614   0.0      
ref|XP_004147870.1|  PREDICTED: galactose oxidase-like                  613   0.0      
ref|XP_009336703.1|  PREDICTED: galactose oxidase-like                  614   0.0      
ref|XP_006838081.1|  hypothetical protein AMTR_s00225p00021580          610   0.0      
ref|XP_008466667.1|  PREDICTED: galactose oxidase-like                  614   0.0      
gb|AAG12543.1|AC007797_3  Unknown Protein                               607   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393211.1|  PREDICTED: galactose oxidase-like                  608   0.0      
ref|XP_008813838.1|  PREDICTED: galactose oxidase-like                  603   0.0      
gb|KFK44113.1|  hypothetical protein AALP_AA1G217400                    598   0.0      
ref|XP_009408991.1|  PREDICTED: galactose oxidase-like                  596   0.0      
gb|KHG09161.1|  galactose oxidase                                       592   0.0      
emb|CDP08591.1|  unnamed protein product                                590   0.0      
ref|XP_009606830.1|  PREDICTED: galactose oxidase                       589   0.0      
ref|XP_010256224.1|  PREDICTED: galactose oxidase                       583   0.0      
gb|EYU38846.1|  hypothetical protein MIMGU_mgv1a027114mg                580   0.0      
ref|XP_009801814.1|  PREDICTED: galactose oxidase                       581   0.0      
ref|XP_003553749.1|  PREDICTED: galactose oxidase-like                  580   0.0      
ref|XP_010416451.1|  PREDICTED: galactose oxidase-like isoform X2       577   0.0      
emb|CDY43432.1|  BnaC07g14990D                                          575   0.0      
gb|EAY89314.1|  hypothetical protein OsI_10817                          578   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001049609.1|  Os03g0258900                                       578   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004494672.1|  PREDICTED: galactose oxidase-like                  577   0.0      
ref|XP_007147126.1|  hypothetical protein PHAVU_006G098100g             577   0.0      
ref|XP_004304717.1|  PREDICTED: uncharacterized protein LOC101300467    576   0.0      
ref|XP_003626387.1|  Galactose oxidase                                  576   0.0      
emb|CDY01390.1|  BnaA07g11630D                                          573   0.0      
emb|CDY43429.1|  BnaC07g14960D                                          572   0.0      
ref|XP_007030653.1|  Glyoxal oxidase-related protein                    571   0.0      
ref|XP_002468154.1|  hypothetical protein SORBIDRAFT_01g040550          569   0.0      Sorghum bicolor [broomcorn]
ref|XP_006577272.1|  PREDICTED: galactose oxidase-like                  567   0.0      
ref|XP_006471853.1|  PREDICTED: galactose oxidase-like                  567   0.0      
ref|XP_010660091.1|  PREDICTED: galactose oxidase                       566   0.0      
ref|XP_011073112.1|  PREDICTED: galactose oxidase                       566   0.0      
ref|XP_011003791.1|  PREDICTED: galactose oxidase-like                  566   0.0      
ref|XP_009119411.1|  PREDICTED: galactose oxidase                       565   0.0      
ref|XP_006343542.1|  PREDICTED: galactose oxidase-like                  564   0.0      
ref|XP_006389311.1|  glyoxal oxidase-related family protein             564   0.0      
ref|XP_006649773.1|  PREDICTED: galactose oxidase-like                  563   0.0      
gb|KFK35620.1|  hypothetical protein AALP_AA4G014800                    561   0.0      
ref|XP_010242442.1|  PREDICTED: galactose oxidase                       561   0.0      
ref|XP_004984953.1|  PREDICTED: galactose oxidase-like                  561   0.0      
gb|EMT01589.1|  hypothetical protein F775_04099                         560   0.0      
tpg|DAA44472.1|  TPA: glyoxal oxidase                                   561   0.0      
ref|NP_001149941.1|  glyoxal oxidase precursor                          560   0.0      Zea mays [maize]
emb|CDY62245.1|  BnaC01g42480D                                          559   0.0      
ref|XP_010652487.1|  PREDICTED: galactose oxidase                       558   0.0      
ref|XP_009364601.1|  PREDICTED: galactose oxidase                       557   0.0      
emb|CDY44816.1|  BnaCnng11720D                                          556   0.0      
ref|XP_006357288.1|  PREDICTED: galactose oxidase-like                  557   0.0      
ref|XP_006849171.1|  hypothetical protein AMTR_s00027p00177380          556   0.0      
ref|XP_009594288.1|  PREDICTED: uncharacterized protein LOC104090813    556   0.0      
emb|CBI19807.3|  unnamed protein product                                552   0.0      
ref|XP_009619752.1|  PREDICTED: galactose oxidase-like                  556   0.0      
gb|EYU23055.1|  hypothetical protein MIMGU_mgv1a021812mg                552   0.0      
ref|XP_006382737.1|  glyoxal oxidase-related family protein             553   0.0      
ref|XP_006828863.1|  hypothetical protein AMTR_s00001p00165980          553   0.0      
ref|XP_003561804.1|  PREDICTED: galactose oxidase-like                  553   0.0      
ref|XP_009779182.1|  PREDICTED: galactose oxidase-like                  554   0.0      
ref|XP_006290310.1|  hypothetical protein CARUB_v10019204mg             551   0.0      
ref|XP_002876427.1|  hypothetical protein ARALYDRAFT_907231             551   0.0      
ref|NP_191321.1|  glyoxal oxidase-related protein                       550   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004243010.2|  PREDICTED: galactose oxidase                       550   0.0      
ref|XP_010504696.1|  PREDICTED: galactose oxidase-like                  549   0.0      
ref|XP_009782130.1|  PREDICTED: galactose oxidase-like                  550   0.0      
ref|XP_008389005.1|  PREDICTED: galactose oxidase                       549   0.0      
ref|XP_010532190.1|  PREDICTED: galactose oxidase                       549   0.0      
ref|XP_010516382.1|  PREDICTED: galactose oxidase-like                  548   0.0      
ref|XP_006392509.1|  hypothetical protein EUTSA_v10023396mg             547   0.0      
ref|XP_010041767.1|  PREDICTED: galactose oxidase                       546   0.0      
ref|XP_008218222.1|  PREDICTED: galactose oxidase                       546   0.0      
ref|XP_006433075.1|  hypothetical protein CICLE_v10000768mg             543   0.0      
gb|EYU22441.1|  hypothetical protein MIMGU_mgv1a024085mg                544   0.0      
ref|XP_007208189.1|  hypothetical protein PRUPE_ppa020922mg             541   0.0      
ref|XP_004239377.1|  PREDICTED: galactose oxidase-like                  542   0.0      
ref|XP_010674901.1|  PREDICTED: galactose oxidase                       541   0.0      
ref|XP_006849170.1|  hypothetical protein AMTR_s00027p00175370          541   0.0      
ref|XP_009117902.1|  PREDICTED: galactose oxidase-like                  540   0.0      
emb|CDY53551.1|  BnaA09g57100D                                          540   0.0      
gb|KHN04050.1|  Galactose oxidase                                       536   0.0      
ref|XP_010100623.1|  hypothetical protein L484_011554                   535   0.0      
ref|XP_006344285.1|  PREDICTED: galactose oxidase-like                  536   2e-180   
ref|XP_004237211.1|  PREDICTED: galactose oxidase-like                  535   7e-180   
emb|CDX81637.1|  BnaC08g39640D                                          533   2e-179   
ref|XP_002512263.1|  Galactose oxidase precursor, putative              529   3e-178   Ricinus communis
ref|XP_010458940.1|  PREDICTED: galactose oxidase-like                  530   5e-178   
ref|XP_007039386.1|  Glyoxal oxidase-related protein                    529   9e-178   
ref|XP_010496071.1|  PREDICTED: galactose oxidase-like                  528   1e-177   
ref|XP_006483245.1|  PREDICTED: galactose oxidase-like                  529   1e-177   
ref|XP_006417012.1|  hypothetical protein EUTSA_v10007241mg             528   1e-177   
ref|XP_010476497.1|  PREDICTED: galactose oxidase-like                  528   2e-177   
ref|XP_006438575.1|  hypothetical protein CICLE_v10031195mg             527   2e-177   
ref|XP_011071032.1|  PREDICTED: galactose oxidase-like                  530   2e-177   
ref|XP_008781649.1|  PREDICTED: uncharacterized protein LOC103701389    527   5e-177   
ref|NP_172895.2|  glyoxal oxidase-related protein                       524   7e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009407008.1|  PREDICTED: uncharacterized protein LOC103989784    522   2e-175   
ref|XP_002890054.1|  hypothetical protein ARALYDRAFT_888820             522   3e-175   
gb|KDP25206.1|  hypothetical protein JCGZ_20362                         521   5e-175   
ref|XP_006833409.1|  hypothetical protein AMTR_s00109p00131490          523   5e-175   
gb|KDO82728.1|  hypothetical protein CISIN_1g048017mg                   521   1e-174   
ref|XP_002973684.1|  hypothetical protein SELMODRAFT_413959             519   3e-174   
ref|XP_006378160.1|  glyoxal oxidase-related family protein             518   1e-173   
gb|EPS72896.1|  hypothetical protein M569_01859                         516   1e-173   
ref|XP_011010793.1|  PREDICTED: galactose oxidase                       517   2e-173   
emb|CDP00283.1|  unnamed protein product                                514   6e-173   
gb|KFK43688.1|  hypothetical protein AALP_AA1G160100                    516   6e-173   
ref|XP_007227672.1|  hypothetical protein PRUPE_ppa026498mg             516   6e-173   
ref|XP_008221748.1|  PREDICTED: galactose oxidase                       517   8e-173   
ref|XP_006304526.1|  hypothetical protein CARUB_v10011386mg             515   2e-172   
ref|XP_010930930.1|  PREDICTED: uncharacterized protein LOC105051966    514   3e-172   
ref|XP_009360496.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    514   5e-172   
ref|XP_002518913.1|  Galactose oxidase precursor, putative              511   5e-171   Ricinus communis
ref|XP_004298452.1|  PREDICTED: galactose oxidase-like                  510   2e-170   
ref|XP_007046239.1|  Glyoxal oxidase-related protein, putative          508   7e-170   
ref|XP_002520142.1|  conserved hypothetical protein                     506   8e-169   Ricinus communis
ref|XP_009392205.1|  PREDICTED: galactose oxidase-like                  505   1e-168   
gb|KDP21232.1|  hypothetical protein JCGZ_21703                         505   2e-168   
ref|XP_010096335.1|  hypothetical protein L484_021082                   504   7e-168   
ref|XP_010554972.1|  PREDICTED: galactose oxidase                       501   5e-167   
ref|XP_008340335.1|  PREDICTED: uncharacterized protein LOC103403295    513   9e-167   
ref|XP_004489989.1|  PREDICTED: uncharacterized protein LOC101500908    502   9e-167   
tpg|DAA44471.1|  TPA: hypothetical protein ZEAMMB73_122663              499   3e-166   
ref|XP_002975736.1|  hypothetical protein SELMODRAFT_232564             497   3e-166   
ref|XP_003613586.1|  hypothetical protein MTR_5g038410                  497   8e-166   
ref|XP_011026783.1|  PREDICTED: galactose oxidase-like                  496   2e-165   
ref|XP_010541897.1|  PREDICTED: galactose oxidase-like                  494   4e-164   
ref|XP_002972039.1|  hypothetical protein SELMODRAFT_441651             490   9e-163   
ref|XP_002972585.1|  hypothetical protein SELMODRAFT_97196              489   2e-162   
ref|XP_008245383.1|  PREDICTED: galactose oxidase-like                  489   2e-162   
gb|KCW65018.1|  hypothetical protein EUGRSUZ_G02553                     489   3e-162   
ref|XP_007209012.1|  hypothetical protein PRUPE_ppa023406mg             486   1e-161   
ref|XP_006477507.1|  PREDICTED: galactose oxidase-like                  483   3e-160   
ref|XP_003519774.1|  PREDICTED: galactose oxidase-like                  483   5e-160   
ref|XP_010523439.1|  PREDICTED: galactose oxidase-like isoform X1       483   9e-160   
gb|EPS58061.1|  hypothetical protein M569_16755                         475   7e-159   
ref|XP_008352131.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    474   9e-159   
ref|XP_004309580.1|  PREDICTED: galactose oxidase-like                  479   9e-159   
ref|XP_002299426.2|  hypothetical protein POPTR_0001s11390g             479   2e-158   Populus trichocarpa [western balsam poplar]
ref|NP_001150444.1|  glyoxal oxidase precursor                          479   2e-158   Zea mays [maize]
ref|XP_006439219.1|  hypothetical protein CICLE_v10024435mg             478   4e-158   
ref|XP_006383732.1|  hypothetical protein POPTR_0005s25680g             475   6e-158   
ref|XP_004978797.1|  PREDICTED: galactose oxidase-like                  474   1e-156   
ref|XP_004298451.1|  PREDICTED: galactose oxidase-like                  474   4e-156   
ref|XP_002272723.2|  PREDICTED: uncharacterized protein LOC100259927    471   1e-155   
emb|CBI34589.3|  unnamed protein product                                471   1e-155   
ref|XP_002446737.1|  hypothetical protein SORBIDRAFT_06g021520          471   3e-155   
ref|XP_001771865.1|  predicted protein                                  468   4e-155   
ref|XP_010262660.1|  PREDICTED: galactose oxidase                       469   4e-155   
ref|XP_010100201.1|  hypothetical protein L484_015346                   470   5e-155   
emb|CDP06561.1|  unnamed protein product                                468   2e-154   
emb|CAN83495.1|  hypothetical protein VITISV_026965                     468   5e-154   
ref|XP_007157402.1|  hypothetical protein PHAVU_002G066900g             465   1e-153   
ref|XP_002449081.1|  hypothetical protein SORBIDRAFT_05g004490          467   1e-153   
ref|XP_008442498.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    466   1e-153   
emb|CDP00282.1|  unnamed protein product                                464   3e-153   
ref|NP_001176372.1|  Os11g0169700                                       466   4e-153   
ref|XP_006857804.1|  hypothetical protein AMTR_s00061p00216590          464   4e-153   
ref|XP_004137754.1|  PREDICTED: galactose oxidase-like                  463   1e-152   
ref|XP_003516307.1|  PREDICTED: galactose oxidase-like                  463   3e-152   
ref|XP_010924630.1|  PREDICTED: uncharacterized protein LOC105047413    464   4e-152   
ref|XP_008801460.1|  PREDICTED: galactose oxidase-like                  463   1e-151   
gb|EAY80097.1|  hypothetical protein OsI_35269                          460   8e-151   
gb|KDO76728.1|  hypothetical protein CISIN_1g0433692mg                  457   1e-150   
ref|XP_006349488.1|  PREDICTED: galactose oxidase-like                  458   2e-150   
ref|XP_010656292.1|  PREDICTED: galactose oxidase                       460   3e-150   
ref|XP_008359690.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    457   3e-150   
ref|XP_004288880.1|  PREDICTED: uncharacterized protein LOC101300395    459   6e-150   
ref|XP_004293134.1|  PREDICTED: uncharacterized protein LOC101306599    454   1e-149   
ref|XP_002961909.1|  hypothetical protein SELMODRAFT_77682              455   3e-149   
ref|XP_009774166.1|  PREDICTED: galactose oxidase                       454   4e-149   
ref|XP_001778975.1|  predicted protein                                  454   4e-149   
ref|XP_010904553.1|  PREDICTED: galactose oxidase-like                  454   7e-149   
ref|XP_010553274.1|  PREDICTED: galactose oxidase                       453   1e-148   
ref|XP_002274763.1|  PREDICTED: galactose oxidase                       452   2e-148   
emb|CDX67577.1|  BnaA07g16170D                                          452   3e-148   
gb|ABA42922.1|  glyoxal oxidase                                         451   3e-148   
ref|XP_007208466.1|  hypothetical protein PRUPE_ppa003992mg             452   3e-148   
ref|XP_010254463.1|  PREDICTED: galactose oxidase                       454   4e-148   
ref|XP_004249644.1|  PREDICTED: galactose oxidase                       452   5e-148   
ref|XP_009602919.1|  PREDICTED: galactose oxidase                       451   6e-148   
ref|XP_008240187.1|  PREDICTED: galactose oxidase                       451   7e-148   
ref|XP_002876232.1|  hypothetical protein ARALYDRAFT_485786             451   1e-147   
gb|EYU41788.1|  hypothetical protein MIMGU_mgv1a004290mg                451   1e-147   
gb|ACV49899.1|  glyoxal oxidase                                         450   1e-147   
ref|NP_190963.1|  glyoxal oxidase-related protein                       451   1e-147   
gb|ACV49898.1|  glyoxal oxidase                                         449   2e-147   
emb|CDY59162.1|  BnaC06g42590D                                          450   2e-147   
gb|ACV49897.1|  glyoxal oxidase                                         449   4e-147   
ref|XP_009103886.1|  PREDICTED: galactose oxidase                       449   4e-147   
ref|XP_006290869.1|  hypothetical protein CARUB_v10016978mg             449   4e-147   
emb|CBI28031.3|  unnamed protein product                                460   8e-147   
ref|XP_010674911.1|  PREDICTED: uncharacterized protein LOC104890981    448   1e-146   
ref|XP_010515903.1|  PREDICTED: galactose oxidase-like                  448   1e-146   
gb|KFK34638.1|  hypothetical protein AALP_AA5G172000                    448   1e-146   
ref|XP_001771982.1|  predicted protein                                  448   1e-146   
ref|XP_007134016.1|  hypothetical protein PHAVU_010G012100g             447   1e-146   
ref|XP_010427056.1|  PREDICTED: galactose oxidase-like                  448   1e-146   
ref|XP_007226541.1|  hypothetical protein PRUPE_ppa024999mg             449   1e-146   
gb|EPS61181.1|  glyoxal oxidase                                         447   2e-146   
ref|XP_008464498.1|  PREDICTED: uncharacterized protein LOC103502362    448   3e-146   
ref|XP_009381768.1|  PREDICTED: uncharacterized protein LOC103969853    448   3e-146   
ref|XP_006381726.1|  hypothetical protein POPTR_0006s16390g             449   4e-146   
ref|XP_009394071.1|  PREDICTED: uncharacterized protein LOC103979627    447   6e-146   
ref|XP_008793761.1|  PREDICTED: galactose oxidase-like                  447   1e-145   
ref|XP_009367481.1|  PREDICTED: uncharacterized protein LOC103957109    447   2e-145   
ref|XP_004305171.1|  PREDICTED: galactose oxidase-like                  445   2e-145   
ref|XP_010511646.1|  PREDICTED: galactose oxidase-like                  447   2e-145   
ref|XP_002322929.1|  glyoxal oxidase-related family protein             444   2e-145   
ref|XP_010504181.1|  PREDICTED: galactose oxidase-like                  445   2e-145   
gb|KDP24540.1|  hypothetical protein JCGZ_25104                         444   4e-145   
ref|XP_001765643.1|  predicted protein                                  444   4e-145   
ref|XP_001762124.1|  predicted protein                                  444   4e-145   
ref|XP_002873953.1|  hypothetical protein ARALYDRAFT_488852             446   5e-145   
ref|XP_010688268.1|  PREDICTED: uncharacterized protein LOC104902254    444   5e-145   
ref|XP_007026880.1|  Glyoxal oxidase-related protein                    451   7e-145   
ref|XP_009367892.1|  PREDICTED: uncharacterized protein LOC103957460    444   1e-144   
ref|XP_003520957.1|  PREDICTED: uncharacterized protein LOC100776515    442   2e-144   
ref|XP_011006630.1|  PREDICTED: galactose oxidase                       441   3e-144   
ref|XP_001757263.1|  predicted protein                                  442   3e-144   
ref|XP_008811510.1|  PREDICTED: galactose oxidase                       442   3e-144   
ref|XP_008242563.1|  PREDICTED: uncharacterized protein LOC103340881    446   8e-144   
ref|XP_009378871.1|  PREDICTED: galactose oxidase                       441   8e-144   
ref|XP_011094925.1|  PREDICTED: galactose oxidase                       441   8e-144   
ref|XP_004138264.1|  PREDICTED: uncharacterized protein LOC101204692    442   8e-144   
ref|XP_010905399.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    441   1e-143   
ref|XP_008220102.1|  PREDICTED: uncharacterized protein LOC103320236    441   2e-143   
ref|XP_004969528.1|  PREDICTED: uncharacterized protein LOC101774211    443   2e-143   
ref|XP_010470629.1|  PREDICTED: galactose oxidase-like isoform X1       442   2e-143   
ref|XP_010454240.1|  PREDICTED: galactose oxidase-like                  441   2e-143   
ref|XP_007203106.1|  hypothetical protein PRUPE_ppa023837mg             446   3e-143   
ref|XP_001783776.1|  predicted protein                                  439   3e-143   
ref|XP_010493033.1|  PREDICTED: galactose oxidase-like                  441   3e-143   
ref|XP_004292851.1|  PREDICTED: uncharacterized protein LOC101303486    440   5e-143   
ref|XP_001784508.1|  predicted protein                                  439   5e-143   
ref|XP_010088559.1|  hypothetical protein L484_016951                   438   6e-143   
ref|XP_008367509.1|  PREDICTED: uncharacterized protein LOC103431143    439   7e-143   
ref|XP_006287335.1|  hypothetical protein CARUB_v10000533mg             440   1e-142   
ref|XP_010424026.1|  PREDICTED: galactose oxidase-like                  437   2e-142   
gb|AAL84955.1|  AT5g19580/T20D1_100                                     439   3e-142   
ref|XP_006475694.1|  PREDICTED: galactose oxidase-like                  438   3e-142   
ref|NP_197459.1|  glyoxal oxidase-related protein                       439   3e-142   
ref|XP_008239597.1|  PREDICTED: uncharacterized protein LOC103338188    438   3e-142   
ref|XP_003516476.1|  PREDICTED: uncharacterized protein LOC100797716    438   5e-142   
ref|XP_003528130.2|  PREDICTED: uncharacterized protein LOC100814200    436   9e-142   
ref|XP_007037788.1|  Glyoxal oxidase-related protein                    436   1e-141   
ref|XP_002888587.1|  hypothetical protein ARALYDRAFT_475824             437   2e-141   
ref|XP_010420764.1|  PREDICTED: galactose oxidase-like isoform X1       436   2e-141   
ref|XP_002438138.1|  hypothetical protein SORBIDRAFT_10g008655          435   2e-141   
ref|XP_003576251.1|  PREDICTED: galactose oxidase-like                  436   3e-141   
ref|XP_008367891.1|  PREDICTED: galactose oxidase-like                  438   4e-141   
ref|XP_011009462.1|  PREDICTED: galactose oxidase-like                  436   5e-141   
ref|XP_006850437.1|  hypothetical protein AMTR_s00165p00057230          433   8e-141   
ref|XP_010251352.1|  PREDICTED: uncharacterized protein LOC104593293    434   1e-140   
ref|NP_176897.1|  glyoxal oxidase-related protein                       435   1e-140   
ref|XP_009352508.1|  PREDICTED: galactose oxidase-like                  437   1e-140   
ref|XP_010026976.1|  PREDICTED: uncharacterized protein LOC104417381    433   1e-140   
ref|XP_001763031.1|  predicted protein                                  432   1e-140   
ref|XP_006451231.1|  hypothetical protein CICLE_v10010756mg             434   1e-140   
ref|XP_011048365.1|  PREDICTED: galactose oxidase                       434   2e-140   
ref|XP_002324431.2|  hypothetical protein POPTR_0018s09110g             434   2e-140   
ref|XP_009105271.1|  PREDICTED: galactose oxidase                       433   5e-140   
ref|XP_010044010.1|  PREDICTED: galactose oxidase                       431   6e-140   
gb|KDO57956.1|  hypothetical protein CISIN_1g044265mg                   430   7e-140   
emb|CDY01797.1|  BnaC06g28370D                                          432   9e-140   
ref|XP_006429215.1|  hypothetical protein CICLE_v10011448mg             430   9e-140   
ref|XP_010107380.1|  hypothetical protein L484_003656                   433   1e-139   
ref|XP_006480899.1|  PREDICTED: galactose oxidase-like                  429   2e-139   
emb|CDM83959.1|  unnamed protein product                                430   4e-139   
ref|XP_004507195.1|  PREDICTED: galactose oxidase-like                  428   5e-139   
ref|XP_002968444.1|  hypothetical protein SELMODRAFT_231119             427   7e-139   
ref|XP_002970607.1|  hypothetical protein SELMODRAFT_411320             427   1e-138   
emb|CDX96101.1|  BnaA07g26300D                                          429   1e-138   
ref|XP_003567916.1|  PREDICTED: galactose oxidase-like                  429   2e-138   
ref|XP_010535983.1|  PREDICTED: galactose oxidase-like                  428   3e-138   
ref|XP_010532465.1|  PREDICTED: galactose oxidase-like                  429   4e-138   
emb|CDY42279.1|  BnaC02g08850D                                          427   4e-138   
ref|XP_009336933.1|  PREDICTED: galactose oxidase-like                  430   4e-138   
emb|CDY44928.1|  BnaA02g04330D                                          427   5e-138   
ref|XP_002281387.1|  PREDICTED: uncharacterized protein LOC100256065    427   5e-138   
ref|XP_006400518.1|  hypothetical protein EUTSA_v10012975mg             428   5e-138   
ref|XP_009421296.1|  PREDICTED: galactose oxidase                       426   7e-138   
gb|KHN07971.1|  E3 ubiquitin-protein ligase RGLG2                       436   9e-138   
ref|XP_004139435.1|  PREDICTED: galactose oxidase-like                  427   1e-137   
gb|ACG29670.1|  glyoxal oxidase                                         427   1e-137   
ref|XP_001774885.1|  predicted protein                                  424   1e-137   
ref|XP_002456130.1|  hypothetical protein SORBIDRAFT_03g031030          427   1e-137   
gb|KFK26190.1|  hypothetical protein AALP_AA8G214300                    426   2e-137   
ref|XP_009126377.1|  PREDICTED: galactose oxidase-like                  426   2e-137   
ref|XP_001759192.1|  predicted protein                                  424   2e-137   
ref|XP_002970610.1|  hypothetical protein SELMODRAFT_93556              424   2e-137   
ref|NP_001170492.1|  hypothetical protein precursor                     427   2e-137   
ref|XP_008649992.1|  PREDICTED: uncharacterized protein LOC103630723    427   2e-137   
ref|XP_010541740.1|  PREDICTED: galactose oxidase-like                  426   3e-137   
ref|XP_006391296.1|  hypothetical protein EUTSA_v10018300mg             426   6e-137   
ref|XP_004503455.1|  PREDICTED: uncharacterized protein LOC101501825    426   6e-137   
ref|XP_002968445.1|  hypothetical protein SELMODRAFT_89852              422   7e-137   
ref|XP_010102932.1|  hypothetical protein L484_018951                   424   2e-136   
emb|CDP12684.1|  unnamed protein product                                422   2e-136   
dbj|BAL41451.1|  glyoxal oxidase 2                                      427   2e-136   
ref|XP_010663077.1|  PREDICTED: uncharacterized protein LOC100253501    424   2e-136   
ref|XP_008460895.1|  PREDICTED: galactose oxidase                       424   3e-136   
ref|XP_010535982.1|  PREDICTED: galactose oxidase-like                  420   1e-135   
ref|XP_006301879.1|  hypothetical protein CARUB_v10022352mg             427   1e-135   
gb|KFK41129.1|  hypothetical protein AALP_AA2G089900                    423   2e-135   
ref|XP_001774194.1|  predicted protein                                  419   2e-135   
emb|CDY51183.1|  BnaC02g45610D                                          421   2e-135   
ref|XP_001777189.1|  predicted protein                                  419   2e-135   
ref|XP_010535981.1|  PREDICTED: galactose oxidase-like                  419   2e-135   
ref|XP_003630749.1|  Galactose oxidase                                  422   3e-135   
gb|KDO54103.1|  hypothetical protein CISIN_1g039705mg                   419   3e-135   
ref|XP_009127543.1|  PREDICTED: galactose oxidase-like                  420   3e-135   
gb|KEH28959.1|  glyoxal oxidase amino-terminal protein                  418   3e-135   
dbj|BAL41454.1|  glyoxal oxidase 5                                      422   4e-135   
ref|XP_001759194.1|  predicted protein                                  418   4e-135   
ref|XP_008362947.1|  PREDICTED: galactose oxidase-like                  422   4e-135   
ref|XP_006848962.1|  hypothetical protein AMTR_s00166p00070030          418   7e-135   
gb|KDO66474.1|  hypothetical protein CISIN_1g042303mg                   417   7e-135   
ref|XP_001756237.1|  predicted protein                                  417   8e-135   
ref|XP_007137990.1|  hypothetical protein PHAVU_009G171700g             418   8e-135   
gb|EEE51720.1|  hypothetical protein OsJ_33111                          417   2e-134   
gb|KDP33711.1|  hypothetical protein JCGZ_07282                         419   2e-134   
dbj|BAL41452.1|  glyoxal oxidase 3                                      421   3e-134   
ref|XP_007152887.1|  hypothetical protein PHAVU_004G168600g             419   3e-134   
ref|XP_003569556.2|  PREDICTED: uncharacterized protein LOC100835848    417   4e-134   
ref|XP_001769885.1|  predicted protein                                  415   5e-134   
ref|XP_011087000.1|  PREDICTED: galactose oxidase-like                  416   6e-134   
ref|XP_001774105.1|  predicted protein                                  415   6e-134   
ref|XP_006420316.1|  hypothetical protein CICLE_v10006853mg             416   2e-133   
ref|XP_004501852.1|  PREDICTED: uncharacterized protein LOC101503410    427   3e-133   
gb|KCW83241.1|  hypothetical protein EUGRSUZ_B00180                     412   4e-133   
gb|KDP29259.1|  hypothetical protein JCGZ_16648                         416   4e-133   
gb|KDP33710.1|  hypothetical protein JCGZ_07281                         418   6e-133   
ref|XP_007160315.1|  hypothetical protein PHAVU_002G311300g             415   9e-133   
ref|XP_004513017.1|  PREDICTED: uncharacterized protein LOC101505637    414   1e-132   
ref|XP_003620657.1|  Galactose oxidase                                  412   3e-132   
gb|KEH35019.1|  glyoxal oxidase amino-terminal protein                  409   5e-132   
ref|XP_010051583.1|  PREDICTED: galactose oxidase-like                  413   5e-132   
ref|XP_006400519.1|  hypothetical protein EUTSA_v10012975mg             413   5e-132   
ref|XP_004299160.1|  PREDICTED: uncharacterized protein LOC101293298    410   1e-131   
ref|NP_001043851.1|  Os01g0677000                                       412   2e-131   
ref|XP_006584818.1|  PREDICTED: uncharacterized protein LOC100808336    412   2e-131   
ref|XP_002440240.1|  hypothetical protein SORBIDRAFT_09g028310          411   4e-131   
gb|KDO52701.1|  hypothetical protein CISIN_1g048136mg                   409   4e-131   
gb|EEC71262.1|  hypothetical protein OsI_03252                          411   4e-131   
ref|XP_002514260.1|  Galactose oxidase precursor, putative              410   5e-131   
ref|XP_006654771.1|  PREDICTED: uncharacterized protein LOC102716970    410   9e-131   
ref|XP_001754066.1|  predicted protein                                  405   1e-130   
ref|XP_006437613.1|  hypothetical protein CICLE_v10033514mg             407   5e-130   
ref|XP_001762682.1|  predicted protein                                  403   1e-129   
ref|XP_001782509.1|  predicted protein                                  403   2e-129   
emb|CAN73409.1|  hypothetical protein VITISV_024374                     401   2e-129   
ref|XP_007013099.1|  Glyoxal oxidase-related protein, putative          406   2e-129   
ref|XP_004963606.1|  PREDICTED: galactose oxidase-like                  405   7e-129   
dbj|BAL41448.1|  glyoxal oxidase 1                                      405   1e-128   
ref|XP_004242940.2|  PREDICTED: uncharacterized protein LOC101252095    402   2e-128   
gb|KDO66471.1|  hypothetical protein CISIN_1g035640mg                   401   1e-127   
ref|XP_006475693.1|  PREDICTED: galactose oxidase-like                  400   4e-127   
ref|XP_006451228.1|  hypothetical protein CICLE_v10010177mg             399   6e-127   
ref|XP_006341271.1|  PREDICTED: uncharacterized protein LOC102605018    397   1e-126   
gb|EAY98991.1|  hypothetical protein OsI_20949                          399   1e-126   



>ref|XP_009614398.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=553

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/549 (64%), Positives = 422/549 (77%), Gaps = 7/549 (1%)
 Frame = +2

Query  35    LLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTD  214
             L F L  LF++ +     R  FA+AAGG +W +L+ NIGI+AMHMQLLNNDKVVIFDRTD
Sbjct  10    LFFILLHLFVLLS---CHRPNFASAAGG-KWNILMSNIGISAMHMQLLNNDKVVIFDRTD  65

Query  215   FGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDG  394
             FG SNI L  G+CR DP +  +++DCTAHSVEY++  N++RPLMVQTDVWCSS +V PDG
Sbjct  66    FGHSNISLPDGKCRNDPNDTTLQIDCTAHSVEYNIVTNSIRPLMVQTDVWCSSGSVFPDG  125

Query  395   TLIQTGGWNDGDHVVRVFNPCN-DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             +L+QTGG+NDG+ VVRVF PCN +  CDW EI   L + RWYATNHILPDGRQIIIGGR 
Sbjct  126   SLVQTGGFNDGEKVVRVFKPCNGNNTCDWQEIQGGLAQRRWYATNHILPDGRQIIIGGRR  185

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
              FNYEFYPK       Y+LPFL +TNDP  ENNLYP+VFLN+DG+LFIFANN+AIL+DY 
Sbjct  186   AFNYEFYPKPASAYKAYSLPFLVQTNDPKIENNLYPFVFLNMDGNLFIFANNRAILFDYT  245

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
             K+ VV+ YP +P G PRSYPSTGSAVLLPLKNLQ   I AEVL+CGGAPKG++ +++ G 
Sbjct  246   KNVVVKSYPQIPGGDPRSYPSTGSAVLLPLKNLQTQQIQAEVLVCGGAPKGSYISAQNGK  305

Query  932   FMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRN  1111
             F+GAL+TCGRIRITDPNP W +E MP+AR MGDMV LPNGN+LIINGAA G+AG+  GR+
Sbjct  306   FLGALSTCGRIRITDPNPQWTIENMPLARTMGDMVILPNGNVLIINGAATGTAGWELGRD  365

Query  1112  PVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGAL  1291
             PV  PV+Y  DNP G+RFEI NPS IPRMYHSTA LLR+ RVL+ GSNPH  Y F  G L
Sbjct  366   PVLKPVIYRPDNPFGSRFEIQNPSTIPRMYHSTATLLRNGRVLIAGSNPHIYYNF-TGVL  424

Query  1292  FPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTM  1471
             FPTEL LEAFSP YLD  +  +RP I  P S    GYG+ + I+F  +G V+ NLVTVTM
Sbjct  425   FPTELSLEAFSPSYLDPESEYLRPQIISPASQYIIGYGQRVPIRFKVSGRVNRNLVTVTM  484

Query  1472  VAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGI  1651
             VAP F THSF+Q+QRLL L     VK VG   Y +  VTP S  L+P GYY+LFVVH+ I
Sbjct  485   VAPGFNTHSFTQNQRLLVL-ANENVKLVGEKAYQVNVVTPNSATLAPPGYYLLFVVHQDI  543

Query  1652  PSEGIWIQM  1678
             PSEGIW+++
Sbjct  544   PSEGIWVKI  552



>ref|XP_004238618.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=553

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/528 (65%), Positives = 415/528 (79%), Gaps = 4/528 (1%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A AA GG+W+LL+ NIGI++MHMQLLNND+V+++DRTDFG SNI L  G+CR +  ++ +
Sbjct  28    AYAAAGGKWDLLMSNIGISSMHMQLLNNDRVIMYDRTDFGASNISLPNGKCRNNTNDLAL  87

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             K+DCTAHSVEYDV+ N++RPLMVQTDVWCSS +   DGTL+QTGG+NDG+ VVRV  PCN
Sbjct  88    KIDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGEKVVRVLKPCN  147

Query  461   DKK--CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
               K  CDW EI +AL + RWYATNH+LPDGRQIIIGGRE FNYEFYPKT   + ++NL F
Sbjct  148   GNKSRCDWREIESALIQSRWYATNHVLPDGRQIIIGGREAFNYEFYPKTLSTNNIFNLTF  207

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L +TNDP  ENNLYP+VFLNVDG+LFIFANN+AIL+DY    +V+ YP +P G PR+YPS
Sbjct  208   LQQTNDPREENNLYPFVFLNVDGNLFIFANNRAILFDYTSDTIVKTYPQIPGGDPRNYPS  267

Query  815   TGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWF  994
             TGSAVLLPLKNL+A  I AEVL+CGG   G+F  ++RG F+GALNTCGRIRITDPNP W 
Sbjct  268   TGSAVLLPLKNLEAQIIQAEVLVCGGTKNGSFLRAQRGKFLGALNTCGRIRITDPNPQWV  327

Query  995   METMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEIL  1174
             METMP+AR+M DMV LPNGN+LIINGAA G+AG+  GR+PV +PV+Y  DNPV +RFE+ 
Sbjct  328   METMPLARIMSDMVILPNGNVLIINGAAAGTAGWELGRSPVLSPVIYRPDNPVNSRFEVQ  387

Query  1175  NPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAG  1354
             NPS IPRMYHST ILLRD RVLVGGSNPH  Y F  G L+PTEL LEAFSP YLD+ +A 
Sbjct  388   NPSTIPRMYHSTTILLRDGRVLVGGSNPHGLYNF-TGVLYPTELSLEAFSPSYLDSDSAN  446

Query  1355  IRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGG  1534
             +RP I  P S  K  YG  + I+F   GP++ NLV VTMVAP F THSF+ +QR+L L  
Sbjct  447   LRPQIISPASRRKVKYGGQVNIRFIVPGPINRNLVKVTMVAPGFNTHSFTMNQRILVLSS  506

Query  1535  GGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             G  V  VG +TY + ++ P S  L+P GYYMLFVVH+ IPSEGIWI++
Sbjct  507   GN-VTQVGTSTYKINSIFPNSSKLAPPGYYMLFVVHQDIPSEGIWIRI  553



>emb|CDP07430.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/528 (66%), Positives = 419/528 (79%), Gaps = 4/528 (1%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             AAA  GG+W LL  +IGIA+MHMQLLNNDKVVI+DRTDFG SNI L  G+CR DP E V+
Sbjct  35    AAATTGGQWALLQSSIGIASMHMQLLNNDKVVIYDRTDFGPSNISLASGKCRYDPQEQVL  94

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             KVDCTAHSVEYDVA N+ RPL V TDVWCSS ++MPDGT +QTGG+NDGDHVVR++ PC+
Sbjct  95    KVDCTAHSVEYDVATNSFRPLTVLTDVWCSSGSLMPDGTFVQTGGFNDGDHVVRLYKPCS  154

Query  461   D-KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFL  637
                 CDW EI N L + RWYATNHILPD  QIIIGGR +FNYEFYPKT   + ++NL FL
Sbjct  155   SGSNCDWQEINNGLIQRRWYATNHILPDSSQIIIGGRRQFNYEFYPKTAATNQVFNLRFL  214

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
              +TNDP  ENNLYP+VFLNVDG+LFIFANN+AIL +Y K+ VV+ YP +PDG PR YPST
Sbjct  215   VQTNDPVVENNLYPFVFLNVDGNLFIFANNRAILLNYKKNIVVKNYPQLPDGNPRCYPST  274

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             GSAVLLPL+NLQ P I AEVL+CGGAPKGA+ ++++G FMGALNTCGRI I DPNP W M
Sbjct  275   GSAVLLPLRNLQGPAIQAEVLVCGGAPKGAYASAQKGDFMGALNTCGRISINDPNPQWVM  334

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP+AR+MGDM+ LPNG++L+INGA+ G+AG+  GRNPV +PV+Y  +  +G+RFE+ N
Sbjct  335   ETMPLARVMGDMLLLPNGHVLMINGASAGTAGWEYGRNPVLSPVIYQPNKTIGSRFEVQN  394

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS IPRMYHS+AILLRD RVLVGGSNPH  Y F  G L+PTEL LEAFSP YLD   AG+
Sbjct  395   PSTIPRMYHSSAILLRDGRVLVGGSNPHMLYNF-TGVLYPTELSLEAFSPSYLDPGVAGL  453

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S S+ GYG+ + I+F+ +G + GNLVTVTM APSF THSFS +QRLL L GG
Sbjct  454   RPRIISPVSQSQIGYGRQLVIRFSVSGQLKGNLVTVTMAAPSFNTHSFSMNQRLLVL-GG  512

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLF-VVHKGIPSEGIWIQM  1678
               VK  G +TY    +TP + +L+P G+Y+LF VVH+ IPS+GIW+ +
Sbjct  513   DNVKIAGNSTYQTAVLTPSTSSLAPPGFYLLFVVVHQDIPSQGIWVHL  560



>ref|XP_010061250.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
 gb|KCW68173.1| hypothetical protein EUGRSUZ_F01844 [Eucalyptus grandis]
Length=551

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/522 (67%), Positives = 410/522 (79%), Gaps = 4/522 (1%)
 Frame = +2

Query  113   GGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDC  292
             GGGRW+LL  +IG++AMHMQLL+ND VVIFDRTDFG SN+ L  G+CR DP +  +K+DC
Sbjct  33    GGGRWQLLQRSIGVSAMHMQLLHNDVVVIFDRTDFGKSNLSLPNGKCRNDPRDTALKIDC  92

Query  293   TAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKC  472
             TAHS+EYDVA N+ RPLMVQTDVWCSS +VMPDG LIQTGG+NDG+  +R+FNPC+   C
Sbjct  93    TAHSIEYDVASNSFRPLMVQTDVWCSSGSVMPDGRLIQTGGFNDGERRIRIFNPCSG--C  150

Query  473   DWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETND  652
             DW E+ N L   RWYATNHILP+G QII+GGR +FNYEFYPKT G   +YNLPFLA+TND
Sbjct  151   DWQEVENGLSARRWYATNHILPNGLQIIVGGRGQFNYEFYPKT-GAPKVYNLPFLAQTND  209

Query  653   PGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVL  832
                ENNLYP+V LNVDG+LFIFANN+AIL+DY    VV+ YPAMP G PR+YPSTGS+VL
Sbjct  210   ANIENNLYPFVHLNVDGNLFIFANNRAILFDYAHGKVVKTYPAMPGGDPRNYPSTGSSVL  269

Query  833   LPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPM  1012
             LPLKNLQAP   AEVL+CGGAP+G++  + +G F+GAL TCGRI+ITDP P W METMP 
Sbjct  270   LPLKNLQAPVKEAEVLVCGGAPRGSYIKATKGNFVGALTTCGRIKITDPAPQWVMETMPK  329

Query  1013  ARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIP  1192
              R+MGDM  LPNGN+LIINGAA G+AG+  GRNPV  PVLY  DNP G RFE+ NPS IP
Sbjct  330   PRVMGDMTLLPNGNVLIINGAAVGTAGWEIGRNPVFNPVLYRPDNPTGNRFELQNPSSIP  389

Query  1193  RMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHIT  1372
             RMYHSTAILLRD RVLVGGSNPH  Y F    LFPTEL LEAFSPPYLDA    +RP I 
Sbjct  390   RMYHSTAILLRDGRVLVGGSNPHVTYAF-TSVLFPTELSLEAFSPPYLDAQYNNLRPRII  448

Query  1373  LPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKP  1552
              P S +  GYG  + ++F+  G V  + VTVTMVAPSFTTHSFS +QRLL +G G  V  
Sbjct  449   SPASQAGIGYGMKLLVRFSVVGAVSASRVTVTMVAPSFTTHSFSMNQRLLVIGDGRGVTA  508

Query  1553  VGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             VG + Y + AVTPG+  L+PAGYY+LFVVH+ +PSEGIWI++
Sbjct  509   VGKSVYEVEAVTPGTRTLAPAGYYLLFVVHQDVPSEGIWIRV  550



>ref|XP_006342233.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/535 (64%), Positives = 416/535 (78%), Gaps = 5/535 (1%)
 Frame = +2

Query  80    PWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQ  259
             P  RN  A AAGGGRW+LL+ NIGI++MHMQLLNND+VV++DRTDFG SNI L  G+CR 
Sbjct  22    PRHRNS-AYAAGGGRWDLLMSNIGISSMHMQLLNNDRVVMYDRTDFGASNISLPNGKCRN  80

Query  260   DPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVV  439
             +  ++ +KVDCTAHSVEYDV+ N+VRPLMVQTDVWCSS +   DGTL+QTGG+NDG++VV
Sbjct  81    NTNDLTLKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGENVV  140

Query  440   RVFNPCNDKK--CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGD  613
             RV  PCN  K  CDW EI  AL + RWYATNH+LPDGRQIIIGGRE FNYEFYPKT   +
Sbjct  141   RVLKPCNGNKSTCDWKEIEGALIQSRWYATNHVLPDGRQIIIGGREAFNYEFYPKTLSTN  200

Query  614   LLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDG  793
              ++NL FL +TND   ENNLYP+VFLNVDG+LFIFANN+AIL+DY +  +V+ YP +P G
Sbjct  201   NIFNLTFLQQTNDLREENNLYPFVFLNVDGNLFIFANNRAILFDYTRDIIVKTYPQIPGG  260

Query  794   QPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRIT  973
              PR+YPSTGSAVLLPLKNL+A  I AEVL+CGG   G+F  ++RG F+GALNTCGRI IT
Sbjct  261   DPRNYPSTGSAVLLPLKNLEAQIIQAEVLVCGGTKNGSFLRAQRGNFLGALNTCGRITIT  320

Query  974   DPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV  1153
             DPNP W METMP+AR+MGDMV LPNGN+LIINGA  G+AG+  GRNPV +PV+Y  DNPV
Sbjct  321   DPNPQWIMETMPLARIMGDMVILPNGNVLIINGATAGTAGWELGRNPVLSPVIYRPDNPV  380

Query  1154  GTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPY  1333
              +RF++ N S IPRMYHST +LLRD RVLV GSNPH  Y F  G L+PTEL LEAFSP Y
Sbjct  381   NSRFDVQNSSTIPRMYHSTTVLLRDGRVLVSGSNPHGLYNF-TGVLYPTELSLEAFSPSY  439

Query  1334  LDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQ  1513
             LD+ +  +RP +  P S  K  YG  + I+F   GP++ NLV VTMVAP F THSF+ +Q
Sbjct  440   LDSESVNLRPRVVSPSSRRKVKYGGQVNIRFIIPGPINRNLVKVTMVAPGFNTHSFTMNQ  499

Query  1514  RLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             R+L+L  G  V  VG +T+ + ++ P S  L+P GYYMLFVVH+ IPSEGIWI++
Sbjct  500   RILELSSGN-VTQVGTSTFKINSIFPNSSKLAPPGYYMLFVVHQDIPSEGIWIRI  553



>ref|XP_004252835.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=570

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/526 (66%), Positives = 413/526 (79%), Gaps = 7/526 (1%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCT  295
             GG W +LL +IGI+AMHMQLLNND+VV+FDRTDFG+SNI L  G+CR D  +  +KVDCT
Sbjct  46    GGSWNVLLSDIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPDGKCRYDQNDTTLKVDCT  105

Query  296   AHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK--  469
             AHSVEY+VA N++RPLMVQTDVWCSS +V PDG+L+QTGG+NDGD VVRV+ PC++    
Sbjct  106   AHSVEYNVASNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGDKVVRVYKPCSNSTTN  165

Query  470   --CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW EI   L + RWY+TNHILPDGRQIIIGGR  FNYEFYPK+   +  Y+LPFL +
Sbjct  166   STCDWEEIQGGLIQRRWYSTNHILPDGRQIIIGGRRAFNYEFYPKSASANNSYSLPFLVK  225

Query  644   TNDPGA-ENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             TNDP   ENNLYP+VFLNVDG+LFIFANN+AIL+DY+K+ V++ YP +P G PR+YPSTG
Sbjct  226   TNDPNKIENNLYPFVFLNVDGNLFIFANNRAILFDYMKNVVLKNYPEIPGGDPRNYPSTG  285

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             SA+LLPLKNLQA  I AEVL+CGGAPKG++ ++  G F GAL+TCGRI ITDPNP W ME
Sbjct  286   SAILLPLKNLQAQEIQAEVLVCGGAPKGSYTSALNGNFSGALSTCGRITITDPNPQWIME  345

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP+AR MGDMV LPNGN+LIINGAA G+AG+  GR+PV  PV+Y  DNP  +RFEI NP
Sbjct  346   TMPLARTMGDMVILPNGNVLIINGAATGTAGWECGRDPVLKPVIYRPDNPFDSRFEIQNP  405

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTA+LLRD RVLVGGSNPH  Y F  G  FPTEL LEAFSPPYLD+ +  +R
Sbjct  406   STIPRMYHSTAVLLRDGRVLVGGSNPHIYYNF-TGVFFPTELSLEAFSPPYLDSVSEYLR  464

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P IT P S    GYG+ + I+F  AG VD NLVTVTMVAP F THSF+ +QRLL L    
Sbjct  465   PQITSPASQHAIGYGQRVPIRFKVAGRVDINLVTVTMVAPGFNTHSFTMNQRLLVL-VSE  523

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              VK +G N Y +  VTP +  L+P GYY+LFVVH+ IPSEGIW+++
Sbjct  524   NVKLIGKNAYQINVVTPNNAKLAPPGYYLLFVVHQDIPSEGIWVKI  569



>ref|XP_011069751.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=560

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/539 (64%), Positives = 415/539 (77%), Gaps = 6/539 (1%)
 Frame = +2

Query  77    PPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCR  256
             P     +  AA GGG+W LLL +IG++AMHMQLLN D+VVIFDRTDFG SNI L    CR
Sbjct  22    PCQQNTLTLAAPGGGKWNLLLSDIGVSAMHMQLLNTDRVVIFDRTDFGPSNISLPNNHCR  81

Query  257   QDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHV  436
              DP ++++KVDCTAHSVEYDVA N++RPL V TDVWCSS +VMPDG+L+QTGG+NDGD  
Sbjct  82    NDPNDLMLKVDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSVMPDGSLMQTGGFNDGDRN  141

Query  437   VRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDL  616
             VRV+ PC D  CDW E    L + RWYATNHILPDGRQII+GGR +F+YEFYPK  G D 
Sbjct  142   VRVYKPCGDNSCDWQEFDAVLRQRRWYATNHILPDGRQIIVGGRGQFSYEFYPKKAGADQ  201

Query  617   LYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQ  796
              YNLPFL++TNDP  ENNLYP+VFLNVDG+LFIFANN+AIL+DY    VVR YP +P G 
Sbjct  202   SYNLPFLSQTNDPRIENNLYPFVFLNVDGNLFIFANNRAILFDYTNGVVVRNYPTIPGGD  261

Query  797   PRSYPSTGSAVLLPLKNLQA-PGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRIT  973
             PRSYPS+GSAVLLPL++LQA   + AEVL+CGGAPKG+F ++  G F+GALN+CGRIRIT
Sbjct  262   PRSYPSSGSAVLLPLRDLQAGSNVTAEVLVCGGAPKGSFTSANNGKFVGALNSCGRIRIT  321

Query  974   DPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV  1153
             DPNP W METMP+AR+MGDMV LPNGN+LIINGA+ G+AG+  GR+PV TP++Y  +NPV
Sbjct  322   DPNPQWVMETMPLARVMGDMVLLPNGNVLIINGASTGTAGWDLGRDPVLTPLIYRPNNPV  381

Query  1154  GTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPY  1333
             G RFE  N + IPRMYHSTAILLRD R+LV GSNPH  Y F  G LFPT+L +E FSP Y
Sbjct  382   GLRFEAQNSTSIPRMYHSTAILLRDGRILVSGSNPHAYYNF-TGVLFPTDLTMETFSPDY  440

Query  1334  LDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQ  1513
             LD     +RP I  P SHS+  YG+ + I FTA G ++   +TVTMVAP FTTHSFS +Q
Sbjct  441   LDPRLVRVRPRIVSPASHSQIEYGQQLVINFTAQGRINRGFITVTMVAPPFTTHSFSMNQ  500

Query  1514  RLLDL----GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             RLL L    G   +V P+G + Y +  +TPGS  L+P GYY+LFVV++ +PS+GIWIQ+
Sbjct  501   RLLVLTNRTGISASVTPLGRSNYQVRVMTPGSNILAPPGYYLLFVVYREVPSQGIWIQI  559



>ref|XP_007225625.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
 gb|EMJ26824.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
Length=546

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/524 (65%), Positives = 408/524 (78%), Gaps = 4/524 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W LL  NIGI+AMHMQLL+ND+VV+FDRTDFG SN+ L  G+CR DP + V+KVD
Sbjct  27    AAGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPEGQCRNDPNDTVLKVD  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYD   N+ RPLMVQTDVWCSS +V  DG+LIQTGG+NDG+  VR+F  C    
Sbjct  87    CTAHSAEYDAPTNSFRPLMVQTDVWCSSGSVAQDGSLIQTGGFNDGERRVRIFQSCTG--  144

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW E  N L   RWYATNHILPDGRQIIIGGR +FNYEFYPK+     +++LPFL +TN
Sbjct  145   CDWKEYDNGLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKSESSSNVHSLPFLVQTN  204

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             DP  ENNLYP+VFLNVDG+LFIFANN+AIL+DY+K+ VV+ YP +P G+PRSYPSTGSAV
Sbjct  205   DPKVENNLYPFVFLNVDGNLFIFANNRAILFDYVKNVVVKTYPQIPGGEPRSYPSTGSAV  264

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNLQA  + AEVL+CGGAPKG++  +  G F+ AL TCGRI+ITDPNP W +ETMP
Sbjct  265   LLPLKNLQAQFVEAEVLVCGGAPKGSYAKAVNGTFVEALKTCGRIKITDPNPQWVVETMP  324

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM  LP+G +LIINGAA G+AG+  GRNPV  PV+Y  DN VG+RFE  NP+ I
Sbjct  325   QARVMGDMTLLPDGTVLIINGAAVGTAGWEFGRNPVLNPVIYRPDNAVGSRFEQQNPTTI  384

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTA+LLRD RVLVGGSNPH  Y F N  LFPTELRLE+F+P YLDA +  +RP I
Sbjct  385   PRMYHSTAVLLRDGRVLVGGSNPHIYYEFTN-VLFPTELRLESFNPDYLDAKSVNLRPKI  443

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S +K  YG+ + ++F+ AG V  NLV VTMVAPSFTTHSFS +QRLL L       
Sbjct  444   VAPQSQAKINYGQKLAVRFSVAGTVAPNLVLVTMVAPSFTTHSFSMNQRLLVLAAESATN  503

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              V  +TY +   TPGSGNL+P+GYY+L+VVH+ IPSEGIW+Q++
Sbjct  504   -VAKSTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQIL  546



>ref|XP_009794042.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=553

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/526 (65%), Positives = 407/526 (77%), Gaps = 3/526 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A+A GG+W LL+PNIGI+AMHMQLLNNDKVVIFDRTDFG SNI L  G+CR DP +  ++
Sbjct  29    ASAAGGKWNLLMPNIGISAMHMQLLNNDKVVIFDRTDFGHSNISLPYGKCRNDPNDTTLQ  88

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-  460
             +DCTAHSVEY+   N++RPLMVQTDVWCSS AV PDG+L+QTGG+NDG+ VVRVF PCN 
Sbjct  89    IDCTAHSVEYNTVTNSIRPLMVQTDVWCSSGAVFPDGSLVQTGGFNDGEKVVRVFKPCNG  148

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
             +  CDW EI   L + RWYATNHILPDGRQI+IGGR  FNYEFYPK       Y+LPFL 
Sbjct  149   NNTCDWQEIQGGLAQRRWYATNHILPDGRQIVIGGRRAFNYEFYPKPASAYKAYSLPFLV  208

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             +TND   ENNLYP+VFLNVDG+LFIFANN+AIL+DY K+ VV+ +P +P G PRSYPSTG
Sbjct  209   QTNDLKIENNLYPFVFLNVDGNLFIFANNRAILFDYTKNVVVKNFPQIPGGDPRSYPSTG  268

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             SAVLLPLKNLQ   I AEVL+CGGAPKG++ +++ G F+ AL TCGRI ITDPNP W ME
Sbjct  269   SAVLLPLKNLQTQQIQAEVLVCGGAPKGSYISAQNGNFLAALTTCGRIGITDPNPQWTME  328

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP+AR MGDM+ LPNGN+LII+GAA G+AG+  GR+PV  PV+Y  DNP  +RFEI NP
Sbjct  329   NMPLARTMGDMLILPNGNVLIISGAATGTAGWELGRDPVLKPVIYRPDNPFSSRFEIQNP  388

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTA LLRD RVL+GGSNPH  Y F  G LFPTEL LEAFSP YLD  +  +R
Sbjct  389   STIPRMYHSTATLLRDGRVLIGGSNPHIYYNF-TGVLFPTELSLEAFSPSYLDPESEYLR  447

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P S    GYG+ + ++F  +G V+ NLVTVTMVAP F THSF+Q+QRLL L    
Sbjct  448   PQIISPASQYTIGYGQRVPVRFKVSGRVNRNLVTVTMVAPGFNTHSFTQNQRLLVLASEN  507

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              VK +G   Y +  VTP S  L+P GYY+LFVVH+ IPSEGIW+++
Sbjct  508   -VKLLGEKAYQINVVTPNSATLAPPGYYLLFVVHQDIPSEGIWVKI  552



>ref|XP_010061025.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
Length=565

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/521 (67%), Positives = 401/521 (77%), Gaps = 4/521 (1%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RW+LL  NIGI AMHMQLL+ND+VVI+DRTDFG SN+ L  G+CR DP E VV  DCTAH
Sbjct  46    RWQLLQSNIGIVAMHMQLLHNDRVVIYDRTDFGKSNLSLPDGKCRHDPSEAVVVDDCTAH  105

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWV  481
             SVEYDVA N+ RPLMVQTDVWCSS AV  DGTL+QTGG+NDG+  VR F PC+D++CDW 
Sbjct  106   SVEYDVASNSFRPLMVQTDVWCSSGAVTSDGTLVQTGGYNDGERQVRTFAPCSDRRCDWQ  165

Query  482   EIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGA  661
             EI N L   RWYATN ILPDGRQI+IGGR +FNYEFYPK+     +Y+LPFL +TNDPG 
Sbjct  166   EIRNGLAARRWYATNQILPDGRQIVIGGRRQFNYEFYPKSSSAPNVYSLPFLVQTNDPGL  225

Query  662   ENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPL  841
             ENNLYP+V LNVDG+LFIFANN+AIL+DY+   VVR YP MP G PR YPSTGS+VLLPL
Sbjct  226   ENNLYPFVHLNVDGNLFIFANNRAILFDYVNQKVVRTYPTMPGGDPRCYPSTGSSVLLPL  285

Query  842   KNLQAP--GIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMA  1015
             K    P   + AEVL+CGGAPKGAF  +  G F+GALNTCGRI+ITDPNP W METMP A
Sbjct  286   KTAGRPTGNVEAEVLVCGGAPKGAFKQASGGKFLGALNTCGRIKITDPNPQWAMETMPGA  345

Query  1016  RLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPR  1195
             R MGDMV LPNG++LIING A G+AG+  GRNPV  PV+Y  D P G RF + +PSGIPR
Sbjct  346   RAMGDMVLLPNGDVLIINGVAAGTAGWEFGRNPVLNPVIYKPDGPAGGRFALQDPSGIPR  405

Query  1196  MYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITL  1375
             +YHSTA+LLRD RVLVGGSNPH  Y F  G +FPTELRLEAF PPYLD   +G RP I  
Sbjct  406   VYHSTAVLLRDGRVLVGGSNPHIFYNF-TGVIFPTELRLEAFRPPYLDPEHSGSRPRIIY  464

Query  1376  PGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPV  1555
             P S +K GY +   ++FT  G V  + V VTMVAP F THSFS +QRLL +G G  VK V
Sbjct  465   PTSQAKIGYSQKFSVRFTVTGNVSLDAVAVTMVAPPFNTHSFSMNQRLLVIGSGTVVK-V  523

Query  1556  GINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             G + Y   AV PGS NL+PAGYY+LFVVH+GIPSEGIW+Q+
Sbjct  524   GNSAYAAQAVAPGSHNLAPAGYYLLFVVHQGIPSEGIWVQI  564



>ref|XP_007017716.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14941.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/549 (63%), Positives = 417/549 (76%), Gaps = 7/549 (1%)
 Frame = +2

Query  32    TLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRT  211
             T +F++    L+ A  P+  ++   +A  GRW+LL  +IG++AMHMQLL ND+VV+FDRT
Sbjct  4     TFIFSILLFQLLFASQPY--HLILISAADGRWQLLQKSIGVSAMHMQLLRNDRVVMFDRT  61

Query  212   DFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPD  391
             DFG SN+PL  G+CR DP +  +KVDCTAHSVEYDV  N  R LMVQTDVWCSS A+MPD
Sbjct  62    DFGKSNLPLPNGKCRTDPNDTALKVDCTAHSVEYDVLTNKFRALMVQTDVWCSSGAIMPD  121

Query  392   GTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             G L+QTGG+NDG+  VRVF+PC+   CDW EIPN L   RWYATNHILPDGRQI++GGR 
Sbjct  122   GNLVQTGGFNDGERRVRVFSPCS--TCDWQEIPNGLAAKRWYATNHILPDGRQIVVGGRR  179

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             +FNYEF PK    +  +NLPFL+ETND G ENNLYP+VFLNVDG+LFIFANN+AIL DY+
Sbjct  180   QFNYEFVPKNVAANT-FNLPFLSETNDRGVENNLYPFVFLNVDGNLFIFANNRAILLDYV  238

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
              + VV+ YP +P G PRSYPSTGSAVLLPLKNL+AP I AEVL+CGGAPKG++  + RG 
Sbjct  239   NNKVVKTYPTIPGGDPRSYPSTGSAVLLPLKNLKAPAIQAEVLVCGGAPKGSYLEALRGK  298

Query  932   FMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRN  1111
             F+ AL TC R+ ITDPNP W METMPMAR+M DM+ LPNG +LIINGA  GSAG+  GRN
Sbjct  299   FIAALKTCARMTITDPNPQWVMETMPMARVMSDMILLPNGKVLIINGAGSGSAGWELGRN  358

Query  1112  PVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGAL  1291
             PV +P LY  DN +G+RF+   P+ IPRMYHSTA+LLRD RVLVGGSNPH  Y F  G L
Sbjct  359   PVLSPALYLPDNKIGSRFQAQTPTTIPRMYHSTAVLLRDGRVLVGGSNPHTFYNF-TGVL  417

Query  1292  FPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTM  1471
             FPTEL LEAFSP YLDA    +RP I  P S S+  YGK + +Q    G V  NLV+VTM
Sbjct  418   FPTELSLEAFSPAYLDAKFNNLRPTIVAPKSSSEIQYGKKLTVQVLITGKVAPNLVSVTM  477

Query  1472  VAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGI  1651
             VAPSFTTHSFS +QR+L L G   V  +  +TY++   TP S NL+PAG+Y+LFVVH+ I
Sbjct  478   VAPSFTTHSFSMNQRVLVL-GNDKVTALEKSTYNIDVTTPRSANLAPAGFYLLFVVHQDI  536

Query  1652  PSEGIWIQM  1678
             PS+GIW+++
Sbjct  537   PSQGIWVKL  545



>ref|XP_002280559.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=553

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/552 (63%), Positives = 420/552 (76%), Gaps = 9/552 (2%)
 Frame = +2

Query  23    RNFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIF  202
             R     F  WQL    AP P  R +  AA  GG W+LLL NIGI AMHMQLL+ND+VVIF
Sbjct  10    RTLIFPFLCWQLLF--APGPCCRVLTHAA--GGEWQLLLKNIGITAMHMQLLHNDRVVIF  65

Query  203   DRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAV  382
             DRTDFG SN+ L  G+CR DP + V+ +DCTAHSVEYDVA N++R LMVQTDVWCSS AV
Sbjct  66    DRTDFGKSNLSLPDGKCRNDPNDTVLPIDCTAHSVEYDVATNSIRALMVQTDVWCSSGAV  125

Query  383   MPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIG  562
             M +G LIQTGG+NDGD VVR+F PC+   CDW E+P  L   RWYATNHILPD RQI+IG
Sbjct  126   MANGNLIQTGGFNDGDRVVRIFKPCS--SCDWEEVPFGLAARRWYATNHILPDDRQIVIG  183

Query  563   GREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILY  742
             GR +FNYEFYPKT      Y+LPFLA+TND G ENNLYP+V+L+ DG+LFIF+NN+AIL+
Sbjct  184   GRRQFNYEFYPKTGAASNAYSLPFLAQTNDRGIENNLYPFVYLHTDGNLFIFSNNRAILF  243

Query  743   DYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASE  922
             DY K+ VV+ +P +P G PR YPSTGSAV+LPL NLQA  I  EVL+CGGAP G++  + 
Sbjct  244   DYAKNVVVKTFPTIPGGDPRCYPSTGSAVMLPL-NLQASSIEVEVLVCGGAPTGSYTQAS  302

Query  923   RGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGD  1102
             +G F+GAL TC RI+ITD +P W METMP+AR+MGDM  LPNG++LIINGA+ G+AG+ +
Sbjct  303   KGNFVGALKTCARIKITDSSPQWVMETMPLARVMGDMTLLPNGDVLIINGASAGTAGWEN  362

Query  1103  GRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGN  1282
             GR+PV  PVLY  D P G+RFE++NP+ IPRMYHSTAILLRD RVLVGGSNPH  Y F  
Sbjct  363   GRDPVLKPVLYKPDKPTGSRFEVMNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYKF-T  421

Query  1283  GALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVT  1462
             G L+PTELRLEAFSP YLD+    +RP I  P S +K GYGK + ++F+  G +D + V+
Sbjct  422   GVLYPTELRLEAFSPEYLDSGFKNLRPTIISPTSQAKIGYGKDLTVRFSVTGTLDPDTVS  481

Query  1463  VTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVH  1642
             VTM+APSFTTHS S +QRLL LG G  VK    +T+ +   TP S  L+P+GYY+LFVVH
Sbjct  482   VTMLAPSFTTHSLSMNQRLLVLGSGN-VKNAEKSTFAIAVTTPASAILAPSGYYVLFVVH  540

Query  1643  KGIPSEGIWIQM  1678
             +GIPSEGIW+Q+
Sbjct  541   QGIPSEGIWVQI  552



>ref|XP_002510488.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF52675.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=547

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/523 (65%), Positives = 404/523 (77%), Gaps = 4/523 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GGRW+LL  NIGI AMHMQLLNND+VVIFDRTDFGLSN+ L  G+CR+DP E+V+K D
Sbjct  28    AAGGRWQLLQENIGITAMHMQLLNNDRVVIFDRTDFGLSNLSLPNGKCRKDPTELVLKTD  87

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHSVEYDV  N +R LMVQT+VWCSS AVMPDG+LIQTGG+NDG+  VR F+PC+   
Sbjct  88    CTAHSVEYDVLSNQIRALMVQTNVWCSSGAVMPDGSLIQTGGFNDGERKVRTFDPCS--S  145

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDWVE+ + L   RWYATNHILPDG+QIIIGGR +FNYEFYPK+   D+ Y+L FL ETN
Sbjct  146   CDWVELGDGLKARRWYATNHILPDGKQIIIGGRRQFNYEFYPKSAAPDV-YSLRFLVETN  204

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D   ENNLYP+VFLNVDG+LFIFANN+AI++DY    VV+ YP +P G PRSYPSTGSAV
Sbjct  205   DRNIENNLYPFVFLNVDGNLFIFANNRAIMFDYKVAKVVKTYPTIPGGDPRSYPSTGSAV  264

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             +LPLKN QA  I AEVL+CGGAPKG++  + +G F+ AL+TCGR++ITD NP W +ETMP
Sbjct  265   MLPLKNSQAENIEAEVLVCGGAPKGSYTEAMKGNFVKALDTCGRMKITDANPQWTIETMP  324

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM+ LPNGN++I+NG   G+AG+  GRNPV  PVLY  DN +G+RFE  NPS I
Sbjct  325   EARVMGDMIFLPNGNVIIVNGGGAGTAGWEYGRNPVLNPVLYKPDNAIGSRFESQNPSTI  384

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH NY F     FPTELRLEAFSP YLD A   +RP I
Sbjct  385   PRMYHSTAILLRDGRVLVGGSNPHINYNFSKDVFFPTELRLEAFSPAYLDTANNNLRPTI  444

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S S+ GY + + ++F   G +  N V+VTMVAPSFTTHSFS +QRLL L     V 
Sbjct  445   ISPASKSRLGYAQKLAVRFKVTGRLTENTVSVTMVAPSFTTHSFSMNQRLLVL-DNEKVT  503

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              VG  TY +    P S NL+P G+Y+LFVVH+ IPSEGIW+Q+
Sbjct  504   DVGTGTYDVQVTAPRSTNLAPPGFYLLFVVHEDIPSEGIWVQV  546



>ref|XP_011069718.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/530 (64%), Positives = 413/530 (78%), Gaps = 6/530 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             AA GGG+W LLL NIG++AMHMQLLN D+V+IFDRTDFG SNI L   +CR DP ++ +K
Sbjct  33    AAPGGGKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPNNQCRNDPNDLTLK  92

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHSVEYDVA N++RPL V TDVWCSS + MPDG+L+QTGG+NDGD  VRV+ PC+D
Sbjct  93    VDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDRNVRVYKPCSD  152

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E   AL + RWYATNHILPDGRQII+GGR +F+YEFYPK  G D  YNLPFL++
Sbjct  153   DSCDWQEFDVALRQRRWYATNHILPDGRQIIVGGRGQFSYEFYPKKAGADQSYNLPFLSQ  212

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TNDP  ENNLYP+VFLN DG+LFIFANN+AIL+DY+   VVR YP +P G PRSYPS+GS
Sbjct  213   TNDPRIENNLYPFVFLNTDGNLFIFANNRAILFDYVNGLVVRNYPTIPGGDPRSYPSSGS  272

Query  824   AVLLPLKNLQ-APGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPL++LQ    + AEVL+CGGAPKG+F ++  G F+GALN+CGRIRI+DPNP W ME
Sbjct  273   AVLLPLRDLQGGANVTAEVLVCGGAPKGSFTSANNGNFVGALNSCGRIRISDPNPQWVME  332

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP+AR+MGDMV LPNGNILIINGA+ G+AG+  GRNPV TPV+Y  +NPVG RFE  N 
Sbjct  333   TMPLARVMGDMVLLPNGNILIINGASSGTAGWDLGRNPVFTPVIYRPNNPVGLRFEAQNS  392

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTAILLRD R+LV GSNPH  Y F  G +FPT+L +EAFSP YLD     +R
Sbjct  393   SSIPRMYHSTAILLRDGRILVSGSNPHAYYNF-TGVVFPTDLTMEAFSPDYLDPRLIRVR  451

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL----  1528
             P I  P SHS+ GYG+ + I F A G ++   +TVTMVAP FTTHSFS +QRLL L    
Sbjct  452   PMIVSPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTTHSFSMNQRLLVLTNST  511

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             G   +V  +G + Y +  +TPGS  L+P GYY+LFVV++ +PS+GIW+Q+
Sbjct  512   GISASVTSLGGSNYQVRVMTPGSNILAPPGYYLLFVVYREVPSQGIWVQI  561



>ref|XP_011069750.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/530 (64%), Positives = 412/530 (78%), Gaps = 6/530 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             AA GGG+W LLL NIG++AMHMQLLN D+V+IFDRTDFG SNI L   +CR DP ++ +K
Sbjct  33    AAPGGGKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPNNQCRNDPNDLTLK  92

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHSVEYDVA N++RPL V TDVWCSS + MPDG+L+QTGG+NDGD  VRV+ PC+D
Sbjct  93    VDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDRNVRVYKPCSD  152

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E   AL + RWYATNHILPDGRQII+GGR +F+YEFYPK  G D  YNLPFL++
Sbjct  153   DSCDWQEFDVALRQRRWYATNHILPDGRQIIVGGRGQFSYEFYPKKAGADQSYNLPFLSQ  212

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TNDP  ENNLYP+VFLN DG+LFIFANN+AIL+DY+   VVR YP +P G PRSYPS+GS
Sbjct  213   TNDPRIENNLYPFVFLNTDGNLFIFANNRAILFDYVNGLVVRNYPTIPGGDPRSYPSSGS  272

Query  824   AVLLPLKNLQ-APGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPL++LQ    + AEVL+CGGAPKG+F ++  G F+GALNTCGRIRI+DPNP W ME
Sbjct  273   AVLLPLRDLQGGANVTAEVLVCGGAPKGSFTSANNGNFVGALNTCGRIRISDPNPQWAME  332

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP+AR+MGDMV LPNGNILIINGA+ G+AG+  GRNPV TPV+Y  +NPVG RFE  N 
Sbjct  333   TMPLARVMGDMVLLPNGNILIINGASSGTAGWDFGRNPVLTPVIYRPNNPVGLRFEAQNS  392

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTAILLRD R+LV GSNPH  Y F  G +FPT+L +EAFSP YLD+    +R
Sbjct  393   SSIPRMYHSTAILLRDGRILVSGSNPHAYYNF-TGVVFPTDLTIEAFSPDYLDSRLIRVR  451

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL----  1528
             P I  P SHS+ GYG+ + I F A G ++   +TVTMVAP FTTHSFS +QRLL L    
Sbjct  452   PMIVSPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTTHSFSMNQRLLVLTNST  511

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             G   +V  +G + Y +   TP S  L+P GYY+LFVV++ +PS+GIW+Q+
Sbjct  512   GISASVTSLGGSNYQVRVRTPSSNILAPPGYYLLFVVYREVPSQGIWVQI  561



>gb|AET97563.1| galactose oxidase [Ziziphus jujuba]
Length=545

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/551 (63%), Positives = 417/551 (76%), Gaps = 12/551 (2%)
 Frame = +2

Query  29    FTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDR  208
              + LF L   F  A PP     +FA AAGG +W+LL  +IGI+AMHMQLLNND+VVIFDR
Sbjct  7     LSFLFLLPHFF--AGPP-----LFADAAGG-QWQLLQKSIGISAMHMQLLNNDRVVIFDR  58

Query  209   TDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMP  388
             TDFG SN+ L  G+CR DP + V+ VDCTAHS EYDVA NT RPL VQTDVWCSS  V P
Sbjct  59    TDFGPSNLSLPAGKCRNDPNDTVLTVDCTAHSAEYDVATNTFRPLTVQTDVWCSSGCVTP  118

Query  389   DGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGR  568
             DG LIQTGG+NDG+  VR++ PC    CDW EI   L   RWYATNHILPDGRQIIIGGR
Sbjct  119   DGRLIQTGGYNDGERRVRIYKPCTG--CDWQEIELGLAARRWYATNHILPDGRQIIIGGR  176

Query  569   EEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDY  748
              +FNYEFYPKT     +Y+LPFL +TNDP  ENNLYP+VFLN DG+LF+FANN+AIL DY
Sbjct  177   RQFNYEFYPKTASASNVYSLPFLVQTNDPKIENNLYPFVFLNTDGNLFVFANNRAILLDY  236

Query  749   IKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERG  928
             +K+ V++ YP +P G PRSYPSTGSAVLLPL+NL+A  I AEVL+CGGAPKG++  + + 
Sbjct  237   VKNKVLKTYPEIPGGDPRSYPSTGSAVLLPLENLKANFIEAEVLVCGGAPKGSYTEAIKR  296

Query  929   VFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGR  1108
              F+GAL TC RI+ITDPNP W +ETMP AR+MGDM  LPNGN+LIING A G+AG+  GR
Sbjct  297   NFIGALKTCARIKITDPNPQWVVETMPTARVMGDMTLLPNGNVLIINGGAAGTAGWELGR  356

Query  1109  NPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGA  1288
             NPV  PV+Y  +N VG+RFE  NPS IPRMYHSTAILLRD RVLVGGSNPH  Y F  G 
Sbjct  357   NPVLNPVIYKPNNAVGSRFESQNPSSIPRMYHSTAILLRDGRVLVGGSNPHVYYNF-TGV  415

Query  1289  LFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVT  1468
             +FPT+L LEAFSP YL+A  + +RP I  P S +K  Y + + ++FT  G V   LV+VT
Sbjct  416   IFPTDLSLEAFSPSYLEAQFSNLRPRIVSPTSQTKLAYAQKLAVRFTVTGTVATKLVSVT  475

Query  1469  MVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKG  1648
             MV+PSFTTHSFS +QRLL L G  +V+ +G  TY +   TP SGNL+P+GYY+LFVVH+ 
Sbjct  476   MVSPSFTTHSFSMNQRLLVL-GAESVRNLGKTTYEVQVTTPSSGNLAPSGYYLLFVVHQE  534

Query  1649  IPSEGIWIQMV  1681
             IPS GIW+Q+V
Sbjct  535   IPSLGIWVQIV  545



>ref|XP_008387970.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=547

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/524 (64%), Positives = 409/524 (78%), Gaps = 4/524 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W LL  NIGI AMH+QLL+ND+VVI+DRTDFG+SN+ L  G+CR+DP +  +K+D
Sbjct  28    AAGGKWVLLQQNIGITAMHLQLLHNDRVVIYDRTDFGMSNLSLPDGKCREDPNDTALKID  87

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHSVEYDV  N+ RPLMVQTDVWCSS ++ PDG LIQTGG+NDG+  VR++ PCN   
Sbjct  88    CTAHSVEYDVPTNSFRPLMVQTDVWCSSGSISPDGRLIQTGGFNDGERKVRIYEPCNG--  145

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW E  N L   RWYATNHILPDGRQIIIGGR +FNYEFYPK+     +Y+LPFL +TN
Sbjct  146   CDWKEYDNGLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKSASSSNVYSLPFLVQTN  205

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D   ENNLYP+VFLNVDG+LFIFANN+AIL+DY+K+ +V+ YP +P G PRSYPSTGSAV
Sbjct  206   DAKIENNLYPFVFLNVDGNLFIFANNRAILFDYVKNIIVKTYPQIPGGDPRSYPSTGSAV  265

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNLQA  + AEVL+CGGAPKG+   + +G F+ AL TCGRI+ITDPNP W +ETMP
Sbjct  266   LLPLKNLQAQLVEAEVLLCGGAPKGSHEKAVKGTFVEALKTCGRIKITDPNPQWVVETMP  325

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM  LP+G +LIINGAA G+AG+  GRNPV  PVLY  +N VG+RF   NP+ I
Sbjct  326   QARVMGDMTLLPDGTVLIINGAALGTAGWEFGRNPVLNPVLYQPNNAVGSRFMQQNPTTI  385

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH  Y F N  LFPTELRLEAF+P YLDA  A +RP I
Sbjct  386   PRMYHSTAILLRDGRVLVGGSNPHIYYEFKN-VLFPTELRLEAFNPDYLDAKYANLRPKI  444

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S     Y + + ++F+  G +  NLV+VTMVAPSFTTHSFS +QR+L L    +V 
Sbjct  445   VAPNSQGTITYAQKLAVRFSVTGTLATNLVSVTMVAPSFTTHSFSMNQRVLVL-AAESVT  503

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              V ++TY +   TPGSGNL+P+GYY+L+VVH+ IPSEGIW+Q++
Sbjct  504   NVALSTYQVLVTTPGSGNLAPSGYYLLYVVHQSIPSEGIWVQVL  547



>ref|XP_009797022.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/525 (63%), Positives = 420/525 (80%), Gaps = 3/525 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG+W+LL+ NIGI+AMH+QLLNND+V+++DRTDFG SNI L  G+CR +P ++ +K
Sbjct  29    AYAAGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGPSNISLPDGKCRNNPNDLALK  88

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHSVEYDV+ N+VRPLMVQTDVWCSS +V  DG+L+QTGG+NDG+H+VRV  PC+ 
Sbjct  89    VDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGEHMVRVVKPCS-  147

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ N L + RWY+TNHILPDGRQIIIGGR+ FNYEFYPKT     +++LPFL +
Sbjct  148   -TCDWQEMGNNLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTSNVFSLPFLQQ  206

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TN+P  ENNL+P+VFLNVDG+LFIFAN++AIL DY  + VV+ +P +P G PR+YPS+GS
Sbjct  207   TNNPREENNLFPFVFLNVDGNLFIFANDRAILLDYKTNTVVKTFPQIPGGDPRNYPSSGS  266

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLPLKNL++  + AEVL+CGGAP+G++P +++G F+GALNTCGRI ITDPNP W MET
Sbjct  267   AVLLPLKNLRSQTVQAEVLVCGGAPRGSYPKADKGEFLGALNTCGRITITDPNPQWTMET  326

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP+AR MGDMV LPNGN+LIINGAA G+AG+   RNPV +PV+Y  DNP  +RFE+ NP+
Sbjct  327   MPLARTMGDMVILPNGNVLIINGAASGTAGWQIARNPVLSPVIYRPDNPSDSRFEVQNPN  386

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHSTA+LLRD RVLVGGSNP+  Y F  G LFPT+L LEAFSP YLD  +A +RP
Sbjct  387   AIPRMYHSTAVLLRDGRVLVGGSNPNELYNF-TGVLFPTDLSLEAFSPSYLDQESANLRP  445

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I  P SH K+ YG+ ++I+FTA+G ++ +LV VTMVAP F THSF+ +QR+L L   G 
Sbjct  446   RIISPASHLKYTYGQRVDIRFTASGLLNTDLVKVTMVAPGFNTHSFTMNQRMLVLPRSGM  505

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             V+ VG   Y ++ V P SG  +P GYY+LFVVH+ IPSE IW+++
Sbjct  506   VRQVGRFVYQISCVFPKSGIFAPPGYYLLFVVHQDIPSEAIWVRI  550



>ref|XP_004238617.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=557

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/556 (61%), Positives = 429/556 (77%), Gaps = 6/556 (1%)
 Frame = +2

Query  20    RRNFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVI  199
             R++    F +WQL L+   P   RN+ A AA GG+W+LL+ NIGI+AMHMQLLN+D+VVI
Sbjct  4     RKSVIFCFIVWQLPLLLLLPCHDRNL-AYAAAGGKWDLLMSNIGISAMHMQLLNDDRVVI  62

Query  200   FDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAA  379
             +DRTDFG+SNI L  G+CR +  ++ +KVDCTAHSVEYDV+ N+VRPLM+QT+VWCSS +
Sbjct  63    YDRTDFGMSNISLPDGKCRNNNNDLALKVDCTAHSVEYDVSTNSVRPLMIQTNVWCSSGS  122

Query  380   VMPDGTLIQTGGWNDGDHVVRVFNPC---NDKKCDWVEIPNALHRWRWYATNHILPDGRQ  550
                DG+L+QTGG NDG  V+RV+ PC       CDW+EI N L + RWY+TNHILPDG Q
Sbjct  123   ATSDGSLVQTGGSNDGKFVIRVYRPCIIGKKSNCDWLEIENGLIQSRWYSTNHILPDGSQ  182

Query  551   IIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNK  730
             IIIGGR+ FNYEF+PKT   + ++NLPFL +TNDP  ENNLYP+VFLNVDG+LFIF NN+
Sbjct  183   IIIGGRDAFNYEFFPKTASTNNVFNLPFLQQTNDPREENNLYPFVFLNVDGNLFIFTNNR  242

Query  731   AILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF  910
             AIL+DY  + +V+ YP +P G PR+YPSTGSAVLLPLKNL+A  I AEVL+CGGAP+G++
Sbjct  243   AILFDYTTNMIVKTYPQIPGGDPRNYPSTGSAVLLPLKNLEAHTIQAEVLVCGGAPRGSY  302

Query  911   PASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSA  1090
               + RG F+GALNTCGRI ITDPNP W METMP+ R MGDMV LPNGN+LI+NGAA GSA
Sbjct  303   LKATRGEFIGALNTCGRITITDPNPQWTMETMPLPRTMGDMVILPNGNVLIVNGAAMGSA  362

Query  1091  GYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNY  1270
             G+   R PV +PV+Y  DN   +RFE+ NP+ IPRMYHSTA+LLRD RVLVGGSNP+  Y
Sbjct  363   GWEIARGPVLSPVIYRPDNLPDSRFEVQNPNAIPRMYHSTAVLLRDGRVLVGGSNPNEFY  422

Query  1271  VFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDG  1450
              F  G LFPTEL LEAFSP YLD+ +A +RP I  P S  KF +G+ ++IQF+ +G V+ 
Sbjct  423   NF-TGVLFPTELSLEAFSPSYLDSESAHLRPQIISPVSRHKFKHGQRVDIQFSISGLVNK  481

Query  1451  NLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYML  1630
             N + VTM+AP F THS + +QR+L L   G VK VG ++YHM  + P SG+L+P GYY+L
Sbjct  482   NSIKVTMIAPGFNTHSNTMNQRMLVL-TNGVVKQVGKSSYHMNCLFPKSGSLAPPGYYLL  540

Query  1631  FVVHKGIPSEGIWIQM  1678
             FVVH+ IPSEGIW+++
Sbjct  541   FVVHQDIPSEGIWVRI  556



>ref|XP_009797023.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/523 (63%), Positives = 419/523 (80%), Gaps = 3/523 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LL+ NIGI+AMH+QLLNND+V+++DRTDFG SNI L  G+CR +P ++ +KVD
Sbjct  31    AAGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGPSNISLPDGKCRNNPNDLALKVD  90

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHSVEYDV+ N+VRPLMVQTDVWCSS +V  DG+L+QTGG+NDG+H+VRV  PC+   
Sbjct  91    CTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGEHMVRVVKPCS--T  148

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW E+ N L + RWY+TNHILPDGRQIIIGGR+ FNYEFYPKT   + +++LPFL +TN
Sbjct  149   CDWQEMGNNLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTNNVFSLPFLQQTN  208

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             +P  ENNL+P+VFLNVDG+LFIFAN++AIL DY  + VV+ +P +P G PR+YPS+GSAV
Sbjct  209   NPREENNLFPFVFLNVDGNLFIFANDRAILLDYKTNTVVKTFPQIPGGDPRNYPSSGSAV  268

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL++  + AEVL+CGGAP+G++P +++G F+GALNTCGRI ITDPNP W METMP
Sbjct  269   LLPLKNLRSQTVQAEVLVCGGAPRGSYPKADKGEFLGALNTCGRITITDPNPQWTMETMP  328

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
             +AR MGDMV LPNGN+LIINGAA G+AG+   RNPV +PV+Y  DNP  +RFE+ NP+ I
Sbjct  329   LARTMGDMVILPNGNVLIINGAASGTAGWQIARNPVLSPVIYRPDNPSDSRFEVQNPNAI  388

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTA+LLRD RVLVGGSNP+  Y F  G LFPT+L LEAFSP YLD  +A +RP I
Sbjct  389   PRMYHSTAVLLRDGRVLVGGSNPNELYNF-TGVLFPTDLSLEAFSPSYLDQESANLRPRI  447

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P SH K+ YG+ ++I FTA+G ++ +LV VTMVAP F THSF+ +QR+L L   G V+
Sbjct  448   ISPASHLKYTYGQRVDILFTASGLLNRDLVKVTMVAPGFNTHSFTMNQRMLVLPRSGMVR  507

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              VG   Y ++ V P SG  +P GYY+LFVVH+ IPSE IW+++
Sbjct  508   QVGRFVYQISCVFPKSGIFAPLGYYLLFVVHQDIPSEAIWVRI  550



>ref|XP_011092656.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/530 (64%), Positives = 411/530 (78%), Gaps = 6/530 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             AA GGG+W L+L NIG++AMHMQLLN D+VVIFDRTDFG SNI L   +CR DP ++ +K
Sbjct  33    AAPGGGKWNLVLSNIGVSAMHMQLLNTDRVVIFDRTDFGPSNISLPNNQCRNDPNDLTLK  92

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHSVEYDVA N++RPL V TDVWCSS + MPDG+L+QTGG+NDGD  VRV+ PC+D
Sbjct  93    VDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDRNVRVYKPCSD  152

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E   AL + RWYATNHILPDGRQII+GGR +F YEFYPK  G D  YNLPFL++
Sbjct  153   DSCDWQEFDVALRQRRWYATNHILPDGRQIIVGGRGQFGYEFYPKKTGADQSYNLPFLSQ  212

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TNDP  ENNLYP+VFLN DG+LFIFANN+AIL+DY+   VVR YP +P G PRSYPS+GS
Sbjct  213   TNDPRIENNLYPFVFLNTDGNLFIFANNRAILFDYVNGLVVRNYPTIPGGDPRSYPSSGS  272

Query  824   AVLLPLKNLQ-APGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPL++LQ    + AEVL+CGGAPKG+F ++  G F+GALNTC RIRI+DPNP W ME
Sbjct  273   AVLLPLRDLQGGANVTAEVLVCGGAPKGSFTSANNGNFVGALNTCWRIRISDPNPQWVME  332

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP+AR+MGDMV LPNGNILIINGA+ G+AG+  GRNPV TPV+Y  +NPVG RFE  N 
Sbjct  333   TMPLARVMGDMVLLPNGNILIINGASSGTAGWDLGRNPVLTPVIYRPNNPVGLRFEAQNS  392

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTAILLRD R+LV GSNPH  Y F  G +FPT+L +EAFSP YLD     +R
Sbjct  393   STIPRMYHSTAILLRDGRILVSGSNPHAYYNF-TGVVFPTDLTMEAFSPDYLDPHLIRVR  451

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL----  1528
             P I  P SHS+ GYG+ + I F A G ++   +TVTMVAP FTTHSFS +QRLL L    
Sbjct  452   PMIVSPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTTHSFSMNQRLLVLTNST  511

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             G   +V  +G + Y +  +TPGS  L+P GYY+LFVV++ +PS+GIW+Q+
Sbjct  512   GISASVISLGGSNYQVRVMTPGSNILAPPGYYLLFVVYREVPSQGIWVQI  561



>ref|XP_011083592.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=550

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/531 (65%), Positives = 410/531 (77%), Gaps = 8/531 (2%)
 Frame = +2

Query  89    RNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPY  268
             RN+   AA G RW+LLL NIGI+AMHMQLL+ D+VV+FDRTDFG SNI L  G+CR+DP 
Sbjct  26    RNILTRAADG-RWDLLLSNIGISAMHMQLLHTDRVVMFDRTDFGPSNISLPDGKCRRDPN  84

Query  269   EVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVF  448
             + V+ VDCTAHSVEYDVA N++RPLMV TDVWCSS AVMPDGTL+QTGG+NDGDH +R++
Sbjct  85    DTVLPVDCTAHSVEYDVASNSIRPLMVLTDVWCSSGAVMPDGTLVQTGGFNDGDHAIRIY  144

Query  449   NPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNL  628
              PC +  CDW EI   L + RWYATNHILPDGRQI++GGR +FNYEFYPKT   D  YNL
Sbjct  145   EPCRNSTCDWREISRGLTQRRWYATNHILPDGRQIVVGGRRQFNYEFYPKTSSADGSYNL  204

Query  629   PFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSY  808
             PFL +TNDP  ENNLYP+VFLN DG+LFIFANN+AIL++Y+  +VVR YP MP G PRSY
Sbjct  205   PFLVQTNDPRIENNLYPFVFLNGDGNLFIFANNRAILFNYLNGSVVRTYPTMPGGDPRSY  264

Query  809   PSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPV  988
             PSTGSAVLLPLKN        EVL+CGGAPKGA+  +  G F+GALNTCGRIRI D NP 
Sbjct  265   PSTGSAVLLPLKN----NAETEVLVCGGAPKGAYVRANNGDFVGALNTCGRIRINDLNPQ  320

Query  989   WFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFE  1168
             W METMPM R+M DM+ LPNG +LIINGA  G+AG+  GR+PV  PV+Y  DNP+G+RFE
Sbjct  321   WVMETMPMGRVMSDMLLLPNGEVLIINGAGSGTAGWELGRSPVLAPVIYRPDNPIGSRFE  380

Query  1169  ILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAAT  1348
             + NPS  PRMYHSTA+LLRD RVLVGGSNPH  Y F  G LFPT+L L+AFSP YLD   
Sbjct  381   VQNPSSTPRMYHSTAVLLRDGRVLVGGSNPHTYYNF-TGVLFPTDLTLQAFSPRYLDPKL  439

Query  1349  AGIRPHITLPGSHSKFGYGKVIEIQFTA-AGPVDGNLVTVTMVAPSFTTHSFSQHQRLLD  1525
             + +RP I  P S S+  YG+ + I+FT   G ++   V VTMVAPSF THSFS +QRLL 
Sbjct  440   SYLRPKIISPVSQSEIRYGQQLPIRFTIPPGRLNSTSVMVTMVAPSFNTHSFSMNQRLLV  499

Query  1526  LGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             L  G  V  VG +TY +   TPGSGNL+PAGYY++FVVH+ IPSEGIW+Q+
Sbjct  500   LSHGD-VTAVGKSTYQVRVGTPGSGNLAPAGYYLVFVVHQDIPSEGIWVQI  549



>ref|XP_010263908.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=550

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/530 (63%), Positives = 414/530 (78%), Gaps = 4/530 (1%)
 Frame = +2

Query  89    RNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPY  268
             R++  AA GGG+W+LL  +IGI+AMHMQLLNND+VVIFDRTDFG S +PL  G+CR DP 
Sbjct  24    RSLTHAAGGGGKWDLLQQSIGISAMHMQLLNNDRVVIFDRTDFGESKLPLPDGKCRNDPN  83

Query  269   EVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVF  448
             + V+ VDCTAHS EYDV   ++RPLMV TDVWCSS AV PDG LIQTGG+NDGDH VR+F
Sbjct  84    DTVLTVDCTAHSAEYDVLSKSIRPLMVLTDVWCSSGAVSPDGRLIQTGGFNDGDHAVRIF  143

Query  449   NPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNL  628
              PCN   CDW E  + L   RWYATNHILPDGR IIIGGR +FNYEFYPK+   ++L++L
Sbjct  144   TPCN--GCDWQENSSGLLARRWYATNHILPDGRSIIIGGRRQFNYEFYPKSSSTNILFSL  201

Query  629   PFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSY  808
             PFL++TNDP  ENNLYP+V LNVDG+LFIFANN+AIL DY K+AVV+ +P MP G PRSY
Sbjct  202   PFLSQTNDPKIENNLYPFVHLNVDGNLFIFANNRAILLDYTKNAVVKTFPQMPGGDPRSY  261

Query  809   PSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPV  988
             PSTGS+VLLPLKNLQ   + AEVL+CGGAPK ++  +++G F+ AL+TCGRI+ITD +P 
Sbjct  262   PSTGSSVLLPLKNLQQSSVEAEVLVCGGAPKDSYVQAKKGKFVRALDTCGRIKITDASPD  321

Query  989   WFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFE  1168
             W METMP+AR+MGDM+ LPNG++LIINGA+ G+AG+  GR P   PV+Y  DNP G+RFE
Sbjct  322   WSMETMPLARVMGDMLLLPNGHVLIINGASSGTAGWELGREPELKPVIYRPDNPSGSRFE  381

Query  1169  ILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAAT  1348
             + NPS  PR+YHSTAILLRD RVLVGG+NPH  Y F  G L+PT+L LEAFSP YLD+  
Sbjct  382   VQNPSSTPRLYHSTAILLRDGRVLVGGNNPHRYYNF-TGVLYPTDLSLEAFSPDYLDSKF  440

Query  1349  AGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL  1528
             + +RP I  PGS ++  YG+ + ++F+ +G ++   V+VTMV+PSFTTHSFS +QRLL L
Sbjct  441   STLRPKILSPGSQAQLSYGQRLSVRFSVSGALNDKWVSVTMVSPSFTTHSFSMNQRLLVL  500

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               GG V PV  + Y +    P SG L+P+GYY+LFVVH+ IPSEGIW+ +
Sbjct  501   -DGGKVTPVSSSVYDVEVTAPNSGFLAPSGYYLLFVVHQEIPSEGIWVNI  549



>ref|XP_008221312.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=546

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/524 (64%), Positives = 407/524 (78%), Gaps = 4/524 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W LL  NIGI+AMHMQLL+ND+VV+FDRTDFG SN+ L  G+CR DP + V+KVD
Sbjct  27    AAGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPKGKCRNDPNDTVLKVD  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDV  N+ RPLMVQTDVWCSS +V  DG+LIQTGG+NDG+  VR+F  C    
Sbjct  87    CTAHSAEYDVPTNSFRPLMVQTDVWCSSGSVAQDGSLIQTGGFNDGERRVRIFQSCTG--  144

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW E  N L   RWYATNHILP+GRQIIIGGR +FNYEFYPK+     +++LPFL +TN
Sbjct  145   CDWKEYDNGLAARRWYATNHILPEGRQIIIGGRRQFNYEFYPKSESSSNVHSLPFLVQTN  204

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             DP  ENNLYP+VFLNVDG+LFIFANN+AIL+DY+K+ VV+ YP +P G+PRSYPSTGSAV
Sbjct  205   DPKVENNLYPFVFLNVDGNLFIFANNRAILFDYVKNVVVKTYPQIPGGEPRSYPSTGSAV  264

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNLQA  + AEVL+CGGAPKG++  +  G F+ AL TCGRI+ITDPNP W +ETMP
Sbjct  265   LLPLKNLQARFVEAEVLVCGGAPKGSYAKAVNGTFVEALKTCGRIKITDPNPQWVVETMP  324

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM  LP+G +LIINGAA G+AG+  GRNPV  PV+Y  D  VG+RFE  NP+ I
Sbjct  325   QARVMGDMTLLPDGTVLIINGAAVGTAGWEFGRNPVLNPVIYQPDKAVGSRFEQQNPTTI  384

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHS A+LLRD RVLVGGSNPH  Y F N  LFPTELRLE+F+P YLDA    +RP I
Sbjct  385   PRMYHSAAVLLRDGRVLVGGSNPHIYYEFTN-VLFPTELRLESFNPDYLDAMYVNLRPKI  443

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S +K  +G+ + ++F   G V  NLV+VTMVAPSFTTHSFS +QRLL L    +V 
Sbjct  444   VAPQSQAKINHGQKLAVRFYVEGTVAPNLVSVTMVAPSFTTHSFSMNQRLLVL-AAESVT  502

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              V  +TY +   TPGSGNL+P+GYY+L+VVH+ IPSEGIW+Q++
Sbjct  503   NVAKSTYQVQVTTPGSGNLAPSGYYILYVVHQQIPSEGIWVQIL  546



>ref|XP_009774595.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=554

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/527 (64%), Positives = 413/527 (78%), Gaps = 4/527 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG W+LL+ NIGI+AMHMQLLNND+V+++DRTDFG SNI L  G+CR +P ++ +K
Sbjct  29    AYAVGGNWDLLISNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPDGKCRNNPNDLALK  88

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHSVEYDV+ N+VRPLMVQTDVWCSS +   DG+L+QTGG+NDG++VVRVF PCN 
Sbjct  89    LDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGENVVRVFRPCNG  148

Query  464   --KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFL  637
                 CDW EI   L + RWYATNHILPDGRQIIIGGRE FNYEFYPKT   + ++NLPFL
Sbjct  149   NGSTCDWKEIGGGLIQSRWYATNHILPDGRQIIIGGREAFNYEFYPKTASTNSVFNLPFL  208

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
              +TNDP  ENNLYP+VFLNVDG+LFIFAN++AIL++Y+ + VV+ YP +P G PR+YPST
Sbjct  209   QQTNDPREENNLYPFVFLNVDGNLFIFANDRAILFNYMANTVVKTYPQIPGGDPRNYPST  268

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             GSAVLLPLKNLQA  I AEVL+CGG P+G++  +  G F+GALNTCGRI ITDPNP W M
Sbjct  269   GSAVLLPLKNLQAQIIQAEVLVCGGTPRGSYLNASSGNFLGALNTCGRITITDPNPQWIM  328

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP+AR MGDMV LPNGN+LI+NGAA G+AG+  GR+PV +PV+Y  DNP  +RFE+ N
Sbjct  329   ETMPLARTMGDMVILPNGNVLILNGAAAGTAGWELGRSPVLSPVIYRPDNPFDSRFEVQN  388

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
              + IPRMYHST+IL+RD RVLVGGSNPH  Y F  G L+PTEL LE FSP YLD  +A  
Sbjct  389   SNTIPRMYHSTSILIRDGRVLVGGSNPHAFYNF-TGVLYPTELSLETFSPSYLDPESANS  447

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S  K  YG+ + I+FT  G V+ ++V VTMVAP F THSF+ +QR+L L  G
Sbjct  448   RPRIIAPASRHKIKYGQRVNIRFTVPGSVNRDVVNVTMVAPGFNTHSFTMNQRMLVLFSG  507

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                + VG + Y + +V P S NL+PAGYY+LFVVH+ IPSEGIW+++
Sbjct  508   NVTR-VGKSAYKINSVFPNSSNLAPAGYYLLFVVHQDIPSEGIWVRI  553



>ref|XP_006342711.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=568

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/526 (65%), Positives = 407/526 (77%), Gaps = 7/526 (1%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCT  295
             GG W LLL NIGI+AMHMQLLNND+VV+FDRTDFG+SNI L  G+CR D  +  +KVDCT
Sbjct  44    GGSWNLLLSNIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPDGKCRYDQNDTTLKVDCT  103

Query  296   AHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK--  469
             AHS+EYD+A N++RPLMVQTDVWCSS +V PDG+L+QTGG+NDG+ VVRVF PC++    
Sbjct  104   AHSIEYDIASNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGEKVVRVFKPCSNATTN  163

Query  470   --CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW EI   L + RWY+TNHILPDGRQIIIGGR  FNYEFYPK+   +  Y+LPFL +
Sbjct  164   GTCDWEEIQGGLVQRRWYSTNHILPDGRQIIIGGRRAFNYEFYPKSASANNSYSLPFLVK  223

Query  644   TNDPGA-ENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             TNDP   ENNLYP+VFLNVDG+LFIFANN+AIL+DY K+ V+  YP +P G PR+YPSTG
Sbjct  224   TNDPNKIENNLYPFVFLNVDGNLFIFANNRAILFDYTKNVVLTNYPEIPGGDPRNYPSTG  283

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             SAVLLPLKNLQA  I AEVL+CGGAPKG++ ++  G F GAL+TCGRI ITDPNP W ME
Sbjct  284   SAVLLPLKNLQAQEIQAEVLVCGGAPKGSYTSALNGNFSGALSTCGRIIITDPNPQWTME  343

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP+AR MGDMV LPNGN+LIINGA  G+AG+  GR+PV  PV+Y  DNP  +RFEI N 
Sbjct  344   TMPLARTMGDMVILPNGNVLIINGATTGTAGWECGRDPVLKPVIYRPDNPFDSRFEIQNS  403

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTA+LLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YLD+ +  +R
Sbjct  404   STIPRMYHSTAVLLRDGRVLVGGSNPHIYYNF-TGVLFPTELSLEAFSPSYLDSISEYLR  462

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P S     YG+ + I+F  AG VD NLVT+TMVAP F THSF+ +QRLL L    
Sbjct  463   PQIISPASQYAIEYGQRMPIRFKVAGRVDINLVTITMVAPGFNTHSFTMNQRLLVLVSEN  522

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              VK +G N Y +  VTP +  L+P GYY+LFVVH+ IPSEGIW+++
Sbjct  523   -VKLIGENAYQINVVTPNNAKLAPPGYYLLFVVHQDIPSEGIWVKI  567



>ref|XP_009335425.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=547

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/524 (64%), Positives = 405/524 (77%), Gaps = 4/524 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A  G+W LL  NIGI AMHMQLL+ND+VVI+DRTDFG+SN+ L  G+CR+DP +  +K+D
Sbjct  28    AATGKWVLLQQNIGITAMHMQLLHNDRVVIYDRTDFGMSNLSLPDGKCREDPNDTALKID  87

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHSVEYDV  N+ RPLMVQTDVWCSS ++ PDG LIQTGG+NDG+  VR++ PC    
Sbjct  88    CTAHSVEYDVPTNSFRPLMVQTDVWCSSGSISPDGRLIQTGGFNDGERKVRIYQPCTG--  145

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW E  N     RWYATNHILPDGRQIIIGGR +FNYEFYPK+     +Y+LPFL +TN
Sbjct  146   CDWKEYDNGXXXRRWYATNHILPDGRQIIIGGRRQFNYEFYPKSASSSNVYSLPFLVQTN  205

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D   ENNLYP+VFLNVDG+LFIFANN+AIL++Y+K+ +V+ YP +P G PRSYPSTGSAV
Sbjct  206   DAKIENNLYPFVFLNVDGNLFIFANNRAILFNYVKNIIVKTYPKIPGGDPRSYPSTGSAV  265

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNLQA  + AEVLICGGAPKG++  + +G F+ AL TCGRI+ITDPNP W +ETMP
Sbjct  266   LLPLKNLQAQLVEAEVLICGGAPKGSYEKAVKGTFVEALKTCGRIKITDPNPQWVVETMP  325

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM  LP+G +LIINGAA G+AG+  GRNPV  P LY  +N VG+RF   NP+ I
Sbjct  326   QARVMGDMTLLPDGTVLIINGAALGTAGWEFGRNPVLNPALYQPNNAVGSRFVQQNPTTI  385

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH  Y F N  LFPTELRLEAF+P YLDA  A +RP I
Sbjct  386   PRMYHSTAILLRDGRVLVGGSNPHIYYEFKN-VLFPTELRLEAFNPDYLDAKYANLRPKI  444

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S     Y + + ++F+  G V  NLV+VTMVAPSFTTHSFS +QR+L L    +V 
Sbjct  445   VAPKSQGTITYAQKLAVRFSVTGTVATNLVSVTMVAPSFTTHSFSMNQRVLVL-AAESVT  503

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              V ++TY     TPGSG+L+P+GYY+L+VVH+ IPSEGIW+Q++
Sbjct  504   NVALSTYQALVTTPGSGHLAPSGYYLLYVVHQSIPSEGIWVQIL  547



>ref|XP_009791893.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=545

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/525 (63%), Positives = 418/525 (80%), Gaps = 4/525 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG+W+LL  NIGI+AMHMQLLNND+V+++DRTDFG SNI L  GRCR +P ++ +K
Sbjct  24    ADAAGGKWQLLKSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPNGRCRNNPNDLALK  83

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHSVEYDV+ N+VRPLMVQTDVWCSS +V  DG+L+QTGG+NDG+ +VRV  PCN 
Sbjct  84    VDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNADGSLVQTGGFNDGERMVRVVKPCN-  142

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ + L + RWY+TNHILPDGRQIIIGGR+ FNYEFYPKT   + +++LPFL +
Sbjct  143   -TCDWQEMGSNLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTNNVFSLPFLQQ  201

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TN+P  ENNL+P+VFLNVDG+LFIFAN++AIL+DY  + VV+ YP +P G PR+YPS+GS
Sbjct  202   TNNPREENNLFPFVFLNVDGNLFIFANDRAILFDYKVNKVVKTYPQIPGGDPRNYPSSGS  261

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLPLKNL+A  + AEVL+CGGAP+G++P +++G F+GALNTCGRI ITDPNP W +ET
Sbjct  262   AVLLPLKNLRAQTVQAEVLVCGGAPRGSYPKADKGEFIGALNTCGRITITDPNPQWTVET  321

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP+AR MGDMV LP+GN+LIINGAA G+AG+   R PV +PV+Y  DNP+G+RFE+ N +
Sbjct  322   MPLARTMGDMVILPDGNVLIINGAAAGTAGWQIARKPVLSPVIYRPDNPLGSRFEVQNSN  381

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHSTA+LLRD RVLVGGSNP+  Y F  G LFPTEL LEAFSP YLD  ++ +RP
Sbjct  382   TIPRMYHSTAVLLRDGRVLVGGSNPNEFYNF-TGVLFPTELSLEAFSPSYLDPESSNLRP  440

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I  P S  K  YGK + I+FT +G ++ +LV VTMVAP F THS + +QR+L L   G 
Sbjct  441   QIISPASRHKTKYGKSVNIRFTVSGLLNTDLVKVTMVAPGFNTHSNTMNQRMLVL-SSGK  499

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             V+ +G ++Y +  + P SG L+P GYYMLFVVH+ IPSEGIWI++
Sbjct  500   VRRIGKSSYQINLIFPNSGKLAPPGYYMLFVVHQEIPSEGIWIKI  544



>gb|KDP38596.1| hypothetical protein JCGZ_04521 [Jatropha curcas]
Length=550

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/529 (64%), Positives = 407/529 (77%), Gaps = 3/529 (1%)
 Frame = +2

Query  95    MFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEV  274
             +   AAGGGRW+LL  +IGI AMHMQLLNND+VVIFDRTDFG+SN+ L  G+CR DP E+
Sbjct  25    ILTEAAGGGRWQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGISNLSLPEGQCRDDPNEL  84

Query  275   VVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNP  454
             V+K DCTAHS EYD   N  RPL V T+VWCSS AV PDG LIQTGG+NDG+  VRVF+P
Sbjct  85    VIKTDCTAHSAEYDALTNKFRPLRVLTNVWCSSGAVTPDGRLIQTGGFNDGERQVRVFSP  144

Query  455   CNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
             C+   CDW E+ N L   RWYATNHILP+G Q+IIGGR +F+YEFYPKT   DL Y+LPF
Sbjct  145   CSSTNCDWQEVGNGLKARRWYATNHILPEGNQVIIGGRRQFSYEFYPKTGAADL-YSLPF  203

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L +T+D   ENNLYP+VFLNVDG+LFIFANN+AIL+DY    VV+ YP +P G PRSYPS
Sbjct  204   LVQTDDRNIENNLYPFVFLNVDGNLFIFANNRAILFDYKLGKVVKTYPEIPGGDPRSYPS  263

Query  815   TGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWF  994
             TGSAVLLPLK LQA  I AEVL+CGGAPKG++  +++G F+ AL+TCGRI+ITDPNP W 
Sbjct  264   TGSAVLLPLKKLQATNIEAEVLVCGGAPKGSYVQAKKGNFVKALDTCGRIKITDPNPKWT  323

Query  995   METMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEIL  1174
             ME MP +R+MGDM+ LPNGN+LIINGA+ G+AG+  GRNPV  PVLY+ D  +G+RFE L
Sbjct  324   MENMPHSRVMGDMILLPNGNVLIINGASAGTAGWEFGRNPVLNPVLYNPDKAIGSRFESL  383

Query  1175  NPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAG  1354
             NP+ IPRMYHSTAILLRD RVLVGGSNPH  Y F  G LFPTEL LEAF PPYLD+    
Sbjct  384   NPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYNF-TGVLFPTELSLEAFYPPYLDSQNNN  442

Query  1355  IRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGG  1534
             +R  I  P S +K GY + + ++F  AG +D N V+VTM+APSFTTHSFS +QRLL L  
Sbjct  443   LRLTIVSPASKAKIGYAQKLLVRFKVAGRLDTNTVSVTMIAPSFTTHSFSMNQRLLVL-E  501

Query  1535  GGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
                V  VG  TY++    P S N++P GYY+L+VVH+ IPSEGIW+Q+V
Sbjct  502   NEKVTNVGTATYNVEVTAPRSPNIAPPGYYLLYVVHQDIPSEGIWVQIV  550



>ref|XP_006342231.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=556

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/533 (62%), Positives = 421/533 (79%), Gaps = 6/533 (1%)
 Frame = +2

Query  89    RNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPY  268
             RN+ A AA GG+W+LL+ NIGI+AMHMQLLN+D+VV++DRTDFG+SNI L  G+CR +  
Sbjct  26    RNL-AYAAAGGKWDLLMSNIGISAMHMQLLNDDRVVMYDRTDFGMSNISLPNGKCRNNNN  84

Query  269   EVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVF  448
             ++ +KVDCTAHS+EYDV+ N+VRPLM+QT+VWCSS +   DG+L+QTGG NDG  V+RV+
Sbjct  85    DLALKVDCTAHSIEYDVSTNSVRPLMIQTNVWCSSGSATSDGSLVQTGGSNDGKFVIRVY  144

Query  449   NPCNDKK---CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLL  619
              PC   K   CDW E+ N L + RWY+TNHILPDGRQIIIGGR+ FNYEF+PK P  + +
Sbjct  145   KPCITGKRSNCDWQEMGNGLIQSRWYSTNHILPDGRQIIIGGRDAFNYEFHPKIPSTNNV  204

Query  620   YNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQP  799
             ++LPFL +TNDP  ENNLYP+VFLNVD +LFIF NN+AIL+DY K+ +V+ YP +PDG P
Sbjct  205   FSLPFLQQTNDPREENNLYPFVFLNVDANLFIFTNNRAILFDYTKNTIVKTYPQIPDGDP  264

Query  800   RSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDP  979
             R+YPSTGSAVLLPLKNL+A  I AEVL+CGGAP+G++  + RG F+GALNTCGRI ITDP
Sbjct  265   RNYPSTGSAVLLPLKNLEAQTIQAEVLVCGGAPRGSYLKATRGEFVGALNTCGRITITDP  324

Query  980   NPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT  1159
             NP W +ETM + R MGDMV LPNGN+LI+NGAA G+AG+G  R+PV +PV+Y  DN + +
Sbjct  325   NPQWTIETMLLPRTMGDMVILPNGNVLIVNGAATGTAGWGIARSPVLSPVIYRPDNLLDS  384

Query  1160  RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLD  1339
             RFEI NP+ IPRMYHSTA+LLRD RVLVGGSNP+  Y F  G LFPTEL LEAFSP YLD
Sbjct  385   RFEIQNPNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNF-TGVLFPTELSLEAFSPSYLD  443

Query  1340  AATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRL  1519
             + +A +RP I  P S  KF YG+ + IQF+ +G ++ N + VTMVAP F THS + +QR+
Sbjct  444   SESANLRPQIISPVSRHKFNYGQRVNIQFSISGLLNKNSIKVTMVAPGFNTHSNTMNQRM  503

Query  1520  LDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             L L   G VK VG ++Y M+ + P SG+L+P GYY+LFVVH+ IPSEGIW+++
Sbjct  504   LVL-SNGVVKQVGKSSYQMSCLFPKSGSLAPPGYYLLFVVHQDIPSEGIWVRI  555



>ref|XP_009600286.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=554

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/527 (64%), Positives = 409/527 (78%), Gaps = 4/527 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG W+LL+ NIGI+AMHMQLLNND+V+I+DRTDFG SNI L  G+CR +  ++ +K
Sbjct  29    AYAAGGNWDLLISNIGISAMHMQLLNNDRVIIYDRTDFGASNISLPDGKCRNNSNDLALK  88

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHSVEYDV+ N+VRPLMVQTDVWCSS +   DG+L+QTGG+NDG++VVRVF PCN 
Sbjct  89    LDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGENVVRVFRPCNG  148

Query  464   --KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFL  637
                 CDW EI   L + RWYATNHILPDGRQIIIGGRE FNYEFYPKT   + +++LPFL
Sbjct  149   NGSTCDWKEIGGGLIQSRWYATNHILPDGRQIIIGGREAFNYEFYPKTASTNNVFSLPFL  208

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
              +TNDP  ENNLYP+VFLNVDG+LFIFAN++AIL++Y+ + VV+ YP +P G PR+YPST
Sbjct  209   QQTNDPREENNLYPFVFLNVDGNLFIFANDRAILFNYMANTVVKTYPQIPGGDPRNYPST  268

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             GSA+LLPLKNLQA  I AEVL+CGG  KG++  +  G F+GALNTCGRI ITDPNP W M
Sbjct  269   GSAILLPLKNLQAQTIQAEVLVCGGTAKGSYLNASSGNFLGALNTCGRITITDPNPQWIM  328

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP+ R MGDMV LPNGN+LIINGAA G+AG+  GR+PV +PV+Y  DNP  +RFE+ N
Sbjct  329   ETMPLVRTMGDMVILPNGNVLIINGAAAGTAGWELGRSPVLSPVIYRPDNPSHSRFEVQN  388

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
              + IPRMYHST+ILLRD RVLVGGSNPH  Y F  G L+PTEL LE FSP YLD  +A  
Sbjct  389   SNTIPRMYHSTSILLRDGRVLVGGSNPHALYNF-TGVLYPTELSLETFSPSYLDPESANS  447

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S  K  YG  + I+FT  G V  +LV VTMV+P F THSF+ +QR+L L  G
Sbjct  448   RPQIISPASQRKVKYGGRVNIRFTVPGSVKRDLVKVTMVSPGFNTHSFTMNQRMLVLFSG  507

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                + VG + Y + +V P S NL+PAGYY+LFVVH+GIPSEGIW+++
Sbjct  508   NVTR-VGKSAYKINSVFPNSSNLAPAGYYLLFVVHQGIPSEGIWVRI  553



>ref|XP_009603236.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=564

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/525 (63%), Positives = 419/525 (80%), Gaps = 3/525 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG+W+LL+ NIGI+AMH+QLLNND+V+++DRTDFG SNI L  G+CR +P ++ +K
Sbjct  42    AYAAGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGASNISLPNGKCRNNPNDLALK  101

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHSVEYDV+ N+VRPLMVQTDVWCSS +V  DG+L+QTGG+NDG+ +VRV  PC+ 
Sbjct  102   VDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGERMVRVVKPCS-  160

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ + L + RWY+TNHILPDGRQIIIGGR+ FNYEFYPKT   + ++NLPFL +
Sbjct  161   -TCDWQEMGSNLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTNNVFNLPFLQQ  219

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TN+P  ENNL+P+VFLNVDG+LFIFAN++AIL+DY  + VV+ YP +P G PR+YPS+GS
Sbjct  220   TNNPREENNLFPFVFLNVDGNLFIFANDRAILFDYKTNKVVKTYPQIPGGDPRNYPSSGS  279

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLPLKNL++  + AEVL+CGGAP+G++P +++G F+GALNTCGRI ITDPNP W +ET
Sbjct  280   AVLLPLKNLRSQTVQAEVLVCGGAPRGSYPKADKGEFLGALNTCGRITITDPNPQWTIET  339

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP+AR MGDMV LPNGN+LIINGAA G+AG+   RNPV +PV+Y  DNP  +RFE+ NP+
Sbjct  340   MPLARTMGDMVILPNGNVLIINGAASGTAGWQIARNPVLSPVIYRPDNPSDSRFEVQNPN  399

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHSTA+LLRD RVLVGGSNP+  Y F  G LFPT+L LEAFSP YLD  +A +RP
Sbjct  400   VIPRMYHSTAVLLRDGRVLVGGSNPNELYNF-TGVLFPTDLSLEAFSPSYLDPESANLRP  458

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I  P SH KF YG+ ++I+FTA+  ++ +LV VTMVAP F THSF+ +QR+L L   G 
Sbjct  459   RIISPASHLKFTYGQRVDIRFTASRLLNRDLVKVTMVAPGFNTHSFTMNQRMLVLPRSGI  518

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             V+ VG   Y ++ V P S   +P GYY+LFVVH+ IPSE IW+++
Sbjct  519   VRQVGRFVYQISCVFPKSAIFAPPGYYLLFVVHQDIPSEAIWVRI  563



>ref|XP_008221311.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=535

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/524 (63%), Positives = 402/524 (77%), Gaps = 12/524 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LL  NIGI+AMHMQLL+ND+VV+FDRTDFG SN+ L  G+C        V  D
Sbjct  24    AAGGKWQLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPDGKC--------VGND  75

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDV  NT RPL + +DVWCSS +V PDG LIQTGG+ +G+  VR+F PC    
Sbjct  76    CTAHSAEYDVTTNTFRPLTLLSDVWCSSGSVAPDGRLIQTGGFTNGERRVRIFEPCTG--  133

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI N L   RWYAT+HILPDGRQIIIGGR +FNYEFYPK+   + +++LPFL +TN
Sbjct  134   CDWKEIENGLAARRWYATDHILPDGRQIIIGGRRQFNYEFYPKSASTNKVFSLPFLVQTN  193

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             DP AENNLYP+VFLNVDG+LFIFANN+AIL+DY+K+ VV+ YP +P G PRSYPSTGSAV
Sbjct  194   DPDAENNLYPFVFLNVDGNLFIFANNRAILFDYVKNNVVKTYPQIPGGDPRSYPSTGSAV  253

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL+A  I AEVL+CGGAP G++  + +G F GALNTC RI+ITDPNP W +ETMP
Sbjct  254   LLPLKNLKARSIEAEVLVCGGAPTGSYIKATKGTFTGALNTCARIKITDPNPQWVLETMP  313

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM  LP+G +L+INGA+ G+AG+  GRNPV  PV+Y  DN  G+RFE  NP+ I
Sbjct  314   QARVMGDMTLLPDGTVLLINGASNGAAGWELGRNPVLNPVVYRPDNAAGSRFEQQNPTTI  373

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTA+LLRD RVLVGGSNPHPNY F N  LFPTELR+EAFSP YLDA  A +RP I
Sbjct  374   PRMYHSTAVLLRDGRVLVGGSNPHPNYEFTN-VLFPTELRVEAFSPDYLDAKYANVRPKI  432

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S +K  YGK + I+F+  G +  N V+VTMVAPSFTTHSFS + R L L     VK
Sbjct  433   VSPKSQAKINYGKKLTIRFSMTGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLASEN-VK  491

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              VG + Y +   TP SGNL+P+GYY+L+VVH+ IPS+GIW+Q++
Sbjct  492   SVGKSAYEVEVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQIM  535



>ref|XP_007017718.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14943.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/549 (62%), Positives = 413/549 (75%), Gaps = 7/549 (1%)
 Frame = +2

Query  32    TLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRT  211
             T +F++    L+ A  P  R + +AA   GRW+LL  +IG++AMHMQLL ND+VV+FDRT
Sbjct  4     TFIFSILVFQLLFASQPCHRILTSAA--DGRWQLLQKSIGVSAMHMQLLRNDRVVMFDRT  61

Query  212   DFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPD  391
             DFG SN+ L  G+C  +P    + VDCTAHSVEY+V  N  R L VQTDVWCSS A+MPD
Sbjct  62    DFGKSNLSLPNGKCLSNPTNTALPVDCTAHSVEYNVLTNEFRALTVQTDVWCSSGAIMPD  121

Query  392   GTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             G L+QTGG+N+G   VRVF+PC+   CDW EIPN L   RWYATNHILPDGRQII+GGR 
Sbjct  122   GNLVQTGGFNNGTRRVRVFSPCS--TCDWQEIPNGLAAKRWYATNHILPDGRQIIVGGRR  179

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             +FNYEF PKT   +  +NLPFL+ETND G ENNLYP+VFLNVDG+LFIFANN+AIL DY+
Sbjct  180   QFNYEFIPKTVAANT-FNLPFLSETNDRGVENNLYPFVFLNVDGNLFIFANNRAILLDYV  238

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
              + VV+ YP +P G PRSYPSTGSAVLLPLKNL+AP I AEVL+CGGAPKG++  + +G 
Sbjct  239   NNKVVKTYPTIPGGDPRSYPSTGSAVLLPLKNLKAPAIQAEVLVCGGAPKGSYLQALKGN  298

Query  932   FMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRN  1111
             F+GALNTC R+ ITDPNP W METMPMAR+M DM+ LPNG +LIINGA  GSAG+  GR+
Sbjct  299   FIGALNTCARMTITDPNPQWVMETMPMARVMSDMILLPNGKVLIINGAGSGSAGWELGRD  358

Query  1112  PVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGAL  1291
             PV +PV+Y  D+ +G+RFE   P+ IPRMYHS  +LLRD RVLVGGSNPH  Y F  G L
Sbjct  359   PVLSPVMYLPDHEIGSRFETQTPTTIPRMYHSAVVLLRDGRVLVGGSNPHAFYNF-TGVL  417

Query  1292  FPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTM  1471
             FPTEL LEAFSP Y+DA    +RP I  P S S     K + +Q    G VD NLV+VTM
Sbjct  418   FPTELSLEAFSPVYMDAEFNDLRPTIVAPKSMSGIQIRKKLSVQVVITGKVDPNLVSVTM  477

Query  1472  VAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGI  1651
             VAPSFTTHSFS +QR+LDLG    V  +G +TY++   TP S NL+PAG+Y+LFVVH+ I
Sbjct  478   VAPSFTTHSFSMNQRVLDLGNNN-VTALGNSTYNIEYTTPRSYNLAPAGFYLLFVVHQDI  536

Query  1652  PSEGIWIQM  1678
             PS+GIW+++
Sbjct  537   PSQGIWVKL  545



>ref|XP_004499224.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=549

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/547 (63%), Positives = 406/547 (74%), Gaps = 7/547 (1%)
 Frame = +2

Query  50    WQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSN  229
             W LFL+      +      AAG G+W+ L  NIGI AMHMQLL+ND++VIFDRTDFGLSN
Sbjct  7     WLLFLLPILITTAMTWRVTAAGNGQWQQLQKNIGIVAMHMQLLHNDRIVIFDRTDFGLSN  66

Query  230   IPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQT  409
             + L  G+CR DP E  VK DCTAHSVEYDV  NT R L VQTDVWCSS  V P+G LIQT
Sbjct  67    LSLPNGKCRHDPKETTVKTDCTAHSVEYDVKSNTFRALFVQTDVWCSSGTVNPNGILIQT  126

Query  410   GGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEF  589
             GG+NDGD  VR++NPC+D  CDW E    L   RWYAT+HILPDGRQIIIGGR++FNYEF
Sbjct  127   GGFNDGDRAVRIYNPCDD--CDWQEFDGGLTARRWYATDHILPDGRQIIIGGRKQFNYEF  184

Query  590   YPKTPGGDL-LYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVV  766
             YPK    D  +YNLPFL ETND G ENNLYP+VFLNVDG+LF+FANN+AIL DY K+AVV
Sbjct  185   YPKNHEVDKKVYNLPFLDETNDRGEENNLYPFVFLNVDGNLFVFANNRAILLDYTKNAVV  244

Query  767   RLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGAL  946
             R +P +P G+PRSYPSTGS VLLPLKNLQ+  + AEVLICGGAPKG+F  + +  F+ AL
Sbjct  245   RTFPQVPGGEPRSYPSTGSGVLLPLKNLQSKAVEAEVLICGGAPKGSFQLATKNKFLKAL  304

Query  947   NTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTP  1126
             NTC RI+ITDPNP W METMP +R+M DMV LPNGN+LIINGA  G+AG+  GR+PV  P
Sbjct  305   NTCVRIKITDPNPKWVMETMPGSRVMSDMVMLPNGNVLIINGAGSGTAGWEFGRDPVLNP  364

Query  1127  VLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTEL  1306
             VLY TDNP+G+RFE+ NPS  PRMYHS+A+L+RD RVLVGGSNP+  Y F N  LFPTEL
Sbjct  365   VLYKTDNPIGSRFELQNPSETPRMYHSSAVLVRDGRVLVGGSNPYIGYNFIN-VLFPTEL  423

Query  1307  RLEAFSPPYLDAATAGIRPHIT--LPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAP  1480
              +EAFSP YL+   A +RP I   +  S +K  YG+ + ++F     +D NL+ VT++AP
Sbjct  424   SIEAFSPSYLEPRFANVRPKIMSHISESQTKLRYGQKLVLRFQVKTTLDRNLLYVTLLAP  483

Query  1481  SFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSE  1660
              F THSFS +QRLL L     V  V   TY +    PGS  L+P G+YMLFVVHK IPSE
Sbjct  484   PFNTHSFSMNQRLLVL-EPNKVNNVAGTTYEIVVTIPGSTILAPPGFYMLFVVHKEIPSE  542

Query  1661  GIWIQMV  1681
             GIWIQM+
Sbjct  543   GIWIQML  549



>ref|XP_004238325.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=547

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/525 (62%), Positives = 411/525 (78%), Gaps = 4/525 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG+W+LL+ NIGI+AMHMQLLNND+V+++DRTDFG SNI L  G+CR +P E+ +K
Sbjct  26    ANAAGGKWDLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPDGKCRNNPKELALK  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHSVEYDV+ N++RPLMVQT+VWCSS +   DG+L+QTGG+NDG  +VR FNPCN 
Sbjct  86    IDCTAHSVEYDVSTNSIRPLMVQTNVWCSSGSATSDGSLVQTGGFNDGKLMVRTFNPCN-  144

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ + L + RWY+TNHILPDG QIIIGGR+ FNYEF+P+T     ++NLPFL E
Sbjct  145   -TCDWQEMGDGLGQSRWYSTNHILPDGSQIIIGGRDAFNYEFFPQTASTSNVFNLPFLRE  203

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TN P  ENNLYP+VFLNVDG+LFIF N++AIL DY  + +V+ YP +P G PR+YPSTGS
Sbjct  204   TNVPREENNLYPFVFLNVDGNLFIFTNDRAILLDYTTNTIVKTYPQIPGGDPRNYPSTGS  263

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLPLKNL++  + AEVL+CGGAPKG++  + +G F+GALNTCGRI ITDPNP W MET
Sbjct  264   AVLLPLKNLRSQKVQAEVLVCGGAPKGSYLRATKGDFVGALNTCGRITITDPNPQWTMET  323

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP+ R MGDMV LPNGN+LI+NGAA G+AG+   RNPV +PV+Y TDNP  +RFE+  P+
Sbjct  324   MPLPRTMGDMVILPNGNVLIVNGAATGTAGWQIARNPVFSPVIYRTDNPSDSRFEVQTPN  383

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHSTA+LLRD RVLVGGSNP+  Y F  G +FPT+L LEAFSP YLD   A +RP
Sbjct  384   AIPRMYHSTAVLLRDGRVLVGGSNPNELYNF-TGVVFPTDLSLEAFSPSYLDVEFANLRP  442

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I  P SH KF YG+ ++I+FTA G ++ +L+ VTMVAP F THS + +QR+L L   G 
Sbjct  443   QIISPDSHLKFTYGQRVDIRFTALGLLNRDLIKVTMVAPGFNTHSNTMNQRMLVL-PRGI  501

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             V+ VG   Y ++ V P SG+L+P GYY+LFVVH+ IPSE IW+++
Sbjct  502   VRQVGRFVYEVSCVFPKSGSLAPPGYYLLFVVHQDIPSEAIWVRV  546



>ref|XP_004500954.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=555

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/530 (62%), Positives = 399/530 (75%), Gaps = 6/530 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A +G G+W+LL  NIGI  MHMQLL+ND+VVIFDRTDFGLSN+ L  GRCR +P E VVK
Sbjct  28    AESGSGQWQLLQKNIGIVGMHMQLLHNDRVVIFDRTDFGLSNLSLPNGRCRINPQEQVVK  87

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHS+EYDV  N+ RPL VQT+VWCSS +V PDG LIQTGG+NDGD  VR+FNPC+ 
Sbjct  88    TDCTAHSLEYDVVSNSFRPLFVQTNVWCSSGSVSPDGKLIQTGGFNDGDRTVRIFNPCSS  147

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPG-GDLLYNLPFLA  640
               CDW E   +L   RWY+TNH LPDGRQIIIGGR +FNYEFYPK        Y+LPFL 
Sbjct  148   --CDWQEFNASLAARRWYSTNHNLPDGRQIIIGGRRQFNYEFYPKKESTAKNTYSLPFLV  205

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             +TND GAENNLYP+VFLNVDG+LFIFANN+AIL+DY  + VV+ YP +P G PRSYPSTG
Sbjct  206   QTNDAGAENNLYPFVFLNVDGNLFIFANNRAILFDYNSNNVVKTYPVIPGGDPRSYPSTG  265

Query  821   SAVLLPLKNLQA-PGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             SAVLLPL NLQ  P + AEV+ICGGAP+G+F  +  G F+GALNTC RI+ITDPNP W +
Sbjct  266   SAVLLPLSNLQKYPSVEAEVMICGGAPRGSFQKTLNGTFIGALNTCARIKITDPNPNWVI  325

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP  R+M DM+ LPNGN+L+INGAA GSAG+  GRNPV  P LY  +  VG+RF++  
Sbjct  326   ETMPGGRVMSDMLLLPNGNVLLINGAAMGSAGWESGRNPVLNPFLYKPNERVGSRFQLQK  385

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PSGIPRMYHSTA+L+RD RVLVGGSNPH +Y F N  LFPTELRLEAFSP YL+A    +
Sbjct  386   PSGIPRMYHSTAVLVRDGRVLVGGSNPHIDYKFNNNVLFPTELRLEAFSPSYLEAGLDDV  445

Query  1358  RPHITLPG--SHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
             RP +  P   S +K  YG+ ++++F     +  N V+VTM+AP F THSFS +QRLL L 
Sbjct  446   RPKMVFPAPQSQTKLKYGQKLKVRFQVKATLVRNSVSVTMIAPPFNTHSFSMNQRLLVLE  505

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
                    VG +TY +   TPGS  L+P  YY+LFVVH+ +PS+G+W+Q+V
Sbjct  506   MKLQNNTVGESTYEIEVTTPGSAILAPPAYYLLFVVHQEVPSQGVWVQLV  555



>ref|XP_004291826.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/524 (63%), Positives = 402/524 (77%), Gaps = 5/524 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LLLPN+GI+AMHMQLL ND+VV+FDRTDFG SN+ L  G CR +P +  +KVD
Sbjct  34    AAGGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLSLPNGVCRNNPNDTALKVD  93

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDVA N +RPL V +DVWCSS +V P GTL+QTGG+NDG+  VR ++PC    
Sbjct  94    CTAHSAEYDVAGNKIRPLFVYSDVWCSSGSVNPSGTLVQTGGFNDGEKRVRTYDPC--AT  151

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI NAL   RWYATNHILPDGRQIIIGGR +FNYEFYPK+ G    ++LPFL ET+
Sbjct  152   CDWKEIENALTNRRWYATNHILPDGRQIIIGGRRQFNYEFYPKSEGSMNAHSLPFLVETS  211

Query  650   DPGA-ENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
             D  A ENNLYP+VFLNVDG+LFIFANN+AIL+DY    +V+ YP +P G PRSYPSTGSA
Sbjct  212   DGTAIENNLYPFVFLNVDGNLFIFANNRAILFDYAAGKIVKTYPTIPGGDPRSYPSTGSA  271

Query  827   VLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             VLLPLK+ +   + AEVL+CGGAPKG++  +E G F+ AL TC RI+ITDPNP W METM
Sbjct  272   VLLPLKSSKGQVVAAEVLVCGGAPKGSYVNAESGTFVEALKTCARIKITDPNPQWVMETM  331

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P+AR+MGDM  L NG++LIINGA QG+AG+  GRNPV  PV+Y +DN VG+RFE  NPS 
Sbjct  332   PLARVMGDMTLLANGDVLIINGAGQGTAGWELGRNPVLNPVVYKSDNAVGSRFEQQNPST  391

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHSTAILLRD RVLVGGSNPH  Y F N  +FPTEL LEAFSP YL++  A IRP 
Sbjct  392   IPRMYHSTAILLRDGRVLVGGSNPHIRYEFSN-VMFPTELALEAFSPSYLESQFASIRPS  450

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
             I  P S    GYG+ + ++F+  G +  N V+VTMV+PSFTTHSFS +QRLL L     +
Sbjct  451   IFSPLSQVTVGYGQKLAVRFSITGKIALNSVSVTMVSPSFTTHSFSMNQRLLVLASENVI  510

Query  1547  KPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               VG   + +   TP +GNL+P+GYY+L+VVH+ IPSEGIW+++
Sbjct  511   A-VGNLKFEVQVTTPATGNLAPSGYYLLYVVHQQIPSEGIWVKI  553



>ref|XP_006342232.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/527 (62%), Positives = 412/527 (78%), Gaps = 6/527 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG+W+LL+PNIGI+AMHMQLLNND+V+++DRTDFG SNIPL  G+CR +P E+ +K
Sbjct  30    ANAAGGKWDLLMPNIGISAMHMQLLNNDRVIMYDRTDFGASNIPLPDGKCRNNPKELALK  89

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHSVEYDV+ N++RPLMVQTDVWCSS +   DG+L+QTGG+NDG  +VR FNPCN 
Sbjct  90    VDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGKLMVRTFNPCN-  148

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ + L + RWY+TNHILPDG QIIIGGR+ FNYEF+PKT   + +++LPFL +
Sbjct  149   -TCDWQEMGDGLVQSRWYSTNHILPDGSQIIIGGRDAFNYEFFPKTASTNNVFSLPFLQQ  207

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TN P  ENNLYP+VFLNVDG+LFIF N++AIL DY  + +V+ YP +P G PR+YPSTGS
Sbjct  208   TNVPREENNLYPFVFLNVDGNLFIFTNDRAILLDYTTNTIVKTYPQIPGGDPRNYPSTGS  267

Query  824   AVLLPLKNLQAPGIV--AEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             AVLLPLKNL++  +   AEVL+CGGAPKG++  + +G F+GALNTCGRI ITDPNP W M
Sbjct  268   AVLLPLKNLRSQTVFVQAEVLVCGGAPKGSYLRATKGDFVGALNTCGRITITDPNPQWTM  327

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP+ R MGDMV LPNGN+LI+NGAA G+AG+   RNPV +PV+Y  DNP  +RFE+  
Sbjct  328   ETMPLPRTMGDMVILPNGNVLIVNGAATGTAGWQIARNPVLSPVIYRPDNPSDSRFEVQT  387

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             P+ IPRMYHSTA+LLRD RVLVGGSNP+  Y F  G +FPTEL LEAFSP YLDA  A +
Sbjct  388   PNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNF-TGVVFPTELSLEAFSPSYLDAEFANL  446

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P SH KF YG+ ++I+FTA G ++ + + VT+VAP F THS + +QR+L L   
Sbjct  447   RPQIISPDSHLKFTYGQRVDIRFTALGLLNRDSIKVTIVAPGFNTHSNTMNQRMLVL-PR  505

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             G V+ VG   Y ++ V P SG L+P GYY+LFVVH+ IPSE IW+++
Sbjct  506   GIVRQVGRFVYEVSCVFPNSGKLAPPGYYLLFVVHQDIPSEAIWVRV  552



>ref|XP_010271447.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=553

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/533 (62%), Positives = 407/533 (76%), Gaps = 4/533 (1%)
 Frame = +2

Query  80    PWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQ  259
             PW R   AA  GGG+W+LL  +IGI+AMHMQLL+ND+VVIFDRTDFG S + L  G+CR 
Sbjct  24    PWPRLAHAAGVGGGKWDLLKHSIGISAMHMQLLHNDRVVIFDRTDFGRSMLALPHGKCRH  83

Query  260   DPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVV  439
             DP + V++VDCTAHS EYDV+ N++RPLMVQTDVWCSS +V PDG LIQTGG NDG+  V
Sbjct  84    DPKDFVLQVDCTAHSAEYDVSSNSIRPLMVQTDVWCSSGSVSPDGRLIQTGGSNDGERSV  143

Query  440   RVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLL  619
             R+F PCN   CDW E  + L   RWYATN ILPDGR IIIGGR +FNYEFYPK+   D L
Sbjct  144   RIFAPCNG--CDWEENSSGLLVPRWYATNQILPDGRSIIIGGRNQFNYEFYPKSSSTDTL  201

Query  620   YNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQP  799
             ++LPFL++TNDP  ENNLYP+V LNVDG+LFIFANN+AIL DY ++ VV+ +P MPDG  
Sbjct  202   FDLPFLSQTNDPNVENNLYPFVHLNVDGNLFIFANNRAILLDYTRNVVVKRFPKMPDGHA  261

Query  800   RSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDP  979
             R YPSTGS+VLLPLK L+ P + AEVLICGGAPKG++  + RG F+GAL+TCGRI+ITD 
Sbjct  262   RCYPSTGSSVLLPLKKLKRPSVEAEVLICGGAPKGSYFQAIRGSFVGALSTCGRIKITDE  321

Query  980   NPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT  1159
             +P W METMP+AR+MGDM+ LP+G +L+INGA  G AG+  GRNP   PV+Y  ++P G+
Sbjct  322   SPAWSMETMPLARVMGDMILLPDGQVLMINGAKSGVAGWELGRNPELYPVIYRPNSPSGS  381

Query  1160  RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLD  1339
             RF + NP+ IPRMYHS+A+LLRD RVLVGGSNPH  Y F  G L+PTEL LEAFSP YLD
Sbjct  382   RFHVQNPTTIPRMYHSSALLLRDGRVLVGGSNPHEFYNF-TGVLYPTELSLEAFSPGYLD  440

Query  1340  AATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRL  1519
                + +RP I  P S +K  YG+ I ++F+ +G +    V+VTMVAPSFTTHSF+ +QRL
Sbjct  441   PGVSHLRPEIISPPSQTKLKYGQSITVRFSLSGELSSKGVSVTMVAPSFTTHSFAMNQRL  500

Query  1520  LDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             L+L  G  VKPV  + Y +    P SG L+P+GYY+LFVVH  +PSEGIW+ +
Sbjct  501   LEL-DGRQVKPVSKSVYDVQVTIPESGFLAPSGYYLLFVVHTEVPSEGIWVHI  552



>ref|XP_004289629.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=547

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/524 (62%), Positives = 402/524 (77%), Gaps = 5/524 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A  G+WELL  N+GI+AMHMQLL+ND+VV+FDRTDFG SN+ L  G CR +P +  +KVD
Sbjct  27    AAVGKWELLTKNVGISAMHMQLLHNDRVVMFDRTDFGASNLSLPNGVCRNNPNDTTLKVD  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDVA NTVRPL V TD WCSS AV P+G+L+QTGG+NDG+ +VRVF PC    
Sbjct  87    CTAHSAEYDVASNTVRPLFVFTDTWCSSGAVNPNGSLVQTGGYNDGEKMVRVFTPC--AT  144

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI N L  WRWYAT+HILPDGRQIIIGGR +F+YEFYPK+ G     NLPFL ET+
Sbjct  145   CDWEEIGNVLANWRWYATDHILPDGRQIIIGGRGQFSYEFYPKSEGSMTSLNLPFLQETS  204

Query  650   DPGA-ENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
             D  A ENNLYP+VFLNVDG+LFIFANN+AIL+DY+    V+ YP +P G+PRSYPSTGSA
Sbjct  205   DGAAIENNLYPFVFLNVDGNLFIFANNRAILFDYVASKTVKTYPTIPGGEPRSYPSTGSA  264

Query  827   VLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             VLLPLK+       AEVL+CGGAP GA+  + +  +M +L +C RI+ITDPNP W ME M
Sbjct  265   VLLPLKSTNGQAAEAEVLVCGGAPFGAYTKALKKTYMDSLKSCARIKITDPNPEWVMEDM  324

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P+AR+MGDM  LPNG++LIINGAAQG+AG+  GR+PV+TPV+Y  DN  G+RFE+ NPS 
Sbjct  325   PLARIMGDMTLLPNGDVLIINGAAQGTAGWELGRHPVRTPVVYKPDNATGSRFELQNPSA  384

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             I RMYHSTA+LLRD RVLVGGSNPH  YVF N  LFPT+L LEAFSP YLD+  A +RP 
Sbjct  385   ISRMYHSTAVLLRDGRVLVGGSNPHERYVFSN-VLFPTDLSLEAFSPNYLDSKFASVRPT  443

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
                P S ++ GYG+ + + F+  G +  + V+VTMV+PSFTTHSFS +QRL+ L    TV
Sbjct  444   TLSPSSQAEVGYGEKLTVSFSITGTIALDTVSVTMVSPSFTTHSFSMNQRLVIL-ASETV  502

Query  1547  KPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             + +G  T+ +   TP SGNL+P+GY++L+VVH+ IPS GIW+++
Sbjct  503   RALGNLTFQVEVTTPASGNLAPSGYFLLYVVHQQIPSAGIWVKI  546



>ref|XP_010271448.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=549

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/531 (63%), Positives = 401/531 (76%), Gaps = 4/531 (1%)
 Frame = +2

Query  89    RNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPY  268
             R     AAG G WELL  +IGI+AMHMQLL ND+VVIFDRTDFG S + L  G+CR DP 
Sbjct  23    RRSLTLAAGRGSWELLQKSIGISAMHMQLLYNDRVVIFDRTDFGKSELALPQGKCRTDPS  82

Query  269   EVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVF  448
             + V+ VDCTAHS EYDV+ N+ RPLMVQTDVWCSS  V PDG LIQTGG+NDG+  VR+F
Sbjct  83    DTVLTVDCTAHSAEYDVSTNSFRPLMVQTDVWCSSGVVAPDGRLIQTGGFNDGERSVRMF  142

Query  449   NPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNL  628
              PCN   CDW E  + L   RWYATNHILPDGR I+IGGR EFNYEFYPK+P  + L++L
Sbjct  143   TPCNG--CDWEENRSGLLARRWYATNHILPDGRSIVIGGRREFNYEFYPKSPSTNKLFSL  200

Query  629   PFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSY  808
             PFL ETNDPG ENNLYP+V LNVDG+LFIF+NN+AIL DY ++ VV+ +P +P G PR Y
Sbjct  201   PFLWETNDPGIENNLYPFVHLNVDGNLFIFSNNRAILLDYNRNKVVKTFPQIPGGDPRCY  260

Query  809   PSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPV  988
             PSTGS+VLLPLK+ Q P I AEVL+CGGA KG++  ++RG F+ ALNTCGRI+ITDP P 
Sbjct  261   PSTGSSVLLPLKHTQRPYIEAEVLVCGGALKGSYAQAKRGNFVKALNTCGRIKITDPKPA  320

Query  989   WFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFE  1168
             WFMETMP+ R+MGDM  LPNG+ILIINGAA G+ G+  GR+PV +PVLY  D P G+RFE
Sbjct  321   WFMETMPLPRVMGDMTILPNGHILIINGAASGTGGWEMGRDPVYSPVLYKPDYPSGSRFE  380

Query  1169  ILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAAT  1348
             + NP+ IPRMYHSTAILLRD RVLVGG+NPH  Y F  G L+PT+L LEAFSP YLD   
Sbjct  381   VQNPTKIPRMYHSTAILLRDGRVLVGGNNPHVFYNF-TGVLYPTDLSLEAFSPGYLDPGL  439

Query  1349  AGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL  1528
               +RP I  P S  K  YG+ + ++ +  G  D + V++TMVAPSFTTHSFS +QRLL L
Sbjct  440   LNVRPRIIYPLSQVKLKYGQRLRVRISVPGAFDSSRVSITMVAPSFTTHSFSMNQRLLVL  499

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
                  V PV    Y +  + P SG LSP+GYY+LFVVH+ +PS+GIWIQ++
Sbjct  500   -DAARVTPVSGPVYDVETLMPKSGLLSPSGYYLLFVVHQEVPSKGIWIQIM  549



>ref|XP_004291825.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/524 (63%), Positives = 399/524 (76%), Gaps = 5/524 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LLLPN+GI+AMHMQLL ND+VV+FDRTDFG SN+PL  GRCR +P +  +KVD
Sbjct  34    AAGGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLPLPNGRCRNNPNDTALKVD  93

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDVA N +RPL V +DVWCSS +V P GTL+QTGG+NDG+  VR ++PC    
Sbjct  94    CTAHSAEYDVAGNKIRPLFVYSDVWCSSGSVNPSGTLVQTGGFNDGEKRVRTYDPC--AT  151

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI NAL   RWYATNH LPDGRQIIIGGR EFNYEFYPK+ G    ++LPFL ET+
Sbjct  152   CDWKEIENALTNRRWYATNHELPDGRQIIIGGRREFNYEFYPKSGGSMNAHSLPFLVETS  211

Query  650   DPGA-ENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
             D  A ENNLYP+VFLNVDG+LFIFANN+AIL+DY    +V+ YP +P G PRSYPSTGSA
Sbjct  212   DGNAIENNLYPFVFLNVDGNLFIFANNRAILFDYAAGKIVKTYPTIPGGDPRSYPSTGSA  271

Query  827   VLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             VLLPLK+ +   + AEVL+CGGAPKG++  +  G F+ AL TC RI+ITDP+P W METM
Sbjct  272   VLLPLKSSKGQVVAAEVLVCGGAPKGSYVKAASGTFVEALKTCARIKITDPSPQWGMETM  331

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P+AR+MGDM  L NG++LIINGA  G+AG+  GRNPV  PV+Y  DN VG+RFE  NPS 
Sbjct  332   PLARVMGDMTLLANGDVLIINGAGSGTAGWELGRNPVLNPVVYKPDNAVGSRFEQQNPST  391

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHS AILLRD RVLVGGSNPH  Y F N  LFPTEL LEAFSP YL++  A IRP 
Sbjct  392   IPRMYHSAAILLRDGRVLVGGSNPHIRYEFSN-VLFPTELALEAFSPSYLESQFASIRPS  450

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
             I  P S    GYG+ + ++F+  G +  N V+VTMV+PSFTTHSFS +QRLL L     +
Sbjct  451   IFSPLSQVTVGYGQKLAVRFSITGKIALNSVSVTMVSPSFTTHSFSMNQRLLVLASENVI  510

Query  1547  KPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               VG   + +   TP +GNL+P+GYY+L+VVH+ IPSEGIW+++
Sbjct  511   A-VGNLKFEVQVTTPATGNLAPSGYYLLYVVHQQIPSEGIWVKI  553



>gb|EYU36763.1| hypothetical protein MIMGU_mgv1a004035mg [Erythranthe guttata]
Length=548

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/527 (64%), Positives = 398/527 (76%), Gaps = 7/527 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A+A GG+W++LL NIG++AMH+QLLNND+VVIFDRTDFG SNI L  G+CR DP +    
Sbjct  26    ASAAGGKWDVLLSNIGVSAMHIQLLNNDRVVIFDRTDFGSSNISLPAGKCRNDPNDTYST  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHSVEYDV  NTVRPL VQTD WCSS AV PDG+L+QTGG+NDGDH VR F PCND
Sbjct  86    VDCTAHSVEYDVVSNTVRPLTVQTDTWCSSGAVAPDGSLVQTGGYNDGDHAVRTFRPCND  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLL-YNLPFLA  640
               CDW EI   L + RWYATNHILPDG+QIIIGGR +F +EFYPKT   D   YNL FL 
Sbjct  146   SSCDWQEINPGLIKRRWYATNHILPDGKQIIIGGRRQFGFEFYPKTSPADYKSYNLSFLV  205

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             +T DP  ENNLYP+VFLN DG+LFIFANN+AIL++Y    VV+ YP +P G PRSYPS+G
Sbjct  206   QTYDPLIENNLYPFVFLNTDGNLFIFANNRAILFNYSNRVVVKTYPIIPGGDPRSYPSSG  265

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             SAVLLPLKN       AEVL+CGGAPK ++  +  G+F+ AL+TCGRIRI DPNP W +E
Sbjct  266   SAVLLPLKNNSG----AEVLVCGGAPKDSYVNATNGIFLPALDTCGRIRINDPNPQWVVE  321

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP  R+MGDMV LPNGN+LIINGA  G+AG+  GR+PV +PV+Y  D  + +RFE+ N 
Sbjct  322   TMPGPRVMGDMVLLPNGNVLIINGARSGTAGWEYGRDPVLSPVIYRPDKSIWSRFEVQNS  381

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S  PRMYHSTA+LLRD RVLVGG+NPH  Y F  G LFPT+L LEAFSP YLD+  A  R
Sbjct  382   STTPRMYHSTAVLLRDGRVLVGGNNPHAYYNF-TGVLFPTDLTLEAFSPSYLDSKFASSR  440

Query  1361  PHITLPGSHSKFGYGKVIEIQF-TAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             P I  P S S  GYG+ + I F  A+G + G+LV VTMVAPSFTTHSFS +QRLL L GG
Sbjct  441   PVIVTPVSPSVIGYGQELTIGFAVASGRIIGSLVKVTMVAPSFTTHSFSMNQRLLVLSGG  500

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                      TY +  +TPGSG L+P+GYY+LFVV++ IPSEGIW+Q+
Sbjct  501   NVTTSFDNTTYQIRVITPGSGILAPSGYYLLFVVYQEIPSEGIWVQI  547



>ref|XP_008367966.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/545 (61%), Positives = 409/545 (75%), Gaps = 16/545 (3%)
 Frame = +2

Query  47    LWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLS  226
             ++ LF+++    +  ++    A GG+W+LL  N+GI+AMHMQLL ND+V++FDRTDFG S
Sbjct  12    IFSLFILS----FQFSLTTTHAAGGKWQLLQQNVGISAMHMQLLYNDRVIMFDRTDFGKS  67

Query  227   NIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQ  406
             N+ L  G C        V+ DCTAHS EYDV  NTVRPL VQ+D+WCSS +V P+G LIQ
Sbjct  68    NLSLPNGTC--------VRNDCTAHSAEYDVTTNTVRPLTVQSDIWCSSGSVAPNGNLIQ  119

Query  407   TGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYE  586
             TGG++ G+  VRVF PC    CDW E  N L   RWYAT+HILPDGRQIIIGGR +FNYE
Sbjct  120   TGGYDIGERRVRVFKPCTG--CDWKEYENTLGVSRWYATDHILPDGRQIIIGGRGQFNYE  177

Query  587   FYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVV  766
             FYPKT     +Y+LPFL +TNDP  ENNLYPYVFLNVDG+LFIFANN+AIL DY+ + VV
Sbjct  178   FYPKTESSSNVYSLPFLVQTNDPNEENNLYPYVFLNVDGNLFIFANNRAILLDYVMNKVV  237

Query  767   RLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGAL  946
             ++YP +P G PRSYPSTGSAVLLPL+NL AP I AEVL+CGGAPKG++  + +G F+ AL
Sbjct  238   KIYPQIPGGDPRSYPSTGSAVLLPLRNLTAPSIEAEVLVCGGAPKGSYVQAIKGTFVEAL  297

Query  947   NTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTP  1126
             NTCGRI+I DP P W +ETMP AR+M DM+ LP+G ++IINGA+ G+AG+  G+NPV  P
Sbjct  298   NTCGRIKINDPKPQWVVETMPQARVMSDMLLLPDGTVVIINGASFGTAGWELGQNPVLEP  357

Query  1127  VLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTEL  1306
             ++Y  DN VG+RFE  NP+ IPRMYHSTA+LLRD RVLVGGSNPH  Y   +  LFPTEL
Sbjct  358   LVYRPDNAVGSRFEKQNPAPIPRMYHSTAVLLRDGRVLVGGSNPHDKYELAD-ELFPTEL  416

Query  1307  RLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSF  1486
             RLEAFS  YLDA  + +RP I  P S +K  YGK + I+F+  G +  NLV VT+VAPSF
Sbjct  417   RLEAFSXDYLDAKYSKLRPRIVDPKSQAKISYGKKLFIRFSLXGSIATNLVMVTIVAPSF  476

Query  1487  TTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGI  1666
              THSFS +QRLL L    TVK VG  TY +   TPGSGNL+P+GYY+L+VVH+ IPSEGI
Sbjct  477   NTHSFSMNQRLLVL-AAETVKKVGTMTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGI  535

Query  1667  WIQMV  1681
             W+Q++
Sbjct  536   WVQIL  540



>ref|XP_008338258.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/545 (61%), Positives = 408/545 (75%), Gaps = 16/545 (3%)
 Frame = +2

Query  47    LWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLS  226
             ++ LF+++    +  ++    A GG+W+LL  N+GI+AMHMQLL ND+V++FDRTDFG S
Sbjct  12    IFSLFILS----FQFSLTTTHAAGGKWQLLQQNVGISAMHMQLLYNDRVIMFDRTDFGKS  67

Query  227   NIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQ  406
             N+ L  G C        V+ DCTAHS EYDV  NTVRPL VQ+D+WCSS +V P+G LIQ
Sbjct  68    NLSLPNGTC--------VRNDCTAHSAEYDVTTNTVRPLTVQSDIWCSSGSVAPNGNLIQ  119

Query  407   TGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYE  586
             TGG++ G+  VRVF PC    CDW E  N L   RWYAT+HILPDGRQIIIGGR +FNYE
Sbjct  120   TGGYDIGERRVRVFKPCTG--CDWKEYENTLGVSRWYATDHILPDGRQIIIGGRXQFNYE  177

Query  587   FYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVV  766
             FYPKT     +Y+LPFL +TNDP  ENNLYPYVFLNVDG+LFIFANN+AIL DY+ + VV
Sbjct  178   FYPKTESSSNVYSLPFLVQTNDPNEENNLYPYVFLNVDGNLFIFANNRAILLDYVMNKVV  237

Query  767   RLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGAL  946
             + YP +P G PRSYPSTGSAVLLPL+NL AP I AEVL+CGGAPKG++  + +G F+ AL
Sbjct  238   KXYPQIPGGDPRSYPSTGSAVLLPLRNLTAPSIEAEVLVCGGAPKGSYXQAIKGTFVEAL  297

Query  947   NTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTP  1126
             NTCGRI+I DP P W +ETMP AR+M DM+ LP+G ++IINGA+ G+AG+  G+NPV  P
Sbjct  298   NTCGRIKINDPKPQWVVETMPQARVMSDMLLLPDGTVVIINGASFGTAGWELGQNPVLEP  357

Query  1127  VLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTEL  1306
             ++Y  DN VG+RFE  NP+ IPRMYHSTA+LLRD RVLVGGSNPH  Y   +  LFPTEL
Sbjct  358   LVYRPDNAVGSRFEKQNPAPIPRMYHSTAVLLRDGRVLVGGSNPHDKYELAD-ELFPTEL  416

Query  1307  RLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSF  1486
             RLEAFS  YLDA  + +RP I  P S +K  YGK + I+F+  G +  NLV VT+VAPSF
Sbjct  417   RLEAFSXDYLDAKYSKLRPRIVDPKSQAKISYGKKLFIRFSLXGSIATNLVMVTIVAPSF  476

Query  1487  TTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGI  1666
              THSFS +QRLL L    TVK VG  TY +   TPGSGNL+P+GYY+L+VVH+ IPSEGI
Sbjct  477   NTHSFSMNQRLLVL-AAETVKKVGTMTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGI  535

Query  1667  WIQMV  1681
             W+Q++
Sbjct  536   WVQIL  540



>ref|XP_011028961.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=598

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/527 (64%), Positives = 408/527 (77%), Gaps = 7/527 (1%)
 Frame = +2

Query  107   AAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKV  286
             AAGGG+W+LL  +IGI AMHMQLL+ND+VVI+DRTDFG SN+ L  G+CR D  E+V+K 
Sbjct  75    AAGGGQWQLLQNSIGITAMHMQLLSNDRVVIYDRTDFGRSNLSLPDGKCRNDSSELVIKY  134

Query  287   DCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDK  466
             DC+AHSVEYDV  N  RPLMVQ+DVWCSS AV+PDG+LIQTGG+NDG+  VR+F+PCN  
Sbjct  135   DCSAHSVEYDVLANRFRPLMVQSDVWCSSGAVVPDGSLIQTGGFNDGERKVRIFSPCNGA  194

Query  467   KCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAET  646
              CDW E+ + L   RWYAT+HILPDGRQIIIGGR +FNYEFYPK+   ++ Y+L FL ET
Sbjct  195   DCDWEEVGDGLKAKRWYATSHILPDGRQIIIGGRRQFNYEFYPKSSAPNV-YSLRFLMET  253

Query  647   NDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
             ND G ENNLYP VFLN DG+LFIFANN+AIL+D+  + VV+ YPA+P G PRSYPSTGSA
Sbjct  254   NDRGIENNLYPSVFLNGDGNLFIFANNRAILFDHKTNKVVKTYPAIPGGDPRSYPSTGSA  313

Query  827   VLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             VLLPLKNLQA  I AEVL+CGGAPKG+F   E+G F+ AL+TC RI+I DPNP W METM
Sbjct  314   VLLPLKNLQASTIEAEVLVCGGAPKGSFARVEKGNFVQALDTCARIKINDPNPRWVMETM  373

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P AR+MGDM  LPNGN+LIINGA  G+AG+ +GR+PV  PVLY  D+  G+RFE+ NPS 
Sbjct  374   PTARVMGDMTLLPNGNVLIINGAGAGTAGWENGRDPVLNPVLYRPDDASGSRFELQNPST  433

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHSTAILLRD R LVGGSNPH  Y F  G LFPTEL LEAFSPPYLD     +RP 
Sbjct  434   IPRMYHSTAILLRDGRGLVGGSNPHIGYEF-TGVLFPTELSLEAFSPPYLDPKFDDLRPK  492

Query  1367  ITLPGSHSK---FGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             I +  S SK    GYG+ + ++F     +  ++V+VTMVAP+F THSFS + RLL L G 
Sbjct  493   I-VSSSASKGKNIGYGQKLLVRFKVTSKIVIDMVSVTMVAPAFNTHSFSMNHRLLVL-GN  550

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               V  VG +TY +  +TP  G+L+P+G+YML+VVH+ IPSEG+W+++
Sbjct  551   EKVTDVGASTYDIQVMTPPPGDLAPSGHYMLYVVHQEIPSEGLWVKI  597



>ref|XP_010105252.1| hypothetical protein L484_019394 [Morus notabilis]
 gb|EXC04187.1| hypothetical protein L484_019394 [Morus notabilis]
Length=544

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/525 (62%), Positives = 396/525 (75%), Gaps = 3/525 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
              AA GGRW+LL  +IGI AMHMQLLNND+VVIFDRTDFG S + L  G+CR D ++  +K
Sbjct  22    TAAAGGRWQLLQKSIGIPAMHMQLLNNDRVVIFDRTDFGRSQLSLPDGKCRNDRFDTALK  81

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHS EYDV  NT R L VQTDVWCSS AVM DGTLIQTGG+NDG+  VRVF PC+ 
Sbjct  82    VDCTAHSAEYDVTSNTFRALTVQTDVWCSSGAVMADGTLIQTGGYNDGERRVRVFKPCDG  141

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
             + CDW EI   L   RWYATNHILP GRQIIIGGR +FNYE+YPK    ++ +NLPFL+E
Sbjct  142   RTCDWQEIDLGLSAKRWYATNHILPGGRQIIIGGRRQFNYEYYPKDTDKNV-HNLPFLSE  200

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TND G ENNLYP+VFLN DG+LF+FANN+AIL++Y ++ VV+ YP +P G PRSYPSTGS
Sbjct  201   TNDKGIENNLYPFVFLNTDGNLFVFANNRAILWNYARNQVVKRYPQIPGGDPRSYPSTGS  260

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLPLKN+QA  + AEVL+CGGAPKGA+  + R  F+ AL TC RI+ITDP P W +E 
Sbjct  261   AVLLPLKNIQARNVEAEVLVCGGAPKGAYVQAARKKFVEALKTCARIKITDPKPNWVVEN  320

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP AR+MGDM  LPNG++LIINGA  G+AG+ +  +PV  PVLY  DN  G+RFE  NP+
Sbjct  321   MPRARVMGDMALLPNGHVLIINGAGSGTAGWENAIDPVLNPVLYRPDNKAGSRFEDENPT  380

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
               PRMYHSTA+LLRD R+LVGGSNPH  Y F  G  FPT L LEAFSP YL+A  + +RP
Sbjct  381   TTPRMYHSTAVLLRDGRILVGGSNPHVGYNF-TGVTFPTTLSLEAFSPNYLEAKFSNVRP  439

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I LP SH+K  Y + + ++F   G V  NLV+VT+V+PSFTTHSFS +QRLL L   G 
Sbjct  440   RILLPTSHTKVKYAQKLFVRFRIGGNVAQNLVSVTLVSPSFTTHSFSMNQRLLVL-PRGQ  498

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             ++ +G  TYH+    P S  L+PAGYY+LFV H+ IPSEG+W+Q+
Sbjct  499   IRSLGKKTYHVEVAMPRSAILAPAGYYLLFVNHQEIPSEGVWVQL  543



>ref|XP_003589379.1| Galactose oxidase [Medicago truncatula]
 gb|AES59630.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=543

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/528 (63%), Positives = 400/528 (76%), Gaps = 7/528 (1%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             +  AAG G+W++L  +IGI AMHMQLL+ND++VIFDRTDFGLS +PL  G+CR DP E  
Sbjct  23    YLVAAGNGQWQVLQKSIGIVAMHMQLLHNDRIVIFDRTDFGLSKLPLPNGKCRHDPRETT  82

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
             VK DCTAHSVEY++  NT RPL VQTDVWCSS +V P GTL+QTGG+NDGD  +R+F+ C
Sbjct  83    VKTDCTAHSVEYNIKSNTFRPLFVQTDVWCSSGSVNPKGTLVQTGGYNDGDRTIRMFDTC  142

Query  458   NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFL  637
             N+  CDW E    L   RWYATNHILPDGRQIIIGGR++FNYEFYPK   G  +Y LPFL
Sbjct  143   NN--CDWQEFDGGLAARRWYATNHILPDGRQIIIGGRKQFNYEFYPKNNIG--VYRLPFL  198

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
              +TND GAENNLYP+V LNVDG+LFIFANN+AIL+DY K+ VVR +P +P G PRSYPS+
Sbjct  199   EQTNDAGAENNLYPFVILNVDGNLFIFANNRAILFDYTKNVVVRTFPQIPGGDPRSYPSS  258

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             GS VLLPLKNLQ+  I AEVLICGGAPKG++  + +  F+GALNTC RI+ITDPNP W +
Sbjct  259   GSGVLLPLKNLQSKFIEAEVLICGGAPKGSYQKASKREFLGALNTCARIKITDPNPTWVV  318

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP AR+MGDMV LPNG++LIINGA  G+AG+  GR+PV  PVLY T+NP+G RFE+ N
Sbjct  319   ETMPRARVMGDMVMLPNGDVLIINGAGSGTAGWEYGRDPVLNPVLYKTNNPIGARFELQN  378

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS  PRMYHSTAIL+RD RVLVGGSNPH  Y F N  LFPTEL +EAFSP YL+   A +
Sbjct  379   PSHTPRMYHSTAILVRDGRVLVGGSNPHIGYNF-NNVLFPTELSIEAFSPSYLEPRFANV  437

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I    S  +  +G+ + ++F     +D NLV VTM+AP F THSFS +QRLL L   
Sbjct  438   RPRIVASTSELQ-KHGQKLGLRFQVKAALDKNLVYVTMLAPPFNTHSFSMNQRLLVL-ES  495

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
               V  V   TY +    PGS  L+P G+Y+LFVVHK IPSEGIWIQ++
Sbjct  496   NKVNIVEGTTYDVQVTMPGSPILAPPGFYLLFVVHKEIPSEGIWIQIL  543



>ref|XP_009797024.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=558

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/560 (61%), Positives = 424/560 (76%), Gaps = 8/560 (1%)
 Frame = +2

Query  14    MGRRNFTLLFA--LWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNND  187
             M  R   +L +  LWQ  ++    P+  N  A AA GG WELL+ +IGI+AMHMQLLNND
Sbjct  1     MTTRTAVILLSNFLWQWPVLILLLPFHHNS-ANAAVGGTWELLMSDIGISAMHMQLLNND  59

Query  188   KVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWC  367
             +VV+FDRTDFG SNI L  G+CR +  ++ + VDCTAHSVE+DV  N+VRPLMVQT+VWC
Sbjct  60    RVVMFDRTDFGASNIALPNGKCRNNSNDLALIVDCTAHSVEFDVTTNSVRPLMVQTNVWC  119

Query  368   SSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK---CDWVEIPNALHRWRWYATNHILP  538
             SS +   DG+L+QTGG+NDG +VVRVF PC   K   CDW E+ N L + RWYATNH+LP
Sbjct  120   SSGSATSDGSLVQTGGFNDGINVVRVFKPCITGKRSTCDWQEMGNGLIQSRWYATNHMLP  179

Query  539   DGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIF  718
             DGRQIIIGGR  FNYEFYPKT   + +++LPFL +TNDP  ENNLYP+VFLNVDG+LFIF
Sbjct  180   DGRQIIIGGRAAFNYEFYPKTASTNNVFSLPFLEQTNDPMEENNLYPFVFLNVDGNLFIF  239

Query  719   ANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAP  898
             AN++AIL+DY  + VV+ YP +P G PR+YPSTGSAVLLPLKNLQ   I AE L+CGG P
Sbjct  240   ANDRAILFDYKSNTVVKTYPQIPGGDPRNYPSTGSAVLLPLKNLQEQTIQAEFLVCGGTP  299

Query  899   KGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAA  1078
             +G++  +  G F+GALNTCGRI ITDP+P W METMP+AR MGDM+ LPNGN+LI+NGAA
Sbjct  300   RGSYLKATTGDFLGALNTCGRITITDPDPQWTMETMPLARTMGDMIILPNGNVLILNGAA  359

Query  1079  QGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNP  1258
              G+AG+  GR+PV  PV+Y  DNP+ +RFE+ NP+ IPRMYHSTA+LLRD RVLVGGSNP
Sbjct  360   AGAAGWELGRDPVLCPVIYRPDNPLDSRFEVQNPNTIPRMYHSTAVLLRDGRVLVGGSNP  419

Query  1259  HPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAG  1438
             +  Y F  G LFPTEL LEAFSP YLD  +A +RP I  P S  KF YG+ + IQFT +G
Sbjct  420   NEFYNF-TGVLFPTELSLEAFSPSYLDPKSANLRPQIISPTSRHKFKYGQRVNIQFTVSG  478

Query  1439  PVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAG  1618
              ++ +L+ VTMVAP F THSF+ +QR+L L  G  V+ +G   Y ++ V P SG L+P G
Sbjct  479   LLNRDLIKVTMVAPGFNTHSFTMNQRMLVLSSGD-VRLIGKFVYQVSLVFPKSGKLAPPG  537

Query  1619  YYMLFVVHKGIPSEGIWIQM  1678
             YYMLFVVH+ IPSEGIW+++
Sbjct  538   YYMLFVVHQDIPSEGIWVRI  557



>ref|XP_008221409.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=540

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/526 (62%), Positives = 401/526 (76%), Gaps = 12/526 (2%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG+W+LL  NIGI+AMHMQLL+ND+VV+FDRT+FG SN+ L  G+C        V 
Sbjct  27    AHAAGGKWQLLQQNIGISAMHMQLLHNDRVVLFDRTNFGNSNLSLPDGKC--------VG  78

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHS EYDV  NT RPL + +DVWCSS +V PDG LIQTGG+ +G+  VR+F PC  
Sbjct  79    NDCTAHSAEYDVTTNTFRPLTLLSDVWCSSGSVAPDGRLIQTGGFTNGERRVRIFEPCTG  138

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW EI N L   RWYAT+HILPDGRQIIIGGR +FNYEFYPK+   + +++LPFL +
Sbjct  139   --CDWKEIENGLAARRWYATDHILPDGRQIIIGGRRQFNYEFYPKSASTNKVFSLPFLVQ  196

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TNDP AENNLYP+VFLNVDG+LFIFANN+AIL+DY+K+ VV+ YP +P G PRSYPSTGS
Sbjct  197   TNDPDAENNLYPFVFLNVDGNLFIFANNRAILFDYVKNNVVKTYPQIPGGDPRSYPSTGS  256

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLPLKNL+A  I AEVL+CGGAP G++  + +G F GALNTC RI+ITDPNP W +ET
Sbjct  257   AVLLPLKNLKARSIEAEVLVCGGAPTGSYIKATKGTFTGALNTCARIKITDPNPQWVLET  316

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP AR+MGDM  LP+G +L+INGA+ G+AG+  GRNPV  PV+Y  DN VG+RFE  NP+
Sbjct  317   MPQARVMGDMTLLPDGTVLLINGASNGAAGWELGRNPVLNPVVYRPDNAVGSRFEQQNPT  376

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHSTA+LLRD RVLVGGSNPHP+Y F N  LFPTEL +EAF+P YLDA    +RP
Sbjct  377   TIPRMYHSTAVLLRDGRVLVGGSNPHPDYEFTN-VLFPTELSVEAFNPDYLDAKYTNVRP  435

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I    S +K  YGK + I+F+  G +  N V+VTMVAPSFTTHSFS + R L L     
Sbjct  436   KIVSSISQAKINYGKKLTIRFSVMGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLASEN-  494

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             VK VG + Y +   TP SGNL+P+GYY+L+VVH+ IPS+GIW+Q++
Sbjct  495   VKSVGKSAYEVEVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQIM  540



>ref|XP_010105253.1| hypothetical protein L484_019396 [Morus notabilis]
 gb|EXC04188.1| hypothetical protein L484_019396 [Morus notabilis]
Length=548

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/523 (63%), Positives = 402/523 (77%), Gaps = 6/523 (1%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             GRW+ L  +IG++AMHMQLLN D+VVIFDRTDFG SN+ L  G+CR DP +  +K+DCTA
Sbjct  28    GRWQTLQTSIGVSAMHMQLLNTDRVVIFDRTDFGKSNLSLPDGKCRNDPNDTALKIDCTA  87

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDW  478
             HSVEYDV  NT RPLMVQTDVWCSS A+ PDGTL+QTGG+NDG+  VR+F PC+   CDW
Sbjct  88    HSVEYDVVSNTFRPLMVQTDVWCSSGALTPDGTLVQTGGFNDGERRVRIFKPCSTGGCDW  147

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNLPFLAETNDP  655
             +EI   L   RWYAT+HILPDG+ I+IGGR +FNYEFYPKT       Y+LPFL +TND 
Sbjct  148   LEIEFGLAARRWYATDHILPDGQVIVIGGRRQFNYEFYPKTTSSAKNPYSLPFLVQTNDA  207

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP+VFLNVDG+LFIFANN+AIL DY K+ V++ YP +P G PRSYPSTGSAVLL
Sbjct  208   KIENNLYPFVFLNVDGNLFIFANNRAILLDYTKNQVLKTYPQIPGGDPRSYPSTGSAVLL  267

Query  836   PLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMA  1015
             PLKNLQA  I AEVL+CGGAPKGA+  +  G F+GAL +C R++ITDPNP W ME MP+A
Sbjct  268   PLKNLQAQLIEAEVLVCGGAPKGAYVQAVNGNFVGALKSCARMKITDPNPTWVMEDMPLA  327

Query  1016  RLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPR  1195
             R+MGDM  LPNGN+LIING A G+AG+  GR+PV +P+LY  D  +G+RFE+ NPS IPR
Sbjct  328   RVMGDMTLLPNGNVLIINGGAAGTAGWEYGRDPVLSPILYRPDKLIGSRFEVQNPSSIPR  387

Query  1196  MYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITL  1375
             MYHSTAILLRD RVLVGGSNPH  Y F  G LFPT+L LE+FSP YLDA  + +RP I  
Sbjct  388   MYHSTAILLRDGRVLVGGSNPHIYYNF-TGVLFPTDLSLESFSPQYLDAQFSNLRPKIVS  446

Query  1376  PGSHSKFGYGKVIEIQFTAAGP--VDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
             P S SK  Y   + ++FT +G   + G+ V VTMVAPSFTTHSFS +QRLL L    ++ 
Sbjct  447   PPSQSKVSYLNKLAVRFTVSGATLLPGS-VAVTMVAPSFTTHSFSMNQRLLVL-SAESMT  504

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              +G +TY +   TPGSG L+P+GYY+ FVVH+ IPS+GIW+Q+
Sbjct  505   SLGKSTYEVRVTTPGSGILAPSGYYLWFVVHQEIPSDGIWVQI  547



>ref|XP_003527766.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=558

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/528 (63%), Positives = 403/528 (76%), Gaps = 6/528 (1%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A AA  G+W+LL  NIGI AMHMQLL+ND+V+IFDRTDFGLSN+ L  GRCR +P E+VV
Sbjct  36    AEAAAKGQWQLLHKNIGIVAMHMQLLHNDRVIIFDRTDFGLSNLTLPDGRCRNNPNEMVV  95

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             K DCTAHSVEYDV  NT R L VQT+VWCSSA+  PDGTL+QTGG+NDGD  VR F PC 
Sbjct  96    KTDCTAHSVEYDVVANTFRALFVQTNVWCSSASASPDGTLVQTGGFNDGDRAVRTFTPC-  154

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
              + CDW EI + L   RWYATNHILPDGRQIIIGGR +FNYEFYPKT   +  Y+LPFL 
Sbjct  155   -RTCDWKEIDDGLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKTQAKNT-YSLPFLV  212

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             +TND  AENNLYP+VFLNVDG+LFIF+NN+AIL+DY K++VVR YP +P G PR YPSTG
Sbjct  213   QTNDANAENNLYPFVFLNVDGNLFIFSNNRAILFDYNKNSVVRTYPQIPGGDPRCYPSTG  272

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             SAVLLPLKNL+AP + AEVLICGGAP+GA+  +  G F+ AL TC RI+ITDPNP W ME
Sbjct  273   SAVLLPLKNLRAPKVEAEVLICGGAPRGAYQNALSGKFVPALETCARIKITDPNPKWDME  332

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP AR+M DMV LPNG++LI+NGAA G+AG+  GRNP+ +P LY  +N VG+RFE+   
Sbjct  333   TMPGARVMSDMVLLPNGDVLIVNGAAVGTAGWELGRNPLLSPFLYKPNNRVGSRFEVQTS  392

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHS+A+LLRD RVLV GSNPH  Y F N  LFPTELRLEAFSP YL+   + +R
Sbjct  393   SDIPRMYHSSAVLLRDGRVLVAGSNPHIYYKFTN-VLFPTELRLEAFSPWYLEPGFSSVR  451

Query  1361  PHITLPGSHSKFGYGKVIEIQFTA-AGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             P I  P S +K  YG+ + ++F   +  + G+ V+VTM++P F THSFS +QR+L L   
Sbjct  452   PTIVFPASQTKLKYGQTLRLRFEVMSATLVGDSVSVTMLSPPFNTHSFSMNQRMLVLEPH  511

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
                K VG +TY +    P S  L+P G+Y+LF+VH+ IPS+GIW+QMV
Sbjct  512   DLSK-VGESTYEVEVTAPVSAVLAPPGFYLLFLVHQEIPSQGIWVQMV  558



>ref|XP_009337676.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/524 (63%), Positives = 390/524 (74%), Gaps = 12/524 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LL  ++GI+AMHMQLL ND+VV+FDRTDFG SN+ L  G C        V+ D
Sbjct  22    AAGGKWQLLQQSVGISAMHMQLLRNDRVVMFDRTDFGKSNLSLPNGEC--------VRND  73

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDV  NTVR L + TDVWCSS AV P+G LIQTGG+ DG+  VRVF PC    
Sbjct  74    CTAHSAEYDVKTNTVRALSLLTDVWCSSGAVAPNGRLIQTGGYGDGERNVRVFEPCTG--  131

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW E  NAL   RWYAT+HILP+GRQIIIGGR EFNYEFYPKT     +Y+LPFL +T+
Sbjct  132   CDWKEFENALGARRWYATDHILPNGRQIIIGGRREFNYEFYPKTGSSSKVYSLPFLVQTD  191

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYP+VFLNVDG+LFIFANN+AIL+DY K+ VV+ YP +P G PR YPSTGSAV
Sbjct  192   DAGEENNLYPFVFLNVDGNLFIFANNRAILFDYAKNNVVKTYPQIPGGDPRCYPSTGSAV  251

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL AP + AEVL+CGGAPKG+F  + +G F+ ALNTC RI I +P P W METMP
Sbjct  252   LLPLKNLAAPSVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARININNPKPQWVMETMP  311

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM+ LP+G +L+INGA+ G+AGY  GRNPV  PV+Y  DN +G+RFE  NP+ I
Sbjct  312   QARVMGDMLLLPDGTVLLINGASSGTAGYEIGRNPVLNPVVYRPDNAIGSRFEQQNPTTI  371

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH  Y F N  LFPTELRLEAFSP YLDA    +RP I
Sbjct  372   PRMYHSTAILLRDGRVLVGGSNPHEKYEFTN-VLFPTELRLEAFSPDYLDAKYNNLRPQI  430

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S +K  YGK + IQF   G +    V+V+MVAPSF THSFS +QRLL L     VK
Sbjct  431   VAPISQAKINYGKKLSIQFLVKGNLATKSVSVSMVAPSFNTHSFSMNQRLLVL-EAENVK  489

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              VG   Y +   TP SGNL+P+GYY+L+VVH+ IPS  IW+Q++
Sbjct  490   KVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQIL  533



>ref|XP_007017717.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14942.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/549 (61%), Positives = 407/549 (74%), Gaps = 7/549 (1%)
 Frame = +2

Query  32    TLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRT  211
             T +F++    L+ A  P  R +  AA   GRW+LL  +IG++AMHMQLL ND+VV+FDRT
Sbjct  4     TFIFSILLFQLLFASQPCHRVLTTAA--DGRWQLLQKSIGVSAMHMQLLRNDRVVMFDRT  61

Query  212   DFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPD  391
             DFG SN+ L  G+C  +     +  DCTAHSVEY+V  N  R LMVQTDVWCSS A+MPD
Sbjct  62    DFGKSNLSLPNGKCLTNSSNTALPADCTAHSVEYNVLTNEFRALMVQTDVWCSSGAIMPD  121

Query  392   GTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             G L+QTGG+N+G+  VRVF+PC+   CDW EIPN L   RWYA+NHILPDGRQII+GGR 
Sbjct  122   GNLVQTGGFNNGERRVRVFSPCS--TCDWQEIPNRLAAKRWYASNHILPDGRQIIVGGRG  179

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             +FNYEF PKT   +  +NLPFL+ETND G ENNLYP+VFLNVDG+LFIFANN+AIL DY+
Sbjct  180   QFNYEFIPKTFAANT-FNLPFLSETNDRGVENNLYPFVFLNVDGNLFIFANNRAILLDYV  238

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
              + VV+ YP +P G PRSYPSTGSAVLLPLKNL+A  I AEV +CGGAPKG++  + +G 
Sbjct  239   NNKVVKTYPTIPGGNPRSYPSTGSAVLLPLKNLKASAIQAEVFVCGGAPKGSYVQALKGN  298

Query  932   FMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRN  1111
             F+GALNTC R+ ITDPNP W METMPMAR+M DM+ LPNG +LIINGA  GSAG+  GR+
Sbjct  299   FIGALNTCARMTITDPNPQWVMETMPMARVMSDMILLPNGKVLIINGAGSGSAGWELGRD  358

Query  1112  PVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGAL  1291
             PV +PV+Y  DN +G+RFE   P+ IPRMYHS  +LLRD RVLVGGSNPH  Y F  G L
Sbjct  359   PVLSPVMYLPDNEIGSRFETQTPTTIPRMYHSAVVLLRDGRVLVGGSNPHAFYNF-TGVL  417

Query  1292  FPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTM  1471
             FPTEL LEAFSP Y+D+    +RP I  P S       K + +Q    G VD NLV+VTM
Sbjct  418   FPTELSLEAFSPAYMDSEFNDLRPTIVAPKSMFGIQIRKKLSVQVQITGKVDPNLVSVTM  477

Query  1472  VAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGI  1651
             VAPSFTTHSFS +QR+LDLG    V   G +TY++   TP S NL+PAG+Y+LFVVH+ I
Sbjct  478   VAPSFTTHSFSMNQRVLDLGNDN-VTASGNSTYNIEYTTPRSYNLAPAGFYLLFVVHQDI  536

Query  1652  PSEGIWIQM  1678
             PS+ IW+++
Sbjct  537   PSQAIWVKL  545



>ref|XP_010111102.1| hypothetical protein L484_008478 [Morus notabilis]
 gb|EXC30148.1| hypothetical protein L484_008478 [Morus notabilis]
Length=544

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/524 (62%), Positives = 393/524 (75%), Gaps = 3/524 (1%)
 Frame = +2

Query  107   AAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKV  286
             AA GGRW+LL  +IGI AMHMQLLNND+VVIFDRTDFG S + L  G+CR D ++  +KV
Sbjct  23    AAAGGRWQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGRSQLSLPDGKCRNDRFDTALKV  82

Query  287   DCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDK  466
             DCTAHS EYDV  NT R L VQTDVWCSS AV+ DGTLIQTGG+NDG+  VRVF PC+ +
Sbjct  83    DCTAHSAEYDVTSNTFRALTVQTDVWCSSGAVIADGTLIQTGGYNDGERRVRVFKPCDGR  142

Query  467   KCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAET  646
              CDW EI   L   RWYATNHILPDGRQIIIGGR +FNYE+YPK    ++ +NLPFL+ET
Sbjct  143   TCDWQEIDLGLSAKRWYATNHILPDGRQIIIGGRRQFNYEYYPKDTDKNV-HNLPFLSET  201

Query  647   NDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
             ND   ENNLYP+VFLN DG+LF+FANN+AIL++Y  + VV+ YP +P G PRSYPSTGSA
Sbjct  202   NDKRIENNLYPFVFLNTDGNLFVFANNRAILWNYASNQVVKTYPQIPGGDPRSYPSTGSA  261

Query  827   VLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             VLLPLKN+QA  + AEVL+CGGAPKGA+  + R  F+ AL TC RI+ITDPNP W +E M
Sbjct  262   VLLPLKNIQARNVKAEVLVCGGAPKGAYVQAARKKFVEALKTCARIKITDPNPNWVVENM  321

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P AR+MGDM  LPNG++LIINGA  G+AG+ +  +PV  PVLY  DN  G+RFE+ NP+ 
Sbjct  322   PRARVMGDMALLPNGHVLIINGAGSGTAGWENAIDPVLNPVLYRPDNKAGSRFEVENPTK  381

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
              PRMYHS A+LLRD R+LVGGSNPH  Y F  G  FPT L LEAFSP YL    + +RP 
Sbjct  382   TPRMYHSAAMLLRDGRILVGGSNPHAGYNF-TGVTFPTTLSLEAFSPNYLGEEFSNVRPR  440

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
             I LP SH+K  Y + + ++F   G V  NLV+VT+V+PSFTTHSFS +QRLL L   G +
Sbjct  441   ILLPTSHTKVKYAQKLFVRFRIGGNVAQNLVSVTLVSPSFTTHSFSMNQRLLVL-PSGQI  499

Query  1547  KPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             + +G  TY +    P S  L+PAGYY+LFV H+ IPSEG+W+Q+
Sbjct  500   RSLGKKTYDVEVAMPRSAILAPAGYYLLFVNHQEIPSEGVWVQL  543



>ref|XP_011045139.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=549

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/532 (64%), Positives = 404/532 (76%), Gaps = 8/532 (2%)
 Frame = +2

Query  95    MFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEV  274
             +  +AAGGGRW+LL  +IGI AMHMQLLNND VVI+DRTDFG SN+ L GG+CR D  E+
Sbjct  23    VVTSAAGGGRWQLLQKSIGIVAMHMQLLNNDHVVIYDRTDFGRSNLSLPGGKCRDDSSEI  82

Query  275   VVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNP  454
             VVK DCTAHSV+YDV  N  RPLMVQTDVWCSS AV PDG+LIQTGG++DG+  VR F P
Sbjct  83    VVKHDCTAHSVDYDVLANKFRPLMVQTDVWCSSGAVFPDGSLIQTGGFSDGERKVRTFYP  142

Query  455   CNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
             C    CDWVE  N L   RWYATNHILPDG+QIIIGGR +FNYEFYPKT   ++ Y+LPF
Sbjct  143   CKGD-CDWVETGNGLKAKRWYATNHILPDGKQIIIGGRRQFNYEFYPKTSSPNV-YSLPF  200

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L +TND G ENNLYP+VFLN DG+LFIFANN+AIL+DY    VV+ YPA+P G PRSYPS
Sbjct  201   LLQTNDRGIENNLYPFVFLNSDGNLFIFANNRAILFDYKTGKVVKTYPAIPGGDPRSYPS  260

Query  815   TGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWF  994
             TGSAVLLPLKNL A  I AEVL+CGGAPKG+F    +G F+ AL+TCGRI+I DPNP W 
Sbjct  261   TGSAVLLPLKNLDAATIAAEVLVCGGAPKGSFEKVAKGNFVKALDTCGRIKINDPNPQWV  320

Query  995   METMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEIL  1174
             METMP AR+MGDM  LPNG +LIINGA  G+AG+  GRNPV  P+LY  +   G+RFE L
Sbjct  321   METMPHARVMGDMTLLPNGVVLIINGAGAGTAGWESGRNPVLNPILYWPNGAAGSRFESL  380

Query  1175  NPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAG  1354
             NP+ IPR+YHSTAILLRD RVLVGGSNPH  Y F  G LFP+EL LEAFSPPYLDA    
Sbjct  381   NPNTIPRVYHSTAILLRDGRVLVGGSNPHIGYEF-KGVLFPSELSLEAFSPPYLDAQHNY  439

Query  1355  IRPHITLPGSHSK---FGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLD  1525
             +RP I L  + SK    GYG+ + ++F   G +  + ++VTMVAP+F THSFS + RLL 
Sbjct  440   VRPTI-LSSTASKGKYIGYGQKLLVRFKVTGKLMADKISVTMVAPAFNTHSFSMNHRLLV  498

Query  1526  LGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             L G   V  VG +TY +   TP SG L+P+G+Y+L+VVH+ IPS GIW++++
Sbjct  499   L-GNTKVTSVGTSTYDVQVTTPRSGYLAPSGHYILYVVHQYIPSTGIWVKIM  549



>ref|XP_006342230.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/527 (63%), Positives = 409/527 (78%), Gaps = 6/527 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG+W+LL+ NIGI+AMHMQLLNND+V+++DRTDFG SNI L  G+CR +P ++ +K
Sbjct  30    AYAAGGKWDLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPNGKCRNNPKDLALK  89

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHSVEYDV+ N++RPLMVQTDVWCSS +   DGTL+QTGG+NDG ++VR F PC+ 
Sbjct  90    VDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGRNMVRTFKPCS-  148

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW EI   L + RWY+ N ILPDGRQIIIGGR+ FNYEFYPKT   + +++LPF+ +
Sbjct  149   -TCDWQEIGTGLIQGRWYSANQILPDGRQIIIGGRDAFNYEFYPKTASTNKVFSLPFIQQ  207

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TN P  ENNLYP+VFLNVDG+LFIFANN+AIL DY  + +V+ YP +P G PR+YPSTGS
Sbjct  208   TNVPKEENNLYPFVFLNVDGNLFIFANNRAILLDYTTNTIVKTYPQIPGGDPRNYPSTGS  267

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERG-VFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPLKNLQA  I AEVL+CGGAP G++  + R   F+GALNTCGRI ITDPNP W ME
Sbjct  268   AVLLPLKNLQAQTIQAEVLVCGGAPIGSYLKAARANTFVGALNTCGRITITDPNPQWTME  327

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP+AR MGDMV LPNGNILI+NGAA G+AG+G  RNPV +PV+Y  DNP G+RFE+ NP
Sbjct  328   TMPLARTMGDMVILPNGNILIVNGAAAGTAGWGIARNPVLSPVIYRPDNPFGSRFEVQNP  387

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             + IPRMYHST +LLRD RVLVGGSNP+  Y F    LFPT+L LEAFSP YLD+ +  +R
Sbjct  388   NAIPRMYHSTTVLLRDGRVLVGGSNPNELYNFTR-VLFPTDLSLEAFSPSYLDSNSTNLR  446

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGP-VDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             P I  P SH    YG+ + I+FT +G  ++ NL+ VTMVAP F THS + +QR+L L   
Sbjct  447   PQIISPASHKTIKYGQRVNIRFTLSGSLLNTNLIKVTMVAPGFNTHSNTMNQRMLVL-SS  505

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               +K  GI TY ++++ P SG L+P GYYMLFVV++ IPSEGIWI++
Sbjct  506   EKIKKTGIFTYQISSIFPNSGKLAPPGYYMLFVVNQDIPSEGIWIKI  552



>ref|XP_009607831.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=558

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/529 (63%), Positives = 410/529 (78%), Gaps = 5/529 (1%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A AA GG WELL+ +IGI+AMHMQLLNND+VV+FDRTDFG SNI L  G+CR +  ++ +
Sbjct  31    ANAAVGGTWELLMSDIGISAMHMQLLNNDRVVMFDRTDFGASNIALPNGKCRNNSNDLAL  90

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
              VDCTAHSVE+D+  N+VRPLMVQT+VWCSS +   DG+L+QTGG+NDG +VVRVF PC 
Sbjct  91    IVDCTAHSVEFDITTNSVRPLMVQTNVWCSSGSATSDGSLVQTGGFNDGVNVVRVFKPCI  150

Query  461   DKK---CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLP  631
               K   CDW E+ N L + RWYATNH+LPDGRQIIIGGR  FNYEFYPKT   + +++LP
Sbjct  151   TGKRSTCDWQEMGNGLIQSRWYATNHMLPDGRQIIIGGRAAFNYEFYPKTASTNNVFSLP  210

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL +TNDP  ENNLYP+VFLNVDG+LFIFAN++AIL+DY  + VV+ YP +P   PR+YP
Sbjct  211   FLEQTNDPMEENNLYPFVFLNVDGNLFIFANDRAILFDYTTNTVVKTYPQIPGSDPRNYP  270

Query  812   STGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVW  991
             STGSAVLLPLKNLQA  I AE L+CGG P+G++  +  G F+GALNTCGRI ITDP+P W
Sbjct  271   STGSAVLLPLKNLQAQTIQAEFLVCGGTPRGSYLKATTGDFLGALNTCGRITITDPDPQW  330

Query  992   FMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
              METMP+AR MGDMV LPNGN+LI+NGAA G+AG+  GR+PV  PV+Y  DNP+ +RFE+
Sbjct  331   TMETMPLARTMGDMVILPNGNVLILNGAAAGAAGWELGRDPVLCPVIYRPDNPLDSRFEV  390

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
              NP+ IPRMYHST +LLRD RVLVGGSNP+  Y F  G LFPTEL LEAFSP YLD+ +A
Sbjct  391   QNPNIIPRMYHSTTVLLRDGRVLVGGSNPNEFYNF-TGVLFPTELSLEAFSPSYLDSESA  449

Query  1352  GIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
              +RP I    S  KF YG+ + IQFT +G V+ +L+ VTMVAP F THSF+ +QR+L L 
Sbjct  450   NLRPQIISSTSRHKFKYGQGVNIQFTVSGLVNRDLIKVTMVAPGFNTHSFTMNQRMLVLS  509

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              G  V+ +G   Y ++ V P SG L+P GYYMLFVVH+ IPSEGIW+++
Sbjct  510   SGD-VRLIGKFVYQVSLVFPKSGKLAPPGYYMLFVVHQDIPSEGIWVRI  557



>ref|XP_009337669.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/524 (63%), Positives = 390/524 (74%), Gaps = 12/524 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LL  ++GI+AMHMQLL ND+VV+FDRTDFG SN+PL  G C        V+ D
Sbjct  22    AAGGKWQLLQQSVGISAMHMQLLRNDRVVMFDRTDFGKSNLPLPNGEC--------VRND  73

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDV  NTVRPL + TDVWCSS AV P+G LIQTGG  DG+  VRVF PC    
Sbjct  74    CTAHSAEYDVKTNTVRPLTLLTDVWCSSGAVAPNGRLIQTGGNGDGERNVRVFEPCTG--  131

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW E  N L   RWYAT+HILP+GRQIIIGGR EFNYEFYPKT     +Y+LPFL +T+
Sbjct  132   CDWKEFENGLGARRWYATDHILPNGRQIIIGGRREFNYEFYPKTGSSSKVYSLPFLVQTD  191

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYP+VFLNVDG+LFIFANN+AIL+DY K+ VV+ YP +P G PR YPSTGSAV
Sbjct  192   DAGEENNLYPFVFLNVDGNLFIFANNRAILFDYAKNNVVKTYPQIPGGDPRCYPSTGSAV  251

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL AP + AEVL+CGGAPKG+F  + +G F+ ALNTC RI I +P P W METMP
Sbjct  252   LLPLKNLAAPAVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARININNPKPQWVMETMP  311

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM+ LP+G +L+INGA+ G+AG+  GRNPV  PV+Y  DN +G+RFE  NP+ I
Sbjct  312   QARVMGDMLLLPDGTVLLINGASSGTAGWEIGRNPVLNPVVYRPDNAIGSRFEQQNPTTI  371

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH  Y F N  LFPTELRLEAFSP YL A    +RP I
Sbjct  372   PRMYHSTAILLRDGRVLVGGSNPHEKYEFTN-VLFPTELRLEAFSPDYLGAKYNNLRPQI  430

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S +K  YGK + IQF+  G +    V+V+MVAPSF THSFS +QRLL L     VK
Sbjct  431   VAPISQAKINYGKKLSIQFSVKGNLATKSVSVSMVAPSFNTHSFSMNQRLLVL-EAENVK  489

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              VG   Y +   TP SGNL+P+GYY+L+VVH+ IPS  IW+Q++
Sbjct  490   KVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQIL  533



>ref|XP_009625411.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase-like [Nicotiana 
tomentosiformis]
Length=550

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/553 (60%), Positives = 426/553 (77%), Gaps = 7/553 (1%)
 Frame = +2

Query  20    RRNFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVI  199
             R     L  LWQL L+   P + +N+  A A GG+W+LL+ NIGI+AMHMQLLNND+V++
Sbjct  4     RTTTPFLNILWQLLLLLLLP-FHQNL--ANAAGGQWQLLMSNIGISAMHMQLLNNDRVIM  60

Query  200   FDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAA  379
             +DRTDFG SNI L  G+CR +P ++ +KVDCTAHSVEYDV+ N+VRPLMVQTDVWCSS +
Sbjct  61    YDRTDFGASNISLPNGKCRNNPNDLALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGS  120

Query  380   VMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIII  559
             V  DG+L+QTGG+NDG+ +VRV  PC+   CDW E+ + L + RWY+TNHILPDGRQIII
Sbjct  121   VDSDGSLVQTGGFNDGERMVRVVKPCS--TCDWQEMGSNLIQSRWYSTNHILPDGRQIII  178

Query  560   GGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAIL  739
             GGR+ FNYEFYPKT   + +++LPFL +TN+P  ENNL+P+VF NVDG+LFIFAN++AIL
Sbjct  179   GGRKAFNYEFYPKTASTNNVFSLPFLQQTNNPREENNLFPFVFXNVDGNLFIFANDRAIL  238

Query  740   YDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPAS  919
             +DY  + VV+ YP +P G PR+YPS+ SAVLLPLKNL+   + AEVL+CGGAP+G++P +
Sbjct  239   FDYKANKVVKTYPQIPGGDPRNYPSSDSAVLLPLKNLRTQKVQAEVLVCGGAPRGSYPKA  298

Query  920   ERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYG  1099
             ++G F+GALNTCGRI ITDPNP W METMP+AR MGDMV LPNGN+LIINGAA G+AG+ 
Sbjct  299   DKGEFIGALNTCGRITITDPNPQWTMETMPLARTMGDMVILPNGNVLIINGAAAGTAGWQ  358

Query  1100  DGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFG  1279
                 PV +PV+Y  DNP+G+RFE+ N + IPR+YHSTAILLRD RVL GGSNP+  Y F 
Sbjct  359   IAGKPVLSPVIYRPDNPLGSRFEVQNSNVIPRIYHSTAILLRDGRVLTGGSNPNEFYNF-  417

Query  1280  NGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLV  1459
              G LFPT+L LEAFSP YLD  +A +R  I    S  K  YG+ + I+FT +G ++ +LV
Sbjct  418   TGVLFPTDLSLEAFSPSYLDPESANLRSQIISLASRHKTKYGQSVSIRFTVSGLLNTDLV  477

Query  1460  TVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVV  1639
              VTMVAP F THS + +QR+L L   G V+ +G +TYH+  + P SG L+P GYYMLFVV
Sbjct  478   KVTMVAPGFNTHSNTMNQRMLVL-SSGKVRRIGKSTYHINLIFPSSGKLAPPGYYMLFVV  536

Query  1640  HKGIPSEGIWIQM  1678
             H+ IPS+GIW+++
Sbjct  537   HQDIPSKGIWVKI  549



>ref|XP_007136064.1| hypothetical protein PHAVU_009G014800g [Phaseolus vulgaris]
 gb|ESW08058.1| hypothetical protein PHAVU_009G014800g [Phaseolus vulgaris]
Length=568

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/545 (61%), Positives = 398/545 (73%), Gaps = 12/545 (2%)
 Frame = +2

Query  47    LWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLS  226
             ++ + L+A P P       A AG G+W LL  +IGI  MHMQLL+ND+VVI DRTDFG S
Sbjct  14    IFHILLLAPPSP-------AEAGNGQWHLLQESIGIVGMHMQLLHNDRVVILDRTDFGFS  66

Query  227   NIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQ  406
             N+ L  GRCR +P E+VVK DCTAHS+EYDVA N  R L VQT+VWCSS +V PDGTL+Q
Sbjct  67    NLSLPNGRCRNNPNEMVVKTDCTAHSIEYDVAVNKFRSLFVQTNVWCSSGSVSPDGTLVQ  126

Query  407   TGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYE  586
             TGG+NDGD  VR   PC  + CDW E+ N L   RWYATNHILPDGRQIIIGGR +FNYE
Sbjct  127   TGGFNDGDRAVRALTPC--RTCDWREVDNGLSARRWYATNHILPDGRQIIIGGRRQFNYE  184

Query  587   FYPKTPG-GDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAV  763
             FYPKT       Y+LPFL +TND  AENNLYP+VFLNVDG+LFIFANN+AIL+DY K++V
Sbjct  185   FYPKTQSTAKNTYSLPFLVQTNDASAENNLYPFVFLNVDGNLFIFANNRAILFDYNKNSV  244

Query  764   VRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGA  943
             V  YP +P G PR YPSTGSAVLLPLKNL+   + AEVLICGGAP+GAF  S  G F GA
Sbjct  245   VTTYPQIPGGDPRCYPSTGSAVLLPLKNLRESKVEAEVLICGGAPRGAFTDSLSGRFTGA  304

Query  944   LNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQT  1123
             L TC RI+ITDP P W METMP  R+M DMV LPNG++LI+NGA+ G+AG+  GRNPV  
Sbjct  305   LKTCARIKITDPKPSWVMETMPGGRVMSDMVLLPNGDVLIVNGASVGTAGWELGRNPVLN  364

Query  1124  PVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTE  1303
             P LY   N +G+RFE+ NPS IPRMYHS+A+LLRD RVLV GSNPH  Y F N  +FPTE
Sbjct  365   PFLYKPSNRIGSRFELQNPSSIPRMYHSSAVLLRDGRVLVAGSNPHTYYNFTN-VMFPTE  423

Query  1304  LRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPS  1483
             LRLEAFSP YL+   + +RP I  P S +K  YG+ +++ F     ++ + V+VTM+AP 
Sbjct  424   LRLEAFSPAYLEPGFSNVRPTIVSPSSQTKVKYGETLKVGFEVIASLNNDSVSVTMLAPP  483

Query  1484  FTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEG  1663
             F THSFS +QRLL L      K VG +TY +    PGS  L+P G+Y+LFVVH+ IPS G
Sbjct  484   FATHSFSMNQRLLVLEPQNLSK-VGESTYEVEVTAPGSSVLAPPGFYLLFVVHREIPSHG  542

Query  1664  IWIQM  1678
             IW++M
Sbjct  543   IWVRM  547



>ref|XP_004238324.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=545

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/527 (63%), Positives = 410/527 (78%), Gaps = 9/527 (2%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG+W+LL+ NIGI+AMHMQLLNND+V+I+DRTDFG SNI L  G+CR +P ++ +K
Sbjct  25    ANAAGGKWDLLMSNIGISAMHMQLLNNDRVIIYDRTDFGASNISLPNGKCRNNPKDLALK  84

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHSVEYDV+ N+VRPLMVQTDVWCSS +   DGTL+QTGG+NDG ++VR F PC  
Sbjct  85    IDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATADGTLVQTGGFNDGRNMVRTFKPC--  142

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW EI N L + RWY+TNHILPDG QIIIGGR+ FNYEF+PKT   + ++NLPF+ +
Sbjct  143   STCDWQEIGNGLIQSRWYSTNHILPDGSQIIIGGRDTFNYEFFPKTASTNKVFNLPFIQQ  202

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TN P  ENNLYP+VFLNVDG+LFIFANN+AIL D+  + +V+ YP +P G PR+YPSTGS
Sbjct  203   TNVPKEENNLYPFVFLNVDGNLFIFANNRAILLDHTTNTIVKTYPQIPGGDPRNYPSTGS  262

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERG-VFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPLK      I AEVL+CGGAP G++  + R   F+GALNTCGRI ITDPNP W ME
Sbjct  263   AVLLPLK---TQTIQAEVLVCGGAPIGSYLKAARANTFVGALNTCGRITITDPNPQWTME  319

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP+AR MGDMV LPNGN+LI+NGAA G+AG+G  RNPV +PV+Y  DNP G+RFE+ NP
Sbjct  320   TMPLARTMGDMVILPNGNVLIVNGAAAGTAGWGIARNPVLSPVIYRPDNPSGSRFEVQNP  379

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             +  PRMYHSTA+LLRD RVLVGGSNP+  Y F    LFPT+L LEAFSP YL++ +A +R
Sbjct  380   NATPRMYHSTAVLLRDGRVLVGGSNPNELYNFTR-VLFPTDLSLEAFSPSYLESNSANLR  438

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGP-VDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             P I  PGSH K  YG+ + I+FT +G  V+ NL+ VTMVAP F THS + +QR+L L   
Sbjct  439   PQIISPGSHKKIKYGQRLNIRFTLSGSLVNTNLIKVTMVAPGFNTHSNTMNQRML-LLSN  497

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               VK +GI TY ++++ P SG L+P GYY+LFVV++ IPSEGIWI++
Sbjct  498   EKVKKIGILTYQVSSIFPNSGKLAPPGYYLLFVVNQDIPSEGIWIKI  544



>ref|XP_011074991.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=544

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/531 (62%), Positives = 395/531 (74%), Gaps = 6/531 (1%)
 Frame = +2

Query  89    RNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPY  268
             RN+   AA G RW+ LL NIGI+AMHMQLL  D+VVIFDRTDFG+SNI L  G CR DP 
Sbjct  18    RNVLTRAASG-RWDFLLSNIGISAMHMQLLYTDRVVIFDRTDFGVSNISLPAGNCRNDPS  76

Query  269   EVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVF  448
             +  +  DCTAHSVEYDVA N++RPLMV TD WCSS AVMPDGTL+QTGG+NDGDH VR++
Sbjct  77    DTALVNDCTAHSVEYDVATNSIRPLMVLTDTWCSSGAVMPDGTLVQTGGYNDGDHAVRLY  136

Query  449   NPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNL  628
              PC +  CDW EI   L + RWYATNHILPDGR I+IGGR + NYEFYPKT  GD  Y L
Sbjct  137   KPCTNNSCDWREINPGLTQRRWYATNHILPDGRAIVIGGRRQHNYEFYPKTSPGDTSYKL  196

Query  629   PFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSY  808
              FL ET DP  ENNLYP+VFLNVDG+LFIFANN+AIL+DY+K  VVR YP +P G PRSY
Sbjct  197   DFLVETKDPKIENNLYPFVFLNVDGNLFIFANNRAILFDYVKGTVVRTYPTIPGGDPRSY  256

Query  809   PSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPV  988
             PSTGSAVLLPL +       AEVL+CGGAP GA+ ++  G F+ AL+TC RIRI +PNP 
Sbjct  257   PSTGSAVLLPLTDNAGS---AEVLVCGGAPNGAYLSAMNGSFVTALDTCARIRINEPNPE  313

Query  989   WFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFE  1168
             W +ETMPM R+MGDMV LPNGN+LIINGA  G+AG+  GRNPV  PV+Y  +NP G+RFE
Sbjct  314   WILETMPMPRVMGDMVLLPNGNVLIINGAGSGAAGWELGRNPVLAPVIYRPNNPFGSRFE  373

Query  1169  ILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAAT  1348
             + + S IPRMYHSTA+LLRD RVLVGGSNPH +Y F  G LFPT+L LEAF P YLD   
Sbjct  374   VQSSSTIPRMYHSTALLLRDGRVLVGGSNPHTHYNF-TGVLFPTDLTLEAFCPSYLDPNF  432

Query  1349  AGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNL-VTVTMVAPSFTTHSFSQHQRLLD  1525
               + P I  P + +K GY + + + FT    ++ +  + VTMVAP+FTTHS S +QRL+ 
Sbjct  433   KNLGPRIVSPTAQTKIGYNQQLTVLFTFPDNLNRDASIMVTMVAPAFTTHSCSMNQRLIV  492

Query  1526  LGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             L GG      G +TY +  +TP SGN++  G+Y+LFVVH+ +PSEGIW+Q+
Sbjct  493   LSGGNVTAADGRSTYQIRVMTPSSGNIAQPGFYLLFVVHQDVPSEGIWVQI  543



>ref|XP_008347351.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/524 (62%), Positives = 389/524 (74%), Gaps = 12/524 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LL  ++GI+AMHMQLL ND+V++FDRTDFG SN+ L  G C        V+ D
Sbjct  22    AAGGKWQLLQQSVGISAMHMQLLRNDRVIMFDRTDFGKSNLALPNGEC--------VRND  73

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDV  NTVR L + +DVWCSS AV P+G LIQTGG   GD  VRVF PC    
Sbjct  74    CTAHSAEYDVKTNTVRALTLLSDVWCSSGAVAPNGRLIQTGGNGAGDRRVRVFEPCTG--  131

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW E  NAL   RWYAT+HILP+G+QIIIGGR +FNYEFYPKT     +Y+LPFL +T+
Sbjct  132   CDWKEFANALGARRWYATDHILPNGQQIIIGGRRQFNYEFYPKTGSSSKVYSLPFLVQTB  191

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYP+VFLNVDG+LFIFANN+AIL+DY K+ VV+ YP +P G PR  PSTGSAV
Sbjct  192   DAGEENNLYPFVFLNVDGNLFIFANNRAILFDYAKNXVVKTYPQIPGGDPRCXPSTGSAV  251

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL AP + AEVL+CGGAPKG+F  + +G F+ ALNTC RI+I +P P W METMP
Sbjct  252   LLPLKNLAAPSVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARIKINNPKPQWVMETMP  311

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM+ LP+G +L+INGA+ G+AG+  GRNPV  PV+Y  DN +G+RFE  NP+ I
Sbjct  312   QARVMGDMLLLPDGTVLLINGASSGAAGWEIGRNPVLNPVVYRPDNAIGSRFEQQNPTTI  371

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH  Y F +  LFPTELRLEAFSP YLDA    +RP I
Sbjct  372   PRMYHSTAILLRDGRVLVGGSNPHXKYEFTB-VLFPTELRLEAFSPDYLDAKYNNLRPQI  430

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S +K  YGK + IQF+  G +    V+V+MVAPSF THSFS +QRLL L     VK
Sbjct  431   VAPISQAKINYGKKLSIQFSVKGNLATQSVSVSMVAPSFNTHSFSMNQRLLVL-EAENVK  489

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              VG   Y +   TP SGNL+P+GYY+L+VVH+ IPS  IW+Q++
Sbjct  490   KVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQIL  533



>ref|XP_006304793.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
 gb|EOA37691.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
Length=549

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/526 (61%), Positives = 398/526 (76%), Gaps = 4/526 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             ++A GG W +LLPN+GI+AMHMQLL+ND+VV+FDRT+FG SNI L  G CR +P + V K
Sbjct  26    SSAAGGSWNVLLPNVGISAMHMQLLHNDRVVMFDRTNFGPSNISLPNGNCRNNPNDAVSK  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHS+EYDVA NTVRPL VQ++ WCSS +V PDG LIQTGG  DG    R F PCND
Sbjct  86    IDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLIQTGGDRDGALKARTFTPCND  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
              KCDWVEI N L + RWY++N +LPDG+QI+IGG+ +FNYEF+PKT   +++ +LPFLAE
Sbjct  146   NKCDWVEIDNGLSKRRWYSSNQLLPDGKQIVIGGQGQFNYEFFPKTTSPNVV-DLPFLAE  204

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TND G ENNLYP+VF+N DG+LFIFANN+A+L DY+K+ VV+ +PA+P G PRSYPSTGS
Sbjct  205   TNDRGQENNLYPFVFMNTDGNLFIFANNRAMLLDYVKNKVVKTFPAIPGGDPRSYPSTGS  264

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPLKNL+A  I AEVL+CGGAPKG++  A  R  F+ AL+TC RI+I D +P W +E
Sbjct  265   AVLLPLKNLEAAKIEAEVLVCGGAPKGSYLQAFRRKTFVKALDTCARIKINDADPQWTVE  324

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP AR+MGDM  LPNG++LI+NG A GSA +  GR PV  P LYH +NPV  RFE LNP
Sbjct  325   TMPHARVMGDMTLLPNGDVLIVNGGASGSAAWELGREPVLAPDLYHPENPVNKRFESLNP  384

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             + IPRMYHS A+L+RD RVLVGGSNPH  Y F  G LFPTELRLEAFSP YL+   A +R
Sbjct  385   TTIPRMYHSAAVLVRDGRVLVGGSNPHAFYEF-TGVLFPTELRLEAFSPAYLEPKFATLR  443

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P S S+  YG  ++++FT  G V G  V VTMV+PSFTTHSFS +QRLL L    
Sbjct  444   PKIQTPKSQSRIKYGTNLKLKFTVIGEVKGQ-VKVTMVSPSFTTHSFSMNQRLLVLDNVK  502

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               +     TY +   TP S  ++P GYYM+FVV++ IPSEG+W+++
Sbjct  503   FTRKGRSTTYEVQVRTPKSAIIAPPGYYMMFVVNQNIPSEGVWVRL  548



>ref|XP_010540180.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=565

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/537 (62%), Positives = 402/537 (75%), Gaps = 14/537 (3%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A AAGGGRW+LLL ++GI+AMHMQLL ND+V++FDRTDFG SNI L GG CR +P + V 
Sbjct  31    ATAAGGGRWQLLLRSVGISAMHMQLLRNDRVIMFDRTDFGPSNISLPGGNCRSNPNDRVS  90

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             KVDCTAHSVE+DV  N +RPL VQ++ WCSS +VMPDGTL+QTGG  DG+   R+F+PC 
Sbjct  91    KVDCTAHSVEFDVISNGIRPLTVQSNTWCSSGSVMPDGTLVQTGGDLDGERRARLFSPCF  150

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
                CDW E+ N L   RWYA+NHILPDG QII+GGR +FN+EFYPKT   + +YNLPFLA
Sbjct  151   SNDCDWKELENGLALRRWYASNHILPDGSQIIVGGRGQFNFEFYPKTKDPN-VYNLPFLA  209

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             +TND G+ENNLYP+VFLNVDG+LF+FANN+AIL DY K+ VV+ YPA+P G PRSYPSTG
Sbjct  210   QTNDRGSENNLYPFVFLNVDGNLFVFANNRAILLDYNKNTVVKTYPAIPGGDPRSYPSTG  269

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFM  997
             SAVLLPLKNL+A  + AEVL+CGGAP+GA+  A  R  F+ ALNTC RIRITDPNP W +
Sbjct  270   SAVLLPLKNLEAIDVEAEVLVCGGAPRGAYEQAWRRNNFIKALNTCARIRITDPNPQWVV  329

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             E+MP AR+MGDM  LPNG++LIING A G+A +  GR+P+  P LY  DNPVG+RFE  N
Sbjct  330   ESMPQARVMGDMTLLPNGDVLIINGGASGTAAWELGRDPIFAPDLYRPDNPVGSRFETQN  389

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             P+ IPRMYHSTA+LLRD RVLVGGSNPH  Y F  G LFPTEL LEAF P YLD   + +
Sbjct  390   PNTIPRMYHSTAVLLRDGRVLVGGSNPHAFYNF-TGVLFPTELSLEAFLPSYLDQQFSNL  448

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP IT P S  K  Y   ++++FT +G V    V VTMV PSFTTHSFS +QR+L L   
Sbjct  449   RPMITSPKSQVKIKYNMKLKLKFTVSGEVKSP-VKVTMVFPSFTTHSFSMNQRVLVLDNI  507

Query  1538  GT----------VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              T           K    +TY +   TP S N++P GYYM+FVV++ IPSEGIW+Q+
Sbjct  508   KTPKIWDFFNFLRKGKSTSTYEVEVKTPRSANIAPPGYYMMFVVNQDIPSEGIWVQL  564



>ref|XP_007222145.1| hypothetical protein PRUPE_ppa004709mg [Prunus persica]
 gb|EMJ23344.1| hypothetical protein PRUPE_ppa004709mg [Prunus persica]
Length=495

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/507 (63%), Positives = 387/507 (76%), Gaps = 12/507 (2%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLL+ND+VV+FDRTDFG SN+ L  G+C        V  DCTAHS EYDV  NT RP
Sbjct  1     MHMQLLHNDRVVLFDRTDFGKSNLSLPDGKC--------VGNDCTAHSAEYDVTTNTFRP  52

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYA  520
             L V +DVWCSS +V PDG LIQTGG+ +G+  VR+F PC    CDW EI N L   RWYA
Sbjct  53    LTVLSDVWCSSGSVAPDGRLIQTGGFTNGERRVRIFEPCTG--CDWKEIENGLAARRWYA  110

Query  521   TNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVD  700
             T+HILPDGRQIIIGGR +FNYEFYPK+   + +++LPFL +TNDP AENNLYP+VFLNVD
Sbjct  111   TDHILPDGRQIIIGGRRQFNYEFYPKSASTNKVFSLPFLVQTNDPDAENNLYPFVFLNVD  170

Query  701   GHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVL  880
             G+LFIFANN+AIL+DY+K+ VV+ YP +P G PRSYPSTGSAVLLPLKNL+A  I AEVL
Sbjct  171   GNLFIFANNRAILFDYVKNNVVKTYPQIPGGDPRSYPSTGSAVLLPLKNLKARSIEAEVL  230

Query  881   ICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNIL  1060
             +CGGAP G++  + +G F GALNTC RI+ITDPNP W +ETMP AR+MGDM  LP+G +L
Sbjct  231   VCGGAPTGSYIKATKGTFTGALNTCARIKITDPNPQWVLETMPQARVMGDMTLLPDGTVL  290

Query  1061  IINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVL  1240
             +INGA+ G+AG+  GRNPV  PV+Y  DN  G+RFE  NP+ IPRMYHSTA+LLRD RVL
Sbjct  291   LINGASNGAAGWELGRNPVLNPVVYRPDNAAGSRFEQQNPTTIPRMYHSTAVLLRDGRVL  350

Query  1241  VGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEI  1420
             VGGSNPHPNY F N  LFPTELR+EAF+P YLDA    +RP I  P S +K  YGK + I
Sbjct  351   VGGSNPHPNYEFTN-VLFPTELRVEAFNPDYLDAKYGNLRPKIVTPKSQAKINYGKKLTI  409

Query  1421  QFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSG  1600
             +F+  G +  N V+VTMVAPSFTTHSFS + R L L     VK VG + Y +   TP SG
Sbjct  410   RFSVTGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLASEN-VKSVGKSAYEVEVTTPASG  468

Query  1601  NLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             NL+P+GYY+L+VVH+ IPS+GIW+Q++
Sbjct  469   NLAPSGYYLLYVVHQQIPSDGIWVQIM  495



>ref|XP_006416454.1| hypothetical protein EUTSA_v10007284mg [Eutrema salsugineum]
 gb|ESQ34807.1| hypothetical protein EUTSA_v10007284mg [Eutrema salsugineum]
Length=547

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/523 (62%), Positives = 389/523 (74%), Gaps = 3/523 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W LLLPN+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V K+D
Sbjct  27    AAGGKWNLLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPNDAVSKID  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS+EYDVA NTVRPL VQ++ WCSS +V PDG L+QTGG  DG+   R F PCN+ +
Sbjct  87    CTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFTPCNNDR  146

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI N L R RWY++NHILPDG+QII+GG  +FNYEFYPKT   +++  LPFLAETN
Sbjct  147   CDWAEINNGLARRRWYSSNHILPDGKQIIVGGTRQFNYEFYPKTTSPNVIA-LPFLAETN  205

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYPYVFLN DG+LFIFANN+AIL DY K+ VV+ +PA+P G PRSYPSTGSAV
Sbjct  206   DRGQENNLYPYVFLNTDGNLFIFANNRAILLDYTKNTVVKTFPAIPGGDPRSYPSTGSAV  265

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL+A  I AEVL+CGGAPKG+F  + R  F+ AL+TC RI+I D NP W +E MP
Sbjct  266   LLPLKNLEAVKIDAEVLVCGGAPKGSFILARRNTFVRALDTCARIKINDENPQWTVEKMP  325

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM  LPNG++L+ING + GSA +  GR PV  P LYH +NPV +RFE LNPS I
Sbjct  326   RARVMGDMTLLPNGDVLLINGGSSGSAAWELGREPVFVPDLYHPENPVNSRFESLNPSKI  385

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHS A+LLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL+   A +RP I
Sbjct  386   PRMYHSAAVLLRDGRVLVGGSNPHAFYNF-TGVLFPTELSLEAFSPVYLEPEFANLRPKI  444

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S S   Y   ++++F  AG V G  V VTMV PSFTTHSFS +QRLL L      +
Sbjct  445   MAPKSQSSIKYRMNLKLKFKVAGEVKGP-VKVTMVFPSFTTHSFSMNQRLLVLDNVKFTR  503

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                   Y +   TP S  ++P GYYM+FVV++ IPSEGIW+++
Sbjct  504   NGKSTNYEVLVRTPRSAIIAPPGYYMMFVVNQNIPSEGIWVRL  546



>ref|XP_006383733.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
 gb|ERP61530.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
Length=557

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/536 (63%), Positives = 403/536 (75%), Gaps = 13/536 (2%)
 Frame = +2

Query  95    MFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEV  274
             +  +AAG GRW+LL  NIGI AMHMQLLNND+VVI+DRTD+G SNI L  G+CR D +E+
Sbjct  25    VVTSAAGRGRWQLLQKNIGIVAMHMQLLNNDRVVIYDRTDYGKSNISLPHGKCRNDSWEL  84

Query  275   VVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNP  454
             V+K DCTAHSVEYDV  N  RPLMVQT+VWCSS AV+PDG+LIQTGG+NDG   VR F P
Sbjct  85    VIKYDCTAHSVEYDVLANKFRPLMVQTNVWCSSGAVVPDGSLIQTGGFNDGQRKVRTFYP  144

Query  455   CNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
             CN   CDWVE  + L   RWYATNHILPDG+QIIIGGR +FNYEFYPKT   D +Y+LPF
Sbjct  145   CNG-DCDWVETGDGLKARRWYATNHILPDGKQIIIGGRRQFNYEFYPKTSSPD-VYSLPF  202

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L +TND G+ENNLYP+VFLN DG+LFIFANN+AIL+DY    VV+ YPA+P G PRSYPS
Sbjct  203   LLQTNDRGSENNLYPFVFLNSDGNLFIFANNRAILFDYKTGKVVKTYPAIPGGDPRSYPS  262

Query  815   TGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF------PASERGVFMGALNTCGRIRITD  976
             TGSAVLLPLKNL A  I AEVL+CGGAPKG+F       ++ER  F+ AL+TCGRI+I +
Sbjct  263   TGSAVLLPLKNLDAATIEAEVLVCGGAPKGSFEMATKRKSAERK-FLKALDTCGRIKINE  321

Query  977   PNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVG  1156
             P+P W METMP AR+MGDM  LPNG +LIINGA  G+AG+ +GR+P   PVLY  D   G
Sbjct  322   PSPQWVMETMPCARVMGDMTLLPNGVVLIINGAGDGTAGWENGRSPALNPVLYWPDGAAG  381

Query  1157  TRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYL  1336
             +RFE LNPS IPRMYHS AILLRD RVLVGGSNPH  Y F    LFPTEL LEAFSPPYL
Sbjct  382   SRFEPLNPSTIPRMYHSAAILLRDGRVLVGGSNPHSGYEFTR-VLFPTELSLEAFSPPYL  440

Query  1337  DAATAGIRPHI-TLPGSHSKF-GYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQH  1510
             D+    +RP I +   S  K+ GYG+ + ++F   G +  ++V+VTMVAP+F THSFS +
Sbjct  441   DSKNKYLRPKIVSSTASKGKYIGYGQKLWVRFKVIGKLKADMVSVTMVAPAFNTHSFSMN  500

Query  1511  QRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              RLL L     V  V  + Y +   TP SG L+P+GYY+L+VVH+ IPS GIW+++
Sbjct  501   HRLLAL-RNEKVTYVRTSIYDIQVTTPSSGYLAPSGYYILYVVHQYIPSIGIWVKL  555



>emb|CDY62590.1| BnaA08g31280D [Brassica napus]
Length=547

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/526 (62%), Positives = 395/526 (75%), Gaps = 5/526 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             + A GG+W LLL N+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V K
Sbjct  25    SLAAGGKWTLLLSNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSK  84

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHS+EYDVA NTVRPL VQ++ WCSS +V PDG L+QTGG  DG+   R+F+PCN+
Sbjct  85    IDCTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFSPCNN  144

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
              KCDWVEI N L + RWY++NHILPDG+QI+IGG+ +FNYEFYPKT   +++  LPFLAE
Sbjct  145   NKCDWVEINNGLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFYPKTTSPNVIA-LPFLAE  203

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TND G ENNLYPYVFLN DG+LFIFANN+AIL DY+K+ VV+ YPA+P G PRSYPSTGS
Sbjct  204   TNDRGQENNLYPYVFLNTDGNLFIFANNRAILLDYVKNTVVKTYPAIPGGDPRSYPSTGS  263

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPLKNL+A  I AEVL+CGGAPKG++  A  R  F+ AL+TC RI+I D NP W +E
Sbjct  264   AVLLPLKNLEAVKIDAEVLVCGGAPKGSYILAFRRNTFVKALDTCARIKINDENPQWTVE  323

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM  LPNG++LI+NG + GSA +  GR PV  P LYH +NPV +RFE LNP
Sbjct  324   KMPRARVMGDMTLLPNGDVLIVNGGSSGSAAWELGREPVFVPDLYHPENPVNSRFESLNP  383

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTAILLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL+   A +R
Sbjct  384   STIPRMYHSTAILLRDGRVLVGGSNPHGFYNF-TGVLFPTELSLEAFSPVYLEPEFAKLR  442

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P S +   Y K ++++F   G V G  V VTMV PSFTTHSFS +QRLL L    
Sbjct  443   PKIVSPKSQTTITYRKTMKLKFKVVGEVKGP-VKVTMVFPSFTTHSFSMNQRLLVLDNVK  501

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               +    N Y +   TP S  ++P GYYM+FVV+  IPSEGIW+++
Sbjct  502   FKRSKSTN-YEVQVRTPRSAFVAPPGYYMMFVVNDNIPSEGIWVRL  546



>gb|KHN45905.1| Galactose oxidase [Glycine soja]
Length=530

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/528 (62%), Positives = 395/528 (75%), Gaps = 8/528 (2%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             F AA   G+W+LL  NIGI AMHMQLL+ND+V+IFDRTDFGLSN+ L  GRCR +P E+V
Sbjct  11    FHAAEAKGQWQLLHKNIGIVAMHMQLLHNDRVIIFDRTDFGLSNLTLPDGRCRNNPNELV  70

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
             VK DCTAHS+EYDVA NT R L VQT+VWCSS +V PDGTL+QTGG+NDG   VR F PC
Sbjct  71    VKRDCTAHSIEYDVAANTFRALFVQTNVWCSSGSVSPDGTLVQTGGFNDGYRAVRTFTPC  130

Query  458   NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFL  637
               + CDW E+ + L   RWYATNHILPDGRQIIIGGR +FNYEFYPKT   +  Y+LPFL
Sbjct  131   --RSCDWAEVQHGLAAQRWYATNHILPDGRQIIIGGRRQFNYEFYPKTQAKNT-YSLPFL  187

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
             A+TND  AENNLYP+VFLNVDG+LFIFANN+AIL+DY K++VVR YP +P G PR YPST
Sbjct  188   AQTNDANAENNLYPFVFLNVDGNLFIFANNRAILFDYNKNSVVRTYPQIPGGDPRCYPST  247

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             GSAVLLPL+    P + AEVLICGGAP+GAF  +  G F+GAL TC RI+ITDP   W M
Sbjct  248   GSAVLLPLRE---PNVEAEVLICGGAPRGAFRNTLSGKFVGALRTCARIKITDPKANWVM  304

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP AR+M DMV LPNG++LI+NGAA G+AG+  GRNPV  P LY  +  VG RFE+ N
Sbjct  305   ETMPSARVMSDMVLLPNGDVLIVNGAAVGTAGWELGRNPVLNPFLYKPNKRVGMRFEVQN  364

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS IPRMYHS A+LLRD RVL+ GSNPH  Y F    LFPTELRLEAFSP YL+   + +
Sbjct  365   PSHIPRMYHSGAVLLRDGRVLLAGSNPHTYYNF-TKVLFPTELRLEAFSPWYLEPGFSNV  423

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S +K  YG+ + ++F  +  + G+ V+VTM+AP F THSFS +QRLL L   
Sbjct  424   RPAIVSPASQTKLKYGQTLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSMNQRLLVLKPH  483

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
               +  VG +T+ +    P S  L+P G+Y+LFVVH+ +PS GIW+QMV
Sbjct  484   H-LSGVGESTHEVEVTAPASAVLAPPGFYLLFVVHQEVPSHGIWVQMV  530



>ref|XP_006473606.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=535

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/555 (62%), Positives = 418/555 (75%), Gaps = 21/555 (4%)
 Frame = +2

Query  14    MGRRNFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKV  193
             MG+ +F +L  L+QL L       S  +   AAGGG W+LL  +IGI++MHMQLLNND+V
Sbjct  1     MGQYSFIVL--LFQLILC------SHRIVTDAAGGG-WQLLQKSIGISSMHMQLLNNDRV  51

Query  194   VIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSS  373
             V+FDR+DFG SN+ L  G+C        +K DCTAHSVEY+V  N  RPL VQ++VWCSS
Sbjct  52    VMFDRSDFGPSNLSLPPGKC--------LKTDCTAHSVEYNVLTNEFRPLFVQSNVWCSS  103

Query  374   AAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQI  553
              AV PDG LIQTGG+NDG+  +R F PCND+ CDW EI + L   RWYAT+HILPDGR I
Sbjct  104   GAVRPDGVLIQTGGFNDGEKKIRSFVPCNDESCDWKEI-DGLGARRWYATDHILPDGRII  162

Query  554   IIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKA  733
             IIGGR +FNYEFYPK  G   +Y+LPFL +TNDP  ENNLYP+VFLNVDG LFIFANN+A
Sbjct  163   IIGGRRQFNYEFYPKN-GAPNVYSLPFLVQTNDPRVENNLYPFVFLNVDGFLFIFANNRA  221

Query  734   ILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFP  913
             IL+DY+ + VV+ YPA+P G PRSYPS+GSAVLLPLKNL AP + AEVL+CGGAPKGA+ 
Sbjct  222   ILFDYVNNKVVKQYPAIPGGDPRSYPSSGSAVLLPLKNLLAPSVAAEVLVCGGAPKGAYE  281

Query  914   ASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAG  1093
              +E+GVF+ ALNTC RI+ITDP P W +ETMP  R+MGDM  LPNGN+L+INGA +G+AG
Sbjct  282   QAEKGVFVAALNTCARIKITDPTPTWVLETMPQPRVMGDMTLLPNGNVLLINGAGKGTAG  341

Query  1094  YGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYV  1273
             +  GR+PV  PV+Y  DN  G+RF++ NPS IPRMYHSTA+LLRD RVLVGGSNPH  Y 
Sbjct  342   WELGRDPVLAPVVYRPDNIPGSRFDLQNPSTIPRMYHSTAVLLRDGRVLVGGSNPHAYYN  401

Query  1274  FGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGN  1453
             F  G LFPTEL LEAFSP YLDA  A +RP I LP S     Y +   ++F+A+GPV  N
Sbjct  402   F-TGVLFPTELSLEAFSPYYLDAPFANLRPTIVLPESQFTLKYKQKFRVRFSASGPVALN  460

Query  1454  LVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLF  1633
              VTVTMVAPSF THSFS +QRLL L    TV  +G + Y +   +PGSGNL+P+GYY+LF
Sbjct  461   KVTVTMVAPSFNTHSFSMNQRLLVL-ASDTVTKLGNSGYEIVVNSPGSGNLAPSGYYLLF  519

Query  1634  VVHKGIPSEGIWIQM  1678
             VVH+ +PSEGIW+ +
Sbjct  520   VVHQDVPSEGIWVHV  534



>ref|XP_004486272.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=540

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/547 (61%), Positives = 405/547 (74%), Gaps = 13/547 (2%)
 Frame = +2

Query  50    WQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSN  229
             W +F + A       ++  +A GG W++L  NIGI AMHMQLL+ND++VIFDRTDFGLSN
Sbjct  4     WVIFFIIASV-----VYLVSASGGEWKVLQKNIGIVAMHMQLLHNDRIVIFDRTDFGLSN  58

Query  230   IPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQT  409
             I L  GRCR DP E VVKVDCTAHS+EYDV  NT RPL VQTDVWCSS  V  DG L+QT
Sbjct  59    ISLPNGRCRYDPSEKVVKVDCTAHSIEYDVTHNTFRPLFVQTDVWCSSGTVRSDGALVQT  118

Query  410   GGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEF  589
             GG++DG+  VR+F PC+   CDW+E+   L   RWYAT+HILPD RQI+IGGR +FNYEF
Sbjct  119   GGYSDGERNVRIFTPCH--TCDWIELNGGLDTRRWYATSHILPDSRQIVIGGRRQFNYEF  176

Query  590   YPKTPGG--DLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAV  763
             +PK+  G  + +YNLPFL ETNDP  ENNLYP+VFLNVDG+LFI AN+KAIL DY K+ V
Sbjct  177   FPKSINGRANNVYNLPFLVETNDPHQENNLYPFVFLNVDGNLFIMANSKAILLDYTKNMV  236

Query  764   VRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGA  943
             V+ +P +P G PR YPSTGSAVLLPL+NLQA  + AEVL+CGGAP+G+F  +++  F  A
Sbjct  237   VKTFPEVPGGDPRCYPSTGSAVLLPLRNLQAAFLEAEVLVCGGAPRGSFNNTKKHEFRQA  296

Query  944   LNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQT  1123
             LNTC RI+ITDPNP W METMP AR+M DMV LPNGN+L+INGA+ G+AG+  GRNPV T
Sbjct  297   LNTCARIKITDPNPQWEMETMPGARVMSDMVMLPNGNVLLINGASFGTAGWEQGRNPVLT  356

Query  1124  PVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTE  1303
             P LY T+NP+G+RF+  +PS  PRMYHSTAIL+RD RV+VGGSNPH  Y F N  LFPTE
Sbjct  357   PFLYETNNPIGSRFKKQSPSTTPRMYHSTAILVRDGRVVVGGSNPHVGYSFEN-VLFPTE  415

Query  1304  LRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVD-GNLVTVTMVAP  1480
             L LEAFSP YL+   + +RP I L     K  YG+ +E+QF     ++  NLV VTM+AP
Sbjct  416   LSLEAFSPSYLERRYSHLRPRI-LSEPQIKLSYGQKLELQFQMNVTLNYPNLVHVTMLAP  474

Query  1481  SFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSE  1660
             SFTTHSFS +QRLL L     V  V   TY +    PGS  L+P G+Y+LFVV+  IPSE
Sbjct  475   SFTTHSFSMNQRLLVL-EPNKVGIVQDKTYGIKVTVPGSSTLAPPGFYLLFVVYGKIPSE  533

Query  1661  GIWIQMV  1681
             GIW Q++
Sbjct  534   GIWAQIL  540



>gb|KDO84767.1| hypothetical protein CISIN_1g009420mg [Citrus sinensis]
Length=535

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/555 (62%), Positives = 417/555 (75%), Gaps = 21/555 (4%)
 Frame = +2

Query  14    MGRRNFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKV  193
             MG+ +F +L  L+QL L       S  +   AAGGG W+LL  +IGI++MHMQLLNND+V
Sbjct  1     MGQYSFIVL--LFQLILC------SHRIVTDAAGGG-WQLLQKSIGISSMHMQLLNNDRV  51

Query  194   VIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSS  373
             V+FDR+DFG SN+ L  G+C        +K DCTAHSVEY V  N  RPL VQ++VWCSS
Sbjct  52    VMFDRSDFGPSNLSLPPGKC--------LKTDCTAHSVEYSVLTNEFRPLFVQSNVWCSS  103

Query  374   AAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQI  553
              AV PDG LIQTGG+NDG+  +R F PCND+ CDW EI + L   RWYAT+HILPDGR I
Sbjct  104   GAVRPDGVLIQTGGFNDGEKKIRSFVPCNDESCDWKEI-DGLGARRWYATDHILPDGRII  162

Query  554   IIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKA  733
             IIGGR +FNYEFYPK  G   +Y+LPFL +TNDP  ENNLYP+VFLNVDG LFIFANN+A
Sbjct  163   IIGGRRQFNYEFYPKN-GAPNVYSLPFLVQTNDPRVENNLYPFVFLNVDGFLFIFANNRA  221

Query  734   ILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFP  913
             IL+DY+ + VV+ YPA+P G PRSYPS+GSAVLLPLKNL AP + AEVL+CGGAPKGA+ 
Sbjct  222   ILFDYVNNKVVKQYPAIPGGDPRSYPSSGSAVLLPLKNLLAPSVAAEVLVCGGAPKGAYE  281

Query  914   ASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAG  1093
              +E+GVF+ ALNTC RI+ITDP P W +ETMP  R+MGDM  LPNGN+L+INGA +G+AG
Sbjct  282   QAEKGVFVAALNTCARIKITDPTPTWVLETMPQPRVMGDMTLLPNGNVLLINGAGKGTAG  341

Query  1094  YGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYV  1273
             +  GR+PV  PV+Y  DN  G+RF++ NPS IPRMYHSTA+LLRD RVLVGGSNPH  Y 
Sbjct  342   WELGRDPVLAPVVYRPDNIPGSRFDLQNPSTIPRMYHSTAVLLRDGRVLVGGSNPHAYYN  401

Query  1274  FGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGN  1453
             F  G LFPTEL LEAFSP YLDA  A +RP I LP S     Y +   ++F+A+GPV  N
Sbjct  402   F-TGVLFPTELSLEAFSPYYLDAPFANLRPTIVLPESQFTLKYKQKFRVRFSASGPVALN  460

Query  1454  LVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLF  1633
              VTVTMVAPSF THSFS +QRLL L    TV  +G + Y +   +PGSGNL+P+GYY+LF
Sbjct  461   KVTVTMVAPSFNTHSFSMNQRLLVL-ASDTVTKLGNSGYEIVVNSPGSGNLAPSGYYLLF  519

Query  1634  VVHKGIPSEGIWIQM  1678
             VVH+ +PSEGIW+ +
Sbjct  520   VVHQDVPSEGIWVHV  534



>ref|XP_010536366.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=551

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/528 (62%), Positives = 395/528 (75%), Gaps = 3/528 (1%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A+AAGGGRW+LL  +IGI+AMHMQLL ND+VVIFDRTDFG SNI L  G+C   P + V 
Sbjct  26    ASAAGGGRWQLLQSSIGISAMHMQLLRNDRVVIFDRTDFGPSNISLPAGKCIDSPDDPVS  85

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             KVDCTAHSVEYDV  N  R L VQ+D WCSS +V+P+GTL+QTGG  DG+  VR+F+PC 
Sbjct  86    KVDCTAHSVEYDVTSNRFRTLTVQSDTWCSSGSVIPNGTLVQTGGDKDGERRVRLFSPCG  145

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
                CDW EI + L   RWYATNHILPDGRQIIIGGR ++N+E+YPKT     +Y+LPFL 
Sbjct  146   SNGCDWSEIDDGLAVRRWYATNHILPDGRQIIIGGRRQWNFEYYPKTAEAPNVYSLPFLV  205

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             +TND G+ENNLYP VFLNVDG+LF+FANN+AIL DY K+ V+R YP +P G PRSYPSTG
Sbjct  206   QTNDRGSENNLYPNVFLNVDGNLFVFANNRAILLDYSKNIVIRTYPTVPGGDPRSYPSTG  265

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFM  997
             SAVLLPLKNL+A  + AEVL+CGGAP+GAF  A +   F+ AL+TC RI+ITD NP W M
Sbjct  266   SAVLLPLKNLEASNVEAEVLVCGGAPRGAFEQALKERTFVKALDTCARIKITDQNPKWVM  325

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP AR+MGDM+ LPNGN+L+ING + G+AG+  GR PV +P LY  DNP G+RFE  N
Sbjct  326   ETMPQARVMGDMILLPNGNVLLINGGSSGTAGWELGREPVLSPDLYRPDNPFGSRFETQN  385

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             P+ IPRMYHSTAILLRD RVLVGGSNPH  Y F N  LF TEL LEAFSP YLD+ ++ +
Sbjct  386   PNSIPRMYHSTAILLRDGRVLVGGSNPHTYYNFTN-VLFRTELSLEAFSPSYLDSESSNL  444

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S S+  Y   +++ FT +  V  N V VTMV PSF THSFS +QRLL L   
Sbjct  445   RPKIISPKSQSRIKYNTQLKLVFTISEAVT-NPVKVTMVYPSFNTHSFSMNQRLLILDNV  503

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
                +     TY +   TP S NL+P+GYYM+FVV++ IPS+GIW+ ++
Sbjct  504   MFTRSGESATYEVEVKTPRSANLAPSGYYMMFVVNQDIPSDGIWVHLL  551



>ref|XP_003523554.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=530

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/528 (62%), Positives = 395/528 (75%), Gaps = 8/528 (2%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             F AA   G+W+LL  NIGI AMHMQLL+ND+V+IFDRTDFGLSN+ L  GRCR +P E+V
Sbjct  11    FHAAEAKGQWQLLHKNIGIVAMHMQLLHNDRVIIFDRTDFGLSNLTLPDGRCRNNPNELV  70

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
             VK DCTAHS+EYDVA NT R L VQT+VWCSS +V PDGTL+QTGG+NDG   VR F PC
Sbjct  71    VKRDCTAHSIEYDVAANTFRALFVQTNVWCSSGSVSPDGTLVQTGGFNDGYRAVRTFTPC  130

Query  458   NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFL  637
               + CDW E+ + L   RWYATNHILPDGRQIIIGGR +FNYEFYPKT   +  Y+LPFL
Sbjct  131   --RSCDWAEVQHGLAAQRWYATNHILPDGRQIIIGGRRQFNYEFYPKTQAKNT-YSLPFL  187

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
             A+TND  AENNLYP+VFLNVDG+LFIFANN+AIL+DY K++VVR YP +P G PR YPST
Sbjct  188   AQTNDANAENNLYPFVFLNVDGNLFIFANNRAILFDYNKNSVVRTYPQIPGGDPRCYPST  247

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             GSAVLLPL+    P + AEVLICGGAP+GAF  +  G F+GAL TC RI+ITDP   W M
Sbjct  248   GSAVLLPLRE---PNVEAEVLICGGAPRGAFRNTLSGKFVGALRTCARIKITDPKANWVM  304

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP AR+M DMV LPNG++LI+NGAA G+AG+  GRNPV  P LY  +  VG RFE+ N
Sbjct  305   ETMPGARVMSDMVLLPNGDVLIVNGAAVGTAGWELGRNPVLNPFLYKPNKRVGMRFEVQN  364

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS IPRMYHS A+LLRD RVL+ GSNPH  Y F    LFPTELRLEAFSP YL+   + +
Sbjct  365   PSHIPRMYHSGAVLLRDGRVLLAGSNPHTYYNF-TKVLFPTELRLEAFSPWYLEPGFSNV  423

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S +K  YG+ + ++F  +  + G+ V+VTM+AP F THSFS +QRLL L   
Sbjct  424   RPAIVSPASQTKLKYGQTLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSMNQRLLVLKPH  483

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
               +  VG +T+ +    P S  L+P G+Y+LFVVH+ +PS GIW+QMV
Sbjct  484   H-LSGVGESTHEVEVTAPASAVLAPPGFYLLFVVHQEVPSHGIWVQMV  530



>gb|KEH36231.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=555

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/532 (60%), Positives = 394/532 (74%), Gaps = 10/532 (2%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A GG+W+LL  NIGI AMHMQLL+ND+V+IFDRTDFG SN+ L  GRCR +P E  VK
Sbjct  28    AIAAGGQWQLLQNNIGIVAMHMQLLHNDRVIIFDRTDFGFSNLSLPNGRCRVNPQEQAVK  87

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHS+EYDV  NT RPL +QT++WCSS +V P+GTLIQTGG+NDGD  VR FNPC  
Sbjct  88    NDCTAHSLEYDVFSNTFRPLFIQTNIWCSSGSVNPNGTLIQTGGFNDGDRSVRTFNPC--  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPG-GDLLYNLPFLA  640
               CDW E   +L   RWYATNH LPDGRQIIIGGR +FNYEFYPK        Y+LPFL 
Sbjct  146   PNCDWQEFNASLSARRWYATNHKLPDGRQIIIGGRRQFNYEFYPKKDATAKNTYSLPFLV  205

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             +TND  AENNLYP+VFLNVDG+LFIFANN+AIL+DY  + VV+ YP +P G PRSYPS+G
Sbjct  206   QTNDASAENNLYPFVFLNVDGNLFIFANNRAILFDYNSNKVVKTYPTIPGGDPRSYPSSG  265

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             SA LLPL+NLQ P + AEV+ICGGAPKG++  + +G F+GALNTCGR++ITDPNP W ME
Sbjct  266   SAALLPLRNLQNPLVEAEVMICGGAPKGSYEKTLQGSFIGALNTCGRLKITDPNPSWVME  325

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP  R+M DM+ LPNG++L+INGAA GSAG+  GRNPV  P LY  ++ VG+RF++  P
Sbjct  326   TMPGGRVMSDMILLPNGDVLLINGAAVGSAGWESGRNPVLNPFLYKPNSLVGSRFQLQKP  385

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTA+LLRD RVLV GSNPH NY F    LFPTELRLEAFSP YL+     +R
Sbjct  386   SDIPRMYHSTAVLLRDGRVLVAGSNPHVNYNFTR--LFPTELRLEAFSPSYLELGFNDVR  443

Query  1361  PHITLPG--SHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLL---D  1525
             P +  P   S +K  Y + ++++F     +  N+V+VTM APSF THSFS +QRLL   +
Sbjct  444   PIMVFPAPQSQTKLKYAQKLKVRFQVKATLMKNMVSVTMYAPSFNTHSFSMNQRLLVLDE  503

Query  1526  LGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             L     V     +TY +    P S  L+P GYY+LFVVH+ +PS+G+W+Q++
Sbjct  504   LSSSKNVVGESTSTYQVEVAIPNSPILAPPGYYLLFVVHQEVPSQGVWVQLL  555



>ref|XP_009149487.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=549

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/525 (63%), Positives = 398/525 (76%), Gaps = 6/525 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GGRW+LLLPN+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V K+D
Sbjct  28    AAGGRWKLLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDPVSKID  87

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS+EYDVA NT+RPL VQ++ WCSS +V PDG L+QTGG  DG+   R+F PCN+KK
Sbjct  88    CTAHSIEYDVASNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFTPCNNKK  147

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW+EI N L + RWY++NHILPDG+QI+IGG+ +FNYEF+PKT   +++  LPFLAETN
Sbjct  148   CDWIEINNGLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFFPKTTSPNVIA-LPFLAETN  206

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYPYVFLN DG+LFIFANN+AIL DYIK+ VV+ YPA+P G PRSYPSTGSAV
Sbjct  207   DRGEENNLYPYVFLNNDGNLFIFANNRAILLDYIKNTVVKTYPAIPGGDPRSYPSTGSAV  266

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             LLPLKNL+A  I AEVL+CGGAPKG++  A  R  F+ AL+TC RI+I D NP W +E M
Sbjct  267   LLPLKNLEAVKIDAEVLVCGGAPKGSYLLAFRRKTFVKALDTCARIKINDENPQWTVEKM  326

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P AR+MGDM  LPNG++LIING A GSA +  GR PV  P +YH  NPV +RFE LNP+ 
Sbjct  327   PRARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLVPDVYHPCNPVNSRFESLNPTT  386

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHSTA+LLRD RVLVGGSNPH  Y F N  LFPTEL LEAFSP YL+   A  RP 
Sbjct  387   IPRMYHSTAVLLRDGRVLVGGSNPHAFYNFTN-VLFPTELSLEAFSPAYLEPEFAKFRPK  445

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
             I  P S     Y   ++++F  AG V G  V VTMV PSFTTHSFS +QRLL L    T 
Sbjct  446   IQSPKSQVMITYRMDLKLKFKVAGEVKGP-VKVTMVFPSFTTHSFSMNQRLLVL-DNVTF  503

Query  1547  KPVGINT-YHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             K  G +T Y +   TP S N++P GYYM+FVV++ IPSEGIW+++
Sbjct  504   KRSGKSTNYEVQVKTPRSVNIAPPGYYMMFVVNQNIPSEGIWVRL  548



>ref|XP_008466509.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=555

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/550 (60%), Positives = 407/550 (74%), Gaps = 15/550 (3%)
 Frame = +2

Query  29    FTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDR  208
              +L+FA   L L +  PP        AA GG W LL  N+GI+AMHMQLL ND+VV++DR
Sbjct  20    LSLIFA--NLLLFSGLPP-------TAAAGGSWRLLQRNVGISAMHMQLLQNDRVVMYDR  70

Query  209   TDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMP  388
             TDFG SN+ L GG+C +DP    +KVDCTAHS+EY+V  NT RPLMV +DVWCSS +V P
Sbjct  71    TDFGPSNLSLPGGKCLRDP-TAKIKVDCTAHSIEYNVITNTFRPLMVLSDVWCSSGSVSP  129

Query  389   DGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGR  568
             DGTL+QTGG+N G+  VR F PC+   CDW EIP AL   RWYATNHILPDGRQIIIGGR
Sbjct  130   DGTLVQTGGFNSGERRVRTFKPCS--TCDWKEIPLALSARRWYATNHILPDGRQIIIGGR  187

Query  569   EEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDY  748
              +FNYEFYPK      +++L FLAETND G ENNLYP+VFL  DG+LFIFANN+AIL+DY
Sbjct  188   RQFNYEFYPKDRATQNVFDLRFLAETNDIGIENNLYPFVFLQPDGNLFIFANNRAILFDY  247

Query  749   IKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERG  928
              K+ VVR +PA+PDGQ R+YPSTGSAV+LPLK + A  I  EVL+CGGAP G++  +  G
Sbjct  248   TKNGVVRKFPAIPDGQHRNYPSTGSAVMLPLK-VDAKFIEVEVLVCGGAPIGSYDRANHG  306

Query  929   VFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGR  1108
             +F+ AL TC RI+ITD NP W METMP  R+M DM+ LPNGN+L+ING + G+AG+  GR
Sbjct  307   IFVDALRTCARIKITDRNPQWVMETMPQPRVMVDMLLLPNGNVLLINGGSAGAAGWEIGR  366

Query  1109  NPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGA  1288
              PV  PV+YHT+NPVG RFE+ NP+ IPRMYHSTAILLRD RVLVGGSNPH  Y F  G 
Sbjct  367   KPVLNPVIYHTNNPVGKRFELQNPTTIPRMYHSTAILLRDGRVLVGGSNPHAGYNF-TGV  425

Query  1289  LFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVT  1468
             L+PTELRLEAFSP YLD   A +RP I  P S +K  +G+ +++ FT  G VD   ++VT
Sbjct  426   LYPTELRLEAFSPSYLDPEFAYLRPAIQFPASSAKLRHGQALKVGFTVPGKVDSTKLSVT  485

Query  1469  MVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKG  1648
             +++PSF THSFS +QRLL L   G  +  G   Y +    PGSGN++P+GYY+L++VHK 
Sbjct  486   ILSPSFNTHSFSMNQRLLIL-STGKYRLRGNKKYEVEVTIPGSGNVAPSGYYILYLVHKE  544

Query  1649  IPSEGIWIQM  1678
             IPS GIW+Q+
Sbjct  545   IPSVGIWVQI  554



>ref|XP_008350495.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=536

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/529 (61%), Positives = 398/529 (75%), Gaps = 12/529 (2%)
 Frame = +2

Query  92    NMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYE  271
             ++  A A GG+W++L  N+GI+AMHMQL  ND++V+FDRTDFG SN+ L  G C      
Sbjct  19    SVLTAHAAGGKWQVL-KNVGISAMHMQLFKNDRIVMFDRTDFGKSNLSLANGNC------  71

Query  272   VVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFN  451
               V  DCTAHS E+ V  N +RPL V +DVWCSS ++   G LIQTGG+N G+  VRVF 
Sbjct  72    --VNNDCTAHSAEFVVQTNALRPLTVLSDVWCSSGSMDAYGNLIQTGGFNSGERRVRVFT  129

Query  452   PCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLP  631
             PC    CDW E  + L   RWYATNH+LPDGR+IIIGGR +FNYEF PKT     +Y+LP
Sbjct  130   PCTG--CDWKETVDGLAVRRWYATNHMLPDGREIIIGGRGQFNYEFSPKTESTSNVYSLP  187

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL++TNDPG ENNLYP+VFLN DG+LFIFANN+AIL DY+K+AVV+ YP +P G PRSYP
Sbjct  188   FLSQTNDPGQENNLYPFVFLNPDGNLFIFANNRAILLDYVKNAVVKTYPQIPGGDPRSYP  247

Query  812   STGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVW  991
             STGSAVLLPLKNL AP + AEVL+CGGAPKG+F  + +GVF+ ALNTC RI+ITDPNP W
Sbjct  248   STGSAVLLPLKNLTAPAVEAEVLVCGGAPKGSFSQANKGVFVEALNTCARIKITDPNPQW  307

Query  992   FMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
              +ETMP AR+MGDM+ LP+  +LIINGA+ G+AG+  GRNPV  PV+Y  DN +G+RFE 
Sbjct  308   IVETMPQARVMGDMILLPDSTVLIINGASSGAAGWEIGRNPVLNPVVYQPDNAIGSRFEQ  367

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
              NP+ IPRMYHS+A+L+RD RV+VGGSNPH  Y FG+  LFPTELRLEAFSP YLDA  A
Sbjct  368   QNPTTIPRMYHSSALLVRDGRVIVGGSNPHDKYQFGSNVLFPTELRLEAFSPEYLDAKYA  427

Query  1352  GIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
              +RP I  P + +K  YG+ + +QF+ AG    N V+VTMVAP F+THSFS +QRLL LG
Sbjct  428   DLRPTIIAPRNQAKIRYGRKLTVQFSLAGRFAMNSVSVTMVAPPFSTHSFSMNQRLLVLG  487

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                T + VG  TY     TP SGNL+P+GYY+L+VVH+ IPSEGI++++
Sbjct  488   AENTHQ-VGPTTYEAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIFVKI  535



>ref|XP_010498415.1| PREDICTED: galactose oxidase [Camelina sativa]
Length=549

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/526 (61%), Positives = 397/526 (75%), Gaps = 4/526 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             ++A GG W +LLPN+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V +
Sbjct  26    SSAAGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDNPNDAVSR  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHS+EYDVA NTVRPL VQ++ WCSS +V PDG L+QTGG  DG    R F+PCN+
Sbjct  86    IDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVTPDGVLVQTGGDRDGALKARTFSPCNN  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
              +CDWVEI N L + RWY++NH+LPDG+QI+IGG+ +FNYEF+PKT   +++  LPFLAE
Sbjct  146   DQCDWVEIDNGLLKRRWYSSNHLLPDGKQIVIGGQGQFNYEFFPKTTSPNVVA-LPFLAE  204

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TND G ENNLYPYVF+N DG+LFIFANN+AIL DY+K+ VV+ +PA+P G PRSYPSTGS
Sbjct  205   TNDRGQENNLYPYVFMNTDGNLFIFANNRAILLDYVKNKVVKTFPAIPGGDPRSYPSTGS  264

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPLKNL+A  I AEVL+CGGAPKG++  A  R  F+ AL+TC RI+I D NP W +E
Sbjct  265   AVLLPLKNLEAAKIEAEVLVCGGAPKGSYTLAFRRKTFVKALDTCARIKINDANPQWTVE  324

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP AR+MGDM  LPNG++LIING A GSA +  GR PV  P +YH +NPV TRFE +NP
Sbjct  325   TMPHARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLAPDVYHPENPVNTRFETMNP  384

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHS A+LLRD RVLVGGSNPH  Y F  G LFPTELRLEAFSP YL+   A +R
Sbjct  385   STIPRMYHSAAVLLRDGRVLVGGSNPHAFYEF-TGVLFPTELRLEAFSPVYLEPQFATLR  443

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P S S+  YG  ++++F+  G V G  V VTMV PSFTTHSFS +QRLL L    
Sbjct  444   PRIQSPKSQSRIKYGLNLKVKFSVIGEVTGP-VKVTMVFPSFTTHSFSMNQRLLVLDNVK  502

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               +     TY +   TP S  ++  GYYM+FVV++ IPSEG+W+++
Sbjct  503   FTRKGRSTTYEVQVRTPKSAIIAQPGYYMMFVVNQNIPSEGVWVRL  548



>ref|XP_008387971.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/524 (61%), Positives = 388/524 (74%), Gaps = 12/524 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LL  ++GI+AMHMQLL+ND+VV+FDRTDFG SN+ L  G C        V  D
Sbjct  22    AAGGKWQLLQQSVGISAMHMQLLHNDRVVMFDRTDFGPSNLSLPNGAC--------VNND  73

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDV  NTVRPL V +DVWCSS AV PDG LIQTGG   G+  VR+F PC    
Sbjct  74    CTAHSAEYDVKTNTVRPLTVLSDVWCSSGAVAPDGRLIQTGGNGAGERRVRIFEPCTG--  131

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI NAL+  RWYAT+HILP+GRQIIIGGR +FNYEFYPKT     LY+LPFL +TN
Sbjct  132   CDWKEIENALNARRWYATDHILPNGRQIIIGGRGQFNYEFYPKTKSSSNLYSLPFLTQTN  191

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
               G ENNLYP+VFLNVDG+LFIFANN+AIL++Y K  VV+ YP +  G PR YPS+GSAV
Sbjct  192   GAGEENNLYPFVFLNVDGNLFIFANNRAILFNYAKKQVVQTYPQISGGDPRCYPSSGSAV  251

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL+AP + AEVL+CGGAPKG+F    +G F+ AL TC RI I +PNP W +ETMP
Sbjct  252   LLPLKNLKAPSVEAEVLVCGGAPKGSFAKVNQGTFVEALKTCARIEINNPNPQWVVETMP  311

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              A++MGDM+ LP+G +L+INGA+ G+AG+ +GRNPV  PV+Y  DN +G+RFE  NP+ I
Sbjct  312   QAKVMGDMLLLPDGTVLLINGASSGTAGWENGRNPVLNPVVYRPDNSIGSRFEQQNPTTI  371

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH  Y F N  LFPTELRLEAFSP YLDA    +RP I
Sbjct  372   PRMYHSTAILLRDGRVLVGGSNPHDKYEFTN-VLFPTELRLEAFSPDYLDAKYNNLRPKI  430

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S +K  YGK + IQF+  G +    V+V+M APSF THSFS +QRLL L     +K
Sbjct  431   NAPKSQAKINYGKKLSIQFSVKGNLVTKSVSVSMAAPSFNTHSFSMNQRLLVLEAENIIK  490

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
               G  TY +   TP S NL+P+GYY+L+VVH+ IPS  IW+Q++
Sbjct  491   G-GTTTYEVQVTTPASRNLAPSGYYLLYVVHQEIPSAAIWVQIL  533



>ref|XP_009110252.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=547

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/526 (62%), Positives = 395/526 (75%), Gaps = 5/526 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             + A GG+W LLL N+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V K
Sbjct  25    SLAAGGKWTLLLSNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSK  84

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHS+EYDVA NTVRPL VQ++ WCSS +V PDG L+QTGG  DG+   R+F+PCN+
Sbjct  85    IDCTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFSPCNN  144

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
              +CDWVEI NA+ + RWY++NHILPDG+QI+IGG+ +FNYEFYPKT   +++  LPFLAE
Sbjct  145   NRCDWVEINNAVAKRRWYSSNHILPDGKQIVIGGQGQFNYEFYPKTTSPNVIA-LPFLAE  203

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TND G ENNLYPYVFLN DG+LFIFANN+AIL DY+K+ VV+ YPA+P G PRSYPSTGS
Sbjct  204   TNDRGQENNLYPYVFLNTDGNLFIFANNRAILLDYVKNTVVKTYPAIPGGDPRSYPSTGS  263

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPLKNL+A  I AEVL+CGGAPKG++  A  R  F+ AL+TC RI+I D NP W +E
Sbjct  264   AVLLPLKNLEAVKIDAEVLVCGGAPKGSYILAFRRNTFVKALDTCARIKINDENPQWTVE  323

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM  LPNG++LI+NG A GSA +  GR PV  P LYH +NPV +RFE LNP
Sbjct  324   KMPRARVMGDMTLLPNGDVLIVNGGASGSAAWELGREPVFVPDLYHPENPVNSRFESLNP  383

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTAILLRD RVL GGSNPH  Y F  G LFPTEL LEAFSP YL+   A +R
Sbjct  384   STIPRMYHSTAILLRDGRVLGGGSNPHGFYNF-TGVLFPTELSLEAFSPVYLEPEFAKLR  442

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P S +   Y K ++++F   G V G  V VTMV PSFTTHSFS +QRLL L    
Sbjct  443   PKIVSPKSQTTITYRKTMKLKFKVVGEVKGP-VKVTMVFPSFTTHSFSMNQRLLVLDNVK  501

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               +    N Y +   TP S  ++P GYYM+FVV+  IPSEGIW+++
Sbjct  502   FKRSKSTN-YEVQVRTPRSAFIAPPGYYMMFVVNDNIPSEGIWVRL  546



>ref|XP_002301997.2| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|EEE81270.2| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=506

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/509 (63%), Positives = 390/509 (77%), Gaps = 5/509 (1%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLL+ND+VVI+DRTDFG SN+ L  G+CR D  E+V+K DCTAHSVEYDV  N  RP
Sbjct  1     MHMQLLSNDRVVIYDRTDFGRSNLSLPDGKCRNDSSELVIKYDCTAHSVEYDVLANRFRP  60

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYA  520
             LMVQ+DVWCSS AV+PDG LIQTGG+NDG+  VR+F+PCN   CDW E+ + L   RWYA
Sbjct  61    LMVQSDVWCSSGAVVPDGRLIQTGGFNDGERKVRIFSPCNGADCDWEEVGDGLKAKRWYA  120

Query  521   TNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVD  700
             T+HILPDGRQIIIGGR +FNYEFYPK+   ++ Y+LPFL ETND G ENNLYP+VFLN D
Sbjct  121   TSHILPDGRQIIIGGRRQFNYEFYPKSSAPNV-YSLPFLMETNDRGIENNLYPFVFLNGD  179

Query  701   GHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVL  880
             G+LFIFANN+AIL+D+  + VV+ YPA+P G PRSYPSTGSAVLLPLKNLQA  I AEVL
Sbjct  180   GNLFIFANNRAILFDHKTNKVVKTYPAIPGGDPRSYPSTGSAVLLPLKNLQASTIEAEVL  239

Query  881   ICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNIL  1060
             +CGGAPKG+F   E G F+ AL+TC RI+I DPNP W METMP AR+MGDM  LPNGN+L
Sbjct  240   VCGGAPKGSFAKVENGTFVQALDTCARIKINDPNPRWVMETMPTARVMGDMTLLPNGNVL  299

Query  1061  IINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVL  1240
             IINGA  G+AG+  GR+PV  PVLY  D+  G+RFE+ NPS IPRMYHSTAILLRD RVL
Sbjct  300   IINGAGAGTAGWEKGRDPVLNPVLYRPDDASGSRFELQNPSTIPRMYHSTAILLRDGRVL  359

Query  1241  VGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHS--KFGYGKVI  1414
             VGGSNPH  Y F  G LFPTEL LEAFSP YLD     +RP I    +      GYG+ +
Sbjct  360   VGGSNPHIGYEF-TGVLFPTELSLEAFSPSYLDPNFDDLRPTIVSSSASEGKNIGYGQKL  418

Query  1415  EIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPG  1594
              ++F     +  ++V+VTMVAP+F THSFS + RLL L G   V  VG + Y +  +TP 
Sbjct  419   LVRFKVTSKIVTDMVSVTMVAPAFNTHSFSMNHRLLVL-GNEKVTVVGTSIYDIQVMTPP  477

Query  1595  SGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             SG+L+P+G+YML+VVH+ IPSEG+W++++
Sbjct  478   SGDLAPSGHYMLYVVHQEIPSEGLWVKIL  506



>ref|XP_009103376.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=556

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/532 (61%), Positives = 399/532 (75%), Gaps = 12/532 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LLL N+GI+AMHMQLL+ND+VV+FDRT+FG SNI L  G CR++P + V K+D
Sbjct  27    AAGGKWDLLLSNVGISAMHMQLLSNDRVVMFDRTNFGPSNISLPNGNCRRNPQDPVSKMD  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS+EYDVA N VRPL VQ++ WCSS +V PDG L+QTGG  DG+   R F+PC+D +
Sbjct  87    CTAHSIEYDVASNKVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCDDNQ  146

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDWVEI N L + RWY++NHILPDG+QI+IGGR +FNYEF+PKT   +++  LPFLAET+
Sbjct  147   CDWVEINNGLAKRRWYSSNHILPDGKQIVIGGRGQFNYEFFPKTTSPNVIA-LPFLAETS  205

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYPYVFLN DG LFIFANN+AIL DY+K+ VV+ YPA+P G PRSYPSTGSAV
Sbjct  206   DKGEENNLYPYVFLNTDGRLFIFANNRAILLDYVKNTVVKTYPAIPGGDPRSYPSTGSAV  265

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             LLPLKNL+A  I AEVL+CGGAPKG+F  AS +  F+ AL+TC RI+I D NP W +E M
Sbjct  266   LLPLKNLEADKIDAEVLVCGGAPKGSFILASRKRTFVKALDTCARIKINDENPQWMVEKM  325

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P AR+MGDM  LPNG++L+ING + GSA +G GR PV  P +YH +NPV +RFE LNP+ 
Sbjct  326   PRARVMGDMTLLPNGDVLLINGGSAGSAAWGLGREPVFVPDMYHPENPVNSRFESLNPNT  385

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHSTAI+LRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL+   A +RP 
Sbjct  386   IPRMYHSTAIILRDGRVLVGGSNPHAFYNF-TGVLFPTELSLEAFSPAYLEPEFAKLRPK  444

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
             IT P S S   YG  ++++F  AG V G  V VTMV PSFT+HSFS +QRLL L      
Sbjct  445   ITSPKSQSTITYGMNLKVEFEVAGEVKGP-VKVTMVFPSFTSHSFSMNQRLLVLDNVSVK  503

Query  1547  KPVGI--------NTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             +   +          + +   TP S  ++P GYYM+FVV++ IPSEGIW+++
Sbjct  504   RTSSVFGVLFGTSRNFEVQVRTPRSAIIAPPGYYMMFVVNQNIPSEGIWVRL  555



>ref|XP_009337677.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=536

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/529 (61%), Positives = 395/529 (75%), Gaps = 12/529 (2%)
 Frame = +2

Query  92    NMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYE  271
             ++  A A GG+W++L  N+GI+AMHMQL  ND++V+FDRTDFG SN+ L  G C      
Sbjct  19    SVLTAHAAGGKWQVL-KNVGISAMHMQLFKNDRIVLFDRTDFGKSNLSLPNGNC------  71

Query  272   VVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFN  451
               V  DCTAHS E+ V  N VRPL V +DVWCSS ++   G LIQTGG N G+  VRVF 
Sbjct  72    --VNNDCTAHSAEFVVQTNAVRPLTVLSDVWCSSGSMDAYGNLIQTGGNNIGERRVRVFT  129

Query  452   PCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLP  631
             PC    CDW EI + L   RWYATNHILPDGR+IIIGGR +FNYEFYPKT     +Y+LP
Sbjct  130   PCTG--CDWKEIVDGLAARRWYATNHILPDGREIIIGGRGQFNYEFYPKTASTSNVYSLP  187

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL++TNDPG ENNLYP+VFLN DG+LF+FANN+AIL DY+K+ VV+ YP +P G PRSYP
Sbjct  188   FLSQTNDPGQENNLYPFVFLNPDGNLFVFANNRAILLDYVKNVVVKTYPQIPGGDPRSYP  247

Query  812   STGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVW  991
             STGSAVLLPLKNL AP + AEVL+CGGAPKG+F  + +G F+ ALNTC RI+ITDPNP W
Sbjct  248   STGSAVLLPLKNLMAPSVEAEVLVCGGAPKGSFVQANKGTFVEALNTCARIKITDPNPQW  307

Query  992   FMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
              +ETMP AR+MGDM+ LP+  +L+INGA+ G AG+  GRNPV  PV+Y  DN VG+RFE 
Sbjct  308   IVETMPQARVMGDMLLLPDSTVLLINGASSGVAGWEIGRNPVFNPVVYRPDNAVGSRFEQ  367

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
              NP+ IPRMYHS+A+L+RD RV+VGGSNPH  Y FGN  LFPTELRLEAFSP YLDA  A
Sbjct  368   QNPTTIPRMYHSSALLVRDGRVIVGGSNPHEKYQFGNDVLFPTELRLEAFSPEYLDAKYA  427

Query  1352  GIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
              +RP I  PG+ +K  YG  + IQF+  G    N V+VTMVAP F+THSFS +QRLL L 
Sbjct  428   NLRPTILAPGNQAKIHYGIKLAIQFSLTGTFAKNSVSVTMVAPPFSTHSFSMNQRLLVL-  486

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             G   V+ VG  TY +   TP S NL+P+GYY+LFVVH+ IPSEGI++++
Sbjct  487   GAENVQQVGPTTYQVQVTTPPSKNLAPSGYYILFVVHQQIPSEGIFVKI  535



>emb|CDY01391.1| BnaA07g11640D [Brassica napus]
Length=556

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/532 (61%), Positives = 398/532 (75%), Gaps = 12/532 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LLL N+GI+AMHMQLL+ND+VV+FDRT+FG SNI L  G CR++P + V K+D
Sbjct  27    AAGGKWDLLLSNVGISAMHMQLLSNDRVVMFDRTNFGPSNISLPNGNCRRNPQDPVSKMD  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS+EYDVA N VRPL VQ++ WCSS +V PDG L+QTGG  DG+   R F+PC+D +
Sbjct  87    CTAHSIEYDVASNKVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCDDNQ  146

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDWVEI N L + RWY++NHILPDG+QI+IGGR +FNYEF+PKT   +++  LPFLAET+
Sbjct  147   CDWVEINNGLAKRRWYSSNHILPDGKQIVIGGRGQFNYEFFPKTTSPNVIA-LPFLAETS  205

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYPYVFLN DG LFIFANN+AIL DY+K+ VV+ YPA+P G PRSYPSTGSAV
Sbjct  206   DKGEENNLYPYVFLNTDGRLFIFANNRAILLDYVKNTVVKTYPAIPGGDPRSYPSTGSAV  265

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             LLPLKNL+A  I AEVL+CGGAPKG+F  AS +  F+ AL+TC RI+I D NP W +E M
Sbjct  266   LLPLKNLEADKIDAEVLVCGGAPKGSFILASRKRTFVKALDTCARIKINDENPQWMVEKM  325

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P AR+MGDM  LPNG++L+ING + GSA +  GR PV  P LYH +NPV +RFE LNP+ 
Sbjct  326   PRARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVFVPDLYHPENPVNSRFESLNPNT  385

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHSTAI+LRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL+   A +RP 
Sbjct  386   IPRMYHSTAIILRDGRVLVGGSNPHAFYNF-TGVLFPTELSLEAFSPAYLEPEFAKLRPK  444

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
             IT P S S   YG  ++++F  AG V G  V VTMV PSFT+HSFS +QRLL L      
Sbjct  445   ITSPKSQSTITYGMNLKVEFEVAGEVKGP-VKVTMVFPSFTSHSFSMNQRLLVLDNVSVK  503

Query  1547  KPVGI--------NTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             +   +          + +   TP S  ++P GYYM+FVV++ IPSEGIW+++
Sbjct  504   RTSSVFGVLFGTSTNFEVQVRTPRSAIIAPPGYYMMFVVNQNIPSEGIWVRL  555



>gb|KGN60011.1| hypothetical protein Csa_3G866440 [Cucumis sativus]
Length=560

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/551 (59%), Positives = 406/551 (74%), Gaps = 16/551 (3%)
 Frame = +2

Query  29    FTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDR  208
              +L+F    LF   +P           A GG W LL  ++GI+AMHMQLL ND+VV++DR
Sbjct  21    LSLIFTNLLLFSSLSP---------TTAAGGSWMLLQRSVGISAMHMQLLQNDRVVMYDR  71

Query  209   TDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMP  388
             TDFG SN+ L GG+C +DP +  +KVDCTAHS+EY+V  NT RPLMV +DVWCSS +V+P
Sbjct  72    TDFGPSNLSLPGGKCLRDP-KAKIKVDCTAHSIEYNVITNTFRPLMVLSDVWCSSGSVLP  130

Query  389   DGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGR  568
             DGTL+QTGG+N G+  VR F PC+   CDW EIP AL   RWYATNHILPDGRQII GGR
Sbjct  131   DGTLVQTGGFNSGERRVRKFRPCS--TCDWEEIPLALSARRWYATNHILPDGRQIIFGGR  188

Query  569   EEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDY  748
              ++NYEFYPK      +++L FLAETND G ENNLYPYVFL  DG+LFIFANN+AIL+DY
Sbjct  189   RQYNYEFYPKDEATQNVFDLRFLAETNDNGIENNLYPYVFLQPDGNLFIFANNRAILFDY  248

Query  749   IKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASER  925
              K+ VV+ +PA+PDG+PR+YPSTGSAV+LPL N+ A  I  EVL+CGGAPKG++  A+  
Sbjct  249   TKNKVVKTFPAIPDGEPRNYPSTGSAVMLPL-NVDAKFIEVEVLVCGGAPKGSYDKANSH  307

Query  926   GVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDG  1105
             G+F+ AL TC RI+ITD NP W METMP  R+M DM+ LPNGN+L+ING + G+AG+  G
Sbjct  308   GIFVEALRTCARIKITDQNPQWVMETMPQPRVMVDMLLLPNGNVLLINGGSAGAAGWEIG  367

Query  1106  RNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNG  1285
             R P   PVLYHT+NPVG RFE+ NP+ IPRMYHSTAILLRD RVLVGGSNPH +Y F  G
Sbjct  368   RKPALNPVLYHTNNPVGKRFELQNPTTIPRMYHSTAILLRDGRVLVGGSNPHSSYNF-TG  426

Query  1286  ALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTV  1465
              LFPTELRLEAFSP YLD   A +RP I  P S  K  +G+ +++ FT  G VD   ++V
Sbjct  427   VLFPTELRLEAFSPSYLDPEFAYLRPAIQFPASSVKLRHGQALKVGFTVPGKVDSTRLSV  486

Query  1466  TMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHK  1645
             T+++PSF THSFS +QRLL L      +  G   Y +    PGSGN++P+GYY+L++VHK
Sbjct  487   TILSPSFNTHSFSMNQRLLIL-STTKYRLRGNKKYEVEVTIPGSGNVAPSGYYILYLVHK  545

Query  1646  GIPSEGIWIQM  1678
              IPS GIW+Q+
Sbjct  546   EIPSIGIWVQL  556



>ref|XP_004147869.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 ref|XP_004170844.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=548

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/551 (59%), Positives = 406/551 (74%), Gaps = 16/551 (3%)
 Frame = +2

Query  29    FTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDR  208
              +L+F    LF   +P           A GG W LL  ++GI+AMHMQLL ND+VV++DR
Sbjct  9     LSLIFTNLLLFSSLSP---------TTAAGGSWMLLQRSVGISAMHMQLLQNDRVVMYDR  59

Query  209   TDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMP  388
             TDFG SN+ L GG+C +DP +  +KVDCTAHS+EY+V  NT RPLMV +DVWCSS +V+P
Sbjct  60    TDFGPSNLSLPGGKCLRDP-KAKIKVDCTAHSIEYNVITNTFRPLMVLSDVWCSSGSVLP  118

Query  389   DGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGR  568
             DGTL+QTGG+N G+  VR F PC+   CDW EIP AL   RWYATNHILPDGRQII GGR
Sbjct  119   DGTLVQTGGFNSGERRVRKFRPCS--TCDWEEIPLALSARRWYATNHILPDGRQIIFGGR  176

Query  569   EEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDY  748
              ++NYEFYPK      +++L FLAETND G ENNLYPYVFL  DG+LFIFANN+AIL+DY
Sbjct  177   RQYNYEFYPKDEATQNVFDLRFLAETNDNGIENNLYPYVFLQPDGNLFIFANNRAILFDY  236

Query  749   IKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASER  925
              K+ VV+ +PA+PDG+PR+YPSTGSAV+LPL N+ A  I  EVL+CGGAPKG++  A+  
Sbjct  237   TKNKVVKTFPAIPDGEPRNYPSTGSAVMLPL-NVDAKFIEVEVLVCGGAPKGSYDKANSH  295

Query  926   GVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDG  1105
             G+F+ AL TC RI+ITD NP W METMP  R+M DM+ LPNGN+L+ING + G+AG+  G
Sbjct  296   GIFVEALRTCARIKITDQNPQWVMETMPQPRVMVDMLLLPNGNVLLINGGSAGAAGWEIG  355

Query  1106  RNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNG  1285
             R P   PVLYHT+NPVG RFE+ NP+ IPRMYHSTAILLRD RVLVGGSNPH +Y F  G
Sbjct  356   RKPALNPVLYHTNNPVGKRFELQNPTTIPRMYHSTAILLRDGRVLVGGSNPHSSYNF-TG  414

Query  1286  ALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTV  1465
              LFPTELRLEAFSP YLD   A +RP I  P S  K  +G+ +++ FT  G VD   ++V
Sbjct  415   VLFPTELRLEAFSPSYLDPEFAYLRPAIQFPASSVKLRHGQALKVGFTVPGKVDSTRLSV  474

Query  1466  TMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHK  1645
             T+++PSF THSFS +QRLL L      +  G   Y +    PGSGN++P+GYY+L++VHK
Sbjct  475   TILSPSFNTHSFSMNQRLLIL-STTKYRLRGNKKYEVEVTIPGSGNVAPSGYYILYLVHK  533

Query  1646  GIPSEGIWIQM  1678
              IPS GIW+Q+
Sbjct  534   EIPSIGIWVQL  544



>ref|XP_006435123.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
 gb|ESR48363.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
Length=521

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/523 (64%), Positives = 401/523 (77%), Gaps = 12/523 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG W+LL  +IGI++MHMQLLNND+VV+FDR+DFG SN+ L  G+C        +K D
Sbjct  10    AAGGGWQLLQKSIGISSMHMQLLNNDRVVMFDRSDFGPSNLSLPPGKC--------LKTD  61

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHSVEY V  N  RPL VQ++VWCSS AV PDG LIQTGG+NDG+  +R F PCND+ 
Sbjct  62    CTAHSVEYSVLTNEFRPLFVQSNVWCSSGAVRPDGVLIQTGGFNDGEKKIRSFVPCNDES  121

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI + L   RWYAT+HILPDGR IIIGGR +FNYEFYPK  G   +Y+LPFL +TN
Sbjct  122   CDWKEI-DGLGARRWYATDHILPDGRIIIIGGRRQFNYEFYPKN-GAPNVYSLPFLVQTN  179

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             DP  ENNLYP+VFLNVDG LFIFANN+AIL+DY+ + VV+ YPAMP G PRSYPS+GSAV
Sbjct  180   DPRVENNLYPFVFLNVDGFLFIFANNRAILFDYVNNKVVKQYPAMPGGDPRSYPSSGSAV  239

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL AP + AEVL+CGGAPKGA+  +E+GVF+ ALNTC RI+ITDP P W +ETMP
Sbjct  240   LLPLKNLLAPSVAAEVLVCGGAPKGAYEQAEKGVFIAALNTCARIKITDPTPTWVLETMP  299

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
               R+MGDM  LPNGN+L+INGA +G+AG+  GR+PV  PV+Y  DN  G+RF++ NPS I
Sbjct  300   QPRVMGDMTLLPNGNVLLINGAGKGTAGWELGRDPVLAPVVYRPDNIPGSRFDLQNPSTI  359

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTA+LLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YLDA  A +RP I
Sbjct  360   PRMYHSTAVLLRDGRVLVGGSNPHAYYNF-TGVLFPTELSLEAFSPYYLDAPFANLRPTI  418

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
              LP S     Y +   ++F+A+GPV  N VTVTMVAPSF THSFS +QRLL L    TV 
Sbjct  419   VLPESQFTLKYKQKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVL-ASDTVT  477

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              +G + Y +   +PGSGNL+P+GYY+LFVVH+ +PSEGIW+ +
Sbjct  478   KLGNSGYEIVVNSPGSGNLAPSGYYLLFVVHQDVPSEGIWVHV  520



>ref|XP_010536368.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=557

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/523 (62%), Positives = 392/523 (75%), Gaps = 5/523 (1%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCT  295
             GG W+LL  N+GI+AMHMQLL+ND+V+ FDRTDFG SNI L  G+CR +  + V K+DCT
Sbjct  37    GGSWQLLQLNVGISAMHMQLLHNDRVITFDRTDFGPSNISLPSGKCRNNQNDRVSKLDCT  96

Query  296   AHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCD  475
             AHSVEYDV  N +RPL VQ++ WCSS +V PDGTL+QTGG  DG+   R+F PC   KCD
Sbjct  97    AHSVEYDVLGNGIRPLTVQSNTWCSSGSVTPDGTLVQTGGDLDGERRARLFFPCKTNKCD  156

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDP  655
             W EI N L   RWYA+NHILPDGRQII+GGR +FN+EFYPKT   + +YNLPFLA+TND 
Sbjct  157   WSEIDNGLALRRWYASNHILPDGRQIIVGGRGQFNFEFYPKTKDPN-VYNLPFLAQTNDR  215

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
             G+ENNLYPYVFLNVDG++FIFANN+AIL DY K+ +V+ YP +P G PRSYPSTGSAV L
Sbjct  216   GSENNLYPYVFLNVDGNIFIFANNRAILLDYTKNIIVKTYPTIPGGDPRSYPSTGSAVFL  275

Query  836   PLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFMETMPM  1012
             PLKNL+A  + AEVL+CGGAP+GA+  A  R  F+ ALNTC RI+ITDPNP W METMP 
Sbjct  276   PLKNLEAANVEAEVLVCGGAPRGAYEQAWRRNNFVKALNTCARIKITDPNPNWVMETMPQ  335

Query  1013  ARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIP  1192
             AR+MGDM  LPNGN+L++NG A G+A +  GR PV  P LY  +NPVG+RFE  NPS IP
Sbjct  336   ARVMGDMTLLPNGNVLLVNGGASGTAAWELGREPVLAPDLYLPENPVGSRFETQNPSTIP  395

Query  1193  RMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHIT  1372
             RMYHSTA+LLRD RVLVGGSNPH  Y F  G LFPTEL LE+FSP YL+   +G+RP IT
Sbjct  396   RMYHSTAVLLRDGRVLVGGSNPHAFYNF-TGVLFPTELSLESFSPSYLNQEMSGLRPKIT  454

Query  1373  LPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGG-GGTVK  1549
              P S  K  Y   ++++F+    V+ N + VTMV PSFTTHSFS +QRLL L     T K
Sbjct  455   SPKSQFKMKYNTKVKLRFSVQSEVE-NPMKVTMVFPSFTTHSFSMNQRLLVLDNVKFTRK  513

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                   Y +   TP S NL+P GYYM+FVV++ +PSEGIW+++
Sbjct  514   SKAKTVYEVEVKTPRSANLAPPGYYMMFVVNQDVPSEGIWVRL  556



>ref|XP_010477216.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=550

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/527 (61%), Positives = 398/527 (76%), Gaps = 5/527 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             ++A GG W +LLPN+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + + +
Sbjct  26    SSAAGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDNPNDAISR  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHS+EYDVA NTVRPL VQ++ WCSS +V PDG L+QTGG  DG+   R F+PCN+
Sbjct  86    TDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCNN  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGR-QIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
              +CDWVEI N L + RWY++NH+LPDG+ QI+IGG+ +FNYEFYPKT   +++  LPFLA
Sbjct  146   DQCDWVEIDNGLWKRRWYSSNHLLPDGKQQIVIGGQGQFNYEFYPKTTNPNVVA-LPFLA  204

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             ETND G ENNLYPYVFLN DG+LFIFANN+AIL DY+K+ VV+ +PA+P G PRSYPSTG
Sbjct  205   ETNDRGQENNLYPYVFLNTDGNLFIFANNRAILLDYVKNTVVKTFPAIPGGDPRSYPSTG  264

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFM  997
             SAVLLPLKNL+A  I AEVL+CGGAPKG++  A  R  F+ AL+TC RI+I D +P W +
Sbjct  265   SAVLLPLKNLEADQIEAEVLVCGGAPKGSYNLAFRRKTFVKALDTCARIKINDADPQWTV  324

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP AR+MGDM  LPNG++LIING A GSA +  GR PV  P +YH +NPV TRFE +N
Sbjct  325   ETMPHARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLAPDVYHPENPVNTRFETMN  384

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS IPRMYHS A+LLRD RVLVGGSNPH  YVF  GALFPTELRLEAFSP YL+   A +
Sbjct  385   PSTIPRMYHSAAVLLRDGRVLVGGSNPHAFYVF-TGALFPTELRLEAFSPAYLEPQFATL  443

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S S+  YG  ++++F+    V G  V VTMV PSFTTHSFS +QRLL L   
Sbjct  444   RPRIQSPKSQSRIKYGMNLKVKFSVVREVTGP-VKVTMVFPSFTTHSFSMNQRLLVLDNV  502

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                +     TY +   TP S  ++  GYYM+FVV++ IPSEG+W+++
Sbjct  503   KFTRKGRSTTYEVQVRTPKSAIIAQPGYYMIFVVNQNIPSEGVWVRL  549



>ref|XP_008377171.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/523 (61%), Positives = 384/523 (73%), Gaps = 12/523 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LL   +GI+AMHMQLL ND+V +FDRTDFG SN+ L  G C        V+ D
Sbjct  22    AAGGKWQLLQQXVGISAMHMQLLRNDRVXMFDRTDFGKSNLXLPNGEC--------VRND  73

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDV  NTVR L + +DVWCSS AV P+G LIQTGG   GD  VRVF PC    
Sbjct  74    CTAHSAEYDVKTNTVRALTLLSDVWCSSGAVAPNGRLIQTGGNGAGDRRVRVFEPCTG--  131

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW E  NAL   RWYAT+HILP+G+QIIIGGR +FNYE YPKT     +Y+LPFL +T+
Sbjct  132   CDWKEFANALGARRWYATDHILPNGQQIIIGGRXQFNYEXYPKTGSSSKVYSLPFLVQTB  191

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYP+VFLNVDG+LFIFANN+AIL+DY K+ VV+ YP +P G PR  PSTGSAV
Sbjct  192   DAGEENNLYPFVFLNVDGNLFIFANNRAILFDYAKNXVVKTYPQIPGGDPRCXPSTGSAV  251

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL AP + AEVL+CGGAPKG+F  + +G F+ ALNTC RI+I +P P W METMP
Sbjct  252   LLPLKNLAAPSVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARIKINNPKPQWVMETMP  311

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM+ LP+G +L+INGA+ G+AG+  GRNPV  PV+Y  DN +G+RFE  NP+ I
Sbjct  312   QARVMGDMLLLPDGTVLLINGASSGAAGWEIGRNPVLNPVVYRPDNAIGSRFEQQNPTTI  371

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH  Y F +  LFPTELRLEAFSP YLDA    +RP I
Sbjct  372   PRMYHSTAILLRDGRVLVGGSNPHXKYEFTB-VLFPTELRLEAFSPDYLDAKYNNLRPQI  430

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S +K  YGK + IQF+  G +    V+V+MVAPSF  HSFS +QRLL L     VK
Sbjct  431   VAPISQAKINYGKKLSIQFSVKGNLATXSVSVSMVAPSFNXHSFSMNQRLLVL-XAENVK  489

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              VG   Y +   TP SGNL+P+GYY+L+VVH+ IPS  IW+Q+
Sbjct  490   KVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_009335433.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/523 (62%), Positives = 390/523 (75%), Gaps = 12/523 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LL  ++GI+AMHMQLL+ND+V++FDRTDFG SN+ L  G C        V  D
Sbjct  22    AAGGKWQLLQQSVGISAMHMQLLHNDRVIMFDRTDFGPSNLSLPNGAC--------VNND  73

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS EYDV  NTVRPL V +DVWCSS AV PDG LIQTGG   G+  VR+F PC    
Sbjct  74    CTAHSAEYDVKTNTVRPLTVLSDVWCSSGAVAPDGRLIQTGGNGAGERRVRIFEPCTG--  131

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI NAL+  RWYAT+HILP+GRQIIIGGR +FNYEFYPKT     LY+LPFL +TN
Sbjct  132   CDWKEIENALNARRWYATDHILPNGRQIIIGGRGQFNYEFYPKTKSSSNLYSLPFLTQTN  191

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYP+VFLN+DG+LFIFANN+AIL++Y K  VV+ YP +P G PR YPSTGSAV
Sbjct  192   DAGEENNLYPFVFLNMDGNLFIFANNRAILFNYAKKQVVQTYPQIPGGDPRCYPSTGSAV  251

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL+AP + AEVL+CGGAPKG+F    +G F+ AL TC RI I +PN  W +ETMP
Sbjct  252   LLPLKNLKAPSVEAEVLVCGGAPKGSFAKVNQGTFVEALKTCARIEINNPNAQWVVETMP  311

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM+ LP+G +L+INGA+ G+AG+ +GRNPV  P++Y  DN +G+RFE  NP+ I
Sbjct  312   QARVMGDMLLLPDGTVLLINGASSGTAGWENGRNPVLNPIVYRPDNAIGSRFEQQNPTTI  371

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVL+GGSNPH  Y F N  LFPTELRLEAFSP YLDA    +RP I
Sbjct  372   PRMYHSTAILLRDGRVLIGGSNPHDKYEFTN-VLFPTELRLEAFSPDYLDATYNNLRPTI  430

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P S +K  YGK + IQF+  G +    V+V+MVAPSF THSFS +QRLL LG    +K
Sbjct  431   VAPNSQAKINYGKKLSIQFSVKGNLVSKSVSVSMVAPSFNTHSFSMNQRLLVLGAENIIK  490

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               G  TY +   TP S NL+P+GYY+L+VVH+ IPS  IW+Q+
Sbjct  491   G-GTTTYEVQVTTPASRNLAPSGYYLLYVVHQQIPSAAIWVQI  532



>ref|XP_010459669.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=550

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/527 (61%), Positives = 396/527 (75%), Gaps = 5/527 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             ++A GG W +LLPN+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V +
Sbjct  26    SSAAGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDNPNDAVSR  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHS+EYDVA NTVRPL VQ++ WCSS +V PDG L+QTGG  DG    R F+PCN+
Sbjct  86    MDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGALKARTFSPCNN  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGR-QIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
              +CDWVEI N L + RWY++NH+LPDG+ QI+IGG+ +FNYEF+PKT   +++  LPFLA
Sbjct  146   DQCDWVEIDNGLSKRRWYSSNHLLPDGKQQIVIGGQGQFNYEFFPKTTNPNVVA-LPFLA  204

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             ETND G ENNLYPYVF+N DG+LFIFANN+AIL DY+K+ VV+ +PA+P G PRSYPSTG
Sbjct  205   ETNDRGQENNLYPYVFMNTDGNLFIFANNRAILLDYVKNTVVKTFPAIPGGDPRSYPSTG  264

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFM  997
             SAVLLPLKNL+   I AEVL+CGGAPKG++  A  R  F+ AL+TC RI+I D +P W +
Sbjct  265   SAVLLPLKNLEVAKIEAEVLVCGGAPKGSYNLAFRRKTFVKALDTCARIKINDADPQWTV  324

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP AR+MGDM  LPNG++LIING A GSA +  GR PV  P +YH +NPV TRFE +N
Sbjct  325   ETMPHARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLAPDVYHPENPVNTRFETMN  384

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS IPRMYHS A+LLRD RVLVGGSNPH  Y F  G LFPTELRLEAFSP YL+   A +
Sbjct  385   PSTIPRMYHSAAVLLRDGRVLVGGSNPHAFYEF-TGVLFPTELRLEAFSPVYLEQQFANL  443

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S S+  YG  ++++F+  G V G  V VTMV PSFTTHSFS +QRLL L   
Sbjct  444   RPRIQSPKSQSRIKYGMNLKVKFSVIGEVTGP-VKVTMVFPSFTTHSFSMNQRLLVLDNV  502

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                +     TY +   TP S  ++  GYYM+FVV++ IPSEG+W+++
Sbjct  503   KFTRKGRSTTYEVQVRTPKSAIIAQPGYYMMFVVNQNIPSEGVWVRL  549



>ref|XP_008444780.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=563

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/551 (60%), Positives = 405/551 (74%), Gaps = 12/551 (2%)
 Frame = +2

Query  32    TLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRT  211
             TLLFA + LF V+   PW     +    GG W LL  NIG+  MHMQLL+ND+VVIFDRT
Sbjct  24    TLLFAEF-LFPVS---PWP----SQPIDGGGWHLLQENIGVLPMHMQLLHNDRVVIFDRT  75

Query  212   DFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPD  391
             DFG SN+    G+CR DP +V +K+DCTAHS+EYD+A N+ RPLMVQTDVWCS+ A M D
Sbjct  76    DFGASNLSFPDGKCRTDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMSD  135

Query  392   GTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             G L+QTGG+NDGD  VR+F P  +   DW EIP AL   RWY TN ILPDGRQI+IGGR 
Sbjct  136   GALVQTGGFNDGDRRVRIFKPYPNGS-DWEEIPFALAVRRWYPTNQILPDGRQIVIGGRR  194

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             +F+YEF PKT G    Y+ PFL ETNDP  ENNLYP+VFLNVDG+LF+FANN++IL+DY 
Sbjct  195   QFSYEFVPKTNGATKAYSFPFLVETNDPMIENNLYPFVFLNVDGNLFVFANNRSILFDYA  254

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
             ++ V++++PA+P G PR YPSTGSA LLPL+NLQA  I AEVL+CGGAPKGAF  +   +
Sbjct  255   RNKVLKIFPAIPGGDPRCYPSTGSAALLPLRNLQAATIEAEVLVCGGAPKGAFDKAVNRI  314

Query  932   FMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRN  1111
             F+GALNTC +I+ITDP P W METMPM R+MGDMV LPNGN+LIINGA  G+AG+ + R+
Sbjct  315   FVGALNTCAKIKITDPKPEWVMETMPMGRVMGDMVLLPNGNVLIINGAGSGTAGWDNARD  374

Query  1112  PVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGAL  1291
             PV  PVLY  ++  G+RF +LNPS IPR+YHSTA+LLRD RVLVGGSNP+  Y F  G  
Sbjct  375   PVLNPVLYRPNDSPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNF-TGVP  433

Query  1292  FPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAG-PVDGNLVTVT  1468
             FPTELRLEAFSPPYLD     +RP I  P S +   + + + ++FT  G  V  N V VT
Sbjct  434   FPTELRLEAFSPPYLDPEFENLRPKILSPSSQTTVSHAQQLAVRFTVTGNNVTLNAVEVT  493

Query  1469  MVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKG  1648
             MVAP F THSFS  QRLL + GG  V  +G  T+ +    P SG ++P+GYY+LFVVH+ 
Sbjct  494   MVAPPFNTHSFSMSQRLLVI-GGENVTDMGNATWDVHVSIPKSGTIAPSGYYLLFVVHRE  552

Query  1649  IPSEGIWIQMV  1681
             IPS GIWI+++
Sbjct  553   IPSNGIWIRLL  563



>gb|KGN62661.1| hypothetical protein Csa_2G365680 [Cucumis sativus]
Length=561

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/551 (60%), Positives = 403/551 (73%), Gaps = 14/551 (3%)
 Frame = +2

Query  32    TLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRT  211
             TL FA + LFLV+   P            GRW LL  +IG+  MHMQLL++D+VVIFDRT
Sbjct  24    TLQFADF-LFLVSQSQP---------IDSGRWNLLQEDIGVLPMHMQLLHSDRVVIFDRT  73

Query  212   DFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPD  391
             DFG SN+P   G+CR DP +V +K+DCTAHS+EYD+A N+ RPLMVQTDVWCS+ A M D
Sbjct  74    DFGASNLPFPDGKCRMDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMSD  133

Query  392   GTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             G L+QTGG+NDGD  VR+F P  +   DW EIP AL   RWY TN ILPDGRQI+IGGR 
Sbjct  134   GALVQTGGFNDGDRRVRIFKPYPNGS-DWEEIPFALAVRRWYPTNQILPDGRQIVIGGRR  192

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             +F+YEF PKT G    Y+ PFL ETNDP  ENNLYP+VFLNVDG+LF+FANN++IL+DY 
Sbjct  193   QFSYEFVPKTNGATKAYSFPFLVETNDPLIENNLYPFVFLNVDGNLFVFANNRSILFDYA  252

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
             ++ V++++PA+P G PR YPSTGSAVLLPL+NLQA  I AEVL+CGGAPKGAF  +   +
Sbjct  253   RNKVLKIFPAIPGGDPRCYPSTGSAVLLPLRNLQAATIEAEVLVCGGAPKGAFDKAVNRI  312

Query  932   FMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRN  1111
             F+GALNTC RI+ITDP P W METMPM R+MGDMV LPNG++LIINGA  G+AG+ + R+
Sbjct  313   FVGALNTCARIKITDPKPEWVMETMPMGRVMGDMVLLPNGDVLIINGAGSGTAGWDNARD  372

Query  1112  PVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGAL  1291
             P+  P+LY  ++  G+RF +LNPS IPR+YHSTA+LLRD RVLVGGSNP+  Y F  G  
Sbjct  373   PILNPILYRPNDSPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNF-TGVP  431

Query  1292  FPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAG-PVDGNLVTVT  1468
             FPTELRLEAFSPPYLD     +RP I  P S +   + + + ++F   G  V  N V VT
Sbjct  432   FPTELRLEAFSPPYLDPEFENMRPKILSPSSQTTVRHTQQLAVRFNVTGNNVSLNTVEVT  491

Query  1469  MVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKG  1648
             MVAP F THSFS  QRLL + GG  V  +G  T  +    PGSG ++P GYY+LFVVH+ 
Sbjct  492   MVAPPFNTHSFSMSQRLLVI-GGENVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHRE  550

Query  1649  IPSEGIWIQMV  1681
             IPS GIWI++V
Sbjct  551   IPSNGIWIRIV  561



>ref|XP_007160695.1| hypothetical protein PHAVU_001G009200g [Phaseolus vulgaris]
 gb|ESW32689.1| hypothetical protein PHAVU_001G009200g [Phaseolus vulgaris]
Length=552

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/549 (59%), Positives = 395/549 (72%), Gaps = 16/549 (3%)
 Frame = +2

Query  56    LFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIP  235
             L  V  PPP+S      A+  G+W+LL   IGI AMHMQLL+ D VVIFDRTDFGLSN+ 
Sbjct  13    LLAVKLPPPYS----VVASAAGQWQLLHKTIGIVAMHMQLLHTDTVVIFDRTDFGLSNLS  68

Query  236   LGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGG  415
             L GGRCR DP E VVK DCTAHSVEYDVA NT RPL +QT++WCSSAAV  DGTL+QTGG
Sbjct  69    LAGGRCRHDPDEKVVKTDCTAHSVEYDVASNTFRPLFLQTNIWCSSAAVAADGTLVQTGG  128

Query  416   WNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYP  595
             +NDG+  VR F PC    CDW E P+ L   RWYATN  LPDGRQIIIGGR +FNYEFYP
Sbjct  129   FNDGERTVRTFLPC--ATCDWREFPDGLAVRRWYATNQKLPDGRQIIIGGRRQFNYEFYP  186

Query  596   KTPG-GDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRL  772
             K+       Y+LPFL +TNDP  ENNLYP+VFLNVDG LFIFANN+AIL DY K+AVV+ 
Sbjct  187   KSDATAKNTYSLPFLVQTNDPSEENNLYPFVFLNVDGTLFIFANNRAILLDYTKNAVVKT  246

Query  773   YPAMPDGQPRSYPSTGSAVLLPLK----NLQAPGIVAEVLICGGAPKGAFPASERGVFMG  940
             +P +P   PR YPSTGSAVLLPL+    N  +P   AEVLICGGAP+GA+  +++G F+G
Sbjct  247   FPNIPGNDPRCYPSTGSAVLLPLRSKNPNFFSPE--AEVLICGGAPRGAYTQAKKGTFIG  304

Query  941   ALNTCGRIRITDPNPVWFMETMP--MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNP  1114
             AL TC RI+ITDPNP W METMP    RLM DM+ LPNGN+LI+NGA  GSAG+  GR+P
Sbjct  305   ALRTCARIKITDPNPTWVMETMPGGKGRLMSDMILLPNGNVLIVNGAGSGSAGWEFGRDP  364

Query  1115  VQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALF  1294
             V  P +Y+ D   G+RFEILN +  PRMYHS+A+L+RD RVLV GSNPH  Y F +   F
Sbjct  365   VLAPFVYNPDKEFGSRFEILNATNTPRMYHSSAVLVRDGRVLVAGSNPHVGYNFSH-VTF  423

Query  1295  PTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMV  1474
             PT+L +EAFSPPYL+AA   +RP I  P S ++  YG+ ++++   A  +  +LV VT++
Sbjct  424   PTDLSVEAFSPPYLEAAFRNVRPRIVGPESGTRVAYGQKVKVRVDVAAALVRSLVRVTVL  483

Query  1475  APSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIP  1654
             AP F THSFS +QR+L L         G  T+ +    PGS  L+P G+Y+LFVVH+ IP
Sbjct  484   APPFATHSFSMNQRMLVLEPSHVTNVDGPTTFELEVTAPGSPILAPPGFYLLFVVHQEIP  543

Query  1655  SEGIWIQMV  1681
             SEGIWIQ++
Sbjct  544   SEGIWIQIL  552



>ref|XP_004164439.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=561

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/551 (59%), Positives = 402/551 (73%), Gaps = 14/551 (3%)
 Frame = +2

Query  32    TLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRT  211
             TL FA + LFLV+   P            GRW LL  +IG+  MHMQLL++D+VVIFDRT
Sbjct  24    TLQFADF-LFLVSQSQP---------IDSGRWNLLQEDIGVLPMHMQLLHSDRVVIFDRT  73

Query  212   DFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPD  391
             DFG SN+P   G+CR DP +V +K+DCTAHS+EYD+A N+ RPLMVQTDVWCS+ A M D
Sbjct  74    DFGASNLPFPDGKCRMDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMSD  133

Query  392   GTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             G L+QTGG+NDGD  VR+F P  +   DW EIP AL   RWY TN ILPDGRQI+IGGR 
Sbjct  134   GALVQTGGFNDGDRRVRIFKPYPNGS-DWEEIPFALAVRRWYPTNQILPDGRQIVIGGRR  192

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             +F+YEF PKT G    Y+ PFL ETNDP  ENNLYP+VFLNVDG+LF+FANN++IL+DY 
Sbjct  193   QFSYEFVPKTNGATKAYSFPFLVETNDPLIENNLYPFVFLNVDGNLFVFANNRSILFDYA  252

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
             ++ V++++PA+P G PR YPSTGSAVLLPL+ LQA  I AEVL+CGGAPKGAF  +   +
Sbjct  253   RNKVLKIFPAIPGGDPRCYPSTGSAVLLPLRKLQAATIEAEVLVCGGAPKGAFDKAVNRI  312

Query  932   FMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRN  1111
             F+GALNTC RI+ITDP P W METMPM R+MGDMV LPNG++LIINGA  G+AG+ + R+
Sbjct  313   FVGALNTCARIKITDPKPEWVMETMPMGRVMGDMVLLPNGDVLIINGAGSGTAGWDNARD  372

Query  1112  PVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGAL  1291
             P+  P+LY  ++  G+RF +LNPS IPR+YHSTA+LLRD RVLVGGSNP+  Y F  G  
Sbjct  373   PILNPILYRPNDSPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNF-TGVP  431

Query  1292  FPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAG-PVDGNLVTVT  1468
             FPTELRLEAFSPPYLD     +RP I  P S +   + + + ++F   G  V  N V VT
Sbjct  432   FPTELRLEAFSPPYLDPEFENMRPKILSPSSQTTVRHTQQLAVRFNVTGNNVSLNTVEVT  491

Query  1469  MVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKG  1648
             MVAP F THSFS  QRLL + GG  V  +G  T  +    PGSG ++P GYY+LFVVH+ 
Sbjct  492   MVAPPFNTHSFSMSQRLLVI-GGENVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHRE  550

Query  1649  IPSEGIWIQMV  1681
             IPS GIWI++V
Sbjct  551   IPSNGIWIRIV  561



>ref|XP_008348975.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=536

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/529 (60%), Positives = 392/529 (74%), Gaps = 12/529 (2%)
 Frame = +2

Query  92    NMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYE  271
             ++  A A GG+W++L  N+GI+AMHMQL  ND++V+FDRTDFG SN+ L  G C      
Sbjct  19    SVLXAHAAGGKWQVL-KNVGISAMHMQLFKNDRIVLFDRTDFGKSNLSLPNGNC------  71

Query  272   VVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFN  451
               V  DCTAHS E+ V  N VRPL V +DVWCSS ++   G LIQTGG N G+  VRVF 
Sbjct  72    --VXNDCTAHSAEFVVQTNAVRPLTVLSDVWCSSGSMDAYGNLIQTGGNNIGERRVRVFT  129

Query  452   PCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLP  631
             PC    CDW EI + L   RWYATNHILPDGR+IIIGGR +FNYEFYPKT     +Y+LP
Sbjct  130   PCTG--CDWKEIVDGLAARRWYATNHILPDGREIIIGGRGQFNYEFYPKTASTSNVYSLP  187

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL++TNDPG ENNLYP+VFLN DG+LF+FANN+AIL DY+K+ VV+ YP +P G PRSYP
Sbjct  188   FLSQTNDPGQENNLYPFVFLNPDGNLFVFANNRAILLDYVKNVVVKTYPQIPGGDPRSYP  247

Query  812   STGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVW  991
             STGSAVLLPLKNL AP + AEVL+CGGAPKG+F  + +G F+ ALNTC RI+ITDPN  W
Sbjct  248   STGSAVLLPLKNLMAPSVEAEVLVCGGAPKGSFVQANKGTFVEALNTCARIKITDPNAQW  307

Query  992   FMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
              +ETMP AR+MGDM+ L +  +L+INGA+ G AG+  GRNPV  PV+Y  DN VG+RFE 
Sbjct  308   IVETMPQARVMGDMLLLXDSTVLLINGASSGVAGWEIGRNPVFNPVVYRPDNAVGSRFEQ  367

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
              NP+ IPRMYHS+A+L+RD RV+VGGSNPH  Y FG+  LFPTELRLEAFSP YLDA  A
Sbjct  368   QNPTTIPRMYHSSALLVRDGRVIVGGSNPHDKYQFGSDVLFPTELRLEAFSPEYLDAKYA  427

Query  1352  GIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
              +RP I  PG+ +K  YG  + +QF+  G    N V+VTMVAP F+THSFS +QRLL L 
Sbjct  428   NLRPTIIAPGNQAKIHYGIKLAVQFSLTGTFTKNSVSVTMVAPPFSTHSFSMNQRLLVL-  486

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                 V+ VG  TY +   TP S NL+P+GYY+L+VVH+ IPSEGI++++
Sbjct  487   AAENVQQVGPTTYQVQVTTPPSKNLAPSGYYILYVVHQQIPSEGIFVKI  535



>ref|XP_004152661.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=561

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/551 (59%), Positives = 402/551 (73%), Gaps = 14/551 (3%)
 Frame = +2

Query  32    TLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRT  211
             TL FA + LFLV+   P            GRW LL  +IG+  MHMQLL++D+VVIFDRT
Sbjct  24    TLQFADF-LFLVSQSQP---------IDSGRWNLLQEDIGVLPMHMQLLHSDRVVIFDRT  73

Query  212   DFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPD  391
             DFG SN+P   G+CR DP +V +K+DCTAHS+EYD+A N+ RPLMVQTDVWCS+ A M D
Sbjct  74    DFGASNLPFPDGKCRMDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMSD  133

Query  392   GTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             G L+QTGG+NDGD  VR+  P  +   DW EIP AL   RWY TN ILPDGRQI+IGGR 
Sbjct  134   GALVQTGGFNDGDRRVRILKPYPNGS-DWEEIPFALAVRRWYPTNQILPDGRQIVIGGRR  192

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             +F+YEF PKT G    Y+ PFL ETNDP  ENNLYP+VFLNVDG+LF+FANN++IL+DY 
Sbjct  193   QFSYEFVPKTNGATKAYSFPFLVETNDPLIENNLYPFVFLNVDGNLFVFANNRSILFDYA  252

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
             ++ V++++PA+P G PR YPSTGSAVLLPL+NLQA  I AEVL+CGGAPKGAF  +   +
Sbjct  253   RNKVLKIFPAIPGGDPRCYPSTGSAVLLPLRNLQAATIEAEVLVCGGAPKGAFDKAVNRI  312

Query  932   FMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRN  1111
             F+GALNTC RI+ITDP P W METMPM R+MGDMV LPNG++LIINGA  G+AG+ + R+
Sbjct  313   FVGALNTCARIKITDPKPEWVMETMPMGRVMGDMVLLPNGDVLIINGAGSGTAGWDNARD  372

Query  1112  PVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGAL  1291
             P+  P+LY  ++  G+RF +LNPS IPR+YHSTA+LLRD RVLVGGSNP+  Y F  G  
Sbjct  373   PILNPILYRPNDSPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNF-TGVP  431

Query  1292  FPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAG-PVDGNLVTVT  1468
             FPTELRLEAFSPPYLD     +RP I  P S +   + + + ++F   G  V  N V VT
Sbjct  432   FPTELRLEAFSPPYLDPEFENMRPKILSPSSQTTVRHTQQLAVRFNVTGNNVSLNTVEVT  491

Query  1469  MVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKG  1648
             MVAP F THSFS  QRLL + GG  V  +G  T  +    PGSG ++P GYY+LFVVH+ 
Sbjct  492   MVAPPFNTHSFSMSQRLLVI-GGENVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHRE  550

Query  1649  IPSEGIWIQMV  1681
             IPS GIWI++V
Sbjct  551   IPSNGIWIRIV  561



>ref|XP_009103375.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=556

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/532 (60%), Positives = 393/532 (74%), Gaps = 12/532 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LLL N+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V K+D
Sbjct  27    AAGGKWDLLLSNVGISAMHMQLLPNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSKID  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS+EY V  NT+RPL VQ++ WCSS ++ PDG L+QTGG  DG+   R F PC+D++
Sbjct  87    CTAHSIEYKVESNTIRPLTVQSNTWCSSGSLRPDGVLVQTGGDRDGELKARTFTPCSDEE  146

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDWVEI   L R RWY++NHILPDG+QIIIGG+ +FNYEF+PKT   +++ +LPFLAETN
Sbjct  147   CDWVEINKGLARRRWYSSNHILPDGKQIIIGGQRQFNYEFFPKTTSPNVI-DLPFLAETN  205

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYPYVFLN DG+LFIFANN+AIL DY+ + VV+ YPA+P G PRSYPSTGSAV
Sbjct  206   DRGEENNLYPYVFLNTDGNLFIFANNRAILLDYVNNKVVKTYPAIPGGDPRSYPSTGSAV  265

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             LLPLKNL+A  I AEVL+CGGAPKG+F  A  +  F+ AL+TC RI+I D NP W +E M
Sbjct  266   LLPLKNLEADKIDAEVLVCGGAPKGSFILAFRKRTFVKALDTCARIKINDENPQWMVEKM  325

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P AR+MGDM  LPNG++L+ING + GSA +  GR PV  P +YH +NPV +RFE LNP+ 
Sbjct  326   PRARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVFVPDMYHPENPVNSRFESLNPNT  385

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHSTAILLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL+   A  RP 
Sbjct  386   IPRMYHSTAILLRDGRVLVGGSNPHGFYNF-TGVLFPTELSLEAFSPAYLEPEFAKFRPK  444

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
             IT P S S   YG  ++++F  +G + G  V VTMV PSFTTHSFS +QRLL L      
Sbjct  445   ITSPKSQSTITYGTNLKVKFKVSGKIKGP-VKVTMVFPSFTTHSFSMNQRLLVLDNVKVK  503

Query  1547  KPVGI--------NTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             +   +          Y +   TP S  ++P GYYM+F+V++ +PSEGIW+++
Sbjct  504   RTSSVFGALFGKSKHYEVQVRTPRSAIIAPPGYYMMFLVNENVPSEGIWVRL  555



>ref|XP_008350494.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=537

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/523 (60%), Positives = 387/523 (74%), Gaps = 12/523 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG W+LL   IG++AMHMQL  ND++V+FDRTDFG SN+ L  G C        V  D
Sbjct  26    AAGGNWQLL-ATIGVSAMHMQLFKNDRIVLFDRTDFGKSNLSLPNGNC--------VNND  76

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS E+ V     RPL V +DVWCSS ++ P+G LIQ+GG+N G+  VRVF PC    
Sbjct  77    CTAHSAEFVVQTKAFRPLTVLSDVWCSSGSMAPNGNLIQSGGFNSGERRVRVFQPCTG--  134

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI + L   RWYATNH LPDGRQIIIGG ++FNYEFYPKT      Y+LPFL++TN
Sbjct  135   CDWTEIVDGLAVRRWYATNHALPDGRQIIIGGTKQFNYEFYPKTESTSNAYSLPFLSQTN  194

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             DPG ENNLYP+VFLN DG+LFIFANN+AIL DY+K+ VV+ YP +P G PR YPS+GSAV
Sbjct  195   DPGEENNLYPFVFLNPDGNLFIFANNRAILLDYMKNVVVKTYPQIPGGDPRCYPSSGSAV  254

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL AP + AEVL+CGGAPKG+F  + + +F+ ALNTC RI+ITDPNP W +ETMP
Sbjct  255   LLPLKNLTAPSVEAEVLVCGGAPKGSFAQANKDIFVEALNTCARIKITDPNPQWIVETMP  314

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM+ LP+  +L+INGA+ G AG+  GRNPV  PV+Y  DN VG+RFE  NP+ I
Sbjct  315   QARVMGDMILLPDSTVLLINGASSGVAGWEIGRNPVLNPVVYRPDNAVGSRFEQQNPTTI  374

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHS+A+L+RD RV+VGGSNPH  Y FG+  LFPTE RLEAFSP YLDA  A +RP I
Sbjct  375   PRMYHSSALLVRDGRVVVGGSNPHDKYQFGSNVLFPTEFRLEAFSPEYLDAKYADLRPTI  434

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P + +K  YG  + IQF+  G +  N V+VTMVAP F+THSFS +QRLL LG    V+
Sbjct  435   LTPLNQAKIHYGIKLTIQFSLTGTLAMNSVSVTMVAPPFSTHSFSMNQRLLVLGAEN-VQ  493

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              VG  TY     TP SGNL+P+GYY+L+VVH+ IPSEGI++Q+
Sbjct  494   QVGPTTYQAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIFVQI  536



>ref|XP_009336713.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=537

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/523 (60%), Positives = 386/523 (74%), Gaps = 12/523 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG W+LL   IG++AMHMQL  ND++V+FD TDFG SN+ L  G C        V  D
Sbjct  26    AAGGNWQLL-ATIGVSAMHMQLFKNDRIVLFDNTDFGKSNLSLPDGNC--------VNND  76

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS E+ V     RPL V +DVWCSS ++ P+G LIQ+GG+N G+  VRVF PC    
Sbjct  77    CTAHSAEFVVQTKAFRPLTVLSDVWCSSGSMAPNGNLIQSGGFNSGERRVRVFQPCTG--  134

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW EI + L   RWYATNH+LPDGRQIIIGG ++FNYEFYPKT      YNLPFL++TN
Sbjct  135   CDWTEIVDGLAVRRWYATNHVLPDGRQIIIGGTKQFNYEFYPKTESTSNAYNLPFLSQTN  194

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             DPG ENNLYP+VFLN DG+LFIFANN+AIL DY+K+ VV+ YP +  G PR YPS+GSAV
Sbjct  195   DPGEENNLYPFVFLNPDGYLFIFANNRAILLDYMKNVVVKTYPQIQGGDPRCYPSSGSAV  254

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLPLKNL AP + AEV +CGGAPKG+F  + +G+F+ ALNTC RI+ITDPNP W +ETMP
Sbjct  255   LLPLKNLTAPSVEAEVFVCGGAPKGSFAQANKGIFVEALNTCARIKITDPNPQWIVETMP  314

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM+ LP+  +L+INGA+ G AG+  GRNPV  PV+Y  DN VG+RFE  NP+ I
Sbjct  315   QARVMGDMILLPDSTVLLINGASSGVAGWEIGRNPVLNPVVYRPDNAVGSRFEQQNPTTI  374

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHS+A+L+RD RV+VGGSNPH  Y FG+  LFPTE RLEAFSP YLDA  A +RP I
Sbjct  375   PRMYHSSALLVRDGRVVVGGSNPHDKYQFGSNVLFPTEFRLEAFSPEYLDAKYADLRPTI  434

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
               P + +K  YG  + IQF+  G +  N V+VTMVAP F+THSFS +QRLL L G   V+
Sbjct  435   LTPLNQAKIRYGIKLTIQFSLTGTLAMNSVSVTMVAPPFSTHSFSMNQRLLVL-GAENVQ  493

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              VG  TY     TP SGNL+P+GYY+L+VVH+ IPSEGI++Q+
Sbjct  494   KVGPTTYQAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIFVQI  536



>ref|XP_009337697.1| PREDICTED: galactose oxidase-like, partial [Pyrus x bretschneideri]
Length=500

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/510 (62%), Positives = 382/510 (75%), Gaps = 11/510 (2%)
 Frame = +2

Query  149   GIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAEN  328
             GI+AMHMQL  ND++V+FDRTDFG SN+ L  G C        V  DCTAHS E+ V  N
Sbjct  1     GISAMHMQLFKNDRIVLFDRTDFGKSNLSLPNGNC--------VNNDCTAHSAEFVVQTN  52

Query  329   TVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRW  508
              VRPL V +DVWCSS ++   G LIQTGG N G+  VRVF PC    CDW EI + L   
Sbjct  53    AVRPLTVLSDVWCSSGSMDAYGNLIQTGGNNIGERRVRVFTPCTG--CDWKEIVDGLAAR  110

Query  509   RWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVF  688
             RWYATNHILPDGR+IIIGGR +FNYEFYPKT     +Y+LPFL++TNDPG ENNLYP+VF
Sbjct  111   RWYATNHILPDGREIIIGGRGQFNYEFYPKTASTSNVYSLPFLSQTNDPGQENNLYPFVF  170

Query  689   LNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIV  868
             LN DG+LF+FANN+AIL DY+K+ VV+ YP +P G PRSYPSTGSAVLLPLKNL AP + 
Sbjct  171   LNPDGNLFVFANNRAILLDYVKNVVVKTYPQIPGGDPRSYPSTGSAVLLPLKNLMAPSVE  230

Query  869   AEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPN  1048
             AEVL+CGGAPKG+F  + +G F+ ALNTC RI+ITDPNP W +ETMP AR+MGDM+ LP+
Sbjct  231   AEVLVCGGAPKGSFVQANKGTFVEALNTCARIKITDPNPQWIVETMPQARVMGDMLLLPD  290

Query  1049  GNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRD  1228
               +L+INGA+ G AG+  GRNPV  PV+Y  DN VG+RFE  NP+ IPRMYHS+A+L+RD
Sbjct  291   STVLLINGASSGVAGWEIGRNPVFNPVVYRPDNAVGSRFEQQNPTTIPRMYHSSALLVRD  350

Query  1229  SRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGK  1408
              RV+VGGSNPH  Y FGN  LFPTELRLEAFSP YLDA  A +RP I  PG+ +K  YG 
Sbjct  351   GRVIVGGSNPHEKYQFGNDVLFPTELRLEAFSPEYLDAKYANLRPTILAPGNQAKIHYGI  410

Query  1409  VIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVT  1588
              + IQF+  G    N V+VTMVAP F+THSFS +QRLL L G   V+ VG  TY +   T
Sbjct  411   KLAIQFSLTGTFAKNSVSVTMVAPPFSTHSFSMNQRLLVL-GAENVQQVGPTTYQVQVTT  469

Query  1589  PGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             P S NL+P+GYY+LFVVH+ IPSEGI++++
Sbjct  470   PPSKNLAPSGYYILFVVHQQIPSEGIFVKI  499



>emb|CDY44191.1| BnaC05g15480D [Brassica napus]
Length=777

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/526 (62%), Positives = 395/526 (75%), Gaps = 6/526 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W LLLPN+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + + K+D
Sbjct  27    AAGGKWNLLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDPISKID  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS+EYDVA NT+RPL VQ++ WCSS +V PDG L+QTGG  DG+   R+F+PC DK+
Sbjct  87    CTAHSIEYDVASNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFSPCKDKR  146

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDW+EI N L + RWY++NHILPDG+QI+IGG+ +FNYEF+PKT   +++  LPFLAETN
Sbjct  147   CDWIEINNGLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFFPKTTSPNVIA-LPFLAETN  205

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYPYVFLN DG LFIFANN+AIL DY+K+ VV+ YPA+P G PRSYPSTGSAV
Sbjct  206   DRGEENNLYPYVFLNTDGRLFIFANNRAILLDYVKNTVVKTYPAIPGGDPRSYPSTGSAV  265

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             LLPLKNL+A  I AEVL+CGGAPKG++  A  R  F+ AL+TC RI+I D NP W +E M
Sbjct  266   LLPLKNLEAVKIDAEVLVCGGAPKGSYLLAFRRKTFVKALDTCARIKINDENPQWMVEKM  325

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P AR+MGDM  LPNG++LIING A GSA +  GR PV  P +YH +NPV +RFE LNP+ 
Sbjct  326   PRARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLVPDVYHPENPVNSRFESLNPTT  385

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHSTA+LLRD RVLVGGSNPH  Y F N  LFPTEL LEAFSP YL+   A +RP 
Sbjct  386   IPRMYHSTAVLLRDGRVLVGGSNPHAFYNFTN-VLFPTELSLEAFSPGYLEPEFAKLRPK  444

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
             I  P S     Y   ++++F  AG V G  V VTMV PSFTTHSFS +QRLL L    T 
Sbjct  445   IQSPKSQVMITYRMNLKLKFKVAGEVKGP-VKVTMVFPSFTTHSFSMNQRLLVL-DNVTF  502

Query  1547  KPVGINT-YHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             K  G +T Y +   TP S N++  GYYM+FVV++ IPSE +  ++V
Sbjct  503   KRSGKSTNYEVEVKTPRSANIALPGYYMVFVVNQNIPSEDLKPRLV  548



>ref|XP_010536365.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=539

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/532 (60%), Positives = 401/532 (75%), Gaps = 8/532 (2%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A  AG GRWELL  N GI+AMH+QLL ND+VV+FDRT++G SNI L  G+CR +P + V 
Sbjct  7     AYVAGDGRWELLRGNAGISAMHIQLLRNDRVVMFDRTNWGPSNISLPDGKCRNNPNDRVS  66

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             K+DCTAHSVEYDV  N VRPL V ++ +CSS +V PDGTL+QTGG  DGD +VR+F+ C 
Sbjct  67    KMDCTAHSVEYDVVANRVRPLTVMSNPFCSSGSVRPDGTLVQTGGDEDGDRMVRLFSACE  126

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
                CDW EI + L   RWYA++HILPDGRQ+I+GGRE+FN+EF+PKT     +Y+LPFL+
Sbjct  127   MDGCDWTEIKSGLAVRRWYASDHILPDGRQVIVGGREQFNFEFFPKTKDPK-VYSLPFLS  185

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             ETND G+ENNLYP++FLNVDG+LF+FANN+AIL DY K+ VV+ YP +P G PRSYPS+G
Sbjct  186   ETNDNGSENNLYPFIFLNVDGNLFVFANNRAILLDYGKNVVVKTYPMIPGGDPRSYPSSG  245

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASER-GVFMGALNTCGRIRITDPNPVWFM  997
             SAVL+PLKN++A  + A+VL+CGGAPKGA+  + R   F+ ALNTC RI+ITDPNP W +
Sbjct  246   SAVLIPLKNIEASNVEADVLVCGGAPKGAYQLAWRNNTFVEALNTCARIKITDPNPQWTL  305

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             ETMP AR+MGDM+ LPNGN+LIING A+G+A Y  G++PV  PVLY  DNP+G+RFE LN
Sbjct  306   ETMPHARVMGDMILLPNGNVLIINGCAKGTASYQAGQDPVFAPVLYRPDNPIGSRFETLN  365

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             P+  PRMYHSTA+LLRD RVLVGGSNP+P Y F  G LFPTEL L+AFSP YLD   +G 
Sbjct  366   PNTTPRMYHSTAVLLRDGRVLVGGSNPNPFYNF-TGVLFPTELSLQAFSPSYLDPGFSGT  424

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRL--LDLG  1531
             RP I  P S SK  Y   ++++F A   V+   V VTMV PSFTTHSFS +QRL  LD+ 
Sbjct  425   RPKIISPDSQSKIEYNSRLKLRFAANDVVNNATVRVTMVFPSFTTHSFSMNQRLLFLDIM  484

Query  1532  GGGTVKPVGINT---YHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                 +K VG      Y +   TP + N++P GYYM+F+V+  IPSEGIW+Q+
Sbjct  485   DFTPLKTVGNGKSLIYEVVMKTPRTTNIAPPGYYMMFLVNGEIPSEGIWVQL  536



>ref|XP_006390288.1| hypothetical protein EUTSA_v10018361mg [Eutrema salsugineum]
 gb|ESQ27574.1| hypothetical protein EUTSA_v10018361mg [Eutrema salsugineum]
Length=552

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/526 (60%), Positives = 389/526 (74%), Gaps = 5/526 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A+  GG W+LLL N+GI+AMH QLL ND+V+IFDRT+FG SNI L  G C   P + V K
Sbjct  30    ASGAGGTWQLLLSNVGISAMHSQLLINDRVIIFDRTNFGPSNISLPNGACHDSPNDAVSK  89

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHS+EYDVA N +RPL VQ++ WCSS  V+PDGTL+QTGG  DG+   R+F+PC D
Sbjct  90    QDCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVLPDGTLLQTGGDKDGERKARLFSPCQD  149

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ N L   RWYA+NHILPDGRQIIIGGR +FN+EF+PKT   + LY+LPFL++
Sbjct  150   NSCDWTEVDNGLAARRWYASNHILPDGRQIIIGGRGQFNFEFFPKTNAPN-LYSLPFLSQ  208

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TND G ENNLYPYVFLN DG++FIFANN+AIL DY K+ V + YP +P G PRSYPSTGS
Sbjct  209   TNDRGDENNLYPYVFLNSDGNMFIFANNRAILLDYSKNNVFKTYPEIPGGDPRSYPSTGS  268

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPAS-ERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLP+KNL+A  +  EVL+CGGAPKG+F  S  R  F+ AL+TC RI+I D NP W +E
Sbjct  269   AVLLPVKNLEATVVDLEVLVCGGAPKGSFDLSLRRNTFVKALDTCARIKINDANPQWIVE  328

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM  LP+G++L+ING + G+AG+  GR PV  P LYH D PVG+RFE+LNP
Sbjct  329   KMPRARVMGDMTLLPDGHVLLINGGSSGTAGWELGREPVLNPDLYHPDKPVGSRFEVLNP  388

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHSTA LLRD RVLVGGSNPH  Y F  G LFPTELRLEAFSP YL+     IR
Sbjct  389   STIPRMYHSTAGLLRDGRVLVGGSNPHAFYNF-TGVLFPTELRLEAFSPSYLETQYRSIR  447

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P   S   YG ++ ++F   G V    V VTMV PSFTTHSFS +QRLL L   G
Sbjct  448   PRIVSPTLQSTINYGGILRLRFRVMGRVKSP-VKVTMVFPSFTTHSFSMNQRLLVLDHFG  506

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             + + +G+ T+ +    P S NL+P G+YM+FVV++ IPSEGIW+++
Sbjct  507   SSR-MGLWTHEVRVKIPRSANLAPPGFYMVFVVNQDIPSEGIWVRL  551



>ref|XP_008377179.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=537

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/526 (59%), Positives = 387/526 (74%), Gaps = 12/526 (2%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
              A A GG W++L   IG++AMHMQLL ND++V+FDRTDFG SN+ L  G C        V
Sbjct  23    TAHAAGGNWQVL-ATIGVSAMHMQLLKNDRIVLFDRTDFGTSNLSLPNGNC--------V  73

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
               DCTAHS E+ V     RPL V +DVWCSS ++ P+G LIQTGG+N G+  VRVF PC 
Sbjct  74    NNDCTAHSAEFVVQTKAFRPLTVLSDVWCSSGSMAPNGNLIQTGGFNSGERRVRVFQPCT  133

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
                CDW E+ + L   RWYATNH+LPDGR+IIIGGR +FNYEFYPKT     +Y+LPFL+
Sbjct  134   G--CDWTEVVDGLAVRRWYATNHVLPDGREIIIGGRGQFNYEFYPKTDSTSNVYSLPFLS  191

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             +TND G ENNLYP+VFLN DG+LFIFANN+AIL DY+K+ +V+ YP +P G PR YPS+G
Sbjct  192   QTNDAGQENNLYPFVFLNPDGNLFIFANNRAILLDYLKNVIVKTYPQIPGGDPRCYPSSG  251

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             SAVLLPLKNL AP + AEVL+CGGAPKG+F  + +G F+ ALNTC RI+ITDPNP W +E
Sbjct  252   SAVLLPLKNLTAPSVEAEVLVCGGAPKGSFVQANKGTFVDALNTCARIKITDPNPQWIVE  311

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMP AR+MGDM+ LP+  +L+INGA+ G AG+  GRNPV  PV+Y  DN  G+RFE  NP
Sbjct  312   TMPQARVMGDMLLLPDSTVLLINGASSGVAGWEIGRNPVLNPVVYRPDNAFGSRFEQQNP  371

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             + IPRMYHS+A+L+RD RV+VGGSNPH  Y FG+  LFPTE RLEAFSP YLDA  A +R
Sbjct  372   TTIPRMYHSSALLVRDGRVIVGGSNPHDKYQFGSNVLFPTEFRLEAFSPEYLDAKYADLR  431

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P + +K  YG+ + +QF+  G +  N V VTMVAP F+THSFS +QRLL LG   
Sbjct  432   PTIINPLNQAKIHYGRKLTVQFSLTGTLAMNSVLVTMVAPPFSTHSFSMNQRLLVLGAEN  491

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              V+ VG  TY     TP S NL+P+GYY+L+VVH+ IPSEGI++ +
Sbjct  492   -VQKVGPTTYQAQVTTPPSVNLAPSGYYILYVVHQQIPSEGIFVHI  536



>ref|NP_177692.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAF87115.1|AC006434_11 F10A5.18 [Arabidopsis thaliana]
 gb|AEE35738.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/526 (60%), Positives = 385/526 (73%), Gaps = 8/526 (2%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
              A+   G WELLLPN+GI+AMH QLL+ND+V+++DRT+FG SNI L  G CR  P + V 
Sbjct  29    VASGDEGTWELLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRSSPGDAVS  88

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             K DCTAHSVEYDVA N +RPL VQ++ WCSS  V PDGTL+QTGG  DG+  VR+ +PC+
Sbjct  89    KTDCTAHSVEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTGGDLDGERKVRLMDPCD  148

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
             D  CDW+E+ N L   RWYATNHILPDGRQIIIGGR +FNYEF+PKT   +  Y++PFL+
Sbjct  149   DNSCDWIEVDNGLAARRWYATNHILPDGRQIIIGGRGQFNYEFFPKTNAPN-FYSIPFLS  207

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             ETNDPG ENNLYP+VFLN DG+LFIFANN+AIL DY  + VVR YP +P G PRSYPSTG
Sbjct  208   ETNDPGDENNLYPFVFLNTDGNLFIFANNRAILLDYSTNTVVRTYPEIPGGDPRSYPSTG  267

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             SAVLLP+KNL     V EVL+CGGAPKG++  S R  F+ AL+TC RI I D NP W +E
Sbjct  268   SAVLLPIKNL-----VLEVLVCGGAPKGSYNLSWRNTFVKALDTCARININDVNPQWIVE  322

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM+ LP+GN+L+ING + G+A +  GR PV  P LYH D PVG+RFE+ NP
Sbjct  323   KMPRARVMGDMMLLPDGNVLLINGGSSGTAAWELGREPVLHPDLYHPDKPVGSRFEVQNP  382

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPRMYHS A LLRD R+LVGGSNPH  Y F  G LFPTELRLEAFSP YLD   + +R
Sbjct  383   STIPRMYHSIATLLRDGRILVGGSNPHAFYNF-TGVLFPTELRLEAFSPSYLDTKYSSLR  441

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P   +   YG+V+ ++F  +G V    V VTM+ PSFTTHSFS HQRLL L    
Sbjct  442   PSIVDPRPQTTVNYGRVLRLRFIVSGRVKSP-VKVTMLFPSFTTHSFSMHQRLLVLDHVI  500

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             + K      Y +   TP S  L+P GYYM+FVV++ IPSEG+W+++
Sbjct  501   SFKLGISKIYEVRVRTPSSAILAPPGYYMVFVVNQDIPSEGLWVRL  546



>ref|XP_011045140.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=511

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/514 (63%), Positives = 386/514 (75%), Gaps = 13/514 (3%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLLNND+VVI+DRTD+G SNI L  G+CR +  E+V+K DCTAHSVEYDV  N  RP
Sbjct  1     MHMQLLNNDRVVIYDRTDYGKSNISLPHGKCRNNSRELVIKYDCTAHSVEYDVLANKFRP  60

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYA  520
             LMVQTDVWCSS AV+PDG+LIQTGG+NDG   VR F PCN   CDWVE  + L   RWYA
Sbjct  61    LMVQTDVWCSSGAVVPDGSLIQTGGFNDGRRKVRTFYPCNGD-CDWVETGDGLKARRWYA  119

Query  521   TNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVD  700
             TNHILPDG+QI+IGGR +FNYEFYPKT   ++ Y+LPFL +TND G ENNLYP+VFLN D
Sbjct  120   TNHILPDGKQIVIGGRRQFNYEFYPKTSSPNV-YSLPFLLQTNDRGIENNLYPFVFLNSD  178

Query  701   GHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVL  880
             G+LFIFANN+AIL+DY    VV+ YPA+P G PRSYPSTGSAVLLPLKNL A  I AEVL
Sbjct  179   GNLFIFANNRAILFDYKTGKVVKTYPAIPGGDPRSYPSTGSAVLLPLKNLDAATIEAEVL  238

Query  881   ICGGAPKGAF------PASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTL  1042
             +CGGAPKG+F       ++ER  F  AL+TCGRI+I +P+P W METMP AR+MGDM  L
Sbjct  239   VCGGAPKGSFEMATKRKSAERK-FNKALDTCGRIKINEPSPQWVMETMPCARVMGDMTLL  297

Query  1043  PNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILL  1222
             PNG +LIINGA  G+AG+ +GR P  +PVLY  D   G+RFE LNPS IPRMYHSTAILL
Sbjct  298   PNGVVLIINGAGDGTAGWENGRRPALSPVLYWPDGAAGSRFEQLNPSTIPRMYHSTAILL  357

Query  1223  RDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI-TLPGSHSKF-  1396
             RD RVLVGGSNPH  Y F  G LFPTEL LEAFSPPYLD+    +RP I +   S  K+ 
Sbjct  358   RDGRVLVGGSNPHIGYDF-TGVLFPTELSLEAFSPPYLDSKNKHLRPKIVSSTASKGKYI  416

Query  1397  GYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHM  1576
             GYG+ + ++F   G +  ++V+VTMVAP+F THSFS + RLL L     V  V  + Y +
Sbjct  417   GYGQKLWVRFKVIGKLKADMVSVTMVAPAFNTHSFSMNHRLLAL-RNENVTYVRTSIYDI  475

Query  1577  TAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                TP SG L+P+GYYML+VVH+ IPS GIW+++
Sbjct  476   QVTTPSSGYLAPSGYYMLYVVHQYIPSIGIWVKL  509



>emb|CDY29385.1| BnaA06g14110D [Brassica napus]
Length=505

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/508 (62%), Positives = 383/508 (75%), Gaps = 6/508 (1%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V K+DCTAHS+EYDVA NT+RP
Sbjct  1     MHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRNNPQDPVSKIDCTAHSIEYDVASNTIRP  60

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYA  520
             L VQ++ WCSS +V PDG L+QTGG  DG+   R+F PCN+KKCDW+EI N L + RWY+
Sbjct  61    LTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFTPCNNKKCDWIEINNGLTKRRWYS  120

Query  521   TNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVD  700
             +NHILPDG QI+IGG+ +FNYEF+PKT   +++  LPFLAETND G ENNLYPYVFLN D
Sbjct  121   SNHILPDGTQIVIGGQGQFNYEFFPKTTSPNVIA-LPFLAETNDRGEENNLYPYVFLNND  179

Query  701   GHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVL  880
             G+LFIFANN+AIL DY+K+ VV+ YPA+P G PRSYPSTGSAVLLPLKNL+A  I AEVL
Sbjct  180   GNLFIFANNRAILLDYVKNTVVKTYPAIPGGDPRSYPSTGSAVLLPLKNLEAAKIDAEVL  239

Query  881   ICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNI  1057
             +CGGAPKG++  A  R  F+ AL+TC RI+I D NP W +E MP AR+MGDM  LPNG++
Sbjct  240   VCGGAPKGSYLLAFRRKTFVKALDTCARIKINDENPQWTVEKMPRARVMGDMTLLPNGDV  299

Query  1058  LIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRV  1237
             LIING A GSA +  GR PV  P +YH++NPV +RFE LNP+ IPRMYHSTA+LLRD RV
Sbjct  300   LIINGGASGSAAWELGREPVLVPDVYHSENPVNSRFESLNPTTIPRMYHSTAVLLRDGRV  359

Query  1238  LVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIE  1417
             LVGGSNPH  Y F N  LFPTEL LEAFSP YL+   A  RP I  P S     Y   ++
Sbjct  360   LVGGSNPHAFYNFTN-VLFPTELSLEAFSPAYLEPEFAKFRPKIQSPKSQVMITYRMDLK  418

Query  1418  IQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINT-YHMTAVTPG  1594
             ++F  AG V G  V VTMV PSFTTHSFS +QRLL L    T K  G +T Y +   TP 
Sbjct  419   LKFKVAGEVKGP-VKVTMVFPSFTTHSFSMNQRLLVL-DNVTFKRSGKSTNYEVQVKTPR  476

Query  1595  SGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             S N++P GYYM+FVV++ IPSEGIW+++
Sbjct  477   SVNIAPPGYYMMFVVNQNIPSEGIWVRL  504



>ref|XP_010670864.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/523 (60%), Positives = 381/523 (73%), Gaps = 6/523 (1%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             +W+LL  +IG++AMHMQLLNND+V+I DRTDFG SNI L  G+CR+DPY++ +  DCTAH
Sbjct  96    QWQLLQKSIGVSAMHMQLLNNDRVIILDRTDFGPSNISLSNGKCRKDPYDLAMTTDCTAH  155

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWV  481
             SVEYD   NT RPLMV TD WCSS A + +GTL+QTGG+NDG  V R F P  +  CDWV
Sbjct  156   SVEYDSLSNTFRPLMVLTDTWCSSGATLANGTLVQTGGYNDGARVARTFQPSCEA-CDWV  214

Query  482   EIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTP-GGDLLYNLPFLAETNDPG  658
             E+PN L   RWYAT+H LPDGR I++GGR  FNYEFYPKT      LY LPFLA+TND  
Sbjct  215   EMPNKLLIRRWYATDHALPDGRLIVVGGRRAFNYEFYPKTTFSSSKLYKLPFLAQTNDAK  274

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
              ENNLYP+VFLNVDG+LFIFANN+AIL DY  + VVR YP +P G PRSYPS+GSAVLLP
Sbjct  275   MENNLYPFVFLNVDGNLFIFANNRAILLDYTNNLVVRTYPTIPGGDPRSYPSSGSAVLLP  334

Query  839   LKNLQA--PGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPM  1012
             L+NL+     +V EVLICGGAP G++  +  G F+ ALNTC RI I   N  W METMPM
Sbjct  335   LRNLEMGLLNMVVEVLICGGAPSGSYLKARSGQFLPALNTCARININSRNSTWVMETMPM  394

Query  1013  ARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIP  1192
             AR+MGDM+ LPNG+IL+INGA  G+AG+  GR+PV  PV+YH +N +G+RFE  N S IP
Sbjct  395   ARVMGDMIVLPNGDILLINGAGSGTAGWELGRDPVLEPVIYHPNNALGSRFETQNSSQIP  454

Query  1193  RMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHIT  1372
             RMYHS+AI++RD RVLVGGSNPH    F +  L+PTEL LEAFSPPYL+     +RP I 
Sbjct  455   RMYHSSAIVMRDGRVLVGGSNPHMVNRFTH-VLYPTELSLEAFSPPYLNPNKTVLRPIII  513

Query  1373  LPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG-GTVK  1549
              P S SK  Y +V+E++F   G +D   + VTM+ P F THSFS  QRLL L     +  
Sbjct  514   TPDSGSKVQYAQVLEVKFLVFGLIDQASIMVTMLRPPFNTHSFSMSQRLLVLTNTMQSAT  573

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              +G N + +   TP S N+SP GYY+LFVVH+GIPS GIW+Q+
Sbjct  574   SIGPNQFQVNVTTPESTNISPPGYYLLFVVHQGIPSTGIWVQI  616



>gb|KFK37635.1| hypothetical protein AALP_AA3G008700 [Arabis alpina]
Length=548

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/525 (58%), Positives = 386/525 (74%), Gaps = 3/525 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A  GGG W+LLLPN+GI+AMH QLL+ND V+++DR++FG SNI L  G C   P ++V K
Sbjct  26    AYGGGGTWKLLLPNVGISAMHSQLLHNDHVIMYDRSNFGPSNISLPNGTCLNSPNDIVSK  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHS+EYDVA N +RPL V+++ WCSS  + PDGTL+QTGG  +G+   R+F+PC+D
Sbjct  86    RDCTAHSIEYDVASNQIRPLTVRSNTWCSSGGLTPDGTLLQTGGDKEGERKARLFSPCDD  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ N L   RWYA+NH+LPDGRQIIIGGR +F+YEFYPKT     L++LPFL +
Sbjct  146   NTCDWSEVDNGLATRRWYASNHVLPDGRQIIIGGRAQFSYEFYPKT-NAPYLFSLPFLTQ  204

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T+DP  ENNLYP VFLN DG+LFIFANN+AIL DY K+ VV+ YP +P G PRSYPSTGS
Sbjct  205   TDDPHDENNLYPSVFLNRDGNLFIFANNRAILLDYKKNMVVKTYPEIPGGDPRSYPSTGS  264

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             +VLLP+KNL+   +  EVL+CGGAPKG+F  + R   + AL+TC RI+I D NP W +E 
Sbjct  265   SVLLPIKNLEDEMVQLEVLVCGGAPKGSFQLTSRNTHVKALDTCARIKINDANPQWLVEK  324

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP AR+MGDM+ LP+G++L+ING   G+AG+  GR PV  P LY  + PVG+RF   NP+
Sbjct  325   MPRARVMGDMILLPDGHVLLINGGGSGTAGWERGREPVLNPDLYRPNKPVGSRFVTQNPT  384

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHSTAILLRD R+LVGGSNPH  Y F N  LFPTEL LEAFSP YL++  +  RP
Sbjct  385   TIPRMYHSTAILLRDGRILVGGSNPHEFYKFTN-VLFPTELSLEAFSPSYLESKHSSHRP  443

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I    S S   YG+++ ++F   G V    V VTMV PSF THSFS HQRLL L     
Sbjct  444   RIVNLTSQSTINYGQILTLRFDVTGRVKSP-VKVTMVFPSFNTHSFSMHQRLLILDHVFA  502

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             V+ +GI++Y +   TP S NL+P GYYM+FVV++GIPSEG+W+++
Sbjct  503   VRRLGISSYEVKVKTPRSVNLAPPGYYMVFVVNQGIPSEGVWVRL  547



>ref|XP_003544396.1| PREDICTED: uncharacterized protein LOC100791340 [Glycine max]
Length=551

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/531 (60%), Positives = 392/531 (74%), Gaps = 13/531 (2%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCT  295
             GG W++L  +IGI AMHMQLL+ D VVIFDRTDFGLSN+ L  G CR D  E+ VK DCT
Sbjct  25    GGHWKVLQQSIGIVAMHMQLLHTDTVVIFDRTDFGLSNLSLPDGLCRHDAAEMAVKTDCT  84

Query  296   AHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC--NDKK  469
             AHS+EYDV+ NT RPL +QT+VWCSSA+V  DGTLIQTGG+NDG+  VR F+PC      
Sbjct  85    AHSLEYDVSSNTFRPLFLQTNVWCSSASVASDGTLIQTGGFNDGEKKVRTFSPCPTTAAT  144

Query  470   CDWVEIP-NALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNLPFLAE  643
             CDW+E+P + L   RWY+TNH+LPDGRQIIIGGR +FNYEF+PKT       Y+LPFL +
Sbjct  145   CDWLELPSDTLSARRWYSTNHLLPDGRQIIIGGRRQFNYEFFPKTHTRAKNAYSLPFLVQ  204

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TNDP  ENNLYP+VFLNVD  LFIFANN+AIL+D+ K+AVVR +P +P G PR YPSTGS
Sbjct  205   TNDPHEENNLYPFVFLNVDSTLFIFANNRAILFDFTKNAVVRTFPTVPHGDPRCYPSTGS  264

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLPL+N   P   AEVL+CGGAP+G++  +++G F+GALNTC RI+ITDP+P W +ET
Sbjct  265   AVLLPLRN---PYSEAEVLVCGGAPRGSYNEAKKGNFLGALNTCARIKITDPDPKWVIET  321

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP AR+MGDM+ LPNGN+LIINGA  GSAG+   R+PV  PV+Y+ D   G+RFEIL  S
Sbjct  322   MPKARVMGDMILLPNGNVLIINGAGSGSAGWEFARDPVLNPVVYNPDKSTGSRFEILVES  381

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
               PRMYHSTAILLRD RVLV GSNPH  Y F N  +FPTEL +EAF PPYL++    +RP
Sbjct  382   NTPRMYHSTAILLRDGRVLVAGSNPHIGYNFSN-VMFPTELSVEAFYPPYLESGYDDVRP  440

Query  1364  HITLPGSH--SKFGYGKVIEIQF-TAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGG  1534
              I  P S   +K  YG+ ++++   A G +  +LV VT+ AP F THSFS +QR+L L  
Sbjct  441   RIVFPESEARTKVTYGEKVKVRVQVAGGSLVRSLVRVTVSAPPFNTHSFSMNQRMLVLEP  500

Query  1535  GGTVKPVG--INTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
                   VG    TY +   TPGS  L+P GYY+LFVVH+ IPS+GIWIQ++
Sbjct  501   INVTNIVGGPTPTYEIEVTTPGSPVLAPPGYYLLFVVHQEIPSQGIWIQIL  551



>ref|XP_002889034.1| hypothetical protein ARALYDRAFT_895435 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65293.1| hypothetical protein ARALYDRAFT_895435 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/527 (60%), Positives = 384/527 (73%), Gaps = 10/527 (2%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
              A+   G WELLLPN+GI+AMH QLL+ND+V+++DRT+FG SNI L  G CR  P + V 
Sbjct  29    VASGDEGTWELLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRSSPGDAVS  88

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
              +DCTAHSVEYDVA N +RPL VQ++ WCSS  V PDGTL QTGG  DG+  VR+F PC+
Sbjct  89    NIDCTAHSVEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLQQTGGDKDGERKVRLFAPCD  148

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
             D  CDW E+ N L   RWYATNH+LPDGRQIIIGGR +FN+EF+PKT   + LY+LPFL+
Sbjct  149   DNICDWTEVDNGLAARRWYATNHVLPDGRQIIIGGRGQFNFEFFPKTNAPN-LYSLPFLS  207

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             ETNDP  ENNLYPYVFLN DG+LFIFANN+AIL DY ++ VV+ YP +P G PRSYPSTG
Sbjct  208   ETNDPD-ENNLYPYVFLNTDGNLFIFANNRAILLDYSRNTVVKTYPEIPGGDPRSYPSTG  266

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASE-RGVFMGALNTCGRIRITDPNPVWFM  997
             SAVLLP+KNL     V EVL+CGGAPKG++  S+ R  F+ AL+TC RI I D NP W +
Sbjct  267   SAVLLPIKNL-----VLEVLVCGGAPKGSYDLSQRRNTFVKALDTCARININDVNPQWIV  321

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             E MP AR+MGDM+ LP+GN+L+ING   G+A +  GR PV  P +YH D PVG RFE  N
Sbjct  322   EKMPRARVMGDMMLLPDGNVLLINGGGSGTAAWELGREPVFNPDIYHPDKPVGLRFEAQN  381

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS IPRMYHSTA LLRD RVLVGGSNPH  Y F  G LFPTELRLEAFSP YLD   + I
Sbjct  382   PSKIPRMYHSTATLLRDGRVLVGGSNPHAFYNF-TGVLFPTELRLEAFSPSYLDPKYSSI  440

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S S   YG+++ +++T  G V    V VTM+ PSFTTHSFS HQRLL L   
Sbjct  441   RPSIVDPRSQSTINYGRILRLRYTVTGRVKSP-VKVTMLFPSFTTHSFSMHQRLLVLDHV  499

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              + +      Y +   TP S  L+P GYYM+FVV++ IPSEG+W+++
Sbjct  500   ISFRLGISRIYEVRVRTPSSPILAPPGYYMVFVVNQDIPSEGLWVRL  546



>ref|XP_002893079.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69338.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/547 (57%), Positives = 400/547 (73%), Gaps = 6/547 (1%)
 Frame = +2

Query  41    FALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFG  220
             F  + LFL +     + ++ +AA G   W+ + PN+GI+AMHMQLL+ND+VV++DRT+FG
Sbjct  7     FIFYALFLTSIQLLLTYHVSSAARG--LWKYIAPNVGISAMHMQLLHNDRVVMYDRTNFG  64

Query  221   LSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTL  400
              SNI L  G CR +P ++V K DCTAHS+EYDVA NTVRPL VQ++ WCSS +V PDG L
Sbjct  65    PSNISLPNGNCRDNPNDIVSKRDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVL  124

Query  401   IQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFN  580
             +QTGG  DG+   R F+PC++ +CDWVEI N L + RWYA+NHILPDG+QI+IGG+ +FN
Sbjct  125   VQTGGDRDGELKARTFSPCDNNQCDWVEINNGLTKRRWYASNHILPDGKQIVIGGQAQFN  184

Query  581   YEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHA  760
             YEF+PKT   +++  LPFLAET+D G ENNLYP+VF+N DG+LFIFANNKAIL DY+K+ 
Sbjct  185   YEFFPKTTNPNVVA-LPFLAETHDQGQENNLYPFVFMNTDGNLFIFANNKAILLDYVKNT  243

Query  761   VVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFM  937
             VV+ +PA+P G PR+YPSTGSAVLLPLKNL+A  I  EVL+CGGAPKG++  A  +  F+
Sbjct  244   VVKTFPAIPGGDPRNYPSTGSAVLLPLKNLEADQIETEVLVCGGAPKGSYNLAFRKKTFV  303

Query  938   GALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPV  1117
              AL+TC RI+I D NP W +E MP AR+MGDM+ LPNG++LIING + G+A +  GR PV
Sbjct  304   EALDTCARIKINDANPQWTVENMPHARVMGDMILLPNGDVLIINGGSFGTAAWELGREPV  363

Query  1118  QTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFP  1297
               P LYH +NPV +RFE L P+ IPRMYHS AILLRD RVLVGGSNPH  Y F  G LFP
Sbjct  364   LAPDLYHPENPVNSRFESLRPTTIPRMYHSAAILLRDGRVLVGGSNPHAFYNF-TGVLFP  422

Query  1298  TELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVA  1477
             TEL LEAFSP YL    + +RP I  P   S   YG  ++++FT  G V    V VT+V 
Sbjct  423   TELSLEAFSPVYLQREFSDLRPKIISPKPQSTIKYGMNLKLKFTVTGEVT-TPVKVTLVF  481

Query  1478  PSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPS  1657
             P+FTTHSF+ +QR+L L      +     TY +   TP S N++  GYYM+FVV++ IPS
Sbjct  482   PTFTTHSFAMNQRVLVLDNVKLTRKGKSPTYEVQVRTPKSANIAWPGYYMIFVVNQNIPS  541

Query  1658  EGIWIQM  1678
             EG+W+++
Sbjct  542   EGVWVRL  548



>ref|XP_010670858.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=545

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/535 (59%), Positives = 389/535 (73%), Gaps = 8/535 (1%)
 Frame = +2

Query  89    RNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPY  268
             R++FAA  GGGRW LL  +IGI+AMHMQLLN+D+V+I+DRTDFG SN+PL    CR DP 
Sbjct  15    RSIFAA--GGGRWHLLKKSIGISAMHMQLLNDDRVIIYDRTDFGSSNLPLASENCRIDPN  72

Query  269   EVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVF  448
             +  +++DCTAHS EYD   NT RPL V TD WCSS   +P+GTL+QTGG+NDG+ VVR F
Sbjct  73    DQALQIDCTAHSAEYDSLSNTFRPLTVLTDTWCSSGTTLPNGTLMQTGGFNDGERVVRTF  132

Query  449   NPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK--TPGGDLLY  622
              P +   CDWVE PN L   RWYATNH+LPDGR IIIGGR   NYEFYPK  T     LY
Sbjct  133   QP-SCSGCDWVEFPNKLLDRRWYATNHVLPDGRSIIIGGRRAPNYEFYPKDGTSFSSQLY  191

Query  623   NLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPR  802
              LPFL++T+DP  ENNLYPYVFL+VDG+LFIFANN+AIL+DY  + +VR YP +P G PR
Sbjct  192   KLPFLSQTHDPQQENNLYPYVFLHVDGNLFIFANNRAILFDYNNNVIVRTYPTIPGGDPR  251

Query  803   SYPSTGSAVLLPLKNLQ-APGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITD  976
             SYPSTGSAVLLPLKNL+    +  EVLICGGAP G++  A   G F+ AL TC RI I D
Sbjct  252   SYPSTGSAVLLPLKNLELGLNMQFEVLICGGAPLGSYLKALNMGQFLPALKTCARININD  311

Query  977   PNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVG  1156
              NP W +ETMPMAR+MGDM+ LPN +++IINGA  G+AG+  GR+PV +PV+YH DN  G
Sbjct  312   HNPSWSLETMPMARVMGDMLILPNEDVIIINGAGSGTAGWELGRDPVLSPVIYHPDNIRG  371

Query  1157  TRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYL  1336
             +RF +   + IPR+YHS+AILLRD RV+VGGSNPH  Y F N  L+PTEL LEAFSP YL
Sbjct  372   SRFTVQRSTNIPRLYHSSAILLRDGRVVVGGSNPHRTYNFTN-VLYPTELSLEAFSPSYL  430

Query  1337  DAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQR  1516
             D     IRP I +P S S+  YG+VI+++F   G  + +L+ VTM+ P F THSFS  QR
Sbjct  431   DPTKVEIRPIINVPISGSRIRYGEVIKVKFLIVGSNNLDLIKVTMLRPPFNTHSFSMSQR  490

Query  1517  LLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             LL L     VK  G   + +  + PGS N++P G+Y+ FVVH+ +PS+G+W+Q+ 
Sbjct  491   LLVLTNTKPVKLTGTGQFQVNIMIPGSANIAPPGFYIFFVVHQNVPSKGVWVQLT  545



>ref|XP_010471675.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/526 (59%), Positives = 384/526 (73%), Gaps = 9/526 (2%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
              +  GG W LLLPN+GI+AMH QLL+ND+V+++DRT+FG SNI L  G CR+ P + V K
Sbjct  30    TSGAGGTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRKSPNDAVSK  89

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHSVEY+VA N++RPL VQ++ WCSS  V PDGTL+QTGG  DG+   R+F PC+D
Sbjct  90    TDCTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGERKTRLFAPCDD  149

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ N L   RWYA+NH+LPDGRQIIIGGR++FNYEF+PKT   + LY LPFLA+
Sbjct  150   DSCDWTEVDNGLAASRWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPN-LYELPFLAQ  208

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T DPG ENNLYPYVFLN DG+LFIFANN+AIL +Y  + VV+ YP +P G PRSYPSTGS
Sbjct  209   TTDPGQENNLYPYVFLNTDGNLFIFANNRAILLNYATNTVVKTYPEIPGGDPRSYPSTGS  268

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLP+KNL     V EVL+CGGAPKG++  AS+R  F+ AL+TC RI I D NP W +E
Sbjct  269   AVLLPIKNL-----VLEVLVCGGAPKGSYILASQRKTFIKALDTCARININDENPQWAVE  323

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM  LP+G++L+ING + G+A +  GR PV  P +YH D PVG+RFE  N 
Sbjct  324   KMPRARVMGDMTLLPDGHVLLINGGSSGTAAWDLGREPVFNPDIYHPDRPVGSRFEPQNA  383

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             + IPRMYHSTA LLRD RV+VGGSNPH  Y F  G LFPTEL LEAFSP YL++  + +R
Sbjct  384   NAIPRMYHSTATLLRDGRVIVGGSNPHAYYNF-TGVLFPTELSLEAFSPSYLESKYSSLR  442

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P   +   YG+++ ++FT  G V    V VTMV PSF THSFS  QRLL L    
Sbjct  443   PVIMDPMPQTTINYGQILRLRFTVQGRVK-TPVKVTMVYPSFNTHSFSMSQRLLVLDHVL  501

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              ++      Y ++  TP S NL+P GYYM+FVV++ IPSEG+W+++
Sbjct  502   FLRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQDIPSEGVWVRL  547



>ref|XP_010471676.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=548

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/526 (59%), Positives = 384/526 (73%), Gaps = 9/526 (2%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
              +  GG W LLLPN+GI+AMH QLL+ND+V+++DRT+FG SNI L  G CR+ P + V K
Sbjct  30    TSGAGGTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRKSPNDAVSK  89

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHSVEY+VA N++RPL VQ++ WCSS  V PDGTL+QTGG  DG+   R+F PC+D
Sbjct  90    TDCTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGERKTRLFAPCDD  149

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ N L   RWYA+NH+LPDGRQIIIGGR++FNYEF+PKT   + LY LPFLA+
Sbjct  150   DSCDWTEVDNGLAASRWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPN-LYELPFLAQ  208

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T DPG ENNLYPYVFLN DG+LFIFANN+AIL +Y  + VV+ YP +P G PRSYPSTGS
Sbjct  209   TTDPGQENNLYPYVFLNTDGNLFIFANNRAILLNYATNTVVKTYPEIPGGDPRSYPSTGS  268

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLP+KNL     V EVL+CGGAPKG++  AS+R  F+ AL+TC RI I D NP W +E
Sbjct  269   AVLLPIKNL-----VLEVLVCGGAPKGSYILASQRKTFIKALDTCARININDENPQWAVE  323

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM  LP+G++L+ING + G+A +  GR PV  P +YH D PVG+RFE  N 
Sbjct  324   KMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPVFNPDIYHPDRPVGSRFEPQNA  383

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             + IPRMYHSTA LLRD RV+VGGSNPH  Y F  G LFPTEL LEAFSP YL++  + +R
Sbjct  384   NAIPRMYHSTATLLRDGRVIVGGSNPHAYYNF-TGVLFPTELSLEAFSPSYLESKYSSLR  442

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P   +   YG+++ ++FT  G V    V VTMV PSF THSFS  QRLL L    
Sbjct  443   PVIMDPMPQTTINYGQILRLRFTVQGRVK-TPVKVTMVYPSFNTHSFSMSQRLLVLDHVL  501

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              ++      Y ++  TP S NL+P GYYM+FVV++ IPSEG+W+++
Sbjct  502   FLRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQDIPSEGVWVRL  547



>ref|XP_009388162.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=544

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/530 (60%), Positives = 386/530 (73%), Gaps = 11/530 (2%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A AAGGG+W LL  +IG++AMHMQLL+ND+VV+FDRTDFG SN+ L  G+CR DP E  +
Sbjct  21    ATAAGGGQWALLQRSIGVSAMHMQLLHNDRVVVFDRTDFGPSNLSLPVGKCRNDPDEKAL  80

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             +VDCTAHSVEYDVA NT RPLM+ TD WCSS  V PDGTL+QTGG+NDG+   R F PC+
Sbjct  81    RVDCTAHSVEYDVAANTFRPLMLLTDAWCSSGTVAPDGTLVQTGGFNDGERASRTFRPCD  140

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYN--LPF  634
             D +C+WVE+P AL   RWYATN ILPDGR I++GGR +FNYEFYPK+P    L    LPF
Sbjct  141   DCRCNWVEVPQALAVRRWYATNQILPDGRAIVVGGRRQFNYEFYPKSPDASDLRTIALPF  200

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L +T D   ENNLYP+V LN+DG+LF+FANN+AIL DY K+ VV+ YP MP G+PR+YPS
Sbjct  201   LRDTRD-AVENNLYPFVHLNIDGNLFVFANNRAILLDYTKNTVVKTYPKMPGGEPRNYPS  259

Query  815   TGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPAS--ERGVFMGALNTCGRIRITDPNPV  988
             TGS+VLLPLK   +P   AEVLICGGAP G++  +   RG F+ AL+TCGRI+IT+    
Sbjct  260   TGSSVLLPLK--PSPK-EAEVLICGGAPMGSYVQALQSRG-FVRALDTCGRIKITEAAAS  315

Query  989   WFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFE  1168
             W METMP+ R+MGDMV LP+G +L+INGAA G+AG+   R+PV TPV+Y  + P G RF+
Sbjct  316   WSMETMPVPRVMGDMVLLPSGEVLMINGAAAGTAGWELARDPVLTPVVYRPERPAGARFD  375

Query  1169  ILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAAT  1348
             I +PS  PR+YHSTA+LLRD RVLVGGSNP+ NY F +G  FPTEL LEAFSP YL  A 
Sbjct  376   IQSPSTTPRLYHSTAVLLRDGRVLVGGSNPNVNYNF-SGVEFPTELSLEAFSPAYLSPAH  434

Query  1349  AGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL  1528
             +  RP I    S  +  YGK   +QFT AG V    V VTMVAPSF THSFS +QRLL L
Sbjct  435   SARRPRIVTSPSPLRLSYGKRFSLQFT-AGAVGDEGVRVTMVAPSFATHSFSMNQRLLVL  493

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                   K     TY + A+ P S  L+P+GYYM+FVV+ G+PSE  W  +
Sbjct  494   ETEAAAKAADSGTYQVMAMAPASAILAPSGYYMVFVVNGGVPSESNWAHI  543



>emb|CDY47509.1| BnaAnng09070D [Brassica napus]
Length=554

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/552 (59%), Positives = 394/552 (71%), Gaps = 13/552 (2%)
 Frame = +2

Query  26    NFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFD  205
             N  L FAL  LFL       S +   A+  GG W+LLL N+GI+AMH QLL ND+V+++D
Sbjct  14    NHLLYFALI-LFL-------SLSFHVASGAGGTWKLLLNNVGISAMHSQLLINDRVIMYD  65

Query  206   RTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVM  385
             R++FG S I L  G CR  P + V K DCTAHS+EYDVA N +RPL VQ++ WCSS  V 
Sbjct  66    RSNFGPSKISLPNGTCRDSPNDSVSKRDCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVT  125

Query  386   PDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGG  565
             PDGTL+QTGG  DG+   R+F PC+D  CDW EI NAL+  RWYA+NH+LPDGRQII+GG
Sbjct  126   PDGTLLQTGGDKDGERKARLFYPCDDDSCDWSEIDNALNVKRWYASNHVLPDGRQIIVGG  185

Query  566   REEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYD  745
             R+EFN+EF+PKT   +  Y+L FL+ETND   ENNLYP VFLN DG+LFIFANN+AIL D
Sbjct  186   RDEFNFEFFPKTNAPN-TYSLRFLSETNDLDQENNLYPNVFLNTDGNLFIFANNRAILLD  244

Query  746   YIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASE  922
             Y K+ VV+ YP +P G+PRSYPSTGSAVLLP+KNL+   I  EVL+CGGAPKG++  A  
Sbjct  245   YAKNTVVKTYPKIPGGEPRSYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALN  304

Query  923   RGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGD  1102
                F+  L+TC RI+I D NP W +E MP  R+MGDM+ LPNG +L+ING + GSAG+  
Sbjct  305   ENTFVKGLDTCARIKINDANPKWVLEKMPRPRIMGDMIVLPNGQVLLINGGSSGSAGWEL  364

Query  1103  GRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGN  1282
             GR PV  P LYH D PVG+RF+I NPS IPRMYHSTA LLRD RVLVGGSNPH  Y F  
Sbjct  365   GREPVLNPDLYHPDKPVGSRFQIQNPSTIPRMYHSTATLLRDGRVLVGGSNPHEFYNF-T  423

Query  1283  GALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVT  1462
             G LFPTELRLEAFSP YL++    IRP I  P  HS   YG V+ ++F   G V    V 
Sbjct  424   GVLFPTELRLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGGVLRLRFRVLGEVK-TPVK  482

Query  1463  VTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVH  1642
             VTM  PSFTTHSFS  QRLL L    +++ +G  TY +   TP S NL+P GYYM+FVV+
Sbjct  483   VTMAFPSFTTHSFSMSQRLLVLDHVTSLR-IGQWTYEVRVKTPRSANLAPPGYYMVFVVN  541

Query  1643  KGIPSEGIWIQM  1678
             + IPSEGIW+++
Sbjct  542   QDIPSEGIWVRL  553



>ref|XP_009106212.1| PREDICTED: galactose oxidase isoform X1 [Brassica rapa]
Length=560

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/553 (58%), Positives = 395/553 (71%), Gaps = 13/553 (2%)
 Frame = +2

Query  26    NFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFD  205
             N  L FAL  LFL       S +   A+  GG W+LLL N+GI+AMH QLL ND+V+++D
Sbjct  14    NHLLYFALI-LFL-------SLSFHVASGAGGTWKLLLNNVGISAMHSQLLINDRVIMYD  65

Query  206   RTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVM  385
             R++FG S I L  G CR  P + V K DCTAHS+EYDVA N +RPL VQ++ WCSS  V 
Sbjct  66    RSNFGPSKISLPNGTCRDSPNDSVSKRDCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVT  125

Query  386   PDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGG  565
             PDGTL+QTGG  DG+   R+F PC+D+ CDW EI NAL+  RWYA+NH+LPDGRQII+GG
Sbjct  126   PDGTLLQTGGDKDGERKARLFYPCDDESCDWSEIDNALNVKRWYASNHVLPDGRQIIVGG  185

Query  566   REEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYD  745
             R+EFN+EF+PKT   +  Y+L FL+ETND   ENNLYP VFLN DG+LF+FANN+AIL D
Sbjct  186   RDEFNFEFFPKTNAPN-TYSLRFLSETNDLDQENNLYPNVFLNTDGNLFVFANNRAILLD  244

Query  746   YIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASE  922
             Y K+ VV+ YP +P G+PRSYPSTGSAVLLP+KNL+   I  EVL+CGGAPKG++  A  
Sbjct  245   YSKNTVVKTYPEIPGGEPRSYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALN  304

Query  923   RGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGD  1102
                F+  L+TC RI+I D NP W +E MP  R+MGDM+ LPNG +L+ING + GSAG+  
Sbjct  305   ENTFVKGLDTCARIKINDANPKWVLEKMPRPRIMGDMIVLPNGQVLLINGGSSGSAGWEL  364

Query  1103  GRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGN  1282
             GR PV  P LYH D PVG+RF+I NPS IPRMYHSTA LLRD RVLVGGSNPH  Y F  
Sbjct  365   GREPVLNPDLYHPDKPVGSRFQIQNPSTIPRMYHSTATLLRDGRVLVGGSNPHEFYNF-T  423

Query  1283  GALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVT  1462
             G LFPTELRLEAFSP YL++    IRP I  P  HS   YG V+ ++F   G V    V 
Sbjct  424   GVLFPTELRLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGGVLRLRFRVLGEVK-TPVK  482

Query  1463  VTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVH  1642
             VTM  PSFTTHSFS  QRLL L    +++ +G  TY +   TP S NL+P GYYM+FVV+
Sbjct  483   VTMAFPSFTTHSFSMSQRLLVLDHVTSLR-IGQWTYEVRVKTPRSANLAPPGYYMVFVVN  541

Query  1643  KGIPSEGIWIQMV  1681
             + IPSEGIW+++ 
Sbjct  542   QDIPSEGIWLRLT  554



>ref|XP_009106213.1| PREDICTED: galactose oxidase isoform X2 [Brassica rapa]
Length=554

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/552 (59%), Positives = 395/552 (72%), Gaps = 13/552 (2%)
 Frame = +2

Query  26    NFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFD  205
             N  L FAL  LFL       S +   A+  GG W+LLL N+GI+AMH QLL ND+V+++D
Sbjct  14    NHLLYFALI-LFL-------SLSFHVASGAGGTWKLLLNNVGISAMHSQLLINDRVIMYD  65

Query  206   RTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVM  385
             R++FG S I L  G CR  P + V K DCTAHS+EYDVA N +RPL VQ++ WCSS  V 
Sbjct  66    RSNFGPSKISLPNGTCRDSPNDSVSKRDCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVT  125

Query  386   PDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGG  565
             PDGTL+QTGG  DG+   R+F PC+D+ CDW EI NAL+  RWYA+NH+LPDGRQII+GG
Sbjct  126   PDGTLLQTGGDKDGERKARLFYPCDDESCDWSEIDNALNVKRWYASNHVLPDGRQIIVGG  185

Query  566   REEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYD  745
             R+EFN+EF+PKT   +  Y+L FL+ETND   ENNLYP VFLN DG+LF+FANN+AIL D
Sbjct  186   RDEFNFEFFPKTNAPN-TYSLRFLSETNDLDQENNLYPNVFLNTDGNLFVFANNRAILLD  244

Query  746   YIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASE  922
             Y K+ VV+ YP +P G+PRSYPSTGSAVLLP+KNL+   I  EVL+CGGAPKG++  A  
Sbjct  245   YSKNTVVKTYPEIPGGEPRSYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALN  304

Query  923   RGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGD  1102
                F+  L+TC RI+I D NP W +E MP  R+MGDM+ LPNG +L+ING + GSAG+  
Sbjct  305   ENTFVKGLDTCARIKINDANPKWVLEKMPRPRIMGDMIVLPNGQVLLINGGSSGSAGWEL  364

Query  1103  GRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGN  1282
             GR PV  P LYH D PVG+RF+I NPS IPRMYHSTA LLRD RVLVGGSNPH  Y F  
Sbjct  365   GREPVLNPDLYHPDKPVGSRFQIQNPSTIPRMYHSTATLLRDGRVLVGGSNPHEFYNF-T  423

Query  1283  GALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVT  1462
             G LFPTELRLEAFSP YL++    IRP I  P  HS   YG V+ ++F   G V    V 
Sbjct  424   GVLFPTELRLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGGVLRLRFRVLGEVK-TPVK  482

Query  1463  VTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVH  1642
             VTM  PSFTTHSFS  QRLL L    +++ +G  TY +   TP S NL+P GYYM+FVV+
Sbjct  483   VTMAFPSFTTHSFSMSQRLLVLDHVTSLR-IGQWTYEVRVKTPRSANLAPPGYYMVFVVN  541

Query  1643  KGIPSEGIWIQM  1678
             + IPSEGIW+++
Sbjct  542   QDIPSEGIWVRL  553



>ref|NP_173419.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAL24259.1| At1g19900/F6F9_4 [Arabidopsis thaliana]
 gb|AEE29911.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=548

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/525 (56%), Positives = 389/525 (74%), Gaps = 3/525 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             ++A  G W+ + PN+GI+AMHMQLL+ND+VV++DRT+FG SNI L  G CR +P + V K
Sbjct  26    SSAARGLWKYIAPNVGISAMHMQLLHNDRVVMYDRTNFGPSNISLPNGNCRDNPQDAVSK  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHS+EYDVA NT+RPL VQ++ WCSS +V PDG L+QTGG  DG+   R F+PCN+
Sbjct  86    IDCTAHSIEYDVATNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKTRTFSPCNN  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
              +CDWVE+ N L + RWYA+NHILPDG+QI++GG+ +FNYEF+PKT   +++  LPFLAE
Sbjct  146   NQCDWVEMNNGLKKRRWYASNHILPDGKQIVMGGQGQFNYEFFPKTTNPNVVA-LPFLAE  204

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T+D G ENNLYP+VF+N DG+LF+FANN+AIL DY+K+ VV+ +PA+P G PR+YPSTGS
Sbjct  205   THDQGQENNLYPFVFMNTDGNLFMFANNRAILLDYVKNTVVKTFPAIPGGDPRNYPSTGS  264

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLPLKNL+A  +  EVL+CGGAPKG++  + +  F+ AL+TC RI+I D  P W +E 
Sbjct  265   AVLLPLKNLEADNVETEVLVCGGAPKGSYNLARKKTFVKALDTCARIKINDAKPEWAVEK  324

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP AR+MGDM+ LPNG++L+ING + G+A +  GR PV  P LYH +NPVG+RFE L P+
Sbjct  325   MPHARVMGDMIPLPNGDVLLINGGSFGTAAWELGRTPVLAPDLYHPENPVGSRFESLRPT  384

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHS AILLRD RVLVGGSNPH  Y +  G LFPTEL LEAFSP YL    + +RP
Sbjct  385   TIPRMYHSAAILLRDGRVLVGGSNPHAFYNY-TGVLFPTELSLEAFSPVYLQREFSNLRP  443

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I  P   S   YG  ++++F+  G V      VTMV P+FTTHSF+ +QR+L L     
Sbjct  444   KIISPEPQSMIKYGTNLKLKFSVTGEVT-TPAKVTMVFPTFTTHSFAMNQRVLVLDNVKF  502

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              +      Y +   TP S N++  GYYM+FVV++ IPSEG+W+++
Sbjct  503   TRKGKSPMYEVQVRTPRSANIAWPGYYMIFVVNQDIPSEGVWVKL  547



>ref|XP_006300296.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
 gb|EOA33194.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
Length=547

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/526 (58%), Positives = 385/526 (73%), Gaps = 10/526 (2%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A+  GG W+LLL N+GI+AMH QLL+ND+V+++DRT+FG SNI L  G CR  P ++V K
Sbjct  30    ASGAGGSWKLLLSNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGACRNSPNDIVSK  89

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHSVEYDVA N++RPL VQ++ WCSS  V PDGTL+QTGG  DG+   R+F PC+D
Sbjct  90    TDCTAHSVEYDVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGDRDGERKTRLFAPCDD  149

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW EI   L+  RWYA+NH+LPDGRQII+GG+ +FN+EF+PKT   + LY+LPFL++
Sbjct  150   GSCDWTEIDKGLNARRWYASNHVLPDGRQIIVGGQGQFNFEFFPKTNAPN-LYSLPFLSQ  208

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TND G ENNLYPYVFLN DG+LFIFANN+AIL +Y  + VV+ YP +P+G PRSYPSTGS
Sbjct  209   TNDRGEENNLYPYVFLNTDGNLFIFANNRAILLNYATNTVVKTYPEIPEGDPRSYPSTGS  268

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPAS-ERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLP+KNL     V EVL+CGGAPKG++  S  +  F+ AL+TC RI I D NP W +E
Sbjct  269   AVLLPIKNL-----VLEVLVCGGAPKGSYNLSFRKKTFVKALDTCARININDANPQWLVE  323

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM  LP+G++L+ING + G+A +  GR P   P LYH D PVG+RFE+ N 
Sbjct  324   KMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPAFNPDLYHPDKPVGSRFEVQNA  383

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             + IPRMYHS A LLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL++  + +R
Sbjct  384   NAIPRMYHSIATLLRDGRVLVGGSNPHAFYNF-TGVLFPTELSLEAFSPSYLESQYSSLR  442

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P   +   Y +++ ++FT +G V    V VTMV PSFTTHSFS +QRLL L    
Sbjct  443   PRIIDPMPQTTINYSRILRLRFTVSGRVKSP-VKVTMVYPSFTTHSFSMNQRLLVLDHVF  501

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             + +  G  TY +   TP S  L+P GYYM+FVV++ IPSEG+W+++
Sbjct  502   SFR-RGFRTYEVIVRTPSSAELAPPGYYMVFVVNQDIPSEGVWLRL  546



>emb|CDY39045.1| BnaA02g17340D [Brassica napus]
Length=555

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/529 (58%), Positives = 389/529 (74%), Gaps = 7/529 (1%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
              A+  GG W LLL ++GI+AMH QLL ND+V+++DR++FG S I L  G CR  P +VV 
Sbjct  30    VASGAGGTWRLLLNDVGISAMHSQLLINDRVIMYDRSNFGPSKISLPSGACRVSPNDVVS  89

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             K DCTAHS+EYDVA N++RPL ++++ WCSS  V P+G L+QTGG  +G+   R+F PC+
Sbjct  90    KRDCTAHSIEYDVAFNSIRPLTIESNTWCSSGGVTPEGALLQTGGDKEGERKARMFYPCD  149

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
             D+ CDW E+ NAL+  RWYATNH+LPDGRQIIIGGR +FN+EF+PKT     LY LPFL+
Sbjct  150   DESCDWTEVDNALYVRRWYATNHVLPDGRQIIIGGRNQFNFEFFPKTKAPS-LYKLPFLS  208

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             ET D G ENNLYP+VFLN DG+LFI+ANNKAIL DY K+ VV+ YP +P G PRSYPSTG
Sbjct  209   ETYDAGQENNLYPFVFLNSDGNLFIYANNKAILLDYNKNTVVKTYPKIPGGDPRSYPSTG  268

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFM  997
             SAVLLP+KNL+A  +  EVL+CGGAPKG++  A  +  F+ AL+TC RI+I D  P W +
Sbjct  269   SAVLLPIKNLEAEVVEMEVLVCGGAPKGSYLLALYKNTFVKALDTCARIKINDDKPQWVL  328

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             E MP +R+MGDM+ LPNG++L+ING + GSAG+  GR PV  P LYH D PVG+RF++ N
Sbjct  329   EKMPRSRVMGDMILLPNGHVLLINGGSSGSAGWELGREPVLNPDLYHPDKPVGSRFQVQN  388

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS IPRMYHSTA LLRD RVLVGGSNPH  Y F +  LFPTELRLEAFSP YL++    I
Sbjct  389   PSTIPRMYHSTAGLLRDGRVLVGGSNPHQFYNFTD-VLFPTELRLEAFSPSYLESQYWSI  447

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDG--NLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
             RP I    SHS   YG ++ ++F   G + G  + V VTMV PSFT+HSFS  QRLL L 
Sbjct  448   RPRIISLLSHSTVNYGGILRLRFMVFG-IGGVRSPVKVTMVFPSFTSHSFSMSQRLLVLD  506

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                 V+ +G+ TY +    P S NL+P GYYM FVV++ IPSEGIW+++
Sbjct  507   HVELVR-IGVWTYEVRVKAPKSKNLAPPGYYMAFVVNQDIPSEGIWLRL  554



>ref|XP_010428587.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=548

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/526 (58%), Positives = 383/526 (73%), Gaps = 9/526 (2%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
              +  GG W+LLLPN+GI+AMH QLL+ND+V+++DRT+FG SNI L  G CRQ P + V K
Sbjct  30    TSGAGGTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGACRQSPNDAVSK  89

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHS+EY+VA N++RPL VQ++ WCSS  V PDGTL+QTGG  DG+   R+F PC+D
Sbjct  90    TDCTAHSIEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGERKTRLFAPCDD  149

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ N L   RWYA+NH+LPDGRQIIIGGR++FNYEF+PKT   + LY LPFL +
Sbjct  150   DSCDWTEVDNGLATARWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPN-LYALPFLTQ  208

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T DPG ENNLYPYVFLN DG+LFIFANN+AIL +Y  + VV+ YP +P G PRSYPSTGS
Sbjct  209   TTDPGQENNLYPYVFLNTDGNLFIFANNRAILLNYATNTVVKTYPEIPGGDPRSYPSTGS  268

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLP+KNL     V EVL+CGGAPKG++  A     F+ AL+TC RI I DPNP W +E
Sbjct  269   AVLLPIKNL-----VLEVLVCGGAPKGSYLLAFNSKTFIKALDTCARININDPNPQWAVE  323

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM  LP+G++L+ING + G+A +  GR PV  P +YH D PVG+RFE  NP
Sbjct  324   KMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPVFNPDIYHPDRPVGSRFEPQNP  383

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             + IPRMYHSTA LLRD RV+VGGSNPH  Y F  G LFPTEL LEAFSP YL++  + +R
Sbjct  384   NAIPRMYHSTATLLRDGRVIVGGSNPHAYYNF-TGVLFPTELSLEAFSPSYLESKYSSLR  442

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P   +   YG+++ ++FT  G V    V V MV PSF THSFS +QRLL L    
Sbjct  443   PVIMDPMPQTTINYGQILRLRFTVQGRVK-TPVKVNMVYPSFNTHSFSMNQRLLVLDHVL  501

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               +    +TY +   TP S NL+P GYYM+FVV++ IPSEG+W+++
Sbjct  502   FSRIGFSSTYEVRVRTPSSVNLAPPGYYMVFVVNQDIPSEGVWVRL  547



>ref|XP_010533609.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=559

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/526 (59%), Positives = 384/526 (73%), Gaps = 7/526 (1%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCT  295
             GGRW+LL  +IGI+AMH QLL ND+VV+FD TDFG SNI L GG+CR  P +   KVDCT
Sbjct  37    GGRWQLLRRSIGISAMHTQLLRNDRVVMFDLTDFGPSNISLSGGKCRHSPNDGASKVDCT  96

Query  296   AHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC-NDKKC  472
             AHSVEYDV  N VRPL ++++ WCSS +V PDGTLIQTGG+ DG+  VR+F+PC  +K C
Sbjct  97    AHSVEYDVVSNRVRPLTIRSNTWCSSGSVAPDGTLIQTGGFGDGERRVRMFSPCRKNKYC  156

Query  473   DWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETND  652
             DW EI N L   RWYA+NH+L DGRQII+GGR +F++EFYPKT   ++ Y+LPFLA+TND
Sbjct  157   DWKEIENGLVVRRWYASNHVLSDGRQIIVGGRGQFSFEFYPKTKDPNV-YSLPFLAQTND  215

Query  653   PGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVL  832
              G ENNLYP+VFLNVDG++FIFANN+AIL D+  + VV+ YP +P G PRSYPSTGSAVL
Sbjct  216   LGTENNLYPFVFLNVDGNVFIFANNRAILLDHGNNTVVKTYPTIPGGDPRSYPSTGSAVL  275

Query  833   LPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPM  1012
             LPLKNL+A  + AEVL+CGGA +GA+  + +  F+ ALNTC RI+ITDPNP W +ETMP 
Sbjct  276   LPLKNLEALNVEAEVLVCGGATRGAYELALKNTFVKALNTCARIKITDPNPKWEIETMPR  335

Query  1013  ARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIP  1192
              R+MGDM  LPNG++L+ING   G+A +  GR PV  P LY  DNP+G R E    + IP
Sbjct  336   ERVMGDMTLLPNGHVLLINGGYSGTAAWECGREPVFAPDLYRPDNPLGFRSESQKQTSIP  395

Query  1193  RMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHIT  1372
             RMYHSTA+LLRD RVLVGGSNPH  Y F  G LFPT+L LEAFSP YLD   + +RP I 
Sbjct  396   RMYHSTAVLLRDGRVLVGGSNPHRYYNF-TGVLFPTDLSLEAFSPSYLDQEFSNLRPKII  454

Query  1373  LPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGG---GGT  1543
              P S SK  Y   ++++FT +  V    V VTMV PSF THSFS +QR+L L        
Sbjct  455   APKSQSKIKYDTKLKLRFTVSDEVKSP-VKVTMVYPSFATHSFSMNQRVLFLDNVKFTTR  513

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              K     TY +   TP S N++P GYYM+FVV++ IPS+G+W++++
Sbjct  514   SKTARKTTYGVEVKTPRSANVAPPGYYMMFVVNQHIPSKGVWVRLL  559



>ref|XP_003527665.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=541

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/528 (59%), Positives = 382/528 (72%), Gaps = 7/528 (1%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV-  280
             A+   G+W+LL  +IGI AMH+QLLNND+++I+DRTDFG SN+ L  G CR DP E V+ 
Sbjct  17    ASNSNGQWQLLQKSIGIVAMHVQLLNNDRLIIYDRTDFGFSNLTLPNGTCRHDPSEKVLN  76

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             + DCTAHS+EYDVA +T RPL VQTD+WCSS   + +GTLIQTGG+NDG+  +R F PC 
Sbjct  77    QTDCTAHSLEYDVASDTFRPLFVQTDIWCSSGTTVANGTLIQTGGYNDGERKIRSFTPC-  135

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGG--DLLYNLPF  634
              + CDW E  NAL   RWY+T+H LPDGRQIIIGGR +FNYEFYPK      D  Y LPF
Sbjct  136   -ETCDWQETDNALLVKRWYSTDHYLPDGRQIIIGGRRQFNYEFYPKINSAEYDKPYVLPF  194

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L ET D G ENNLYP+VFLNVDG+LFIFAN++AIL+DY    VVR YP +P G PRSYPS
Sbjct  195   LFETYDKGVENNLYPFVFLNVDGNLFIFANSRAILFDYQNDIVVRTYPEIPGGDPRSYPS  254

Query  815   TGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWF  994
             TGSAVLLPL+NL+AP + AEVLICGGAP+GAF    +GVF+ AL++C RI ITDPN  W 
Sbjct  255   TGSAVLLPLRNLEAPSVEAEVLICGGAPRGAFQLVPQGVFLQALDSCARIMITDPNATWT  314

Query  995   METMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEIL  1174
             +E+MPM R+M DMV LPNG+ILIINGA  G+AG+     PV  PV+Y T+  VG+RF + 
Sbjct  315   VESMPMGRVMSDMVMLPNGDILIINGAQLGTAGWDKAMEPVLEPVIYKTNGWVGSRFVLQ  374

Query  1175  NPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAG  1354
             + S IPRMYHSTAIL+RD RVLVGGSNPH  Y F N + +PT+L LEAFSP YLD   + 
Sbjct  375   SASSIPRMYHSTAILVRDGRVLVGGSNPHEKYDFSNVS-YPTDLSLEAFSPYYLDPQFSP  433

Query  1355  IRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGG  1534
             +RP I  P SH+   YG+  ++     G +   LV+VTM+AP F THSFS +QRLL L  
Sbjct  434   LRPMIVEPCSHANVTYGEKFKMGIEVNGTLVPELVSVTMLAPPFNTHSFSMNQRLLVL-S  492

Query  1535  GGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              G V   G  T       PGS  L+P  +Y+LFVVH+ IPSEGIWI++
Sbjct  493   IGQVNVTGNWTCEFEVTPPGSAVLAPPTFYLLFVVHQDIPSEGIWIKI  540



>gb|KEH24796.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=516

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/520 (58%), Positives = 384/520 (74%), Gaps = 7/520 (1%)
 Frame = +2

Query  131   LLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVE  310
             +L  +IG+ AMHMQLL+ND++VIFDRTDFG SN+ L  G+CR DP E+VVK DCTAHS+E
Sbjct  1     MLQKSIGVVAMHMQLLHNDRIVIFDRTDFGYSNLSLPNGQCRHDPAELVVKDDCTAHSLE  60

Query  311   YDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIP  490
             YDV  NT RPL V+T++WCSS +V P+G+L+QTGG+NDG+  +R+++PC    CDW EI 
Sbjct  61    YDVLSNTFRPLFVKTNIWCSSGSVRPNGSLVQTGGYNDGNRNIRIYSPC--PTCDWSEID  118

Query  491   NALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENN  670
               L   RWYAT+HILP+G QI++GGR +FNYEFYPK+   +  Y+L FLAETNDP  ENN
Sbjct  119   GGLSAERWYATSHILPNGSQIVVGGRGQFNYEFYPKSNDINANYSLSFLAETNDPEQENN  178

Query  671   LYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNL  850
             LYP+VFLNVDG+LFI ANNK+IL+DY K  VV+ +P +P G PR+YPSTGSAVLLPLKNL
Sbjct  179   LYPFVFLNVDGNLFIMANNKSILFDYTKGMVVKTFPEVPGGDPRNYPSTGSAVLLPLKNL  238

Query  851   QAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGD  1030
             +A  + AEVL+CGGA +G++  S++ VF+ ALNTC RI+ITDPNP W METMP  R+M D
Sbjct  239   EAKNLEAEVLVCGGASRGSYLQSKKEVFLKALNTCARIKITDPNPQWDMETMPSPRVMSD  298

Query  1031  MVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHST  1210
             MV LPNGNILIINGA+ G++G+  GR+P  TP LY T+NP+G+RF++   S  PRMYHST
Sbjct  299   MVMLPNGNILIINGASSGTSGWEQGRDPALTPFLYRTNNPIGSRFKLQRSSETPRMYHST  358

Query  1211  AILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHS  1390
             A+L+RD RVLVGGSNPH  Y F N  LFPTEL +EA+SP YL    +  RP I    S +
Sbjct  359   AVLVRDGRVLVGGSNPHSGYSFTN-VLFPTELSIEAYSPSYLSDRLSNYRPKIMSLDSKT  417

Query  1391  K--FGYGKVIEIQFTAAGPVDG-NLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGI  1561
             +    YG+ +E+QF     +   NLV VTM+ P F THSFS +QRLL L     V  V  
Sbjct  418   QMELKYGQKLELQFQVNRTLKYLNLVHVTMLLPPFNTHSFSMNQRLLVL-EQNKVNRVNG  476

Query  1562  NTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              TY +    P S  L+P G+Y+LFVV+  IPSEGIW+ ++
Sbjct  477   TTYEIEVTVPNSPILAPPGFYLLFVVNAQIPSEGIWVHIL  516



>ref|XP_008775019.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=544

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/529 (60%), Positives = 387/529 (73%), Gaps = 10/529 (2%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             +AAAGGGRW+LL  +IG++AMHMQLL+ND+VVIFDRTDFGLSN+ L  G+CR DP E V+
Sbjct  22    SAAAGGGRWDLLHRSIGVSAMHMQLLHNDRVVIFDRTDFGLSNLSLPNGKCRNDPNEKVI  81

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             K+DCTAHS EYDVA NT RPLM+ TD WCSS AV PDG LIQTGGWNDGD  VR F PC+
Sbjct  82    KIDCTAHSAEYDVATNTFRPLMILTDSWCSSGAVAPDGRLIQTGGWNDGDRAVRTFVPCD  141

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDL-LYNLPFL  637
             D  CDW E+P  L   RWYATN ILPDGR II+GGR +FNYEF+PK    DL  + LPFL
Sbjct  142   DGSCDWSEVPQGLAARRWYATNQILPDGRAIIVGGRRQFNYEFHPKPNPSDLTTFPLPFL  201

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
               T D   E+NLYP+V LNVDG+LFIFANN+AIL DY ++A+VR YP MP G PR+YPS+
Sbjct  202   QNTKD-DVEDNLYPFVHLNVDGNLFIFANNRAILLDYTRNAIVRTYPEMPGGDPRNYPSS  260

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV--FMGALNTCGRIRITDPNPVW  991
             GS+VLLPLK        AEVL+CGGAP G++  S R V  +M AL TCGRI+ITD +P W
Sbjct  261   GSSVLLPLK---PSATEAEVLVCGGAPVGSY-TSARDVKNYMQALKTCGRIKITDQSPSW  316

Query  992   FMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
              +ETM   R+MGDM+ LP G +L+INGAA G+AG+  G  PV TPV+Y  ++P G RF++
Sbjct  317   SVETMSTPRVMGDMILLPTGEVLLINGAAAGAAGWELGHEPVLTPVVYSPESPAGARFQV  376

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
              NPS IPR+YHS+AILLRD RVLVGGSNPH  Y F  G  FPTEL LEAFSP YL + ++
Sbjct  377   QNPSKIPRLYHSSAILLRDGRVLVGGSNPHVYYNF-TGVEFPTELSLEAFSPEYLTSGSS  435

Query  1352  GIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
               RP I    S     YGK   ++F  A  + G  V+VTM AP+F+TH+FS +QRLL L 
Sbjct  436   NSRPKIDNSSSPISLNYGKQFTLRFAVAA-ISGGGVSVTMAAPAFSTHAFSMNQRLLILE  494

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              G  +      +Y +TAV P SG L+P+GYYM+FVV+ GIPSEG+W Q+
Sbjct  495   TGKALAAGNNGSYEVTAVAPASGILAPSGYYMVFVVNGGIPSEGVWAQI  543



>ref|XP_007136065.1| hypothetical protein PHAVU_009G014900g [Phaseolus vulgaris]
 gb|ESW08059.1| hypothetical protein PHAVU_009G014900g [Phaseolus vulgaris]
Length=565

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/540 (58%), Positives = 381/540 (71%), Gaps = 15/540 (3%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             F + A   +WELL   IGI AMHMQLLNND+V+IFDRTDFG SN+ L  G CR D  E V
Sbjct  27    FPSRASDSQWELLHKTIGIVAMHMQLLNNDRVIIFDRTDFGFSNLTLPNGTCRHDLSEKV  86

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
             +K DCTAHS+EYDVA NT R L VQTDVWCSS   + DGTLIQTGG+NDG+  +R F+PC
Sbjct  87    LKTDCTAHSIEYDVASNTFRALFVQTDVWCSSGGAVADGTLIQTGGYNDGERKIRSFSPC  146

Query  458   N-DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK--TPGGDLLYNL  628
                + C+W E  NAL   RWY+TNH LPDGRQIIIGGR +FN+EFYPK  T   +  Y  
Sbjct  147   KGSEDCEWQESDNALAVRRWYSTNHYLPDGRQIIIGGRRQFNFEFYPKRKTEDKNKPYVF  206

Query  629   PFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSY  808
             PFL +TND GAENNLYP+V LNVDG+LFIFANN+AIL+DY   AVVR YP +P G PR Y
Sbjct  207   PFLFQTNDKGAENNLYPFVVLNVDGNLFIFANNRAILFDYENDAVVRTYPEIPGGDPRCY  266

Query  809   PSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPV  988
             PSTGSAVLLPLKNL+A  + AEVL+CGGA +GAF    +GVF  AL++C RI+ITDPN  
Sbjct  267   PSTGSAVLLPLKNLEAARVEAEVLVCGGARRGAFQLVPKGVFSEALDSCARIKITDPNAT  326

Query  989   WFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTD--------  1144
             W +ETMPM R+M DMV LPNG++LIINGA  G+AG+    NPV  PV+Y T+        
Sbjct  327   WAVETMPMGRVMNDMVMLPNGDVLIINGAQSGTAGWERAENPVLQPVIYKTNGSGSGSGS  386

Query  1145  --NPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEA  1318
                  G+RF +   S IPRMYHSTAIL+RD RV+VGGSNPH  Y+F N A +PTEL LEA
Sbjct  387   GSGSGGSRFVLQPASDIPRMYHSTAILVRDGRVIVGGSNPHEKYMFSNVA-YPTELSLEA  445

Query  1319  FSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHS  1498
             FSP YL +  + +RP I  P SH+   YG+  ++     G +  +L++VTM+AP F THS
Sbjct  446   FSPFYLGSQFSDLRPIILEPSSHTNLMYGEKFKMGIKVNGALVPDLLSVTMLAPPFNTHS  505

Query  1499  FSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             FS +QRLL L  G  VK  G ++       PGS  L+P  +YMLF VH+ IPSEGIWI++
Sbjct  506   FSMNQRLLVLSVGD-VKVSGNSSSEFEVTAPGSAVLAPPTFYMLFAVHQDIPSEGIWIKI  564



>ref|XP_009128116.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=555

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/529 (58%), Positives = 388/529 (73%), Gaps = 7/529 (1%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
              A+  GG W+LLL ++GI+AMH QLL ND+V+++DR++FG S I L  G CR  P +VV 
Sbjct  30    VASGAGGTWKLLLNDVGISAMHSQLLINDRVIMYDRSNFGPSKISLPSGACRDSPNDVVS  89

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             K DCTAHS+EYDVA N++RPL ++++ WCSS  V P+G L+QTGG  +G+   R+F PC+
Sbjct  90    KRDCTAHSIEYDVAFNSIRPLTIESNTWCSSGGVTPEGALLQTGGDKEGERKARMFYPCD  149

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
             D+ CDW E+ NAL+  RWYATNH+LPDGRQIIIGGR +FN+EF+PKT     LY LPFL+
Sbjct  150   DESCDWTEVDNALYVRRWYATNHVLPDGRQIIIGGRNQFNFEFFPKTKAPS-LYKLPFLS  208

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             ET D G ENNLYP+VFLN DG+LFI+ANNKAIL DY K+ VV+ YP +P G PRSYPSTG
Sbjct  209   ETYDAGQENNLYPFVFLNSDGNLFIYANNKAILLDYNKNTVVKTYPKIPGGDPRSYPSTG  268

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFM  997
             SAVLLP+KNL+A  +  EVL+CGGAPKG++  A  +  F+ AL+TC RI+I D  P W +
Sbjct  269   SAVLLPIKNLEAEVVEMEVLVCGGAPKGSYLLALYKNTFVKALDTCARIKINDDKPQWVL  328

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             E MP +R MGDM+ LPNG++L+ING + GSAG+  GR PV  P LYH D PVG+RF++ N
Sbjct  329   EKMPRSREMGDMILLPNGHVLLINGGSSGSAGWELGREPVLNPDLYHPDKPVGSRFQVQN  388

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS IPRMYHSTA LLRD RVLVGGSNPH  Y F +  LFPTELRLEAFSP YL++    I
Sbjct  389   PSTIPRMYHSTAGLLRDGRVLVGGSNPHQFYNFTD-VLFPTELRLEAFSPSYLESQYWSI  447

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDG--NLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
             RP I    SHS   YG ++ ++F   G + G  + V VTMV PSFT+HSFS  QRLL L 
Sbjct  448   RPRIISLLSHSTVNYGGILRLRFMVFG-IGGVRSPVKVTMVFPSFTSHSFSMSQRLLVLD  506

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                 V+ +G+ TY +    P S NL+P GYYM  VV++ IPSEGIW+++
Sbjct  507   HVELVR-IGVWTYEVRVKAPKSKNLAPPGYYMASVVNQDIPSEGIWLRL  554



>ref|XP_010916153.1| PREDICTED: galactose oxidase-like [Elaeis guineensis]
Length=541

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/520 (59%), Positives = 380/520 (73%), Gaps = 10/520 (2%)
 Frame = +2

Query  125   WELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHS  304
             W+LL  +IG++AMHMQLL+ND+V+IFDRTDFG SN+ L  G+CR DP E V+K+DCTAHS
Sbjct  29    WDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGRSNLSLPDGKCRNDPNEKVLKIDCTAHS  88

Query  305   VEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVE  484
              EYD+A NT RPLM+ TD WCSS  V PDG LIQTGGWNDGD  VR F PCND  CDW E
Sbjct  89    AEYDLATNTFRPLMILTDSWCSSGTVAPDGRLIQTGGWNDGDRAVRTFVPCNDGSCDWSE  148

Query  485   IPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDL-LYNLPFLAETNDPGA  661
              P  L   RWYATN ILPDGR II+GGR++FN+EF+PK    DL  + LPFL  T D   
Sbjct  149   DPQGLAARRWYATNQILPDGRAIIVGGRKQFNFEFHPKPNPSDLTTFPLPFLQATKD-DV  207

Query  662   ENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPL  841
             E+NLYP+V LN+DG+LFIFANN+AIL DY K+AVVR YP MP G PR+YPS+GS+VLLPL
Sbjct  208   EDNLYPFVHLNIDGNLFIFANNRAILLDYTKNAVVRTYPEMPGGDPRNYPSSGSSVLLPL  267

Query  842   KNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARL  1021
             K        AEVL+CGGAP G++ ++    +M AL TCGRI+ITD +P W METMP  R+
Sbjct  268   K---PSATEAEVLVCGGAPMGSYTSAREDNYMQALKTCGRIKITDQSPSWSMETMPTPRV  324

Query  1022  MGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMY  1201
             MGDM+ LP+G +L++NGAA G+AG+  G  PV TPVLY  ++  G+RF++ NP+ IPR+Y
Sbjct  325   MGDMILLPSGEVLLLNGAAAGTAGWELGHEPVLTPVLYRPESMAGSRFQVQNPATIPRLY  384

Query  1202  HSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPG  1381
             HS+AIL+RD RVLVGGSNPH  Y F  G  FPTEL LEAFSP YL +  +  RP I +  
Sbjct  385   HSSAILIRDGRVLVGGSNPHVYYNF-TGVDFPTELSLEAFSPEYLSSENSNSRPKIDISA  443

Query  1382  SHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGI  1561
             S     YGK   ++F A G + G  VTVTM AP+F+THSFS +QRLL L  G  +   G 
Sbjct  444   SPISLNYGKQFSMRF-AVGAISGGGVTVTMAAPAFSTHSFSMNQRLLILETGTALS--GD  500

Query  1562  N-TYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             N +Y +TAV P SG L+P+GYY++FVV+ GIPSEG+W  +
Sbjct  501   NSSYEVTAVAPASGVLAPSGYYLVFVVNGGIPSEGVWAHI  540



>ref|XP_010416450.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/526 (58%), Positives = 383/526 (73%), Gaps = 9/526 (2%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
              +  GG W+LLLPN+GI+AMH QLL+ND+V+++DRT+FG SNI L  G CRQ P + + K
Sbjct  30    TSGAGGTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGACRQSPNDAISK  89

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHSVEY+VA N++RPL VQ++ WCSS  V PDGTL+QTGG  DG+   R+F PC+D
Sbjct  90    TDCTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGELKTRLFAPCDD  149

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ N L   RWYA+NH+LPDGRQIIIGGR++FNYEF+PKT   + LY LPFL +
Sbjct  150   DSCDWTEVDNGLAAARWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPN-LYALPFLTQ  208

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T DPG ENNLYPYVFLN DG+LFIFANN+AIL +Y  + VV+ YP +P G PRSYPSTGS
Sbjct  209   TTDPGQENNLYPYVFLNTDGNLFIFANNRAILLNYATNTVVKTYPEIPGGDPRSYPSTGS  268

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLP+KNL     V EVL+CGGAPKG++  A +   F+ AL+TC RI I DPNP W +E
Sbjct  269   AVLLPIKNL-----VLEVLVCGGAPKGSYIFAFKSKTFIKALDTCARININDPNPQWAVE  323

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM  LP+G++L+ING + G+A +  GR PV  P +Y+ D PVG+RFE  N 
Sbjct  324   KMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPVFNPDIYYPDRPVGSRFEPQNA  383

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             + IPRMYHSTA LLRD RV+VGGSNPH  Y F  G LFPTEL LEAFSP YL++  + +R
Sbjct  384   NAIPRMYHSTATLLRDGRVIVGGSNPHAYYNF-TGVLFPTELSLEAFSPSYLESKYSSLR  442

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P   +   YG+++ ++FT  G +    V VTMV PSF THSFS  QRLL L    
Sbjct  443   PVIMDPMPQTTINYGQILRLRFTVQGRMK-TPVKVTMVYPSFNTHSFSMSQRLLVLDHVL  501

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              ++      Y ++  TP S NL+P GYYM+FVV++ IPSEG+W+++
Sbjct  502   FLRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQNIPSEGVWVRL  547



>emb|CDX73183.1| BnaC06g36310D [Brassica napus]
Length=552

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/552 (58%), Positives = 392/552 (71%), Gaps = 15/552 (3%)
 Frame = +2

Query  26    NFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFD  205
             N  L FAL  LFL         +   A+  GG W+LLL N+GI+AMH QLL ND+V+++D
Sbjct  14    NHLLYFALI-LFL---------SFHVASGAGGTWKLLLNNVGISAMHSQLLINDRVIMYD  63

Query  206   RTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVM  385
             R++FG S I L  G CR  P + V K DCTAHS+EYDVA N VRPL VQ++ WCSS  V 
Sbjct  64    RSNFGPSKISLPNGTCRDSPNDSVSKRDCTAHSIEYDVALNRVRPLTVQSNTWCSSGGVT  123

Query  386   PDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGG  565
             PDGTL+QTGG  DG+   R+F PC+D  C W EI NAL+  RWYA+NH+LPDGRQII+GG
Sbjct  124   PDGTLLQTGGDKDGERKARLFYPCDDDSCVWSEIDNALNVKRWYASNHVLPDGRQIIVGG  183

Query  566   REEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYD  745
             R+EFN+EF+PKT   +  Y+L FL+ETND   ENNLYP VFLN DG+LFIFANN+AIL D
Sbjct  184   RDEFNFEFFPKTNAPN-TYSLRFLSETNDLDQENNLYPNVFLNTDGNLFIFANNRAILLD  242

Query  746   YIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASE  922
             Y K+ VV+ YP +P G PRSYPSTGSAVLLP+KNL+   I  EVL+CGGAPKG++  A  
Sbjct  243   YSKNTVVKTYPEIPGGDPRSYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALN  302

Query  923   RGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGD  1102
                F+  L+TC RI+I D NP W +E MP  R+MGDM+ LPNG +L+ING + GSAG+  
Sbjct  303   ENTFVKGLDTCARIKINDANPKWVLEKMPRPRIMGDMIILPNGQVLLINGGSSGSAGWEL  362

Query  1103  GRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGN  1282
             GR PV +P LYH D P+G+RF++ NPS IPRMYHSTA LLRD RVLVGGSNPH  Y F  
Sbjct  363   GRKPVLSPDLYHPDKPIGSRFQVQNPSTIPRMYHSTANLLRDGRVLVGGSNPHEFYNF-T  421

Query  1283  GALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVT  1462
             G LFPTELRLEAFSP YL++    IRP I  P  HS   YG V+ ++F   G V    V 
Sbjct  422   GVLFPTELRLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGGVLRLRFRVLGGVK-TPVK  480

Query  1463  VTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVH  1642
             VTM  PSFTTHSFS  QRLL L    +++ +G  TY +   +P S NL+P GYYM+FVV+
Sbjct  481   VTMAFPSFTTHSFSMSQRLLVLDHVTSLR-IGQWTYEVRVKSPRSANLAPPGYYMVFVVN  539

Query  1643  KGIPSEGIWIQM  1678
             + IPSEGIW+++
Sbjct  540   QDIPSEGIWVRL  551



>ref|XP_010670846.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=538

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/535 (59%), Positives = 383/535 (72%), Gaps = 15/535 (3%)
 Frame = +2

Query  89    RNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPY  268
             RN+ AA    G+W+LL  +IGI+AMHMQLL++D+V+I+DRTDFG SNI    GRC  +P 
Sbjct  15    RNIIAAE--NGQWQLLQKSIGISAMHMQLLDDDRVIIYDRTDFGPSNITFPDGRCPGNPK  72

Query  269   EVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVF  448
                   DCTAHSVEYD   NT RPL + T+ WCSS A +P+GTL+QTGG+ +GD VVR F
Sbjct  73    ------DCTAHSVEYDSLTNTFRPLTLLTNNWCSSGATLPNGTLVQTGGYRNGDRVVRTF  126

Query  449   -NPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK-TPGGDLLY  622
              + CN   CDWVE PN L + RWYA+NH LPDGR I+IGG + FNYEFYPK TP    L+
Sbjct  127   QSSCN--ACDWVEHPNQLLQRRWYASNHALPDGRVIVIGGTKAFNYEFYPKDTPSSSQLF  184

Query  623   NLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPR  802
              LPFL +TN P  ENNLYP+VFL+VDG+LFIFANN+AIL+DY K  VVR YP +P G PR
Sbjct  185   KLPFLEQTNVPKVENNLYPFVFLHVDGNLFIFANNRAILFDYAKDVVVRTYPTIPGGDPR  244

Query  803   SYPSTGSAVLLPLKNLQ-APGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITD  976
             SYPSTGSAVLLPLK L+    I AEVLICGGAP G++  A     F+ AL TC R++ITD
Sbjct  245   SYPSTGSAVLLPLKKLELGLDIEAEVLICGGAPVGSYLKALNSRQFLPALRTCARMKITD  304

Query  977   PNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVG  1156
             PNP W +ETMPMAR+M DMV LPN ++L+INGA++GSAG+  GR PV TPV+YH +   G
Sbjct  305   PNPSWAIETMPMARVMSDMVVLPNEDVLLINGASKGSAGWELGREPVLTPVIYHPNRASG  364

Query  1157  TRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYL  1336
             +RFE  + S IPRMYHS AI+LRD RVLVGGSNPH  Y F N  LFPTEL LE FSPPYL
Sbjct  365   SRFENQSSSTIPRMYHSCAIMLRDGRVLVGGSNPHQFYNFTN-VLFPTELSLETFSPPYL  423

Query  1337  DAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQR  1516
             D   A +RP I  P S +K  YG+ + I+F+ +G ++   V VTM+   F THSFS  QR
Sbjct  424   DPTKARLRPVIIKPISSAKIKYGRFLTIKFSVSGLINLASVKVTMLRAPFNTHSFSMSQR  483

Query  1517  LLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             LL L     V P G   + +    PGS N++P G+YMLFVVH+ IPS+GIW+Q+ 
Sbjct  484   LLVLTNRKLVSPTGQGRFQVRVRLPGSANIAPPGFYMLFVVHRNIPSKGIWVQLT  538



>ref|XP_010539855.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=504

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/524 (58%), Positives = 381/524 (73%), Gaps = 22/524 (4%)
 Frame = +2

Query  107   AAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKV  286
             AAG G W+LL  ++GI+AMHMQLL+ND+V+++DRT+FG SN+ L GG+C  +        
Sbjct  2     AAGEGWWQLLHGSVGISAMHMQLLHNDRVIMYDRTEFGPSNVALPGGKCIGN------AA  55

Query  287   DCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDK  466
             DCTAHS+EYDV  N  RPL VQ+++WCSS  V PDGTL+QTGG+  G+  VR+F PC + 
Sbjct  56    DCTAHSIEYDVISNGFRPLTVQSNIWCSSGYVTPDGTLVQTGGFWTGERRVRLFTPCKNN  115

Query  467   KCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAET  646
              CDW E+ N L   RWYATNHILPDG QII+GGR++FN+EF+PKT   +  YNLPFLAET
Sbjct  116   ICDWKEVDNGLACKRWYATNHILPDGSQIILGGRDQFNFEFFPKTKYPNA-YNLPFLAET  174

Query  647   NDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
              D G ENNLYP+VFLNVDG+LF+FANN+AIL DY K+ VV+ YP +P G PRSYPSTGSA
Sbjct  175   KDFGTENNLYPFVFLNVDGNLFVFANNRAILLDYSKNTVVKTYPTIPGGDPRSYPSTGSA  234

Query  827   VLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             VLLPLKNL+A  + AEVL+CGGAP+G++  + +  F+ AL+TC RI+ITDPNP W +ETM
Sbjct  235   VLLPLKNLEAINVEAEVLVCGGAPRGSYEQAMKNNFVKALDTCARIKITDPNPQWAIETM  294

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P AR+MGDM+ LPNG++LIING A G+A +  GR+PV  P LY  DNPVG+RF+  NP+ 
Sbjct  295   PQARVMGDMIILPNGDVLIINGGASGTAAWELGRDPVLAPDLYRPDNPVGSRFKTQNPTT  354

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHS+ +LLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL      I+  
Sbjct  355   IPRMYHSSTVLLRDGRVLVGGSNPHAYYNF-TGVLFPTELSLEAFSPSYLGKEKPCIK--  411

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
                        Y   I++ F  +G V    V VTMV PSFTTHSFS +QRLL L      
Sbjct  412   -----------YNTTIKLVFAVSGEVKIP-VKVTMVLPSFTTHSFSMNQRLLVLDNIEFY  459

Query  1547  KPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             +     TY++   TPGS N++P GYYM+FVV++ IPS+GIW+Q+
Sbjct  460   RKGNTTTYNVVVKTPGSSNIAPPGYYMMFVVNQDIPSKGIWVQL  503



>emb|CDY13556.1| BnaC02g23670D [Brassica napus]
Length=554

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/529 (57%), Positives = 386/529 (73%), Gaps = 7/529 (1%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
              A+  GG W+LLL  +GI+AMH QLL ND+V+++DR++FG S I L  G CR  P +VV 
Sbjct  29    VASGAGGTWKLLLNEVGISAMHSQLLINDRVIMYDRSNFGPSKISLPSGACRDSPNDVVS  88

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             K DC+AHS+EYDVA N++RPL ++++ WCSS  V P+G L+QTGG  +G+   R+F PC+
Sbjct  89    KRDCSAHSIEYDVAFNSIRPLTIESNTWCSSGGVTPEGALLQTGGDKEGERKARMFYPCD  148

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLA  640
             D+ CDW E+ NAL+  RWYATNH+LPDGRQII+GGR +FN+EF+PKT     LY LPFL+
Sbjct  149   DESCDWTEVDNALNVRRWYATNHVLPDGRQIIVGGRNQFNFEFFPKTKAPS-LYKLPFLS  207

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             ET D G ENNLYP++FLN DG+LFIFANNKAIL DY K+ VV+ YP +P G PRSYPSTG
Sbjct  208   ETYDVGQENNLYPFIFLNSDGNLFIFANNKAILLDYNKNTVVKTYPKIPGGDPRSYPSTG  267

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFM  997
             SAVLLP+KNL+A  +  EVL+CGGAPK ++  A  +  F+ AL+TC RI+I D  P W +
Sbjct  268   SAVLLPIKNLEAEVVEMEVLVCGGAPKRSYLLALYKNTFVKALDTCARIKINDDKPQWVL  327

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             E MP +R+MGDM+ LPNG++L+ING + GSAG+  GR PV  P LYH +  VG+RF++ N
Sbjct  328   EKMPRSRVMGDMILLPNGHVLLINGGSSGSAGWELGREPVLNPDLYHPNKLVGSRFQVQN  387

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
             PS IPRMYHSTA LLRD RVLVGGSNPH  Y F +  LFPTELRLEAFSP YL++    I
Sbjct  388   PSTIPRMYHSTAGLLRDGRVLVGGSNPHQFYNFTD-VLFPTELRLEAFSPSYLESQYWSI  446

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDG--NLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
             RP I    SHS   YG ++ ++F   G + G  + V VTMV PSFT+HSFS  QRLL L 
Sbjct  447   RPRIISLLSHSTVNYGGILRLRFMVFG-IGGVRSPVKVTMVFPSFTSHSFSMSQRLLVLD  505

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                 V+ +G+ TY +    P   N++P GYYM FVV++ IPSEGIW+++
Sbjct  506   HVELVR-IGVWTYEVRVKAPRYKNIAPPGYYMAFVVNQDIPSEGIWVRL  553



>gb|KGN60010.1| hypothetical protein Csa_3G865940 [Cucumis sativus]
Length=556

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/539 (57%), Positives = 381/539 (71%), Gaps = 15/539 (3%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             F  AA  G W+LL   IGI+AMHMQLL+ND+VV+FD T FG SN+     RC +      
Sbjct  22    FTQAAAAGHWKLLQGTIGISAMHMQLLHNDRVVMFDGTGFGPSNLSFPTARCARSYNGRR  81

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
             +  DCTAHSVEYDVA NT RPL VQTD+WCSS   M DGTL+QTGG+  GD  VR+F PC
Sbjct  82    ISFDCTAHSVEYDVATNTFRPLAVQTDMWCSSGGAMRDGTLVQTGGFKAGDRTVRIFKPC  141

Query  458   NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK----------TPG  607
                 CDW EIP  L   RWYATNHILPDG QIIIGGR+ F+YEF+PK          T  
Sbjct  142   --PTCDWEEIPMGLLTRRWYATNHILPDGSQIIIGGRKRFSYEFFPKPAAFNWPLAKTNS  199

Query  608   GDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMP  787
                 Y LPFL +TND  AENNLYP+VFL++DG LFIFANN+AIL+DY K+ +++ +P +P
Sbjct  200   VPEAYRLPFLIQTNDGHAENNLYPFVFLHIDGSLFIFANNRAILFDYTKNKILKTFPKIP  259

Query  788   DGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIR  967
              G PR+YPSTGSAV+LPL NLQA  +  EV++CGGAPKGA   +  GVF+ ALNTC RI+
Sbjct  260   GGDPRNYPSTGSAVILPL-NLQAKLLEVEVMVCGGAPKGASIKARNGVFVEALNTCARIK  318

Query  968   ITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDN  1147
             IT PNP W +E MP++R+MGDM+ LPNGN+L+ING + G+AG+   RNPV  PVLY  +N
Sbjct  319   ITSPNPKWLLEIMPLSRVMGDMLLLPNGNVLLINGGSFGTAGWELARNPVLNPVLYLPNN  378

Query  1148  PVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSP  1327
             P G+RFE+ +PS  PRMYHSTAILLRD R+LVGGSNP P Y F +G LFPTEL LEAF P
Sbjct  379   PHGSRFEVNDPSTTPRMYHSTAILLRDGRILVGGSNPQPGYNF-SGVLFPTELSLEAFHP  437

Query  1328  PYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQ  1507
             PYLD   A +RP I  P S     +G+ ++++FT    +D   V+VTM+AP F THSFS 
Sbjct  438   PYLDPEFAALRPTIIEPRSQVMVFHGQRLKVEFTVIDELDPTKVSVTMLAPPFNTHSFSM  497

Query  1508  HQRLLDLGGGGTVKPVGIN-TYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             +QRLL LG       +     Y +    P SGN++P+G+Y+LFVVH+ +PSEGIW+Q++
Sbjct  498   NQRLLVLGRSNVTTTIWPELMYEVEVNVPVSGNIAPSGFYILFVVHQCVPSEGIWVQIL  556



>ref|XP_004147870.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 ref|XP_004166816.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=537

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/539 (57%), Positives = 381/539 (71%), Gaps = 15/539 (3%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             F  AA  G W+LL   IGI+AMHMQLL+ND+VV+FD T FG SN+     RC +      
Sbjct  3     FTQAAAAGHWKLLQGTIGISAMHMQLLHNDRVVMFDGTGFGPSNLSFPTARCARSYNGRR  62

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
             +  DCTAHSVEYDVA NT RPL VQTD+WCSS   M DGTL+QTGG+  GD  VR+F PC
Sbjct  63    ISFDCTAHSVEYDVATNTFRPLAVQTDMWCSSGGAMRDGTLVQTGGFKAGDRTVRIFKPC  122

Query  458   NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK----------TPG  607
                 CDW EIP  L   RWYATNHILPDG QIIIGGR+ F+YEF+PK          T  
Sbjct  123   --PTCDWEEIPMGLLTRRWYATNHILPDGSQIIIGGRKRFSYEFFPKPAAFNWPLAKTNS  180

Query  608   GDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMP  787
                 Y LPFL +TND  AENNLYP+VFL++DG LFIFANN+AIL+DY K+ +++ +P +P
Sbjct  181   VPEAYRLPFLIQTNDGHAENNLYPFVFLHIDGSLFIFANNRAILFDYTKNKILKTFPKIP  240

Query  788   DGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIR  967
              G PR+YPSTGSAV+LPL NLQA  +  EV++CGGAPKGA   +  GVF+ ALNTC RI+
Sbjct  241   GGDPRNYPSTGSAVILPL-NLQAKLLEVEVMVCGGAPKGASIKARNGVFVEALNTCARIK  299

Query  968   ITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDN  1147
             IT PNP W +E MP++R+MGDM+ LPNGN+L+ING + G+AG+   RNPV  PVLY  +N
Sbjct  300   ITSPNPKWLLEIMPLSRVMGDMLLLPNGNVLLINGGSFGTAGWELARNPVLNPVLYLPNN  359

Query  1148  PVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSP  1327
             P G+RFE+ +PS  PRMYHSTAILLRD R+LVGGSNP P Y F +G LFPTEL LEAF P
Sbjct  360   PHGSRFEVNDPSTTPRMYHSTAILLRDGRILVGGSNPQPGYNF-SGVLFPTELSLEAFHP  418

Query  1328  PYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQ  1507
             PYLD   A +RP I  P S     +G+ ++++FT    +D   V+VTM+AP F THSFS 
Sbjct  419   PYLDPEFAALRPTIIEPRSQVMVFHGQRLKVEFTVIDELDPTKVSVTMLAPPFNTHSFSM  478

Query  1508  HQRLLDLGGGGTVKPVGIN-TYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             +QRLL LG       +     Y +    P SGN++P+G+Y+LFVVH+ +PSEGIW+Q++
Sbjct  479   NQRLLVLGRSNVTTTIWPELMYEVEVNVPVSGNIAPSGFYILFVVHQCVPSEGIWVQIL  537



>ref|XP_009336703.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=573

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/481 (61%), Positives = 361/481 (75%), Gaps = 11/481 (2%)
 Frame = +2

Query  92    NMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYE  271
             ++  A A GG+W++L  N+GI+AMHMQL  ND++V+FDRTDFG SN+ L  G C      
Sbjct  19    SVLTAHAAGGKWQVL-KNVGISAMHMQLFKNDRIVMFDRTDFGKSNLSLANGNC------  71

Query  272   VVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFN  451
               V  DCTAHS E+ V  N +RPL V +DVWCSS ++   G LIQTGG+N G+  VRVF 
Sbjct  72    --VNNDCTAHSAEFVVQTNALRPLTVLSDVWCSSGSMDAYGNLIQTGGFNSGERRVRVFT  129

Query  452   PCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLP  631
             PC    CDW E  + L   RWYATNH+LPDGR+IIIGGR +FNYEF PKT     +Y+LP
Sbjct  130   PCTG--CDWKETVDGLAVRRWYATNHMLPDGREIIIGGRGQFNYEFSPKTESTSNVYSLP  187

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL++TNDPG ENNLYP+VFLN DG+LFIFANN+AIL DY+K+AVV+ YP +P G PR YP
Sbjct  188   FLSQTNDPGQENNLYPFVFLNPDGNLFIFANNRAILLDYVKNAVVKTYPQIPGGDPRCYP  247

Query  812   STGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVW  991
             STGSAVLLPLKNL AP + AEVL+CGGAPKG+F  + +GVF+ ALNTC RI+ITDPNP W
Sbjct  248   STGSAVLLPLKNLTAPAVEAEVLVCGGAPKGSFSQANKGVFVEALNTCARIKITDPNPQW  307

Query  992   FMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
              +ETMP AR+MGDM+ LP+  +LIINGA+ G+AG+  GRNPV  PV+Y  DN +G+RFE 
Sbjct  308   IVETMPQARVMGDMILLPDSTVLIINGASSGAAGWEIGRNPVLNPVVYRPDNAIGSRFEQ  367

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
              NP+ IPRMYHS+A+L+RD RV+VGGSNPH  Y FG+  LFPTELRLEAFSP YLDA  A
Sbjct  368   QNPTTIPRMYHSSALLVRDGRVVVGGSNPHDKYQFGSNVLFPTELRLEAFSPEYLDAKYA  427

Query  1352  GIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
              +RP I  P + +K  YG+ + +QF+  G    N V+VTMVAP F+THSFS +QRLL LG
Sbjct  428   DLRPTIIAPRNQAKIHYGRTLTVQFSLTGTFAMNSVSVTMVAPPFSTHSFSMNQRLLVLG  487

Query  1532  G  1534
              
Sbjct  488   A  488



>ref|XP_006838081.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
 gb|ERN00650.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
Length=546

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/530 (57%), Positives = 383/530 (72%), Gaps = 7/530 (1%)
 Frame = +2

Query  95    MFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEV  274
             MF A A  G WELL  N GI+AMHM LL+N KVV+FDRTDFG SN+ L  GRCR DP E+
Sbjct  20    MFGAIAQLGSWELLQENAGISAMHMALLSNGKVVMFDRTDFGKSNLSLPAGRCRSDPNEL  79

Query  275   VVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNP  454
              + +DCTAHS EYD   N+VRPL VQTDVWCSS A+ PDG LIQTGG+NDGDHVVRVF P
Sbjct  80    ALTLDCTAHSAEYDPVANSVRPLFVQTDVWCSSGAIAPDGRLIQTGGFNDGDHVVRVFQP  139

Query  455   CNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
             C++  CDW E P+ L   RWYATN ILPDGR I+IGGR ++NYEFYPK+      +   F
Sbjct  140   CDN--CDWEEFPSGLAARRWYATNQILPDGRIIVIGGRRQYNYEFYPKSEMTAATFLFRF  197

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             LAET D   ENNLYP+V L+ DG+LF+FANN+++L DY  + +V+++P MP G PR+YPS
Sbjct  198   LAETKD-ANENNLYPFVHLSTDGNLFVFANNRSVLLDYGGNRIVKVFPTMPGGDPRNYPS  256

Query  815   TGSAVLLPLK-NLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVW  991
             +GS+ LLPL+ + +   I  EVL+CGGAP G++  +  G F+ AL+TCGRIRITDP+P W
Sbjct  257   SGSSTLLPLRISPELSAIPVEVLVCGGAPTGSYDQAREGQFVQALDTCGRIRITDPSPQW  316

Query  992   FMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
              +ETMP+AR+MGDMV LP G++LIINGA+ G+AG+  GRNPV +PVLY+   P   RF  
Sbjct  317   QIETMPVARVMGDMVLLPTGDVLIINGASAGTAGWEFGRNPVLSPVLYNPVAPSSARFRT  376

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
             L  + +PR+YHSTAILL D R+LVGGSNPH  Y F +G LFPTELRLE+FSPPYL    +
Sbjct  377   LASTQVPRVYHSTAILLPDGRILVGGSNPHVYYNF-SGVLFPTELRLESFSPPYLSPQFS  435

Query  1352  GIRPHITLPGSH-SKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL  1528
              +RP+I  P S+ +   +G+  +++F+    V    +TVTMVAPSFTTHSFS +QRLL L
Sbjct  436   RLRPNIIFPASNPATIRFGQQFQVRFSVESMVGAEGITVTMVAPSFTTHSFSMNQRLLVL  495

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                  +  +  N Y    V P S  L+P GYY++FVVH+G+PS  IW ++
Sbjct  496   -QNTMLTVLSPNVYQANTVAPQSPLLAPPGYYLIFVVHQGVPSSAIWSRI  544



>ref|XP_008466667.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=655

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/539 (57%), Positives = 382/539 (71%), Gaps = 15/539 (3%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             F  AA  G W+LL   IGI+AMHMQLL+ND+V++FD T FG SN+   G RC +      
Sbjct  121   FTQAAAAGHWKLLQGTIGISAMHMQLLHNDRVIMFDGTGFGPSNLSFPGARCARTYNGRR  180

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
             +  DCTAHSVEYDVA NT RPL VQTD+WCSS   M DGTL+QTGG+  GD  VR+F PC
Sbjct  181   ISFDCTAHSVEYDVATNTFRPLAVQTDMWCSSGGAMRDGTLVQTGGFKAGDRTVRIFKPC  240

Query  458   NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK----------TPG  607
                 CDW EIP  L   RWYATNHILPDG QIIIGGR+ F+YEF+PK          T  
Sbjct  241   TS--CDWEEIPMGLLTRRWYATNHILPDGSQIIIGGRKRFSYEFFPKPAAFNWPLAKTNS  298

Query  608   GDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMP  787
                 Y LPFL +TND  AENNLYP+VFL++DG LFIFANN+AIL+DY K+ V++ +P +P
Sbjct  299   VPEAYRLPFLMQTNDGHAENNLYPFVFLHIDGSLFIFANNRAILFDYTKNKVLKTFPKIP  358

Query  788   DGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIR  967
              G PR+YPSTGSAV+LPL NLQ   +  EV++CGGAPKGA   +  GVF+ ALNTC RI+
Sbjct  359   GGDPRNYPSTGSAVILPL-NLQGKLLEVEVMVCGGAPKGAHIKARNGVFVEALNTCARIK  417

Query  968   ITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDN  1147
             IT PNP W +E MP++R+MGDM+ LPNGN+L+ING + G+AG+   RNPV  PVLY  +N
Sbjct  418   ITSPNPKWVLEIMPLSRVMGDMLLLPNGNVLLINGGSFGTAGWELARNPVLNPVLYLPNN  477

Query  1148  PVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSP  1327
               G+RFE+ +PS  PRMYHSTAILLRD R+LVGGSNPHP Y F +G LFPTEL LEAF P
Sbjct  478   LPGSRFEVNDPSTTPRMYHSTAILLRDGRILVGGSNPHPGYNF-SGFLFPTELSLEAFHP  536

Query  1328  PYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQ  1507
             PYLD   A +RP I  P S     +G+ ++++FT    +D   ++VTM+AP F THSFS 
Sbjct  537   PYLDPEFAALRPTIIEPRSQIMVFHGQRLKVEFTVIDEMDPTKISVTMLAPPFNTHSFSM  596

Query  1508  HQRLLDLGGGGTVKPVGIN-TYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             +QRLL +G G     +     Y +    P SGN++P+G+Y+LFVVH+ +PSEGIW+Q++
Sbjct  597   NQRLLVVGRGNVTTTIWPELMYEVEVNIPVSGNIAPSGFYILFVVHQCVPSEGIWVQIL  655



>gb|AAG12543.1|AC007797_3 Unknown Protein [Arabidopsis thaliana]
Length=504

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/506 (57%), Positives = 375/506 (74%), Gaps = 3/506 (1%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLL+ND+VV++DRT+FG SNI L  G CR +P + V K+DCTAHS+EYDVA NT+RP
Sbjct  1     MHMQLLHNDRVVMYDRTNFGPSNISLPNGNCRDNPQDAVSKIDCTAHSIEYDVATNTIRP  60

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYA  520
             L VQ++ WCSS +V PDG L+QTGG  DG+   R F+PCN+ +CDWVE+ N L + RWYA
Sbjct  61    LTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKTRTFSPCNNNQCDWVEMNNGLKKRRWYA  120

Query  521   TNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVD  700
             +NHILPDG+QI++GG+ +FNYEF+PKT   +++  LPFLAET+D G ENNLYP+VF+N D
Sbjct  121   SNHILPDGKQIVMGGQGQFNYEFFPKTTNPNVVA-LPFLAETHDQGQENNLYPFVFMNTD  179

Query  701   GHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVL  880
             G+LF+FANN+AIL DY+K+ VV+ +PA+P G PR+YPSTGSAVLLPLKNL+A  +  EVL
Sbjct  180   GNLFMFANNRAILLDYVKNTVVKTFPAIPGGDPRNYPSTGSAVLLPLKNLEADNVETEVL  239

Query  881   ICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNIL  1060
             +CGGAPKG++  + +  F+ AL+TC RI+I D  P W +E MP AR+MGDM+ LPNG++L
Sbjct  240   VCGGAPKGSYNLARKKTFVKALDTCARIKINDAKPEWAVEKMPHARVMGDMIPLPNGDVL  299

Query  1061  IINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVL  1240
             +ING + G+A +  GR PV  P LYH +NPVG+RFE L P+ IPRMYHS AILLRD RVL
Sbjct  300   LINGGSFGTAAWELGRTPVLAPDLYHPENPVGSRFESLRPTTIPRMYHSAAILLRDGRVL  359

Query  1241  VGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEI  1420
             VGGSNPH  Y +  G LFPTEL LEAFSP YL    + +RP I  P   S   YG  +++
Sbjct  360   VGGSNPHAFYNY-TGVLFPTELSLEAFSPVYLQREFSNLRPKIISPEPQSMIKYGTNLKL  418

Query  1421  QFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSG  1600
             +F+  G V      VTMV P+FTTHSF+ +QR+L L      +      Y +   TP S 
Sbjct  419   KFSVTGEVT-TPAKVTMVFPTFTTHSFAMNQRVLVLDNVKFTRKGKSPMYEVQVRTPRSA  477

Query  1601  NLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             N++  GYYM+FVV++ IPSEG+W+++
Sbjct  478   NIAWPGYYMIFVVNQDIPSEGVWVKL  503



>ref|XP_009393211.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=542

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/531 (58%), Positives = 382/531 (72%), Gaps = 10/531 (2%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
              A A+GGG+WELL P+IG++AMHMQLL+ND+V++FDRTDFG SN+ L GGRCR DP +  
Sbjct  16    LATASGGGQWELLQPSIGVSAMHMQLLSNDRVIVFDRTDFGPSNLSLPGGRCRNDPRDWT  75

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
             + VDCTAH+ EYDV  N VRPL V TD WCSS  V PDG LIQTGG NDG+  VR  +PC
Sbjct  76    LTVDCTAHAAEYDVPSNAVRPLTVLTDPWCSSGTVSPDGRLIQTGGANDGERAVRYLDPC  135

Query  458   NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDL-LYNLPF  634
             +D+ CDW E    L   RWYATNH+LPDGR +++GGR + NYEF PK    D    +LPF
Sbjct  136   HDRLCDWEEDAAGLAAPRWYATNHVLPDGRAVVVGGRSQHNYEFVPKLGAADAGAVSLPF  195

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L ET D    NNLYP+V+LNVDG+LF+FANN+AIL DY  +++VR YP +PDG PR+YPS
Sbjct  196   LRETRD-AEYNNLYPFVYLNVDGNLFVFANNRAILLDYKTNSIVRTYPTVPDGHPRNYPS  254

Query  815   TGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVW  991
             TGS+VLLP   LQ  G  AEVLICGGAP+G+F  AS + VF+GALNTC RIRI DP+P W
Sbjct  255   TGSSVLLP---LQPSGSEAEVLICGGAPEGSFTKASTQKVFVGALNTCLRIRINDPSPSW  311

Query  992   FMETMPMARLMGDMVTLPNGN-ILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFE  1168
              +ETMP  R+MGDM+ LP+G+ +LIINGAA GS+G+  GR PV TPV Y   +P G+RF+
Sbjct  312   SVETMPTPRVMGDMILLPSGDEVLIINGAAAGSSGWELGREPVLTPVSYRHGSPAGSRFD  371

Query  1169  ILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAAT  1348
             +  P+ IPRMYHSTAILLRD RVLVGGSNPH  Y F  G  FPT+L LEA+SP YL+AA 
Sbjct  372   VKTPATIPRMYHSTAILLRDGRVLVGGSNPHAFYNF-TGVDFPTDLSLEAYSPAYLEAAN  430

Query  1349  AGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL  1528
             +  RP +T  G+  +  Y K   ++F+ A   +   V VTMVAPSF THSFS +QRLL L
Sbjct  431   SNARPTVTWAGTPVELNYAKPFSLRFSVAAMSEKG-VLVTMVAPSFATHSFSMNQRLLIL  489

Query  1529  GGG-GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                         + Y + A+ P S  ++P GYYM+FVV+ GIPSEG+W+ +
Sbjct  490   ESELAAAADAESSLYVVDAMAPSSTFMAPPGYYMVFVVNGGIPSEGVWVHI  540



>ref|XP_008813838.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=548

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/549 (58%), Positives = 393/549 (72%), Gaps = 11/549 (2%)
 Frame = +2

Query  44    ALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGL  223
             AL  LFL       S +   AA+GGGRW+LL  +IG++AMHMQLL+ND+V+IFDRTDFG 
Sbjct  6     ALPLLFLFLYDITLSHSAAEAASGGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGP  65

Query  224   SNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLI  403
             SN+ L  G+CR D +E V+K+DCTAHS EYDV  NT RPL + TD WCSS +V PDG LI
Sbjct  66    SNLSLPDGKCRHDHHERVLKIDCTAHSAEYDVVTNTFRPLTIHTDTWCSSGSVDPDGRLI  125

Query  404   QTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNY  583
             QTGG  DG+  +R F PC D +CDW E+  AL   RWYATN ILPDGR IIIGGR +F+Y
Sbjct  126   QTGGSFDGERAIRTFFPCTDSRCDWKEV-EALAVPRWYATNQILPDGRAIIIGGRLQFSY  184

Query  584   EFYPKT-PGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHA  760
             EFYPK+ P    + NL FL +T D   ENNLYP+V LNVDG+LFIFANN+AIL DY K+ 
Sbjct  185   EFYPKSNPSTAGITNLEFLLQTRDV-EENNLYPFVHLNVDGNLFIFANNRAILLDYTKNN  243

Query  761   VVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFM  937
             +VR YP +P G PRSYPSTGS+VLLP   L++ G  AEVLICGGAP+G+F  A +   F+
Sbjct  244   IVRTYPPVPGGDPRSYPSTGSSVLLP---LESSGEEAEVLICGGAPRGSFMKAIKNEAFV  300

Query  938   GALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGN-ILIINGAAQGSAGYGDGRNP  1114
             GAL+TCGRI+ITDP+P WF+ETMP  R+MGDM+ LP+G  +LIINGAA G+AG+  GR+P
Sbjct  301   GALSTCGRIKITDPSPTWFIETMPTPRVMGDMILLPSGKEVLIINGAAAGAAGWELGRSP  360

Query  1115  VQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALF  1294
             V TPV+Y    PVG RFE+ N S  PR+YHS+AILLRD R+LVGGSNPH NYVF +G  +
Sbjct  361   VMTPVVYCPGKPVGARFEVQNSSSTPRLYHSSAILLRDGRILVGGSNPHENYVF-SGVDY  419

Query  1295  PTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMV  1474
             PTEL LEAFSP YL A  + +RP I  P +     YGK   ++F A        V+VTMV
Sbjct  420   PTELSLEAFSPDYLGAEHSILRPRIIEPRTPLMLNYGKQFSLRFKAR-LTSNEGVSVTMV  478

Query  1475  APSFTTHSFSQHQRLLDLGGGGTVK-PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGI  1651
             APSF+THSFS +QRLL L        P G +T+ + AV P S  L+P GYYM F+V+  I
Sbjct  479   APSFSTHSFSMNQRLLILKSSKAATIPSGSSTHEIGAVAPKSRILAPPGYYMFFIVNGRI  538

Query  1652  PSEGIWIQM  1678
             P EGIW+ +
Sbjct  539   PGEGIWVHI  547



>gb|KFK44113.1| hypothetical protein AALP_AA1G217400 [Arabis alpina]
Length=508

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/525 (57%), Positives = 362/525 (69%), Gaps = 43/525 (8%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             ++A GG+W LLLPN+GIAAMHMQLL ND+VV+FDRT+FG SNI L  G CR  P ++V K
Sbjct  26    SSAAGGKWNLLLPNVGIAAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNCRDSPNDIVTK  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHS+EYDVA NTVRPL VQ++ WCSS +V PDG L+QTGG  DG+   R F+PCN+
Sbjct  86    LDCTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCNN  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
              +CDWVE  N L   RWYA+NHILPDG+QI++GG+ +FNYEFYPKT   +++  LPFLAE
Sbjct  146   NRCDWVEFSNGLATRRWYASNHILPDGKQIVVGGQGKFNYEFYPKTTSQNVVA-LPFLAE  204

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TND G ENNLYPYVFLN DG+LFIFANN+AIL DY+K+ VV+ +PA+P G PRSYP TGS
Sbjct  205   TNDRGEENNLYPYVFLNTDGNLFIFANNRAILLDYVKNTVVKTFPAIPGGDPRSYPRTGS  264

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLPLKNL+A  I AE                                        +  
Sbjct  265   AVLLPLKNLEAVKIEAE----------------------------------------LRK  284

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP AR+MGDM  LPNG++LIING   GSA +  GR PV  P LY  +NPV +RFE LNP+
Sbjct  285   MPRARVMGDMTLLPNGDVLIINGGGSGSAAWELGREPVLVPDLYQPENPVNSRFESLNPT  344

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHSTAILLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL+   A +RP
Sbjct  345   TIPRMYHSTAILLRDGRVLVGGSNPHAFYNF-TGVLFPTELSLEAFSPVYLEPEFANLRP  403

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I  P S S+  Y   +++QF   G V    V VTMV PSFTTHSFS +QRLL L     
Sbjct  404   KIMSPKSPSRIKYRTSLKLQFKVTGEVKSP-VKVTMVFPSFTTHSFSMNQRLLVLDNVKF  462

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              +     TY +   TP S N++P GYYM+FVV++ IPSEG+W+++
Sbjct  463   TRKGKSMTYEVQVRTPRSANIAPPGYYMIFVVNQNIPSEGVWVRL  507



>ref|XP_009408991.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=540

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/527 (57%), Positives = 377/527 (72%), Gaps = 15/527 (3%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             AAAGGG W+LL  +IG++AMHMQLL+ND+VV+FDRTDFG SN+ L  GRCR DP +  + 
Sbjct  26    AAAGGGEWKLLQHSIGVSAMHMQLLHNDRVVVFDRTDFGPSNLSLPDGRCRNDPNDKALP  85

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHS EYDV  N  RPLMV TD WCSS +V PDGTL+QTGG+NDG+   R F PC+D
Sbjct  86    VDCTAHSAEYDVVANAFRPLMVLTDTWCSSGSVAPDGTLVQTGGFNDGERAARTFRPCDD  145

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDL-LYNLPFLA  640
               CDWVE   AL   RWYATN +LPDGR +++GGR +FNYEFYPK    D+    L FL 
Sbjct  146   GSCDWVETAQALAVRRWYATNQVLPDGRAVVVGGRRQFNYEFYPKPDPSDMSTIALRFLQ  205

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
             +T D   E+NLYP+V L++DG+LFIFANN+AIL DY K+ VVR YP MP G+PR+YPS+G
Sbjct  206   DTRD-DVEDNLYPFVHLSIDGNLFIFANNRAILLDYSKNTVVRTYPKMPSGEPRNYPSSG  264

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFM  997
             S+VLLPLK   +P   AEVLICGGAP G++  A ++  F+ AL++CGRI+ITD  P W M
Sbjct  265   SSVLLPLK--PSP-TEAEVLICGGAPAGSYSQALQKKRFLRALDSCGRIKITDAAPSWNM  321

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             E MP+ R+MGDMV LP+G++L+INGAA G+AG+  G +PV TPV+Y  D   G RF++ +
Sbjct  322   EAMPVPRVMGDMVLLPDGDVLLINGAAAGTAGWELGHDPVLTPVVYRPDGAAGARFDVQS  381

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
              S  PR+YHSTA+LLRD RVLVGGSNPH  Y F +G  +PTEL +EAFSP YL++  + +
Sbjct  382   GSTTPRLYHSTAVLLRDGRVLVGGSNPHVKYNF-SGVEYPTELSMEAFSPSYLNSENSRL  440

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I  P S  +  YG    +QF+  G V    + VTMVAPSF THSFS +QRLL L   
Sbjct  441   RPQILTPPSPIQLTYGGRFSLQFS-VGVVSEGGIRVTMVAPSFATHSFSMNQRLLVLETE  499

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             G +  V        AV P S  L+P GYYM++VV+ G+PSEGIW  +
Sbjct  500   GGMSEV-------VAVAPASAILAPPGYYMVYVVNGGVPSEGIWAHI  539



>gb|KHG09161.1| galactose oxidase [Gossypium arboreum]
Length=457

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/506 (59%), Positives = 358/506 (71%), Gaps = 50/506 (10%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLL ND+VV++DRTDFG S +PL  G+C  DP    V+VDCTAHSVEYDV  N  R 
Sbjct  1     MHMQLLKNDRVVMYDRTDFGPSTLPLASGKCHNDPTNTAVQVDCTAHSVEYDVLSNKFRA  60

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYA  520
             L VQ++VWCSS  VMPDG L+QTGG+++G+  VRVF+PC  + CDW E PN L   RWYA
Sbjct  61    LTVQSNVWCSSGGVMPDGKLVQTGGFSEGELRVRVFSPC--ESCDWHETPNGLAAKRWYA  118

Query  521   TNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVD  700
             TNH+LPDGRQI++GGRE+FNYEF PK    D  + L FL+ETN+ G ENNLYP+VFLNVD
Sbjct  119   TNHVLPDGRQIVVGGREQFNYEFVPKNIAADT-FKLHFLSETNERGVENNLYPFVFLNVD  177

Query  701   GHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVL  880
             G+LFIFANN+AIL DY+ + VV+ YP +P G+PRSYPSTGSAVLLPLKNL A  I AEVL
Sbjct  178   GNLFIFANNRAILLDYVNNKVVKTYPKIPGGEPRSYPSTGSAVLLPLKNLTAATIQAEVL  237

Query  881   ICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNIL  1060
             +CGGAPKG+F  + +G F+ ALNTC RI ITDP P W +ETMP+AR+MGDMV LPNG +L
Sbjct  238   VCGGAPKGSFVQALQGKFVKALNTCARISITDPKPKWVLETMPLARVMGDMVLLPNGKVL  297

Query  1061  IINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVL  1240
             +INGA  GSAG+  GR+PV  PVLY  DN + +RF+ILNP+ IPRMYHSTA+LLRD RVL
Sbjct  298   VINGARSGSAGWDLGRDPVLNPVLYMPDNEIESRFKILNPTKIPRMYHSTAVLLRDGRVL  357

Query  1241  VGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEI  1420
             VGGSNPH  Y F  G L+PTEL LEAF P YLDA    +RP                   
Sbjct  358   VGGSNPHAYYNF-TGVLYPTELSLEAFYPGYLDAKFNNLRP-------------------  397

Query  1421  QFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSG  1600
                            T+VAP           +LL L G   V   G +TY +  +TPGSG
Sbjct  398   ---------------TIVAP-----------KLLVL-GNDKVMASGKSTYEIEVMTPGSG  430

Query  1601  NLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             NL+PAG+Y+LFVVH+ IPS+GIW+ +
Sbjct  431   NLAPAGFYLLFVVHQDIPSQGIWVHL  456



>emb|CDP08591.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/526 (56%), Positives = 373/526 (71%), Gaps = 9/526 (2%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A A  G W LL   IGI+AMHMQLL+N++V++FDRTDFG SNI L GGRCR+DP++V +K
Sbjct  32    ATAIQGEWRLLQECIGISAMHMQLLHNNRVIMFDRTDFGNSNISLPGGRCRRDPHDVALK  91

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHSV YD+  N  RPLMVQTD WCSS AV+ DGTL+QTGG+NDGDH VR F+PC  
Sbjct  92    TDCTAHSVLYDIGTNNFRPLMVQTDTWCSSGAVLEDGTLVQTGGYNDGDHAVRKFSPCGG  151

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
             + CDWVE PNAL R RWYATN ILPDGR II+GGR +FNYEFY +     + Y+L FL E
Sbjct  152   EDCDWVEFPNALMRRRWYATNQILPDGRIIIVGGRGQFNYEFYSQP--ATVSYDLEFLKE  209

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T D G ENNLYP++ L  DG+LFIFAN ++IL+DY +  VVR +P +P    R+YPS+GS
Sbjct  210   TKDEG-ENNLYPFLHLLPDGNLFIFANTRSILFDYRQSKVVREFPQIPGDASRNYPSSGS  268

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             +VLLP+ N   P I AE+++CGGAP GAF ++ +G F+ A +TCGR+++TD NP W MET
Sbjct  269   SVLLPI-NENGP-IEAEIMVCGGAPHGAFTSARQGYFIRASSTCGRLKVTDQNPAWEMET  326

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MPMAR+MGDM+ LP G+++IINGA+ G+AG+ + RNPV  PV+Y        RF ++  +
Sbjct  327   MPMARVMGDMLLLPTGDVIIINGASSGTAGWENARNPVTRPVIYKPRAMQHNRFSVMETA  386

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
               PRMYHS+A LL D RVLVGGSNPH  Y F  G  FPT+L LEAFSPPYL      +RP
Sbjct  387   QRPRMYHSSATLLIDGRVLVGGSNPHVYYKF-TGVQFPTDLSLEAFSPPYLAQLHDPVRP  445

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I   G      Y +   + F+    +    ++V ++APSFTTHSFS +QR+L L     
Sbjct  446   RIV--GMAENITYQRKFSVTFSVNNFLKVASLSVRIIAPSFTTHSFSMNQRMLILKFVEA  503

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             V  V  +TY +TA+ P S  ++P GYYMLFVVH+ IPS G+W+ +V
Sbjct  504   VN-VASSTYRITAIGPSSPEIAPKGYYMLFVVHEDIPSTGMWVNVV  548



>ref|XP_009606830.1| PREDICTED: galactose oxidase [Nicotiana tomentosiformis]
Length=556

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/552 (53%), Positives = 381/552 (69%), Gaps = 9/552 (2%)
 Frame = +2

Query  32    TLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRT  211
             T++F L   F+   P   S+ + + +   G W LL  +IG++AMHMQLL N+KVVIFDRT
Sbjct  5     TIIFLLLLTFISLQPLVASQMLVSRSGIEGEWRLLHESIGVSAMHMQLLRNNKVVIFDRT  64

Query  212   DFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPD  391
             DFG SN+ L GGRCR D +++V++ DC+AHSV YDV  NT RPLMVQTD WCSS AV+PD
Sbjct  65    DFGRSNLSLPGGRCRYDSHDLVIREDCSAHSVLYDVGSNTFRPLMVQTDTWCSSGAVLPD  124

Query  392   GTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             GTL+QTGG+NDGDH++R   PC  + CDWVE P  L + RWY+T+HILPD R I+IGGR 
Sbjct  125   GTLVQTGGYNDGDHIIRTLAPCTGENCDWVEFPRTLIQRRWYSTDHILPDARIIVIGGRN  184

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             + NYEFYPK P     + L FL++T D   ENNLYP+VFL  DG+LFIFAN +AI+ DY 
Sbjct  185   QHNYEFYPKNPSSFSAFWLQFLSDTRDGDNENNLYPFVFLLPDGNLFIFANTRAIILDYK  244

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
             K+ VVR  P++P  +PR+YPSTGSAVLLPL   +   + AE+++CGGAP+ AF  ++ GV
Sbjct  245   KNEVVRELPSIPGNEPRNYPSTGSAVLLPLD--ENSPMQAEIMVCGGAPRRAFGLTDYGV  302

Query  932   FMGALNTCGRIRITDP---NPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGD  1102
             +M AL++CGRI I+D    +  W ME MP  R+M DM+ LPNG+I++INGAA+G+AG+ +
Sbjct  303   YMTALSSCGRITISDDHVNDGSWKMEQMPTPRVMSDMLILPNGDIILINGAARGTAGWEN  362

Query  1103  GRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGN  1282
              RNPV  PV+Y  +     RF ++  S  PR+YHSTAILL D RVLVGGSNPH  Y F  
Sbjct  363   ARNPVTRPVIYRPNRAENNRFSVMEASLKPRLYHSTAILLTDGRVLVGGSNPHKFYNF-T  421

Query  1283  GALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVT  1462
             G  FPT+L LEAFSPPYL    A ++P  T+        Y +   + FT    +   +V 
Sbjct  422   GVEFPTDLSLEAFSPPYLAPEYAPLKP--TVLSIDEILIYKQPFSVTFTVPKFLKMGIVL  479

Query  1463  VTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVH  1642
             V +VAPSFTTHSFS +QR++ L     V  V  NTY  TA  P +  ++P GYYMLFVVH
Sbjct  480   VRIVAPSFTTHSFSMNQRMVVLKSIA-VSTVTDNTYRFTAFGPSTKEIAPPGYYMLFVVH  538

Query  1643  KGIPSEGIWIQM  1678
              GIPS G+W+Q+
Sbjct  539   AGIPSSGVWVQI  550



>ref|XP_010256224.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=554

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/551 (53%), Positives = 384/551 (70%), Gaps = 10/551 (2%)
 Frame = +2

Query  38    LFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDF  217
              F +   F+V       RNM ++     +W LL  NIG++AMHMQLL+N+KVV+FDRTDF
Sbjct  9     FFVVSCWFIVILSRVRCRNMSSSEYTDQQWRLLHTNIGLSAMHMQLLHNNKVVMFDRTDF  68

Query  218   GLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGT  397
             G SN+ L  GRCR DP +  +K+DCTAHS+ YDVA NT+RPLMVQTD WCSS A++PDGT
Sbjct  69    GPSNLSLPPGRCRFDPNDTALKIDCTAHSLLYDVATNTIRPLMVQTDTWCSSGALLPDGT  128

Query  398   LIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEF  577
             L+QTGG+NDGD  +R   PCN+ +CDW+E P  L   RWYATN ILPDGR II+GGR EF
Sbjct  129   LLQTGGYNDGDRAIRQLTPCNNDECDWIESPGYLSAKRWYATNQILPDGRVIILGGRREF  188

Query  578   NYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKH  757
             +YEFYP+    +  + L FL ET D   ENNLYP++ L  DG+LFIFAN ++I +DY+ +
Sbjct  189   SYEFYPRGSSSNSFW-LNFLRETRD-NDENNLYPFLHLLPDGNLFIFANTRSISFDYVHN  246

Query  758   AVVRLYPAMPDGQPRSYPSTGSAVLLPLKNL---QAPGIVAEVLICGGAPKGAFPASERG  928
              VVR +P +  G+PR+YPS+GS+VLLPL+     +  G  AEVLICGGAP G+F  + RG
Sbjct  247   RVVREFPPITGGEPRNYPSSGSSVLLPLQLFDENRGTGTPAEVLICGGAPAGSFSQAGRG  306

Query  929   VFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGR  1108
              F+ A +TCGR+++TD +P W ME MPMAR+MGDM+ LP G+++IINGA  G+AG+ + R
Sbjct  307   RFIRACSTCGRLKVTDHDPKWIMEEMPMARVMGDMLLLPTGDVIIINGACYGTAGWENAR  366

Query  1109  NPVQTPVLYHT-DNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNG  1285
             +PV  PV+Y T ++    RF ++ PS  PR+YHSTA+LL D R+LVGGSNPHP Y F  G
Sbjct  367   DPVTKPVIYRTYESANNQRFSVMQPSPTPRLYHSTAVLLPDGRILVGGSNPHPIYRF-TG  425

Query  1286  ALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTV  1465
             A +PT+L LE+FSPPYL    A  RP I   G   K  YG+++ + FT         ++V
Sbjct  426   AEYPTDLSLESFSPPYLAREHAETRPTIVATGEVLK--YGELLTVDFTVQEYQSATALSV  483

Query  1466  TMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHK  1645
             T+VAPSFTTHS + +QRL+ L     V  +  + Y + A  P S  ++P+GYY+LFVVH 
Sbjct  484   TIVAPSFTTHSVAMNQRLVVLRVAD-VSHISAHRYQLKAHGPPSATIAPSGYYLLFVVHA  542

Query  1646  GIPSEGIWIQM  1678
             GIPS  +W+++
Sbjct  543   GIPSSAVWVKI  553



>gb|EYU38846.1| hypothetical protein MIMGU_mgv1a027114mg [Erythranthe guttata]
Length=479

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/512 (58%), Positives = 358/512 (70%), Gaps = 40/512 (8%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLL+ D V++FDRTDFGLSNI L  G C ++P   ++ VDCTAHSV+YDV  N++RP
Sbjct  1     MHMQLLHTDHVIMFDRTDFGLSNISLPNGNCIKNPRSKILPVDCTAHSVDYDVVSNSIRP  60

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK-----CDWVEIPNALHR  505
             L V TDVWCSS AV PDGTL+QTGG++ GD VVR++ PC         CDW E+   L  
Sbjct  61    LTVLTDVWCSSGAVTPDGTLVQTGGFDSGDRVVRLYKPCRSSSNTTTACDWQEVGRGLTV  120

Query  506   WRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYV  685
              RWYATNHILPDGRQI+                             TND   ENNLYP+V
Sbjct  121   RRWYATNHILPDGRQIV-----------------------------TNDAKIENNLYPFV  151

Query  686   FLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGI  865
             FLN DG+LFIFANN+AIL++Y   +V+R YP +P G PRSYPSTGSAVLLPLK   A   
Sbjct  152   FLNGDGNLFIFANNRAILFNYFTGSVIRTYPTIPGGDPRSYPSTGSAVLLPLKPNAAG--  209

Query  866   VAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLP  1045
              AEVL+CGGAPKGAF  +    F+ AL+TCGRIRI DPNP W METMP  R+MGDMV LP
Sbjct  210   -AEVLLCGGAPKGAFIRANNHDFVPALDTCGRIRIDDPNPQWVMETMPAGRVMGDMVLLP  268

Query  1046  NGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLR  1225
             NG++LI+NGA  G+AG+  G +P  +PV+Y  DNP+G+RF   NPS  PRMYHSTAILLR
Sbjct  269   NGDVLIVNGAGSGTAGWEFGADPALSPVIYRPDNPIGSRFATQNPSSTPRMYHSTAILLR  328

Query  1226  DSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYG  1405
             D RVLVGGSNPH  Y F  G L+PT+L LE+FSP YLD     ++P +  PG  +K GYG
Sbjct  329   DGRVLVGGSNPHKFYNF-TGVLYPTDLTLESFSPSYLDPKFGYLKPRVVSPGPQTKIGYG  387

Query  1406  KVIEIQFTA-AGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTA  1582
             + + I+FT   G ++   V VTMVAPSFTTHSFS +QRLL L     +KPVG +TY +  
Sbjct  388   QKLPIRFTIPPGRLNSTSVMVTMVAPSFTTHSFSMNQRLLVL-TRADLKPVGKSTYQIRV  446

Query  1583  VTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              TPGSGNL+P GYYMLFVVH+ IPSEG+WIQ+
Sbjct  447   DTPGSGNLAPPGYYMLFVVHQDIPSEGVWIQI  478



>ref|XP_009801814.1| PREDICTED: galactose oxidase [Nicotiana sylvestris]
Length=560

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/558 (52%), Positives = 381/558 (68%), Gaps = 13/558 (2%)
 Frame = +2

Query  26    NFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFD  205
             N T++F L  +F+       S+ + + +   G W LL  +IG++AMHMQLL N+KVVIFD
Sbjct  3     NETIIFLLLVMFISLQSLVASQMLVSRSGIQGEWRLLHESIGVSAMHMQLLRNNKVVIFD  62

Query  206   RTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVM  385
             RTDFG SN+ L GGRCR D +++V+  DC+AHSV YDV  NT RPLMVQTD WCSS AV+
Sbjct  63    RTDFGRSNLSLPGGRCRYDSHDLVISEDCSAHSVLYDVGSNTFRPLMVQTDTWCSSGAVL  122

Query  386   PDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGG  565
             PDGTL+QTGG+NDGDH++R   PC  K CDWVE+P  L + RWY+T+HILPD R I+IGG
Sbjct  123   PDGTLVQTGGYNDGDHIIRTLAPCTGKNCDWVELPRTLIQRRWYSTDHILPDARIIVIGG  182

Query  566   REEFNYEFYPKT----PGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKA  733
             R + NYEFYPK     P     + L FL++T D   ENNLYP+VFL  DG+LFIFAN + 
Sbjct  183   RNQHNYEFYPKNSRDDPSSFSAFWLQFLSDTRDGDNENNLYPFVFLLPDGNLFIFANTRT  242

Query  734   ILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFP  913
             I+ DY KH VVR  P++P  +PR+YPSTGSAVLLPL   +   + AE+++CGGAP+ AF 
Sbjct  243   IILDYKKHEVVRELPSIPGNEPRNYPSTGSAVLLPLDENRP--MQAEIMVCGGAPRRAFG  300

Query  914   ASERGVFMGALNTCGRIRITD---PNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQG  1084
              ++ GV+M AL++CGRI I+D    +  W ME MP  R+M DM+ LP+G+I++INGAA+G
Sbjct  301   LTDYGVYMTALSSCGRITISDDHVSDSSWKMEQMPTPRVMSDMLILPSGDIILINGAARG  360

Query  1085  SAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHP  1264
             +AG+ + RNPV  P++Y  +     RF ++  S  PR+YHSTAILL D RVLVGGSNPH 
Sbjct  361   TAGWENARNPVTRPMIYRPNRAENNRFSVMEASTRPRLYHSTAILLTDGRVLVGGSNPHK  420

Query  1265  NYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPV  1444
              Y F  G  FPT+L LE+FSPPYL    A ++P  T+        Y +   + FT    +
Sbjct  421   FYNF-TGVDFPTDLSLESFSPPYLAPEYAPLKP--TVLSIDDILMYKQPFSVTFTVPKFL  477

Query  1445  DGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYY  1624
                +V+V +VAPSFTTHSFS +QR++ L     +  V  NTY   A  P +  ++P GYY
Sbjct  478   KMGIVSVRIVAPSFTTHSFSMNQRMVVLKRVA-ISTVSDNTYRFIAFGPSTKEIAPPGYY  536

Query  1625  MLFVVHKGIPSEGIWIQM  1678
             MLFVVH GIPS G+W+++
Sbjct  537   MLFVVHAGIPSSGVWVKI  554



>ref|XP_003553749.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=552

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/547 (52%), Positives = 388/547 (71%), Gaps = 12/547 (2%)
 Frame = +2

Query  59    FLVAAPPPW--SRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNI  232
             F++A+  P+  ++ + +  A  G+W L+ P++GI+AMHMQLL+NDK+++FDRTDFG S +
Sbjct  12    FILASLFPYFEAQTLSSTFANQGQWNLVQPSVGISAMHMQLLHNDKIIMFDRTDFGHSYL  71

Query  233   PLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTG  412
             PL  GRCR DP ++ +KVDC+AHSV YDV  NT+RPLM+QTD WCSS +V+P+GTLIQTG
Sbjct  72    PLSNGRCRMDPNDIALKVDCSAHSVLYDVPTNTLRPLMIQTDTWCSSGSVLPNGTLIQTG  131

Query  413   GWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFY  592
             G+NDG+  +R+F PC D+ CDWVE P  L + RWYATN ILPD R I++GGR +FNYEF 
Sbjct  132   GYNDGERSIRMFTPCFDETCDWVEFPGLLSQRRWYATNQILPDARVIVVGGRRQFNYEFL  191

Query  593   ---PKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAV  763
                P          L FL +T+D  +ENNLYP+V L  DG+LFIFAN K++L+DY +++V
Sbjct  192   PKTPSPNSSPSSIPLNFLQQTSD-RSENNLYPFVHLLPDGNLFIFANTKSVLFDYKQNSV  250

Query  764   VRLYPAMPDGQPRSYPSTGSAVLLPL-KNLQAPGIVAEVLICGGAPKGAFPASERGVFMG  940
             ++ +P +P G PR+YPS+GS+VLLPL +NL +  + AEV++CGGAP+G+F ++ RG F+ 
Sbjct  251   IKEFPPIPGGDPRNYPSSGSSVLLPLDENLAS--LEAEVVVCGGAPRGSFESAARGNFVQ  308

Query  941   ALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQ  1120
             AL TCGRI++TDPNP W ME MPM R MGDM+ LPNG+++I NG   G+AG+  G +PV 
Sbjct  309   ALGTCGRIKVTDPNPNWVMENMPMPRAMGDMLLLPNGDVVITNGVGAGTAGWEHGHDPVL  368

Query  1121  TPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPT  1300
             TPVL+     V  RF ++ P+  PR+YHS+A+LLRD RVLVGGSNPH  Y F  G  +PT
Sbjct  369   TPVLFRPSETVN-RFSVMAPASRPRLYHSSAVLLRDGRVLVGGSNPHVFYNF-TGVEYPT  426

Query  1301  ELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAP  1480
             +L LEAFSPPYL      +RP I    +++  GY     + FT       + V+V +VAP
Sbjct  427   DLSLEAFSPPYLALDFDPVRPTIRYITNNNVLGYRVFCYVTFTVPNFASASEVSVKIVAP  486

Query  1481  SFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSE  1660
             SFTTHSF Q+QR++ L   G     G   Y+ T V P +  ++P GYY+LFVVHKG+PS 
Sbjct  487   SFTTHSFGQNQRMVVLKLSGVTYLAG-EAYYATVVGPSTAEIAPPGYYLLFVVHKGVPSS  545

Query  1661  GIWIQMV  1681
             G W+Q++
Sbjct  546   GSWVQVM  552



>ref|XP_010416451.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=516

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/525 (55%), Positives = 363/525 (69%), Gaps = 39/525 (7%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
              +  GG W+LLLPN+GI+AMH QLL+ND+V+++DRT+FG SNI L  G CRQ P + + K
Sbjct  30    TSGAGGTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGACRQSPNDAISK  89

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DCTAHSVEY+VA N++RPL VQ++ WCSS  V PDGTL+QTGG  DG+   R+F PC+D
Sbjct  90    TDCTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGELKTRLFAPCDD  149

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
               CDW E+ N L   RWYA+NH+LPDGRQIIIGGR++FNYEF+PKT   +L Y LPFL +
Sbjct  150   DSCDWTEVDNGLAAARWYASNHVLPDGRQIIIGGRDQFNYEFFPKTNAPNL-YALPFLTQ  208

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T DPG ENNLYPYVFLN DG+LFIFANN+AIL +Y  + VV+ YP +P G PRSYPSTGS
Sbjct  209   TTDPGQENNLYPYVFLNTDGNLFIFANNRAILLNYATNTVVKTYPEIPGGDPRSYPSTGS  268

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             AVLLP+KNL     V EVL+CGGAPK                               +E 
Sbjct  269   AVLLPIKNL-----VLEVLVCGGAPK-------------------------------VEK  292

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP AR+MGDM  LP+G++L+ING + G+A +  GR PV  P +Y+ D PVG+RFE  N +
Sbjct  293   MPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPVFNPDIYYPDRPVGSRFEPQNAN  352

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHSTA LLRD RV+VGGSNPH  Y F  G LFPTEL LEAFSP YL++  + +RP
Sbjct  353   AIPRMYHSTATLLRDGRVIVGGSNPHAYYNF-TGVLFPTELSLEAFSPSYLESKYSSLRP  411

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
              I  P   +   YG+++ ++FT  G +    V VTMV PSF THSFS  QRLL L     
Sbjct  412   VIMDPMPQTTINYGQILRLRFTVQGRMK-TPVKVTMVYPSFNTHSFSMSQRLLVLDHVLF  470

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             ++      Y ++  TP S NL+P GYYM+FVV++ IPSEG+W+++
Sbjct  471   LRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQNIPSEGVWVRL  515



>emb|CDY43432.1| BnaC07g14990D [Brassica napus]
Length=472

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/474 (60%), Positives = 346/474 (73%), Gaps = 12/474 (3%)
 Frame = +2

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             +DCTAHS+EYDVA N  RPL VQ++ WCSS +V PDG L+QTGG  DG    R F+PC+D
Sbjct  1     MDCTAHSIEYDVASNKFRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGALKARTFSPCDD  60

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAE  643
              +CDWVEI N L + RWY++NHILPDG+QI+IGGR +FNYEF+PKT   +++  LPFLAE
Sbjct  61    NQCDWVEINNGLAKRRWYSSNHILPDGKQIVIGGRGQFNYEFFPKTTSPNVIA-LPFLAE  119

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T+D G ENNLYPYVFLN DG LFIFANN+AIL DY+K+ VV+ YPA+P G PRSYPSTGS
Sbjct  120   TSDKGEENNLYPYVFLNTDGRLFIFANNRAILLDYVKNTVVKTYPAIPGGDPRSYPSTGS  179

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFME  1000
             AVLLPLKNL+A  I AEVL+CGGAPKG+F  AS +  F+ AL+TC RI+I D +P W +E
Sbjct  180   AVLLPLKNLEADKIDAEVLVCGGAPKGSFILASRKRTFVKALDTCARIKINDEDPQWTVE  239

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MP AR+MGDM  LPNG++L+ING + GSA +  GR PV  P LYH +N V +RFE LNP
Sbjct  240   KMPRARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVLVPDLYHPENSVNSRFESLNP  299

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             + IPRMYHSTAILLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL+   A +R
Sbjct  300   NTIPRMYHSTAILLRDGRVLVGGSNPHAFYNF-TGVLFPTELSLEAFSPAYLEPEFAKLR  358

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I  P S S   YG  ++++F  AG V G  V VTMV PSFT+HSFS +QRLL L    
Sbjct  359   PKIKSPKSQSTITYGMNLKVKFEVAGKVKGP-VKVTMVFPSFTSHSFSMNQRLLVLDNVR  417

Query  1541  TVKPVGI--------NTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               +   +          Y +   TP S  ++P GYYM+FVV++ IPSEGIW+++
Sbjct  418   VERTSSVFGALFGKSRNYEIQVRTPRSAIIAPPGYYMMFVVNQNIPSEGIWVRL  471



>gb|EAY89314.1| hypothetical protein OsI_10817 [Oryza sativa Indica Group]
Length=563

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/540 (55%), Positives = 367/540 (68%), Gaps = 20/540 (4%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A+  GGRW++L  +IG++AMHMQLL+ND+V+IFDRTDFGLSN+ L  GRCR++P E VV 
Sbjct  28    ASGAGGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFGLSNLSLPDGRCRRNPRERVVP  87

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-  460
             +DCTAHS EYDVA NT RPL V TD WCSS  V PDGTL+QTGGWNDG   VR    C  
Sbjct  88    MDCTAHSAEYDVASNTFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNVRTMAACEA  147

Query  461   -DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNLPF  634
              D  CDW E  +AL   RWYATN ILPDGR  I+GGR +F YEFYP     G    +LPF
Sbjct  148   GDDTCDWDETQDALAANRWYATNQILPDGRAFIVGGRRQFTYEFYPTADSSGASAISLPF  207

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L +T DP  ENNLYP+V LN+DG+LFIFA N+AIL+DY K+ VVR YP +  G PR+YPS
Sbjct  208   LVQTKDP-EENNLYPFVHLNIDGNLFIFAKNRAILFDYKKNKVVRTYPELAGGDPRNYPS  266

Query  815   TGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWF  994
             +GS+VLLPLK   +P   AEVL+CGGAP G++ +++ G F  AL TCGRI+ITD  P W 
Sbjct  267   SGSSVLLPLK--PSP-TEAEVLVCGGAPAGSYTSTKDGTFSSALVTCGRIKITDTAPAWV  323

Query  995   METMPMARLMGDMVTLPNG-NILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
             +ETMP  R+MGDM+ LPNG  ++IINGA  G+AG+   + P   PV+Y  D+  G RFE 
Sbjct  324   IETMPSPRVMGDMILLPNGAEVVIINGAMDGTAGWESAKTPAYAPVIYRPDHSPGDRFEE  383

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
              + + I R+YHS+A+LLRD R+LVGGSNPH  Y F N   +PTEL LEA+SP YLD +  
Sbjct  384   QSSTDIARLYHSSAVLLRDGRLLVGGSNPHIYYNFSN-VQYPTELSLEAYSPEYLDPSND  442

Query  1352  GIRPHITLP---GSHSKFGYGKVIEIQFTAAGPVDG--------NLVTVTMVAPSFTTHS  1498
              +RP I  P   G+     YG  + +QF                 LV+VTMVAPSFTTHS
Sbjct  443   ALRPTIVDPSPNGAAVSVTYGASLTLQFAVPAARRARGGGGGGIGLVSVTMVAPSFTTHS  502

Query  1499  FSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             F+ +QRLL L    T      +TY  + V P +  L+P GYYM+FVV+  IPSEGIW+ +
Sbjct  503   FAMNQRLLLLDAVKTAALARASTYQTSVVMPATAALAPPGYYMVFVVNGHIPSEGIWVHI  562



>ref|NP_001049609.1| Os03g0258900 [Oryza sativa Japonica Group]
 gb|ABF95066.1| glyoxal oxidase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11523.1| Os03g0258900 [Oryza sativa Japonica Group]
 gb|EAZ26322.1| hypothetical protein OsJ_10202 [Oryza sativa Japonica Group]
 dbj|BAH00424.1| unnamed protein product [Oryza sativa Japonica Group]
Length=564

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/542 (55%), Positives = 370/542 (68%), Gaps = 23/542 (4%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A+  GGRW++L  +IG++AMHMQLL+ND+V+IFDRTDFGLSN+ L  GRCR++P E VV 
Sbjct  28    ASGAGGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFGLSNLSLPDGRCRRNPRERVVP  87

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-  460
             +DCTAHS EYDVA NT RPL V TD WCSS  V PDGTL+QTGGWNDG   VR    C  
Sbjct  88    MDCTAHSAEYDVASNTFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNVRTMAACEA  147

Query  461   -DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYP--KTPGGDLLYNLP  631
              D  CDW E  +AL   RWYATN ILPDGR  I+GGR +F YEFYP   + GG  + +LP
Sbjct  148   GDDTCDWDETQDALAANRWYATNQILPDGRAFIVGGRRQFTYEFYPTADSSGGSAI-SLP  206

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL +T DP  ENNLYP+V LN+DG+LFIFA N+AIL+DY K+ VVR YP +  G PR+YP
Sbjct  207   FLVQTKDP-EENNLYPFVHLNIDGNLFIFAKNRAILFDYKKNKVVRTYPELAGGDPRNYP  265

Query  812   STGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVW  991
             S+GS+VLLPLK   +P   AEVL+CGGAP G++ +++ G F  AL TCGRI+ITD  P W
Sbjct  266   SSGSSVLLPLK--PSP-TEAEVLVCGGAPAGSYTSTKDGTFSSALVTCGRIKITDTAPAW  322

Query  992   FMETMPMARLMGDMVTLPNG-NILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFE  1168
              +ETMP  R+MGDM+ LPNG  ++IINGA  G+AG+   + P   PV+Y  D+  G RFE
Sbjct  323   VIETMPSPRVMGDMILLPNGAEVVIINGAMDGTAGWESAKTPAYAPVIYRPDHSPGDRFE  382

Query  1169  ILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAAT  1348
               + + I R+YHS+A+LLRD R+LVGGSNPH  Y F N   +PTEL LEA+SP YLD + 
Sbjct  383   EQSSTDIARLYHSSAVLLRDGRLLVGGSNPHIYYNFSN-VQYPTELSLEAYSPEYLDPSN  441

Query  1349  AGIRPHITLP---GSHSKFGYGKVIEIQFTAAGPVDG---------NLVTVTMVAPSFTT  1492
               +RP I  P   G+     YG  + +QF                  LV+VTMVAPSFTT
Sbjct  442   DALRPTIVDPSPNGAAVSVTYGASLTLQFAVPAARRARGGGGGGGIGLVSVTMVAPSFTT  501

Query  1493  HSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWI  1672
             HSF+ +QRLL L    T      +TY  + V P +  L+P GYYM+FVV+  IPSEGIW+
Sbjct  502   HSFAMNQRLLLLDAVKTAALARASTYQTSVVMPATAALAPPGYYMVFVVNGHIPSEGIWV  561

Query  1673  QM  1678
              +
Sbjct  562   HI  563



>ref|XP_004494672.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=559

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/563 (52%), Positives = 389/563 (69%), Gaps = 17/563 (3%)
 Frame = +2

Query  26    NFTLLFALWQLFLVAAP----PPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKV  193
             + TL   L  L  +  P    P  S ++ +  +  G+W LL P IGI+AMHMQL +NDK+
Sbjct  3     SITLFLILITLSSLIIPYFHLPLASSSLISPPSNQGQWNLLQPTIGISAMHMQLTHNDKI  62

Query  194   VIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSS  373
             +IFDRTDFG SN+PL  G CR DPY+  +K DCTAHSV YD+  NT R L +QTD WCSS
Sbjct  63    IIFDRTDFGPSNLPLSNGECRMDPYDTALKTDCTAHSVLYDIYTNTFRSLTIQTDTWCSS  122

Query  374   AAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQI  553
              +V+P+GTLIQTGG+NDG+  +R+F PC  + CDW+E P+ L   RWYATN ILPD R I
Sbjct  123   GSVLPNGTLIQTGGFNDGERRIRMFTPCFHENCDWIEFPSYLIERRWYATNQILPDNRVI  182

Query  554   IIGGREEFNYEFYPKT----PGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFA  721
             IIGGR++FNYEF+PKT           +LPFL ETNDP  ENNLYP+V L  +G+LFIFA
Sbjct  183   IIGGRKQFNYEFFPKTITSSESSPSSIHLPFLQETNDPN-ENNLYPFVHLLPNGNLFIFA  241

Query  722   NNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPL-KNLQAPGIVAEVLICGGAP  898
             N ++IL DY ++ VV+ +P +  G PR+YPS+GS+VLLPL +NL +  I AE+++CGGAP
Sbjct  242   NKRSILLDYKQNRVVKEFPEISGGDPRNYPSSGSSVLLPLDENLNS--IEAEIMVCGGAP  299

Query  899   KGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAA  1078
             +GAF  + +G F+ ALNTCG +++TD NP W M+ MP+AR+MGDM+ LPNG+I+IING  
Sbjct  300   RGAFEEASKGNFIQALNTCGFLKVTDSNPNWIMKNMPIARVMGDMLILPNGDIIIINGVE  359

Query  1079  QGSAGYGDGRNPVQTPVLYHTDNPV--GTRFEILNPSGIPRMYHSTAILLRDSRVLVGGS  1252
              G+AG+ +GR PV TPV+Y +   V    RF I+  +  PR+YHS+A++LRD RVLVGGS
Sbjct  360   LGTAGWENGRRPVLTPVIYRSSVTVTESQRFSIMQRASRPRLYHSSAVVLRDGRVLVGGS  419

Query  1253  NPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTA  1432
             NPH NY F +G  FPT+L LEAFSPPYL      +RP I    S+   GY     + FT 
Sbjct  420   NPHVNYNF-SGVEFPTDLSLEAFSPPYLSPEFDPVRPIIRHVTSY-ILGYRVFYYVTFTV  477

Query  1433  AGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSP  1612
                   + V+V ++APSF+THS+  +QR++ L   G V  V   TY+ T V P +  ++P
Sbjct  478   GKFGSASDVSVRILAPSFSTHSYGMNQRMVVLKLIG-VTEVNFGTYYATVVGPSTQEIAP  536

Query  1613  AGYYMLFVVHKGIPSEGIWIQMV  1681
              GYY+LF+VH+G+PS G W+Q++
Sbjct  537   PGYYILFLVHEGVPSSGTWVQLM  559



>ref|XP_007147126.1| hypothetical protein PHAVU_006G098100g [Phaseolus vulgaris]
 gb|ESW19120.1| hypothetical protein PHAVU_006G098100g [Phaseolus vulgaris]
Length=552

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/527 (53%), Positives = 379/527 (72%), Gaps = 8/527 (2%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A  G+W+LL P+IGI+ MHMQLL+NDKV++FDRTDFG S +PL  GRCR DP+++ +K+D
Sbjct  31    ANQGQWQLLHPSIGISPMHMQLLHNDKVIMFDRTDFGHSYLPLSNGRCRMDPFDIALKLD  90

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             C+AHS  YDVA NT+RPLM+QTD WCSS AV+P+GTLIQTGG+NDG+  +R+F PC D+ 
Sbjct  91    CSAHSALYDVATNTLRPLMIQTDTWCSSGAVLPNGTLIQTGGYNDGERNIRMFTPCFDET  150

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYN---LPFLA  640
             CDWVE P  L + RWYATN ILPD R I++GGR +FNYEF PKT   +   +   L FL 
Sbjct  151   CDWVEFPRLLSQRRWYATNQILPDARVIVVGGRRQFNYEFLPKTANPNSYPSSVPLNFLQ  210

Query  641   ETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTG  820
              T+D  +ENNLYP+V L  DG+LFIFAN K++L+DY  ++V++ +P +P   PR+YPS+G
Sbjct  211   RTSD-TSENNLYPFVHLLPDGNLFIFANTKSVLFDYKLNSVIKEFPPIPGEDPRNYPSSG  269

Query  821   SAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             S+VLLPL     P + AEV++CGGAP+G+F ++ RG FM AL +CGR+R+T PNP W ME
Sbjct  270   SSVLLPLDENLVP-LQAEVVVCGGAPRGSFESALRGSFMQALASCGRLRLTHPNPNWVME  328

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
              MPM R MGDM+ LPNG+++IING   G+AG+  GR PV TP+++     V  RF I+ P
Sbjct  329   NMPMPRAMGDMLLLPNGDVVIINGVGAGTAGWEHGREPVLTPLIFRPSETVN-RFSIMAP  387

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             +  PR+YHS+A+LL+D RVLVGGSNPH  Y F  G  +PT+L LEAFSPPYL      +R
Sbjct  388   ASRPRLYHSSAVLLKDGRVLVGGSNPHVFYNF-TGVEYPTDLSLEAFSPPYLAPEFNPVR  446

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
             P I    +++  G+     + F+ +     + V++ ++APSFTTHSF Q+QR++ L   G
Sbjct  447   PTIRYVTNNNVLGFRTFCYVTFSVSDFGSASDVSIRILAPSFTTHSFGQNQRMVVLKLRG  506

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
              V  +G   Y+ T V P +  ++P GYY+LFVVHKG+PS G W+Q++
Sbjct  507   -VTYLGGEAYYATVVGPSTAEIAPPGYYILFVVHKGVPSSGWWVQVM  552



>ref|XP_004304717.1| PREDICTED: uncharacterized protein LOC101300467 [Fragaria vesca 
subsp. vesca]
Length=546

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/549 (51%), Positives = 376/549 (68%), Gaps = 6/549 (1%)
 Frame = +2

Query  32    TLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRT  211
             T  F ++  F +      + +    +   G+W LL  +IGI+AMHMQLL+N+KV++FDRT
Sbjct  3     TFTFTIFNCFFIILRITPTISSQTYSGNQGQWRLLQSSIGISAMHMQLLHNNKVIMFDRT  62

Query  212   DFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPD  391
             DFG SNI L GG+CR+DP +  ++ DCTAHSV YD+ +NT RPL +QTD WCSS AV+PD
Sbjct  63    DFGASNISLPGGKCREDPNDTALQRDCTAHSVLYDIGQNTFRPLTIQTDPWCSSGAVLPD  122

Query  392   GTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGRE  571
             GTL+QTGG+NDGD  +R F+PCND+KCDW E PN L   RWYA+N ILPDGR II+GGR 
Sbjct  123   GTLLQTGGYNDGDRSLRTFSPCNDEKCDWNEEPNYLLTRRWYASNQILPDGRIIIVGGRR  182

Query  572   EFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             ++NYEFYP+      ++ L  L +T D   ENNLYP++ L  DG+LFIFAN KAIL+DY 
Sbjct  183   QYNYEFYPRGSSSSTIW-LEHLRQTRDQRIENNLYPFLHLLPDGNLFIFANTKAILFDYK  241

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGV  931
             ++AVV+  P +P   PR+YPSTGS+VLLPL   Q P + AE+++CGGAP+G+F  +E G 
Sbjct  242   RNAVVKELPEIPGQDPRNYPSTGSSVLLPLDENQ-PFLQAEIVVCGGAPRGSFVLAENGT  300

Query  932   FMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRN  1111
             F   L TCGRI +   NP W ME MP+ R MGDM+ LPNG++LI+NG   G+AG+  GRN
Sbjct  301   FQKTLGTCGRINMNHANPNWVMEDMPVPRAMGDMLILPNGDVLILNGVGLGTAGWELGRN  360

Query  1112  PVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGAL  1291
             PV TPV+Y      G RF ++  S  PR+YHS+A+L+ D RVLVGGSNPH  Y F  G  
Sbjct  361   PVTTPVIYRPSELPGRRFRVMAESNRPRLYHSSAVLVTDGRVLVGGSNPHVGYNF-TGVD  419

Query  1292  FPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTM  1471
             +PT+L LEAFSPPYL      +RP I         GY +   + F     V  ++V+VT+
Sbjct  420   YPTDLSLEAFSPPYLARDYETVRPRIV--SVLENIGYREQFSVAFAVPEYVHSSVVSVTL  477

Query  1472  VAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGI  1651
             VAPSFTTHSF+ +QR++ +   G V+ + ++TY +  + P +  ++P GYY+LFVVH  I
Sbjct  478   VAPSFTTHSFAMNQRMVVM-KLGEVRELSLDTYEVAVMGPSAKEIAPPGYYLLFVVHADI  536

Query  1652  PSEGIWIQM  1678
             PS  +W+++
Sbjct  537   PSSAMWVKL  545



>ref|XP_003626387.1| Galactose oxidase [Medicago truncatula]
 gb|AES82605.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=570

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/530 (53%), Positives = 377/530 (71%), Gaps = 17/530 (3%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G WEL+ P IGI+AMHMQL +N+K++IFDRTDFG SN+PL  GRCR DP++  +K+DCTA
Sbjct  49    GEWELIQPTIGISAMHMQLSHNNKIIIFDRTDFGPSNLPLSNGRCRMDPFDTALKIDCTA  108

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDW  478
             HSV YD+A NT R L VQTD WCSS +V+ +GTL+QTGG+NDG+  +R+F PC ++ CDW
Sbjct  109   HSVLYDIATNTFRSLTVQTDTWCSSGSVLSNGTLVQTGGFNDGERRIRMFTPCFNENCDW  168

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK-----TPGGDLLYNLPFLAE  643
             +E P+ L   RWYATN ILPD R IIIGGR +FNYEF PK     +       +L FL E
Sbjct  169   IEFPSYLSERRWYATNQILPDNRIIIIGGRRQFNYEFIPKTTTSSSSSSSSSIHLSFLQE  228

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             TNDP +ENNLYP+V L  +G+LFIFAN ++IL+DY ++ VV+ +P +P G P +YPS+GS
Sbjct  229   TNDP-SENNLYPFVHLLPNGNLFIFANTRSILFDYKQNVVVKEFPEIPGGDPHNYPSSGS  287

Query  824   AVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             +VLLPL   Q   + A ++ICGGAP+G+F A++   FM AL TCG +++TD NP W +E 
Sbjct  288   SVLLPLDENQI-SMEATIMICGGAPRGSFEAAKGKNFMPALKTCGFLKVTDSNPSWIIEN  346

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYH-TDNPVGTRFEILNP  1180
             MPMAR+MGDM+ LPNG+++IINGA  G+AG+ +GR PV TPV++  ++     RF +++P
Sbjct  347   MPMARVMGDMLILPNGDVIIINGAGSGTAGWENGRQPVLTPVIFRSSETKSDKRFSVMSP  406

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             +  PR+YHS+AI+LRD RVLVGGSNPH NY F  G  FPT+L LEAFSPPYL      +R
Sbjct  407   ASRPRLYHSSAIVLRDGRVLVGGSNPHVNYNF-TGVEFPTDLSLEAFSPPYLSLEFDLVR  465

Query  1361  P---HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
             P   H+T    +   GY     + FT A     + V+V ++APSFTTHSF  +QR++ L 
Sbjct  466   PTIWHVT----NKILGYRVFYYVTFTVAKFASASEVSVRLLAPSFTTHSFGMNQRMVVLK  521

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
               G V  V ++ Y+ T V P +  ++P GYY+LF+VH G+PS G W+Q++
Sbjct  522   LIG-VTMVNLDIYYATVVGPSTQEIAPPGYYLLFLVHAGVPSSGEWVQLM  570



>emb|CDY01390.1| BnaA07g11630D [Brassica napus]
Length=509

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/531 (54%), Positives = 357/531 (67%), Gaps = 57/531 (11%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LLL N+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V K+D
Sbjct  27    AAGGKWDLLLSNVGISAMHMQLLPNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSKID  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS+EY V  NT+RPL VQ++ WCSS ++ PDG L+QTGG  DG+   R F PC+D++
Sbjct  87    CTAHSIEYKVESNTIRPLTVQSNTWCSSGSLRPDGVLVQTGGDRDGELKARTFTPCSDEE  146

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDWVEI N L R RWY++NHILPDG+QIIIGG+ +FNYEF+PKT   +++ +LPFLAETN
Sbjct  147   CDWVEINNGLARRRWYSSNHILPDGKQIIIGGQRQFNYEFFPKTTSPNVI-DLPFLAETN  205

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYPYVFLN DG+LFIFANN+AIL DY+ + VV+ YPA+P G PR+        
Sbjct  206   DRGEENNLYPYVFLNTDGNLFIFANNRAILLDYVNNKVVKTYPAIPGGDPRT--------  257

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
                                                   L+TC RI+I D +P W +E MP
Sbjct  258   --------------------------------------LDTCARIKINDEDPQWTVEKMP  279

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM  LPNG++L+ING + GSA +  GR PV  P LYH +NPV +RFE LNP+ I
Sbjct  280   RARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVFVPDLYHPENPVNSRFESLNPNTI  339

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL+   A  RP I
Sbjct  340   PRMYHSTAILLRDGRVLVGGSNPHGFYNF-TGVLFPTELSLEAFSPAYLEPEFAKFRPKI  398

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
             T P S S   YG  ++++F  +G + G  V VTMV PSFTTHSFS +QRLL L      +
Sbjct  399   TSPKSQSTITYGTNLKVKFKVSGKIKGP-VKVTMVFPSFTTHSFSMNQRLLVLDNVKVKR  457

Query  1550  PVGI--------NTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                +          Y +   TP S  ++P GYYM+FVV++ +PSEGIW+++
Sbjct  458   TSSVFGALFGKSKHYEVQVRTPRSAIIAPPGYYMMFVVNENVPSEGIWVRL  508



>emb|CDY43429.1| BnaC07g14960D [Brassica napus]
Length=509

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/531 (54%), Positives = 358/531 (67%), Gaps = 57/531 (11%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             A GG+W+LLL N+GI+AMHMQLL ND+VV+FDRT+FG SNI L  G CR +P + V K+D
Sbjct  27    AAGGKWDLLLSNVGISAMHMQLLPNDRVVMFDRTNFGPSNISLPNGNCRNNPQDAVSKID  86

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHS+EY+V  NT+RPL VQ++ WCSS ++  DG L+QTGG  DG+   R F+PC+D +
Sbjct  87    CTAHSIEYNVESNTIRPLTVQSNTWCSSGSLRSDGVLVQTGGDRDGELKARTFSPCDDNE  146

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDWVEI N L R RWY++NHILPDG+QIIIGG+ +FNYEF+PKT   +++ +LPFLAETN
Sbjct  147   CDWVEINNGLARRRWYSSNHILPDGKQIIIGGQRQFNYEFFPKTTSPNVI-DLPFLAETN  205

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D G ENNLYPYVFLN DG+LFIFANN+AIL DY+ + VV+ YPA+P G PR+        
Sbjct  206   DRGEENNLYPYVFLNTDGNLFIFANNRAILLDYVNNKVVKTYPAIPGGDPRT--------  257

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
                                                   L+TC RI+I D +P W +E MP
Sbjct  258   --------------------------------------LDTCARIKINDEDPQWTVEKMP  279

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              AR+MGDM  LPNG++L+ING + GSA +  GR PV  P LYH +NPV +RFE LNP+ I
Sbjct  280   RARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVFVPDLYHPENPVNSRFESLNPNTI  339

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHSTAILLRD RVLVGGSNPH  Y F  G LFPTEL LEAFSP YL+   A +RP I
Sbjct  340   PRMYHSTAILLRDGRVLVGGSNPHGFYNF-TGVLFPTELSLEAFSPAYLEPEFAKLRPKI  398

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
             T P S S   YG  ++++F  +G + G  V VTMV PSFTTHSFS +QRLL L      +
Sbjct  399   TSPKSQSTITYGTNLKVKFKVSGKIKGP-VKVTMVFPSFTTHSFSMNQRLLVLDNVKVKR  457

Query  1550  PVGI--------NTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                +          Y +   TP S  ++P GYYM+FVV++ +PSEGIW+++
Sbjct  458   TSSVFGALFGKTKHYEVQVRTPKSAIIAPPGYYMMFVVNENVPSEGIWVRL  508



>ref|XP_007030653.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY11155.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=558

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/534 (52%), Positives = 377/534 (71%), Gaps = 14/534 (3%)
 Frame = +2

Query  107   AAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKV  286
             A   G W+LL  ++GI+AMHMQLL+N+KV+IFDRTDFG SN+ L  G CR DP ++V++ 
Sbjct  28    AGRQGAWQLLHASVGISAMHMQLLHNNKVIIFDRTDFGPSNLSLPSGLCRIDPSDIVLQT  87

Query  287   DCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDK  466
             DCTAHS+ YD++ N  RPLMVQTD WCSS AV+P+GTL+QTGG+NDGD  +R F PC D+
Sbjct  88    DCTAHSILYDISTNAFRPLMVQTDTWCSSGAVLPNGTLVQTGGYNDGDRNIRTFTPCTDE  147

Query  467   KCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGG-------DLLYN  625
              CDW+E P +L + RWYA+N ILPDGR II+GGR +FNYEFYP+   G       D ++ 
Sbjct  148   YCDWIEFPQSLLQRRWYASNQILPDGRIIIVGGRRQFNYEFYPQNIEGKSSSSSTDHIFG  207

Query  626   LPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRS  805
             L FL ETND   ENNLYP++ L  DG+LFIFAN ++IL DY ++ VV+ +P +P G PR+
Sbjct  208   LNFLRETNDYQMENNLYPFLHLLPDGNLFIFANTRSILLDYNQNRVVKEFPQIPGGDPRN  267

Query  806   YPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNP  985
             YPS+GS+VLLPL + Q   I  E+++CGGAPKG+F  + +G F+ A +TCGR++++  NP
Sbjct  268   YPSSGSSVLLPLDD-QNEAIEPEIMVCGGAPKGSFTQATQGNFIRATSTCGRLKVSHANP  326

Query  986   VWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHT-DNPVGTR  1162
              W ME MP+ R+MGDM+ LP+G++LIINGA  G+AG+  GR PV  P++Y T D+    R
Sbjct  327   SWVMEDMPVPRVMGDMILLPSGDVLIINGAEMGTAGWELGRGPVTRPIIYRTSDDRPDWR  386

Query  1163  FEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDA  1342
             F +++PS  PR+YHS+A LL D R+LVGGSNPH  Y F N   FPT+L LE+FSPPYL  
Sbjct  387   FSVMSPSPRPRLYHSSATLLTDGRILVGGSNPHVFYNFTN-VEFPTDLSLESFSPPYLSP  445

Query  1343  ATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRL-  1519
                 IRP I       K  YGK   + F+    +  ++++V +VAPSFTTHSF+ +QR+ 
Sbjct  446   EYDPIRPQIL--SLDEKIRYGKSFWLSFSVKDYLTASVLSVRIVAPSFTTHSFAMNQRMV  503

Query  1520  -LDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              L + G  T+ P     Y ++ V P +  ++P GYY+LFV+H GIPS G+W+++
Sbjct  504   VLKIVGVTTLLPPAPYAYGLSMVGPSTAAIAPPGYYLLFVLHAGIPSSGMWVKI  557



>ref|XP_002468154.1| hypothetical protein SORBIDRAFT_01g040550 [Sorghum bicolor]
 gb|EER95152.1| hypothetical protein SORBIDRAFT_01g040550 [Sorghum bicolor]
Length=585

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/551 (55%), Positives = 374/551 (68%), Gaps = 34/551 (6%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A+ AGGGRW+LL  +IG++AMHMQLL+ND+V+IFDRTDFG SN+ L  G CR +P E V+
Sbjct  40    ASGAGGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGSSNLSLPDGHCRVNPRERVL  99

Query  281   -KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
              + DCTAHS EYDVA N  RPL V TD WCSSA V PDGTL+QTGGWNDG    R    C
Sbjct  100   PRGDCTAHSAEYDVAANAFRPLSVFTDTWCSSATVAPDGTLVQTGGWNDGFRNARTMPAC  159

Query  458   ----NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLY  622
                 +DK CDW E  + L   RWYATN ILPDGR  I+GGR +FNYEFYPK  P    + 
Sbjct  160   GGTGDDKSCDWSEKQDVLAANRWYATNQILPDGRAFIVGGRRQFNYEFYPKAGPSDTSVV  219

Query  623   NLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPR  802
              +PFLA T DP  ENNLYP+V LN+DG+LFIF+NN+A+L DY  + +VR YP + DG PR
Sbjct  220   QMPFLARTKDP-EENNLYPFVHLNIDGNLFIFSNNRAVLLDYKSNKIVRTYPMLGDGDPR  278

Query  803   SYPSTGSAVLLPLKNLQAPG-IVAEVLICGGAPKGAFPASE--RGVFMGALNTCGRIRIT  973
             +YPS+GS+VLLPLK    P    AEVL+CGGAP G++ +++   G F+ AL TCGRI+IT
Sbjct  279   NYPSSGSSVLLPLK----PNPTEAEVLVCGGAPAGSYNSTKGGAGTFVPALTTCGRIKIT  334

Query  974   DPNPVWFMETMPMARLMGDMVTLPNG-NILIINGAAQGSAGYGDGRNPVQTPVLYHTDNP  1150
             D  P W +ETMP  R+MGDM+ LPNG  + IINGAA G+AG+   + P   PV+Y  D+ 
Sbjct  335   DAAPAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWESAKTPAYAPVVYRPDHS  394

Query  1151  VGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPP  1330
              G RFE    +G+ R+YHS+ +LLRD R+LVGGSNPH  Y F N   FPT+L LEAFSP 
Sbjct  395   PGDRFEEQTATGVARLYHSSVVLLRDGRLLVGGSNPHTYYNFSN-VQFPTDLSLEAFSPE  453

Query  1331  YLDAATAGIRPHITLP---GSHSKFGYGKVIEIQFT-----------AAGPVDGNLVTVT  1468
             YLDA+   +RP I  P   G+ S   YG  + +QF+           AAG  D   V+VT
Sbjct  454   YLDASNDMLRPRILDPSPTGAPSSVAYGATMTLQFSVPASARRRRGDAAGLGD---VSVT  510

Query  1469  MVAPSFTTHSFSQHQRLLDLGGGGTVKPVG-INTYHMTAVTPGSGNLSPAGYYMLFVVHK  1645
             MVAPSFTTHSF+ +QRLL L     V   G   T++ +   P +  L+P GYYM+FVV+ 
Sbjct  511   MVAPSFTTHSFAMNQRLLFLDVTKNVAVRGRAGTFNASVTMPATAVLAPPGYYMVFVVNG  570

Query  1646  GIPSEGIWIQM  1678
              IPSEGIW+Q+
Sbjct  571   HIPSEGIWVQI  581



>ref|XP_006577272.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=550

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/551 (52%), Positives = 382/551 (69%), Gaps = 14/551 (3%)
 Frame = +2

Query  41    FALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFG  220
             F L  LF      P S    +A A  G+W LL P+IGI+ MHMQLL+NDK+++FDRTDFG
Sbjct  10    FILASLFPFFQAQPLS----SAFANQGQWNLLQPSIGISPMHMQLLHNDKIIMFDRTDFG  65

Query  221   LSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTL  400
              S +PL  GRCR DP E+ +KVDC+AHSV YDVA NT RPLM+QTD WCSS +V+P+GTL
Sbjct  66    HSYLPLSNGRCRMDPNEIALKVDCSAHSVLYDVATNTFRPLMIQTDTWCSSGSVLPNGTL  125

Query  401   IQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFN  580
             +QTGG+NDG+  +R+F PC  + CDWVE P  L + RWYATN ILPD R I++GGR +FN
Sbjct  126   VQTGGYNDGERSIRMFTPCFGETCDWVEFPGLLSQRRWYATNQILPDARVIVVGGRRQFN  185

Query  581   YEFY---PKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYI  751
             YEF    P          L FL +T+D  +ENNLYP+V L  DG+LFIFAN K++L+DY 
Sbjct  186   YEFLPKTPSPNSSPSSIPLNFLQQTSD-RSENNLYPFVHLLPDGNLFIFANTKSVLFDYK  244

Query  752   KHAVVRLYPAMPDGQPRSYPSTGSAVLLPL-KNLQAPGIVAEVLICGGAPKGAFPASERG  928
             +++V+R +P +P G PR+YPS+GS+VLLPL +NL +  +  EV++CGGAP+G+F  + RG
Sbjct  245   QNSVIREFPPIPGGDPRNYPSSGSSVLLPLDENLDS--LEPEVVVCGGAPRGSFENAARG  302

Query  929   VFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGR  1108
              F+ AL TCGRI++TD NP W M+ MPM R MGDM+ LPNG+++IINGA  G+AG+  G 
Sbjct  303   NFVQALGTCGRIKVTDSNPNWVMQNMPMPRAMGDMLLLPNGDVVIINGAGAGTAGWEHGH  362

Query  1109  NPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGA  1288
             +PV +PV++     V  +F ++ P+  PR+YHS+A+LLRD RVLVGGSNPH  Y F  G 
Sbjct  363   DPVLSPVIFRPSETV-NQFSVMAPASRPRLYHSSAVLLRDGRVLVGGSNPHVFYNF-TGV  420

Query  1289  LFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVT  1468
              +PT+L LEAFSPPYL    A +RP I    +++  GY     + FT       + V++ 
Sbjct  421   EYPTDLSLEAFSPPYLAPDFAPVRPVIRYITNNNVLGYRVFCYVTFTVPNYASVSEVSIR  480

Query  1469  MVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKG  1648
             +VAPSFTTHSF Q+QR++ L         G   Y+ T + P +  ++P GYY+LFVVHKG
Sbjct  481   IVAPSFTTHSFGQNQRMVVLKLSAVTYLAG-EAYYATVMGPSTAEIAPPGYYLLFVVHKG  539

Query  1649  IPSEGIWIQMV  1681
             +PS G W+Q++
Sbjct  540   VPSWGSWVQVM  550



>ref|XP_006471853.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
 gb|KDO53324.1| hypothetical protein CISIN_1g041651mg [Citrus sinensis]
Length=557

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/529 (53%), Positives = 372/529 (70%), Gaps = 11/529 (2%)
 Frame = +2

Query  107   AAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKV  286
             A   G W LL  +IGI+AMHMQLL++++V++FDRTDFG SN+ L  GRCR DPY+ V+  
Sbjct  34    AGSQGEWNLLHESIGISAMHMQLLHDNRVIMFDRTDFGQSNLSLSSGRCRFDPYDTVLHT  93

Query  287   DCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDK  466
             DCTAHS+ YDVA N  RPLMVQTD WCSS +V+P+GTL+Q+GG+NDGDHVVR F PC+D 
Sbjct  94    DCTAHSILYDVATNAYRPLMVQTDTWCSSGSVLPNGTLVQSGGYNDGDHVVRTFTPCDDD  153

Query  467   KCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDL----LYNLPF  634
             +CDW+E+P  L   RWYATN ILPDGR IIIGGR +FNYEFYPK+   DL     + L F
Sbjct  154   QCDWIELPQHLSERRWYATNQILPDGRIIIIGGRRQFNYEFYPKS-DEDLSFPQTFMLHF  212

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L ET D  AENNLYP+V L  DG+LFIFAN ++IL+DY ++ V++ YP +P   PR+YPS
Sbjct  213   LLETRD-YAENNLYPFVHLLPDGNLFIFANTRSILFDYKQNKVLKEYPEIPGADPRNYPS  271

Query  815   TGSAVLLPLKNLQ-APGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVW  991
             TGS+VLLPL     +  + AE++ICGGA   +F  + +GVF+ A++TCGR+ ++  NP W
Sbjct  272   TGSSVLLPLDERNGSTSVQAEIMICGGAQNASFALATQGVFIRAISTCGRLVVSHANPSW  331

Query  992   FMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
              ME MP+ R+MGDM+ LPNG+++IINGA  G+AG+   R P+  P++Y        RF +
Sbjct  332   VMEEMPLPRVMGDMILLPNGDVIIINGAQLGTAGWELARGPMTRPIIYRPSEQTSRRFSV  391

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
             + PS  PRMYHS+AILL D RVL+GGSNPH  Y F N  ++PT+L LEA+SPPYL A  A
Sbjct  392   MEPSTRPRMYHSSAILLTDGRVLIGGSNPHIYYNFTN-VVYPTDLSLEAYSPPYLSAEYA  450

Query  1352  GIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
              +RP I     +   GY    +++F+    +   +V+V ++APSFTTHSF  +QR++ L 
Sbjct  451   TVRPKIL--SLNETIGYKATFQVRFSVEEYLSAGVVSVRLIAPSFTTHSFGMNQRMVVL-  507

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                 V  V    YH+ AV P +  ++P GYY+LFVVH  IPS G+W++M
Sbjct  508   KILEVSHVTSYVYHLAAVAPSTAEIAPPGYYLLFVVHAEIPSSGMWVKM  556



>ref|XP_010660091.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=544

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/546 (52%), Positives = 371/546 (68%), Gaps = 7/546 (1%)
 Frame = +2

Query  41    FALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFG  220
             F L  +F      P       A    G W LL  +IGI+AMHMQLL N+KVVIFDRTDFG
Sbjct  5     FILLSIFFTVFSAPDFSQTLPATVNQGEWHLLHASIGISAMHMQLLWNNKVVIFDRTDFG  64

Query  221   LSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTL  400
              SN+ L    CR DP +  ++ DCTAHS+ Y V  NT RPL VQTD WCSS +V+P+GTL
Sbjct  65    PSNLSLPPHLCRHDPRDHALQTDCTAHSLLYCVDTNTFRPLKVQTDTWCSSGSVLPNGTL  124

Query  401   IQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFN  580
              QTGG+NDGDHV+R+F PC+D  CDWVE P  L + RWYA+N ILPDGR II+GGR +FN
Sbjct  125   TQTGGFNDGDHVLRMFTPCDDYSCDWVEFPGYLSQRRWYASNQILPDGRIIIVGGRRQFN  184

Query  581   YEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHA  760
             YEFYP++  G  LY L FL ET D   ENNLYP++ L  DG+LFIFAN ++I  DY ++ 
Sbjct  185   YEFYPRSSRGSNLYTLDFLRETRD-AHENNLYPFLHLLPDGNLFIFANTRSISLDYKRNR  243

Query  761   VVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMG  940
             VV+ +P +  G+PR+YPS+GS+V+LP+   QA  I AEVL+CGGAP GA   + RG F+ 
Sbjct  244   VVQEFPPITGGEPRNYPSSGSSVMLPINETQA--IEAEVLVCGGAPPGAVSQALRGNFVS  301

Query  941   ALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQ  1120
             A  TCGR+++TD NP W ME MP+AR+MGDM+ LP G+++IINGA  G+AG+  GR+PV 
Sbjct  302   ASLTCGRLKVTDENPNWVMEEMPVARVMGDMLLLPTGDVIIINGARLGAAGWEYGRSPVT  361

Query  1121  TPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPT  1300
              PV+Y     V  RF +++ S  PRMYHS+A+LL D R+LVGGSNPH  Y F N  L+PT
Sbjct  362   NPVIYLPFGDVNRRFLVMSGSIRPRMYHSSAVLLPDGRILVGGSNPHVYYNFTN-VLYPT  420

Query  1301  ELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAP  1480
             +L LEA+SPPY   A + +RPHI          YG+   I F      +  +++  +VAP
Sbjct  421   DLSLEAYSPPYTSPAFSSLRPHIL--SLDENLLYGQSFSIVFNVCEYTNDRVLSANIVAP  478

Query  1481  SFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSE  1660
             SFTTH+ + +QR++ L     ++ VG NTY ++ V P +  ++P GYYMLFVVH GIPS 
Sbjct  479   SFTTHTVAMNQRMVVLRVESVMQEVG-NTYRLSVVGPSTPEIAPPGYYMLFVVHSGIPSH  537

Query  1661  GIWIQM  1678
             G W+++
Sbjct  538   GSWVKI  543



>ref|XP_011073112.1| PREDICTED: galactose oxidase [Sesamum indicum]
Length=549

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/527 (53%), Positives = 364/527 (69%), Gaps = 8/527 (2%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A A   G W LL  +IGI+AMHMQLL N+KVVIFDRTDFG SNI L G RCR DP + V+
Sbjct  29    AYAHIEGEWHLLHRSIGISAMHMQLLKNNKVVIFDRTDFGPSNISLSGRRCRFDPNDRVL  88

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             K DCTAHS+ YD+  N  R L VQTD WCSS A++PDGTL+QTGG+NDGDHV+R+  PCN
Sbjct  89    KKDCTAHSILYDIRTNGFRTLTVQTDTWCSSGALLPDGTLVQTGGYNDGDHVIRILVPCN  148

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYP-KTPGGDLLYNLPFL  637
                CDWVE P +L R RWYA+N ILPDGR II+GGR +FNYEFYP  +P     + L FL
Sbjct  149   GGNCDWVEFPRSLSRRRWYASNQILPDGRVIIVGGRAQFNYEFYPGHSPSSSKSFRLNFL  208

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
              ET D G ENNLYP++ L  DG+LF+FAN ++I+++Y ++ +VR +PA+P   PR+YPS+
Sbjct  209   RETKD-GHENNLYPFLHLLPDGNLFVFANTRSIVFNYKRNQIVREFPAIPGADPRNYPSS  267

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             GS+VLLP+    AP +V E++ICGGA + AF  + RGVF  A +TCGR++IT   P W +
Sbjct  268   GSSVLLPIDE-NAP-VVPEIMICGGATRNAFELANRGVFQRACSTCGRLKITKEEPAWKI  325

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             E MPM R+M DM+ LP+G ++IINGA  G+AG+   +NPV  P++Y+ +   G RF I+ 
Sbjct  326   ENMPMPRVMSDMLILPDGYVIIINGARSGTAGWEYAKNPVTRPLIYNPNGKAGVRFSIMA  385

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
              S  PR+YHSTA+LL D R+LVGGSNPH  Y F  G  +PT+L LE+FSPPYL      +
Sbjct  386   ASSRPRLYHSTAVLLTDGRILVGGSNPHKYYNF-TGVDYPTDLSLESFSPPYLSPVYDRL  444

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             RP I    ++    Y     + FT    V  + V+V +VAPSF THSFS +QR++ L  G
Sbjct  445   RPRIIR--TYEIIRYKNAFSLTFTVQRFVKTSAVSVRIVAPSFNTHSFSMNQRMVVL-KG  501

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               V  VG N Y + A  P    ++P GYY+LF++H GIPS G+W+++
Sbjct  502   ARVSRVGPNVYRVAASGPSKPEIAPPGYYLLFLLHAGIPSSGMWVKI  548



>ref|XP_011003791.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=551

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/551 (52%), Positives = 377/551 (68%), Gaps = 4/551 (1%)
 Frame = +2

Query  26    NFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFD  205
             N      L   F ++ P   S+ + ++    G W LL  N+GI+AMHMQL++++KVVIFD
Sbjct  4     NMVKFLLLAPTFFISFPSVVSQTIPSSGGSQGNWRLLQANVGISAMHMQLMHDNKVVIFD  63

Query  206   RTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVM  385
             RTDFG SNI L GGRCR DP +  +K+DCTAHS+ YD+  +T RPLMVQTD WCSS AV+
Sbjct  64    RTDFGPSNISLPGGRCRIDPSDEALKIDCTAHSILYDIITDTYRPLMVQTDTWCSSGAVL  123

Query  386   PDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGG  565
             P+GTL+QTGG++DGD+V R++  C +  CDWVE PN L R RWYATN ILPDGR IIIGG
Sbjct  124   PNGTLVQTGGFHDGDNVTRMYTSCPNDSCDWVEYPNYLSRRRWYATNQILPDGRIIIIGG  183

Query  566   REEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYD  745
             R EF+YEF+P+       + L  L ET +   ENNLYPYV L  DG+LFIFAN ++IL+D
Sbjct  184   RREFSYEFFPRPSPRRQTFQLRLLIETREGNVENNLYPYVHLLPDGNLFIFANTQSILFD  243

Query  746   YIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASER  925
             Y ++ VVR +P +P G PR+YPSTGS+VLLPL   +   I  EVL+CGGAP+GA+  + R
Sbjct  244   YNQNRVVREFPRIPGGDPRNYPSTGSSVLLPLDENEH-SIDPEVLVCGGAPRGAYQQALR  302

Query  926   GVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDG  1105
             G ++ A++TCGR+RITD N  W METMP+ R+MGDM+ LP G+++IING   G+AG+  G
Sbjct  303   GTYIRAISTCGRLRITDQNASWVMETMPIPRVMGDMLLLPTGDVIIINGGQLGTAGWELG  362

Query  1106  RNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNG  1285
             R     PV+YH  NP   RF ++ PS  PRMYHS AILL D RVLVGG NPH  Y F + 
Sbjct  363   RQAATRPVMYHPSNPSDQRFSVMEPSPRPRMYHSAAILLTDGRVLVGGGNPHIYYNFSD-  421

Query  1286  ALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTV  1465
               +PT+L LE FSPPYL    A IRP I           G+   + F+    + G++++V
Sbjct  422   VFYPTDLSLETFSPPYLSTQYASIRPVIL--SVDDTVSPGQRFLLSFSVGEYIAGSVLSV  479

Query  1466  TMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHK  1645
              +VAPSFTTHS+S +QR++ L   G +     ++Y ++ V P S  ++P GYY+L+VVH 
Sbjct  480   RIVAPSFTTHSYSMNQRMVVLRIDGIIHNETSSSYTLSVVGPSSAEIAPPGYYLLYVVHS  539

Query  1646  GIPSEGIWIQM  1678
             GIPS G+W+++
Sbjct  540   GIPSSGVWVRL  550



>ref|XP_009119411.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=552

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/525 (52%), Positives = 368/525 (70%), Gaps = 16/525 (3%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWE+LLP+IGI+AMHMQLL+N  V++FDRTDFG+SN+ L GG CR DP +  VK DC+AH
Sbjct  37    RWEVLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNLSLPGGMCRFDPSDTAVKFDCSAH  96

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDV  NT R L VQTD WCSS +V+P+GTL+QTGG+NDG+   R+F PC   + CDW
Sbjct  97    SVLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDW  156

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPG-GDLLYNLPFLAETNDP  655
             +E P  L + RWYATN ILPDGR I++GGR +FN+E +P+    G       FL ET D 
Sbjct  157   IEFPQYLAQRRWYATNQILPDGRIIVVGGRRQFNFEIFPRPDSHGYRGSRFDFLRETTDG  216

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
              +ENNLYP+++L  DG+LF+FAN ++I++DY ++ +VR +P +PDG PR+YPS+GS++L 
Sbjct  217   SSENNLYPFLYLLPDGNLFVFANTRSIVFDYKRNRIVREFPEIPDGDPRNYPSSGSSILF  276

Query  836   PL---KNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             PL   KN+      AE+++CGGAPK AFP A  +  F  A +TCGR+R+T PNP+W MET
Sbjct  277   PLDESKNIME----AEIMVCGGAPKDAFPRAKSQQGFTRATSTCGRLRLTSPNPIWEMET  332

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP+ R+MGDM+ LP G+I+I+NGA  G+AG+ + R+PV  PV+YH   P   RF I++ S
Sbjct  333   MPLPRVMGDMLLLPTGDIIIVNGAGAGTAGWENARDPVTRPVIYH---PFDHRFSIMSTS  389

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
               PRMYHS+A+LL D RVLVGGSNPH  Y F N   +PTEL LEA+SPPYL   +  IRP
Sbjct  390   SCPRMYHSSAVLLPDGRVLVGGSNPHIYYNFTN-VEYPTELSLEAYSPPYLSFTSDSIRP  448

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
             HI    +     Y ++  + F+    +  +L++V +VAPSFTTHSF+ +QR++ L     
Sbjct  449   HIL--TNDKVISYKRLFNVHFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLLSV  506

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                   N+Y +  + P +  ++P GYYM+F+VH GIPS G W+Q+
Sbjct  507   THEDLTNSYKLDVLGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQI  551



>ref|XP_006343542.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/555 (51%), Positives = 374/555 (67%), Gaps = 6/555 (1%)
 Frame = +2

Query  14    MGRRNFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKV  193
             M R N   LF L            S+ + +     G W LL  +IGI AMHMQLL+N+KV
Sbjct  1     MDRENIIFLFLLVLTVFTLQTSTASQMLVSRRHLVGEWRLLHKSIGITAMHMQLLHNNKV  60

Query  194   VIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSS  373
             VIFDRTDFG SN+ L  GRCR + +++V+  DC+AHSV YD+A NT RPLMVQTD WCSS
Sbjct  61    VIFDRTDFGRSNLSLPRGRCRYNSHDLVLHKDCSAHSVLYDIASNTFRPLMVQTDTWCSS  120

Query  374   AAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQI  553
              AV+P+GTL+QTGG+NDGDH++R   PC  + CDW E+P  L + RWY+T+HILPD R I
Sbjct  121   GAVLPNGTLVQTGGYNDGDHIIRTIAPCTGENCDWFELPRTLIQRRWYSTDHILPDARII  180

Query  554   IIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKA  733
             +IGGR+++NYEFYPK   G+  + L FL  T D   ENNLYP+VFL  DG+L IF+N +A
Sbjct  181   VIGGRKQYNYEFYPKNSRGNSAFRLQFLKSTQDRKDENNLYPFVFLLPDGNLLIFSNTRA  240

Query  734   ILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFP  913
             I+ +Y K+ VVR  P++P  +PR+YPSTGSAVLLPL   +   + AE+++CGGAP+ A+ 
Sbjct  241   IILNYKKNQVVRELPSIPGDEPRNYPSTGSAVLLPLD--ENRPMEAEIMVCGGAPRRAYG  298

Query  914   ASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAG  1093
              +   V+M AL++CGRI + D +  W METMP  R+M DM+ LPNG+ILIINGA++G+AG
Sbjct  299   LTANMVYMKALSSCGRINVRDDHGRWKMETMPTPRVMSDMLILPNGDILIINGASRGTAG  358

Query  1094  YGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYV  1273
             + + R+PV  PV+Y  +     RF I+  S  PR+YHS+AIL+ D RVLVGGSNP  NY 
Sbjct  359   WDNARSPVTRPVIYRPNMRRHNRFSIMKASSRPRLYHSSAILMTDGRVLVGGSNPQENYN  418

Query  1274  FGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGN  1453
             F  G  FPT+L LEAF PP+L      ++P  T+    +   Y K     FT    +   
Sbjct  419   F-TGVEFPTDLSLEAFYPPFLARKHKHLKP--TVLSIDAILIYKKSFSATFTVPRFLRMG  475

Query  1454  LVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLF  1633
              V++ ++APSFTTHSFS +QR++ L G   V  V  NTY  TA  P +  ++P GYY+LF
Sbjct  476   TVSIRIIAPSFTTHSFSMNQRMVVLKGVVVVA-VSANTYRFTAFGPSTKEIAPPGYYLLF  534

Query  1634  VVHKGIPSEGIWIQM  1678
             VVH GIPS G+W+++
Sbjct  535   VVHAGIPSSGMWVKI  549



>ref|XP_006389311.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP48225.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=551

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/551 (52%), Positives = 376/551 (68%), Gaps = 4/551 (1%)
 Frame = +2

Query  26    NFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFD  205
             N      L   F +  P   ++ + ++    GRW LL  N+GI+AMHMQL++++KVVIFD
Sbjct  4     NMVKFLLLAPTFFIFFPSVMTQTIPSSDGSQGRWRLLHANVGISAMHMQLMHDNKVVIFD  63

Query  206   RTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVM  385
             RTDFG SNI L GGRCR DP +  +K+DCTAHS+ YD+  +T RPLMVQTD WCSS AV+
Sbjct  64    RTDFGPSNISLPGGRCRIDPSDEALKIDCTAHSILYDIITDTYRPLMVQTDTWCSSGAVL  123

Query  386   PDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGG  565
             P+GTL+QTGG++DGD+V R++  C D  CDWVE PN L R RWYATN ILPDGR IIIGG
Sbjct  124   PNGTLVQTGGFHDGDNVTRMYTSCPDDICDWVEYPNYLSRRRWYATNQILPDGRIIIIGG  183

Query  566   REEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYD  745
             R EF+YEF+P+       + L  L ET +   ENNLYPYV L  DG+LFIFAN ++IL+D
Sbjct  184   RREFSYEFFPRPSPRRQTFQLRLLIETREGNVENNLYPYVHLFPDGNLFIFANTRSILFD  243

Query  746   YIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASER  925
             Y ++ VVR +P +P G PR+YPSTGS+VLLPL   +   I  EVL+CGGAP+GA+  + R
Sbjct  244   YNQNRVVREFPRIPGGDPRNYPSTGSSVLLPLDENEH-SIDPEVLVCGGAPRGAYQQALR  302

Query  926   GVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDG  1105
             G ++ A++TCGR+RITD N  W M+TMP+ R+MGDM+ LP G+++IING   G+AG+  G
Sbjct  303   GTYVRAISTCGRLRITDQNASWVMDTMPIPRVMGDMLLLPTGDVIIINGGQSGTAGWELG  362

Query  1106  RNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNG  1285
             R     PV+YH  NP   RF ++ PS  PRMYHS AILL D RVLVGG NPH  Y F + 
Sbjct  363   RQAATRPVMYHPSNPSDQRFSVMEPSPRPRMYHSAAILLTDGRVLVGGGNPHIYYNFSD-  421

Query  1286  ALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTV  1465
               +PT+L LE FSPPYL    A IRP I           G+   + F+    + G++++V
Sbjct  422   VFYPTDLSLETFSPPYLSTQYASIRPVIL--SVDDTVSPGQRFLLSFSVGEYIAGSVLSV  479

Query  1466  TMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHK  1645
              +VAPSFTTHS+S +QR++ L     +     ++Y ++ V P S  ++P GYY+L+VVH 
Sbjct  480   RIVAPSFTTHSYSMNQRMVVLRIDEIIDNETSSSYTLSVVGPSSAEIAPPGYYLLYVVHS  539

Query  1646  GIPSEGIWIQM  1678
             GIPS G+W+++
Sbjct  540   GIPSSGVWVRL  550



>ref|XP_006649773.1| PREDICTED: galactose oxidase-like [Oryza brachyantha]
Length=559

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/530 (55%), Positives = 366/530 (69%), Gaps = 16/530 (3%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RW+LL  +IG++AMHMQLL+ND+V+IFDRTDFG SN+ L  GRCR++P E VV VDCTAH
Sbjct  34    RWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGQSNLSLPDGRCRRNPRERVVPVDCTAH  93

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC--NDKKCD  475
             S EYDVA NT RPL V TD WCSS  V PDGTL+QTGGWNDG   VR    C  +D  CD
Sbjct  94    SAEYDVASNTFRPLYVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNVRTMAACEADDDSCD  153

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNL-PFLAETND  652
             W E  +AL   RWYATN ILPDGR  I+GGR +F+YEFYPK    D    L PFL +T D
Sbjct  154   WDETQDALAVSRWYATNQILPDGRAFIVGGRRQFSYEFYPKADPSDTSVTLMPFLVQTKD  213

Query  653   PGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVL  832
             P  ENNLYP+V LN+DG+LFIFA N+AIL DY K+ +VR YP +  G PR+YPS+GS+VL
Sbjct  214   P-EENNLYPFVHLNIDGNLFIFAKNRAILLDYKKNKIVRTYPELAGGDPRNYPSSGSSVL  272

Query  833   LPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPM  1012
             LPLK   +P   AEVL+CGGAP G++ +++ G F  AL TCGRI+ITD  P W +ETMP 
Sbjct  273   LPLK--PSP-TEAEVLVCGGAPAGSYNSTKDGTFPSALVTCGRIKITDMAPSWVIETMPS  329

Query  1013  ARLMGDMVTLPNG-NILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
              R+MGDM+ LPNG  ++IINGA  G+AG+   + P   P++Y  D+  G RFE  + + I
Sbjct  330   PRVMGDMILLPNGAEVVIINGAMDGTAGWESAKTPALAPLIYRPDHSPGDRFEEQSSTDI  389

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
              R+YHS+A+LLRD R+LVGGSNPH  Y F N   +PTEL LEA+SP YLD +   +RP I
Sbjct  390   ARLYHSSAVLLRDGRLLVGGSNPHIYYNFSN-VQYPTELSLEAYSPEYLDPSNDMLRPTI  448

Query  1370  TLP---GSHSKFGYGKVIEIQFT--AAGPVDGNL--VTVTMVAPSFTTHSFSQHQRLLDL  1528
               P   G+ +   YG  + ++FT  A+    G +  ++ TMVAPSFTTHSF+ +QRLL L
Sbjct  449   VDPSPTGAPASVTYGASLTLRFTVPASKRSRGGIGPLSATMVAPSFTTHSFAMNQRLLFL  508

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                 T       +Y  + V P +  L+P GYYM+FVV+  IPSEGIW+ +
Sbjct  509   DVVKTAALARAGSYQTSVVMPATAVLAPPGYYMVFVVNGHIPSEGIWVHI  558



>gb|KFK35620.1| hypothetical protein AALP_AA4G014800 [Arabis alpina]
Length=549

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/521 (51%), Positives = 362/521 (69%), Gaps = 8/521 (2%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWE+L P+IGI+AMHMQLL+N  V++FDRTDFG SNI L GG CR DP +  VK DC+AH
Sbjct  34    RWEVLQPSIGISAMHMQLLHNGMVIMFDRTDFGNSNISLAGGMCRYDPSDTAVKFDCSAH  93

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDVA NT RPL VQTD WCSS +V+P+GTL+QTGG+NDGD   R+F PC   + CDW
Sbjct  94    SVLYDVASNTYRPLKVQTDTWCSSGSVLPNGTLVQTGGYNDGDRAARMFTPCGFSETCDW  153

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPG  658
             +E P  L + RWYATN ILPDGR I++GGR +FN+E +P+     +     FL ET D  
Sbjct  154   IEFPQYLTQRRWYATNQILPDGRIIVVGGRRQFNFEIFPRADYRSIESRFEFLRETTDGS  213

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
              ENNLYP++ L  DG+LF+FAN ++I++DY ++ +VR +P +P G PR+YPS+GS++LLP
Sbjct  214   NENNLYPFLHLLPDGNLFVFANTRSIVFDYKRNRIVREFPEIPGGDPRNYPSSGSSILLP  273

Query  839   LKNLQAPGIVAEVLICGGAPKGAFPASERGV-FMGALNTCGRIRITDPNPVWFMETMPMA  1015
             L       + AE+++CGGAPKGAF   + G  F  A +TCGR+++T  NP W METMP+ 
Sbjct  274   LDETNNVDLEAEIMVCGGAPKGAFSGVKNGRGFARATSTCGRLKLTGANPSWEMETMPLP  333

Query  1016  RLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPR  1195
             R+MGDM+ LP G+++I+NGA  G+AG+ + R+P+  PV+Y+   P   RF +++ +  PR
Sbjct  334   RVMGDMLLLPTGDVIIVNGAGTGTAGWENARDPLTRPVIYY---PFERRFSVMSTASRPR  390

Query  1196  MYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITL  1375
             MYHS+A+LL D R+LVGGSNPH  Y F N   +PTEL LEA+SPPYL   +  IRP I  
Sbjct  391   MYHSSAVLLADGRILVGGSNPHVYYNFTN-VEYPTELSLEAYSPPYLSFTSDSIRPKILT  449

Query  1376  PGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPV  1555
              G      Y  +  + F+ A  +  +L++V +VAPSFTTHSF+ +QR++ L      +  
Sbjct  450   SG--KVVNYKTLFNLSFSIAQFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLISVARDG  507

Query  1556  GINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               N+Y +  + P +  ++P GYYM+F+VH G+PS G W+Q+
Sbjct  508   LTNSYRINVLGPSTAEIAPPGYYMMFLVHSGVPSSGTWVQI  548



>ref|XP_010242442.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=573

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/537 (53%), Positives = 375/537 (70%), Gaps = 18/537 (3%)
 Frame = +2

Query  113   GGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDC  292
              GG+W LL  +IG++AMHMQLL+NDKV++FDRTDFG SN+ L  GRCR DP +V + +DC
Sbjct  39    SGGKWVLLHTSIGLSAMHMQLLHNDKVLMFDRTDFGPSNLSLSFGRCRFDPNDVALNIDC  98

Query  293   TAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKC  472
             TAHS+ YD+  NT RPLMVQTD WCSS +V+P+GTL+QTGG+NDGD V+R F+PC D  C
Sbjct  99    TAHSLIYDIPTNTFRPLMVQTDTWCSSGSVLPNGTLVQTGGYNDGDRVIRTFSPCIDDLC  158

Query  473   DWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLL---YNLPFLAE  643
             DW E+P  L   RWYA+N ILPDGR II+GGR+ FNYEFYP     +     Y L FL E
Sbjct  159   DWTELPEYLSSRRWYASNQILPDGRIIIVGGRKVFNYEFYPTNLVNESAPSNYYLSFLEE  218

Query  644   TNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGS  823
             T DP  ENNLYP++ L  DG+LFIFAN ++IL+ + ++ V+R +PA+P G  R+YPS+GS
Sbjct  219   TRDPYEENNLYPFLHLLPDGNLFIFANTRSILFSHTRNRVLREFPAIPGGHKRNYPSSGS  278

Query  824   AVLLPL-----KNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPV  988
             +VLLP+        Q+P   AEV++CGGAP GAF  +E G+++GA N+CGR+++TDP P 
Sbjct  279   SVLLPINLAGGNATQSPE--AEVMVCGGAPPGAFDQAEVGIYVGASNSCGRLKVTDPKPK  336

Query  989   WFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHT-DNPVGTRF  1165
             W ME MPM R+M DM+ LP G +LIINGAA G+AG+ +  NPV  PVLY T +     RF
Sbjct  337   WVMEEMPMGRVMSDMLLLPTGEVLIINGAANGTAGWENAINPVLNPVLYLTYEQDPSRRF  396

Query  1166  EILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAA  1345
             ++LN S IPR+YHS A+LL D R+LVGGSNPH  Y F +   +PTEL LEAF P YL A 
Sbjct  397   KVLNGSPIPRLYHSAAVLLPDGRILVGGSNPHRLYNFTDDVRYPTELSLEAFLPHYLAAQ  456

Query  1346  TAGIRPHITL---PGSHSKFGYGKVIEIQF--TAAGPVDGNL-VTVTMVAPSFTTHSFSQ  1507
              A +RP I      G+ S   YG+   + F  + A  ++ ++ V+VT++APSFTTH+F  
Sbjct  457   YALLRPLIVSVGPNGTSSSISYGQKFSVTFALSVAYRIEQDISVSVTLIAPSFTTHAFGM  516

Query  1508  HQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             +QRL+ L     ++ V  + Y      P + +++P GYYMLFVV+ GIPS G W+++
Sbjct  517   NQRLVVLNVISLLQ-VFTSAYQADLDGPTTSSVAPPGYYMLFVVYAGIPSHGFWVKI  572



>ref|XP_004984953.1| PREDICTED: galactose oxidase-like [Setaria italica]
Length=575

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/547 (54%), Positives = 367/547 (67%), Gaps = 27/547 (5%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A+  GGRW+LL  +IG++AMHMQLL+ND+V+IFDRTDFG SN+ L GGRCR +P E  + 
Sbjct  33    ASGSGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGRSNLSLPGGRCRVNPRERALP  92

Query  284   V-DCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC-  457
               DCTAHS EYDVA N  RPL V TD WCSS  V PDGTL+QTGGWNDG    R    C 
Sbjct  93    GGDCTAHSAEYDVAANAARPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNARTMPVCG  152

Query  458   --NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNL  628
               + K CDW E  +AL   RWYATN ILPDGR  IIGGR +F+YEFYPK  P    +  +
Sbjct  153   GSDGKSCDWSEKQDALAANRWYATNQILPDGRAFIIGGRRQFSYEFYPKADPSDTSVIQM  212

Query  629   PFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSY  808
             PFL +T DP  ENNLYP+V LN+DG+LFIFA N+AIL DY ++ V R YP + DG PR+Y
Sbjct  213   PFLVQTRDP-EENNLYPFVHLNIDGNLFIFAKNRAILLDYKRNKVARTYPVLADGDPRNY  271

Query  809   PSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERG--VFMGALNTCGRIRITDPN  982
             PS+GS+VLLPLK        AEVL+CGGAP G++ +++     F+ AL TCGRI+ITDP+
Sbjct  272   PSSGSSVLLPLKPNPTE---AEVLVCGGAPSGSYNSTKGSARTFVPALATCGRIKITDPS  328

Query  983   PVWFMETMPMARLMGDMVTLPNG-NILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT  1159
             P W +ETMP  R+MGDM+ LPNG  + IINGAA G+AG+     P   PV+Y  D   G 
Sbjct  329   PAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWEAAGTPNYAPVIYRPDRSPGD  388

Query  1160  RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLD  1339
             RFE    +G+ R+YHS+ +LLRD R+LVGGSNPH  Y F +G  FPTEL LEAFSP YLD
Sbjct  389   RFEEQAATGVARLYHSSVVLLRDGRLLVGGSNPHTYYNF-SGVEFPTELSLEAFSPEYLD  447

Query  1340  AATAGIRPHITLP---GSHSKFGYGKVIEIQFTAAGPVDGNL----------VTVTMVAP  1480
              +   +RP I  P   G+ S   YG  +++QF+                   V+VTMVAP
Sbjct  448   QSNDMLRPRILDPSPIGAASSVSYGTTLKLQFSVPASARRRRGGAGGFGLGEVSVTMVAP  507

Query  1481  SFTTHSFSQHQRLLDLGGGGTVKPVG-INTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPS  1657
             SFTTHSF+ +QRLL L  G T    G   TY+++A  P +  L+P GYYM+FVV+  +PS
Sbjct  508   SFTTHSFAMNQRLLFLEVGKTAAVRGRAGTYNVSATMPATAVLAPPGYYMVFVVNGHVPS  567

Query  1658  EGIWIQM  1678
             EGIW+ +
Sbjct  568   EGIWVHI  574



>gb|EMT01589.1| hypothetical protein F775_04099 [Aegilops tauschii]
Length=566

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/546 (54%), Positives = 361/546 (66%), Gaps = 25/546 (5%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A+  GGGRW++L  +IG++AMHMQLL+ND+V+IFDRTDFG SN+ L  GRCR++P E V+
Sbjct  25    ASGGGGGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFGQSNLSLPDGRCRRNPRERVL  84

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
              VDCTAHS EYDVA NT RPL V TD WCSS  V PDGTL+QTGGWNDG   VR    C+
Sbjct  85    PVDCTAHSAEYDVASNTFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNVRAMRACD  144

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK-TPGGDLLYNLPFL  637
                CDW E  +AL   RWYATN ILPDGR  I+GGR +FNYEF+PK          LPFL
Sbjct  145   GGSCDWNETQDALAANRWYATNQILPDGRAFIVGGRRQFNYEFFPKADASDASAIALPFL  204

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
              +T DP  ENNLYP+V LN+DG+LFIFA N+A+L DY K+ +VR YP +  G PR+YPS+
Sbjct  205   VQTRDP-EENNLYPFVHLNIDGNLFIFAKNRAVLLDYKKNKIVRTYPELAGGDPRNYPSS  263

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             GS+VLLPLK   +P   AEVLICGGAP G++ +++   F  AL TCGRI+ITD +P W +
Sbjct  264   GSSVLLPLK--PSP-TEAEVLICGGAPAGSYNSTKEKTFFPALVTCGRIKITDASPAWVI  320

Query  998   ETMPMARLMGDMVTLPNG-NILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEIL  1174
             E M   R+MGDM+ LPNG  ++IINGA  G+AG+     P   PV+Y  D+  G RFE  
Sbjct  321   ERMSSPRVMGDMILLPNGAEVVIINGAMDGTAGWEAANTPAYAPVVYRPDHAPGDRFEEQ  380

Query  1175  NPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAG  1354
             + + I R+YHS+AILLRD RVLVGGSNPH  Y F N   +PTEL LEAFSP YLD++   
Sbjct  381   SATDIARLYHSSAILLRDGRVLVGGSNPHIYYNFSN-EQYPTELSLEAFSPEYLDSSNDA  439

Query  1355  IRPHITLPGSHS---KFGYGKVIEIQFTAAGPVDG--------------NLVTVTMVAPS  1483
             +RP IT P          YG  + +QF                       LV+VTMVAPS
Sbjct  440   LRPKITHPSPADPAVSVKYGDSMTLQFEVPAVAPRRRPRGGGDGDGGSLGLVSVTMVAPS  499

Query  1484  FTTHSFSQHQRLLDLG-GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSE  1660
             FTTHSF  +QRLL L   G T        Y  + V P +  L+P GYYM+FVV+  IPSE
Sbjct  500   FTTHSFGMNQRLLFLDVAGPTALHGAAGAYEASVVMPATAVLAPPGYYMVFVVNGHIPSE  559

Query  1661  GIWIQM  1678
             G+W+ +
Sbjct  560   GVWVHI  565



>tpg|DAA44472.1| TPA: glyoxal oxidase [Zea mays]
Length=580

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/550 (54%), Positives = 370/550 (67%), Gaps = 31/550 (6%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV-  280
             A+  GGRW+L   +IG++AMHMQLL+ND+V+IFDRTDFG SN+ L  GRCR +P E V+ 
Sbjct  34    ASGAGGRWDLQQRSIGVSAMHMQLLHNDRVIIFDRTDFGHSNLSLPDGRCRVNPRERVLP  93

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             + DCTAHSVEYDVA N  RPL V TD WCSS  V PDGTL+QTGGWNDG    R    C+
Sbjct  94    QGDCTAHSVEYDVAANAFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGFRNARTMPACS  153

Query  461   D--KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNLP  631
             D  + CDW E  +AL   RWYATN ILPDGR  IIGGR +F+YEFYPK  P    +  +P
Sbjct  154   DGDESCDWSETQDALSANRWYATNQILPDGRAFIIGGRRQFSYEFYPKAGPSDTSVIPMP  213

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL +T DP  ENNLYP+V LN+DG+LFIF+NN+A+L DY  + +VR YP + DG PR+YP
Sbjct  214   FLVQTRDP-EENNLYPFVHLNIDGNLFIFSNNRAVLLDYSSNKIVRTYPVLGDGDPRNYP  272

Query  812   STGSAVLLPLKNLQAPG-IVAEVLICGGAPKGAFPASER------GVFMGALNTCGRIRI  970
             S+GS+VLLPLK    P    AEVL+CGGAP G++ ++++      G F+ AL TCGRI+I
Sbjct  273   SSGSSVLLPLK----PNPTEAEVLVCGGAPAGSYNSTKQQQGGTAGAFVPALTTCGRIKI  328

Query  971   TDPNPVWFMETMPMARLMGDMVTLPNG-NILIINGAAQGSAGYGDGRNPVQTPVLYHTDN  1147
             TD  P W +ETMP  R+MGDMV LPNG  + IINGAA G+AG+   + P   PV+Y  D+
Sbjct  329   TDAAPAWVIETMPSPRVMGDMVLLPNGAEVAIINGAADGTAGWESAKTPAYAPVVYRPDH  388

Query  1148  PVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSP  1327
               G RFE  N +G+ R+YHS+A+LLRD R+LVGGSNPH  Y F N   FPT+L LEAFSP
Sbjct  389   SPGDRFEEQNAAGVARLYHSSAVLLRDGRLLVGGSNPHTYYNFSN-VQFPTDLSLEAFSP  447

Query  1328  PYLDAATAGIRPHITLP---GSHSKFGYGKVIEIQFTAAGPVDGNL---------VTVTM  1471
              YLDA+   +RP I  P   G+ +  GYG  + I+F                   V+VTM
Sbjct  448   EYLDASNDMLRPRILDPSPTGAPASVGYGATMAIRFLVPALARRRRGGRAGGLGDVSVTM  507

Query  1472  VAPSFTTHSFSQHQRLLDLGGGGTVKPVG-INTYHMTAVTPGSGNLSPAGYYMLFVVHKG  1648
             VAPSFTTHSF+ +QRLL L     V   G    +  +   P +  L+P GYYMLFVV+  
Sbjct  508   VAPSFTTHSFAMNQRLLFLDVTKNVAVRGRAGAFSASVTMPATAVLAPPGYYMLFVVNGH  567

Query  1649  IPSEGIWIQM  1678
             IPSEGIW+++
Sbjct  568   IPSEGIWVKI  577



>ref|NP_001149941.1| glyoxal oxidase precursor [Zea mays]
 gb|ACG37287.1| glyoxal oxidase [Zea mays]
Length=579

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/548 (54%), Positives = 369/548 (67%), Gaps = 28/548 (5%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV-  280
             A+  GGRW+L   +IG++AMHMQLL+ND+V+IFDRTDFG SN+ L  GRCR +P E V+ 
Sbjct  34    ASGAGGRWDLQQRSIGVSAMHMQLLHNDRVIIFDRTDFGHSNLSLPDGRCRVNPRERVLP  93

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
             + DCTAHSVEYDVA N  RPL V TD WCSS  V PDGTL+QTGGWNDG    R    C+
Sbjct  94    QGDCTAHSVEYDVAANAFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGFRNARTMPACS  153

Query  461   D--KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNLP  631
             D  + CDW E  +AL   RWYATN ILPDGR  IIGGR +F+YEFYPK  P    +  +P
Sbjct  154   DGDESCDWSETQDALSANRWYATNQILPDGRAFIIGGRRQFSYEFYPKAGPSDTSVIPMP  213

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL +T DP  ENNLYP+V LN+DG+LFIF+NN+A+L DY  + +VR YP + DG PR+YP
Sbjct  214   FLVQTRDP-EENNLYPFVHLNIDGNLFIFSNNRAVLLDYSSNKIVRTYPVLGDGDPRNYP  272

Query  812   STGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASER-----GVFMGALNTCGRIRITD  976
             S+GS+VLLPLK        AEVL+CGGAP G++ ++++     G F+ AL TCGRI+ITD
Sbjct  273   SSGSSVLLPLKPNPTE---AEVLVCGGAPAGSYNSTKQQGGTAGAFVPALTTCGRIKITD  329

Query  977   PNPVWFMETMPMARLMGDMVTLPNG-NILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV  1153
               P W +ETMP  R+MGDM+ LPNG  + IINGAA G+AG+   + P   PV+Y  D+  
Sbjct  330   ATPAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWESAKTPAYAPVVYRPDHSP  389

Query  1154  GTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPY  1333
             G RFE  N +G+ R+YHS+A+LLRD R+LVGGSNPH  Y F N   FPT+L LEAFSP Y
Sbjct  390   GDRFEEQNAAGVARLYHSSAVLLRDGRLLVGGSNPHTYYNFSN-VQFPTDLSLEAFSPEY  448

Query  1334  LDAATAGIRPHITLP---GSHSKFGYGKVIEIQFTAAGPVDGNL---------VTVTMVA  1477
             LDA+   +RP I  P   G+ +  GYG  + I+F                   V+VTMVA
Sbjct  449   LDASNDMLRPRILDPSPTGAPATVGYGATMAIRFLVPALARRRRGGRAGGLGDVSVTMVA  508

Query  1478  PSFTTHSFSQHQRLLDLGGGGTVKPVG-INTYHMTAVTPGSGNLSPAGYYMLFVVHKGIP  1654
             PSFTTHSF+ +QRLL L     V   G    +  +   P +  L+P GYYMLFVV+  IP
Sbjct  509   PSFTTHSFAMNQRLLFLDVTKNVAVRGRAGAFSASVTMPATAVLAPPGYYMLFVVNGHIP  568

Query  1655  SEGIWIQM  1678
             SEGIW+++
Sbjct  569   SEGIWVKI  576



>emb|CDY62245.1| BnaC01g42480D [Brassica napus]
Length=552

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/525 (51%), Positives = 366/525 (70%), Gaps = 16/525 (3%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWE+LLP++GI+AMHMQLL+N  V++FDRTDFG+SN+ L GG CR DP +  VK DC+AH
Sbjct  37    RWEVLLPSVGISAMHMQLLHNGMVIMFDRTDFGISNLSLPGGMCRFDPSDTAVKFDCSAH  96

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDV  NT R L VQTD WCSS +V+P+GTL+QTGG+NDG+   R+F PC   + CDW
Sbjct  97    SVLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDW  156

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLL-YNLPFLAETNDP  655
             +E P  L + RWYATN ILPDGR I++GGR +FN+E +P+            FL ET D 
Sbjct  157   IEFPQYLAQRRWYATNQILPDGRIIVVGGRRQFNFEIFPRPDSHRYRGSRFDFLRETTDG  216

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
              +ENNLYP+++L  DG+LF+FAN ++I++DY ++ +VR +P +P G PR+YPS+GS++L 
Sbjct  217   SSENNLYPFLYLLPDGNLFVFANTRSIVFDYKRNRIVREFPEIPGGDPRNYPSSGSSILF  276

Query  836   PL---KNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             PL   KN+      AE+++CGGAPK AFP A  +  F  A +TCGR+R+T PNP+W MET
Sbjct  277   PLDESKNIME----AEIMVCGGAPKDAFPRAKSQQGFTCATSTCGRLRLTSPNPIWEMET  332

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP+ R+MGDM+ LP G+I+I+NGA  G+AG+ + R+PV  PV+YH   P   RF I++ S
Sbjct  333   MPLPRVMGDMLLLPTGDIIIVNGAGAGTAGWENARDPVTRPVIYH---PFDRRFSIMSTS  389

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
                RMYHS+A+LL D RVLVGGSNPH  Y F N   +PTEL LEA+SPPYL   +  IRP
Sbjct  390   SRSRMYHSSAVLLPDGRVLVGGSNPHIYYNFTN-VEYPTELSLEAYSPPYLSFTSDSIRP  448

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
             HI    +     Y ++  + F+    +  +L++V +VAPSFTTHSF+ +QR++ L     
Sbjct  449   HIL--TNDKVISYKRLFNVNFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLLSV  506

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                   N+Y + A+ P +  ++P GYYM+F+VH GIPS G W+Q+
Sbjct  507   THEDLTNSYKIDALGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQI  551



>ref|XP_010652487.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=563

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/536 (51%), Positives = 367/536 (68%), Gaps = 16/536 (3%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             ++  GG W LL  +IGI+AMHMQ+L+N+K++IFDRTDFG SN+ L  G CR DP ++ +K
Sbjct  32    SSNNGGSWFLLHSSIGISAMHMQILHNNKIIIFDRTDFGASNLSLPDGHCRSDPNDMALK  91

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
             VDCTAHS+ YDV  N++RPLM+QTD WCSS +V+ DGTLIQTGG+NDG+ V R F PCND
Sbjct  92    VDCTAHSLLYDVLLNSIRPLMLQTDTWCSSGSVIADGTLIQTGGYNDGERVARTFTPCND  151

Query  464   KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLL---YNLPF  634
              +CDW E+P  L   RWYA+N ILPDGR I++GGR  F+YEF+PK          Y L F
Sbjct  152   DQCDWKELPEYLSVRRWYASNQILPDGRIIVVGGRNAFSYEFFPKNTLNSTSQPNYYLKF  211

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L +T DP  ENNLYP++ L  DG+LFIFAN ++I +DY ++ VV+ +P +P    RSYPS
Sbjct  212   LKDTRDPKEENNLYPFLHLLPDGNLFIFANKRSISFDYTQNRVVKEFPVIPGEDSRSYPS  271

Query  815   TGSAVLLPLK-----NLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDP  979
             TGS+V+LPL+       Q+P +  E+L+CGGAPKG++  +ERG ++ A  TCGRI++TDP
Sbjct  272   TGSSVMLPLRLTSGNQSQSPEV--EILVCGGAPKGSYSKAERGTYISASKTCGRIKVTDP  329

Query  980   NPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLY--HTDNPV  1153
             NP W ME MPM R+M DM+ LP G++L+INGA+ G+AG+ DGRNPV  PVLY  +  +P 
Sbjct  330   NPKWVMEQMPMPRVMSDMIILPTGDVLLINGASNGTAGWEDGRNPVLNPVLYRSYASDP-  388

Query  1154  GTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPY  1333
               RF +LNPS  PRMYHS A+L+ D RV+VGGSNPH  Y F     +PTEL LEAFSPPY
Sbjct  389   SQRFWVLNPSRTPRMYHSGAVLVPDGRVIVGGSNPHRVYNF-TAYPYPTELGLEAFSPPY  447

Query  1334  LDAATAGIRPHI-TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQH  1510
             L    + +RP I ++    +   Y     I  T +  +    + V ++ PSFTTHSF+ +
Sbjct  448   LAPRYSYLRPSILSIETPQNVLLYRGSFSISLTLSLYLRSRGIEVMIMTPSFTTHSFAMN  507

Query  1511  QRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             QR + L      + + +  Y +    P    ++P GYYMLFVVH G PS+G+W+++
Sbjct  508   QRAVVLNVTSMAQ-LSLFAYKLVVSGPQKTAIAPPGYYMLFVVHAGTPSQGVWVKV  562



>ref|XP_009364601.1| PREDICTED: galactose oxidase [Pyrus x bretschneideri]
Length=556

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/540 (51%), Positives = 375/540 (69%), Gaps = 17/540 (3%)
 Frame = +2

Query  74    PPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRC  253
             PPP+S N        G+W LL  ++GI+AMHMQLL  +KV++FDRTD+G SNI L  G+C
Sbjct  28    PPPYSSNQ-------GQWRLLHSSVGISAMHMQLLRTNKVIMFDRTDYGPSNISLPRGQC  80

Query  254   RQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDH  433
             R+DP + V+KVDCTAHS+ YD+  NT RPL V TD WCSS +V+PDGTL+QTGG+NDGD 
Sbjct  81    RRDPNDTVLKVDCTAHSILYDLGSNTFRPLTVHTDTWCSSGSVLPDGTLVQTGGYNDGDR  140

Query  434   VVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTP---  604
             VVR F+PCN+  CDW+E+PN L + RWYATN ILPDGR II+GGR++FNYEFYP++    
Sbjct  141   VVRTFSPCNNDNCDWLELPNYLIQRRWYATNQILPDGRVIIVGGRQQFNYEFYPRSSQNQ  200

Query  605   GGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAM  784
             GG     L FL +T D   ENNLYP++ L  DG+LFIFAN K+I++DY ++A+VR  P +
Sbjct  201   GGPRTIWLEFLRQTTDQD-ENNLYPFLHLLPDGNLFIFANTKSIIFDYSQNAIVRELPNI  259

Query  785   PDGQPRSYPSTGSAVLLPL-KNLQAPG-IVAEVLICGGAPKGAFPASERGVFMGALNTCG  958
             P G PR+YPSTGS+VLLPL +N  + G I  E+++CGGAP+ ++  +  G F+ AL TCG
Sbjct  260   PGGDPRNYPSTGSSVLLPLDENTPSNGSIEVEIMVCGGAPRKSYVLALHGEFINALGTCG  319

Query  959   RIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYH  1138
             R+ + DPNP W +E MP+ R+M DM+ LP G+++IINGAAQG+AG+ +GR+PV TPV+Y 
Sbjct  320   RLNVYDPNPRWVVELMPVPRVMADMLLLPTGDVVIINGAAQGAAGWENGRDPVTTPVIYR  379

Query  1139  TDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEA  1318
                 +  RF ++  S   R+YHSTA+L+ D R+LVGGSNPH  Y F  G  + T+L LEA
Sbjct  380   PSEVLNHRFSVMIGSPRARLYHSTAVLVPDGRILVGGSNPHAYYNF-TGVEYQTDLSLEA  438

Query  1319  FSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHS  1498
             FSPPYL      +RP I         GY ++I ++          +++  +VAPSFTTHS
Sbjct  439   FSPPYLSEEYDPVRPRIA--AIDVVIGYRQLISVEILVPESQSVRVLSARLVAPSFTTHS  496

Query  1499  FSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             F+ +QR++ L   G V  V   TY ++ V P +  ++P GYY+LFVVH  IPS   W+++
Sbjct  497   FAMNQRMVILKLIG-VTHVAAGTYRVSLVGPSTAEIAPPGYYLLFVVHADIPSSAAWVRV  555



>emb|CDY44816.1| BnaCnng11720D [Brassica napus]
Length=552

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/525 (51%), Positives = 366/525 (70%), Gaps = 16/525 (3%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWE+LLP+IGI+AMHMQLL+N  V++FDRTDFG+SN+ L GG CR DP +  VK DC+AH
Sbjct  37    RWEVLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNLSLPGGMCRFDPSDTAVKFDCSAH  96

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YD+  NT R L VQTD WCSS +V+P+GTL+QTGG+NDG+   R+F PC   + CDW
Sbjct  97    SVLYDIVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDW  156

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPG-GDLLYNLPFLAETNDP  655
             +E P  L + RWYATN ILPDGR I++GGR +FN+E +P+    G       FL ET D 
Sbjct  157   IEFPQYLAQRRWYATNQILPDGRIIVVGGRRQFNFEIFPRPDSHGYRGSRFDFLRETTDG  216

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
              +ENNLYP+++L  DG+LF+FAN ++I++DY  + +VR +P +P G PR+YPS+GS++L 
Sbjct  217   SSENNLYPFLYLLPDGNLFVFANTRSIVFDYKMNRIVREFPEIPGGDPRNYPSSGSSILF  276

Query  836   PL---KNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             PL   KN+      AE+++CGGAPK AFP A  +  F  A +TCGR+R+T  NP+W MET
Sbjct  277   PLDESKNIME----AEIMVCGGAPKDAFPRAKSQQGFRRATSTCGRLRLTSLNPIWEMET  332

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MP+ R+MGDM+ LP G+I+I+NGA  G+AG+ + R+PV  PV+YH   P   RF I++ S
Sbjct  333   MPLPRVMGDMLLLPTGDIIIVNGAGAGTAGWENARDPVTRPVIYH---PFDRRFSIMSTS  389

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
               PRMYHS+A+LL D RVLVGGSNPH  Y F N   +PTEL LEA+SPPYL   +  IRP
Sbjct  390   SRPRMYHSSAVLLPDGRVLVGGSNPHIYYNFTN-VEYPTELSLEAYSPPYLSFTSDSIRP  448

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
             HI    +     Y ++  + F+    +  +L++V +VAPSFTTHSF+ +QR++ L     
Sbjct  449   HIL--TNDKVISYKRLFNVHFSIPLFLTIDLLSVRIVAPSFTTHSFAMNQRMVILKLLSV  506

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                   N+Y + A+ P +  ++P GYYM+F+VH GIPS G W+Q+
Sbjct  507   THEDLTNSYKLDALGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQI  551



>ref|XP_006357288.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=570

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/571 (51%), Positives = 390/571 (68%), Gaps = 28/571 (5%)
 Frame = +2

Query  26    NFTLLFALWQLFLVA---------APPPWSRNMFAAA-------AGGGRWELLLPNIGIA  157
             +FT +FAL+ LF ++         +   + R   +++          G+W LL  +IGI+
Sbjct  7     SFTFIFALFLLFPLSCNSSHKHDTSQKSYHRQHSSSSFDQKNSDHTKGKWILLHKSIGIS  66

Query  158   AMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVR  337
             AMHMQLL+N+KVVIFDRTDFG SN+ L  G+CR +  +  +KVDCTAHS+ Y+VA NT R
Sbjct  67    AMHMQLLHNNKVVIFDRTDFGSSNLSLPRGKCRYN--DEAIKVDCTAHSILYNVATNTYR  124

Query  338   PLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK-CDWVEIPNALHRWRW  514
             PLMVQTDVWCSS AV  +GTLIQTGG++DG+  +R+F+PCND++ CDW E+   L   RW
Sbjct  125   PLMVQTDVWCSSGAVNSNGTLIQTGGYHDGERKIRLFSPCNDEETCDWTELQQNLTVKRW  184

Query  515   YATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLN  694
             Y+T+HILPDGR +IIGGR  ++YEF+P+    + +++LPFL ET DP  ENNLYP+++L 
Sbjct  185   YSTDHILPDGRIMIIGGRNAYSYEFFPQNSNTNYVFHLPFLKETTDPKEENNLYPFLYLL  244

Query  695   VDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAP-GIVA  871
              DG+++IFAN ++I+ DY K+ VVR +P +P G+ RSYP+TGS+V+LP+K +      V 
Sbjct  245   PDGNVYIFANQRSIVLDYAKNRVVREFPVIP-GEKRSYPATGSSVMLPMKLVAGDFSPVV  303

Query  872   EVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNG  1051
             EV++CGGA  GAF  +  G FM A  TCGRI+ITDP+P W ME MP  R+M DM+ LP G
Sbjct  304   EVMVCGGANGGAFLQAAVGGFMPASRTCGRIKITDPDPKWVMEDMPSGRVMPDMLLLPTG  363

Query  1052  NILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV-GTRFEILNPSGIPRMYHSTAILLRD  1228
             +++I+NGA++G+AG+    +PV  PVLY  D P    RF +LNP+ IPRMYHS+A LL D
Sbjct  364   DVIILNGASKGTAGWESAIDPVLNPVLYEPDQPDPNKRFSVLNPTSIPRMYHSSATLLPD  423

Query  1229  SRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP-HITLPGSHSKFGYG  1405
              R+LVGGSNPH  Y F  G  +PTEL LEAF PPYL    + +RP + T+ G  S   YG
Sbjct  424   GRILVGGSNPHIRYNF-TGVKYPTELSLEAFMPPYLSPHHSQLRPSNTTVEGPVS---YG  479

Query  1406  KVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAV  1585
             +   + FT     D   V VTM+APSFTTHSF+ +QRLL L     ++ +   T  +   
Sbjct  480   QKFSVTFTLGVSQDMKEVMVTMIAPSFTTHSFAMNQRLLIL-DIVEIQQLSSFTQKIMVY  538

Query  1586  TPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              P S N++P GYYM+FVVHKG+P   IW++M
Sbjct  539   APPSRNIAPLGYYMVFVVHKGVPGHSIWVKM  569



>ref|XP_006849171.1| hypothetical protein AMTR_s00027p00177380 [Amborella trichopoda]
 gb|ERN10752.1| hypothetical protein AMTR_s00027p00177380 [Amborella trichopoda]
Length=557

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/534 (54%), Positives = 373/534 (70%), Gaps = 15/534 (3%)
 Frame = +2

Query  95    MFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEV  274
             + + A+GGG W+L+  +IGI+AMHM LL ND+V+IFDRTDFG SN+ L  GRCR+DP++ 
Sbjct  32    VLSLASGGGEWKLMKRSIGISAMHMALLPNDRVIIFDRTDFGPSNVSLPKGRCRKDPHDQ  91

Query  275   VVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNP  454
              ++ DC AHSVE D+  + VR L +QTD WCSS A+ PDG LIQTGG+NDG+ VVR F+P
Sbjct  92    ALQTDCWAHSVELDLVTHAVRSLTLQTDTWCSSGALAPDGHLIQTGGFNDGERVVRTFSP  151

Query  455   CNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNLP  631
             C+D  CDW E P+ L   RWYA+N ILPDGR I++GGR+EF+YEF PKT P     Y L 
Sbjct  152   CSD--CDWAETPDGLAVRRWYASNQILPDGRIIVVGGRKEFSYEFVPKTDPSEQCTYPLD  209

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL+ET D   ENNLYP+V L  DG LF+F+N KAI  DY+ H VVR +PA+  G+ R+YP
Sbjct  210   FLSETRDE-CENNLYPFVHLLPDGTLFLFSNTKAISLDYMTHRVVRTFPAL-SGESRNYP  267

Query  812   STGSAVLLPL---KNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPN  982
             STGS+ +LPL    N   P + AEVL+CGGAP  +   + +G+F+ A  TCGRI+ TD +
Sbjct  268   STGSSAMLPLILAVNSTQP-VDAEVLVCGGAPSHSNFQANKGLFLPASRTCGRIKATDDS  326

Query  983   PVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTR  1162
             P W +E MP+ R+MGDM+ LP G +LIINGA +G+AG+G GR+PV +PVLY  D P+G R
Sbjct  327   PEWSIEAMPLNRVMGDMIMLPTGEVLIINGARKGTAGWGVGRDPVLSPVLYKPDEPIGHR  386

Query  1163  FEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDA  1342
             FE+L+P+ IPR+YHS+A LL D RVLVGGSNP+  Y F +G LFPTEL L+ FSPPY+  
Sbjct  387   FEVLSPASIPRLYHSSAHLLPDGRVLVGGSNPNMRYNF-SGVLFPTELSLDIFSPPYMKL  445

Query  1343  ATAGIRPHIT--LPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQR  1516
              ++  RP IT   PG    +     I I+         + + VTMVAPSFTTHS S +QR
Sbjct  446   KSS--RPRITSIKPGRTLSYSQHFFINIEMKEKAIKGVDTILVTMVAPSFTTHSVSMNQR  503

Query  1517  LLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             LL L   G +K     +Y +  V PGS  L+P GYY+L++VH G PS G+W+++
Sbjct  504   LLVLTVMG-LKGGHDGSYRVECVPPGSAVLAPPGYYLLYLVHGGSPSRGVWVRL  556



>ref|XP_009594288.1| PREDICTED: uncharacterized protein LOC104090813 [Nicotiana tomentosiformis]
Length=581

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/538 (52%), Positives = 377/538 (70%), Gaps = 17/538 (3%)
 Frame = +2

Query  92    NMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYE  271
             + F +   GG W  L  +IG++AMHMQLL N+KVVIFDRTDFG SN+ L  G+CR +  +
Sbjct  51    SFFTSTESGGEWVTLQESIGVSAMHMQLLYNNKVVIFDRTDFGPSNLSLPDGKCRYN--D  108

Query  272   VVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFN  451
               + VDCTAHS+ YDV+ NT RPLMVQTDVWCSS AV  DGTLIQTGG++ GDH +R+F+
Sbjct  109   EALDVDCTAHSLLYDVSSNTFRPLMVQTDVWCSSGAVNSDGTLIQTGGYHAGDHKIRLFS  168

Query  452   PCND-KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNL  628
             PC+D   CDW E+P  L   RWYA++HILPDGR II+GGR  F+YEF+PK     + Y L
Sbjct  169   PCDDVDHCDWTELPQNLTVQRWYASDHILPDGRVIIVGGRRAFSYEFFPKNVNDSVFY-L  227

Query  629   PFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSY  808
              FL ET D   ENNLYP++++  DG+L+IFAN K+++ DY+ + +V+ +P +P G+ RSY
Sbjct  228   KFLKETTDHKEENNLYPFLYILPDGNLYIFANQKSVVLDYVNNKIVKEFPMIP-GEKRSY  286

Query  809   PSTGSAVLLPLK-----NLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRIT  973
             P+TGS+V+LPL+     + Q P  V E++ICGGA  GA+  +++GVFM A +TCGR+R+T
Sbjct  287   PATGSSVMLPLRLTTGDSAQNP--VVEMMICGGASGGAYIKAQKGVFMRASSTCGRMRLT  344

Query  974   DPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV  1153
             DP+P W ME MPM R+M DM+ LP G+++I+NGA++G+AG+ +  +PV  PVLY  + P 
Sbjct  345   DPDPKWVMEAMPMGRVMPDMLLLPTGDVIILNGASKGTAGWENAFDPVLNPVLYSPNEPD  404

Query  1154  -GTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPP  1330
                RF +LNPS IPRMYHS+A LL D R+LVGGSNPH  Y F  G  +PTEL LEAFSPP
Sbjct  405   PSKRFSVLNPSTIPRMYHSSATLLPDGRILVGGSNPHVRYNF-TGVRYPTELSLEAFSPP  463

Query  1331  YLDAATAGIRPHI-TLPGSHSKF-GYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFS  1504
             YL    + +RP I  + G  S F  YG+   I FT         + V+M+APSFTTHSF 
Sbjct  464   YLAPQNSYLRPSILAVEGQISGFLSYGQQFSITFTLGFYQPEEELMVSMIAPSFTTHSFG  523

Query  1505  QHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              +QRLL L     ++ + +  Y +T V P S N++P GYYM+FVVH+ +P + +W+++
Sbjct  524   MNQRLLVL-DILEIEQLSMFAYKVTVVAPPSRNIAPPGYYMIFVVHQNVPGQCVWVRI  580



>emb|CBI19807.3| unnamed protein product [Vitis vinifera]
Length=486

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/552 (53%), Positives = 363/552 (66%), Gaps = 76/552 (14%)
 Frame = +2

Query  23    RNFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIF  202
             R     F  WQL    AP P  R +  AA  GG W+LLL NIGI AMHMQLL+ND+VVIF
Sbjct  10    RTLIFPFLCWQLLF--APGPCCRVLTHAA--GGEWQLLLKNIGITAMHMQLLHNDRVVIF  65

Query  203   DRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAV  382
             DRTDFG SN+ L  G+CR DP + V+ +DCTAHSVEYDVA N++R LMVQTDV       
Sbjct  66    DRTDFGKSNLSLPDGKCRNDPNDTVLPIDCTAHSVEYDVATNSIRALMVQTDV-------  118

Query  383   MPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIG  562
                                                        W ++  ++ +G  I  G
Sbjct  119   -------------------------------------------WCSSGAVMANGNLIQTG  135

Query  563   GREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILY  742
             G   FN         GD         +TND G ENNLYP+V+L+ DG+LFIF+NN+AIL+
Sbjct  136   G---FN--------DGD--------PQTNDRGIENNLYPFVYLHTDGNLFIFSNNRAILF  176

Query  743   DYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASE  922
             DY K+ VV+ +P +P G PR YPSTGSAV+LPL NLQA  I  EVL+CGGAP G++  + 
Sbjct  177   DYAKNVVVKTFPTIPGGDPRCYPSTGSAVMLPL-NLQASSIEVEVLVCGGAPTGSYTQAS  235

Query  923   RGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGD  1102
             +G F+GAL TC RI+ITD +P W METMP+AR+MGDM  LPNG++LIINGA+ G+AG+ +
Sbjct  236   KGNFVGALKTCARIKITDSSPQWVMETMPLARVMGDMTLLPNGDVLIINGASAGTAGWEN  295

Query  1103  GRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGN  1282
             GR+PV  PVLY  D P G+RFE++NP+ IPRMYHSTAILLRD RVLVGGSNPH  Y F  
Sbjct  296   GRDPVLKPVLYKPDKPTGSRFEVMNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYKF-T  354

Query  1283  GALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVT  1462
             G L+PTELRLEAFSP YLD+    +RP I  P S +K GYGK + ++F+  G +D + V+
Sbjct  355   GVLYPTELRLEAFSPEYLDSGFKNLRPTIISPTSQAKIGYGKDLTVRFSVTGTLDPDTVS  414

Query  1463  VTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVH  1642
             VTM+APSFTTHS S +QRLL LG G  VK    +T+ +   TP S  L+P+GYY+LFVVH
Sbjct  415   VTMLAPSFTTHSLSMNQRLLVLGSGN-VKNAEKSTFAIAVTTPASAILAPSGYYVLFVVH  473

Query  1643  KGIPSEGIWIQM  1678
             +GIPSEGIW+Q+
Sbjct  474   QGIPSEGIWVQI  485



>ref|XP_009619752.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=598

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/524 (53%), Positives = 372/524 (71%), Gaps = 12/524 (2%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G+W LL  +IG++AMHMQLL+N+KVVIFDRTDFG SN+ L  G+CR +  +  ++VDCTA
Sbjct  82    GKWILLQKSIGVSAMHMQLLHNNKVVIFDRTDFGASNLSLPQGQCRYN--DEAIRVDCTA  139

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC-NDKKCD  475
             HS+ YDVA NT RPLMV TDVWCSS AV P+GTLIQTGG++ G+  +R+F+PC ND+ CD
Sbjct  140   HSILYDVATNTYRPLMVHTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCINDEHCD  199

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDP  655
             W E+P  L   RWYA++HILPDGR II+GGR  F+YEF+P+    + ++ LPFL ET DP
Sbjct  200   WTELPQNLTVKRWYASDHILPDGRVIIVGGRRAFSYEFFPQNSQNNGIFYLPFLKETTDP  259

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP+++L  DG+++IFAN ++++ DY+ + ++R +P +P G+ R+YP+TGS+V+L
Sbjct  260   KEENNLYPFLYLLPDGNIYIFANQRSVVLDYVNNKIIREFPLIP-GEKRTYPATGSSVML  318

Query  836   PLKNL-QAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPM  1012
             P+K +  A   V EV++CGGA  GAF  +E+GVF+ A  TCGR+RITD +PVW ME MPM
Sbjct  319   PMKLVASASSPVVEVMVCGGANGGAFTQAEKGVFLPASRTCGRMRITDLDPVWIMEDMPM  378

Query  1013  ARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV-GTRFEILNPSGI  1189
              R+M DM+ LP G+++I+NGA++G+AG+    +PV  PVLY  + P    RF +L PS I
Sbjct  379   GRVMPDMLLLPTGDVIILNGASKGTAGWESAIDPVLNPVLYKPNEPDPSKRFTVLKPSNI  438

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHS A LL D R+LVGGSNPH  Y F  G  +PTEL LEAF PPYL    + +RP I
Sbjct  439   PRMYHSAATLLPDGRILVGGSNPHIRYNF-TGVQYPTELSLEAFRPPYLAPEHSHLRPSI  497

Query  1370  -TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
              T+ G  S   YG+   I FT         + V+M+APSFTTHSF+ +QRLL L     V
Sbjct  498   LTVEGPVS---YGQKFSITFTLGFFQPAKELMVSMIAPSFTTHSFAMNQRLLIL-DVVEV  553

Query  1547  KPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             + + +    +T   P S N++P GYYM+FVVHKG+P    WI+M
Sbjct  554   QRLSLFAQKITVCAPPSRNIAPPGYYMVFVVHKGVPGHSSWIRM  597



>gb|EYU23055.1| hypothetical protein MIMGU_mgv1a021812mg, partial [Erythranthe 
guttata]
Length=517

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/520 (53%), Positives = 354/520 (68%), Gaps = 7/520 (1%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G W LL  +IGI+AMHMQLL N+K+VIFDRTDFG SN+ L  GRCR DP + V+  DCTA
Sbjct  4     GEWRLLHESIGISAMHMQLLKNNKLVIFDRTDFGPSNLSLPDGRCRSDPNDEVLVRDCTA  63

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDW  478
             HS+ YD+  N+ RPL + TD WCSS  V+PDGTL+QTGG+NDGDHV R   PC  K CDW
Sbjct  64    HSIMYDIGSNSFRPLTILTDTWCSSGTVLPDGTLVQTGGFNDGDHVTRTLAPCARKNCDW  123

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPG  658
              E P++L R RWYATN ILPDGR II+GGR +FNYEFYP+   GD    L FL E  D G
Sbjct  124   NEFPDSLSRRRWYATNQILPDGRIIIVGGRAQFNYEFYPRN-YGDGSIRLRFLKEARD-G  181

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
             +ENNLYP++ L  DG+LF+FAN ++I+ DY +H VVR +PA+  G  R+YPS+GS+VLLP
Sbjct  182   SENNLYPFLHLLPDGNLFVFANTRSIVLDYKRHRVVREFPAIHGGDSRNYPSSGSSVLLP  241

Query  839   LKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMAR  1018
             +     P +  EVLICGGA   A+  +++G F+ A +TCGR+RI+D +P W ME MPM R
Sbjct  242   IDENVTP-VRVEVLICGGAKNNAYEQADQGTFLRASSTCGRLRISDRHPAWKMEAMPMPR  300

Query  1019  LMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRM  1198
             +MGDMV LPNG+++IINGA  G+AG+  GRNPV  PV+Y  D   G RF ++  SG PRM
Sbjct  301   VMGDMVLLPNGDVIIINGAGSGAAGWEAGRNPVTRPVIYRPDGGSGNRFSVMAASGRPRM  360

Query  1199  YHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLP  1378
             YHSTA+L+ D RV VGG NPH  Y F +G  FPT+L LE+FSPPYL      +RP I   
Sbjct  361   YHSTAVLIPDGRVFVGGGNPHIYYNF-SGVDFPTDLSLESFSPPYLSPHYDRLRPRIV--  417

Query  1379  GSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVG  1558
                   GY     ++F        + V+V +VAP F THSFS +QR++ L        +G
Sbjct  418   EIEETLGYTAPFLVRFRVPEFRRMSEVSVRIVAPPFNTHSFSMNQRMVVLRWDEAAY-IG  476

Query  1559  INTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              + Y + A  P +  ++P GYY+LF+VH GIPS G WI++
Sbjct  477   GDVYEVAAFGPSTAEIAPPGYYLLFLVHSGIPSSGAWIKI  516



>ref|XP_006382737.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP60534.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=550

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/532 (53%), Positives = 373/532 (70%), Gaps = 8/532 (2%)
 Frame = +2

Query  86    SRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDP  265
             S+   ++    GRW+LL  ++GI+AMHMQL++++KVVI+DRTDFG SNI L GG CR DP
Sbjct  25    SQTTPSSDGSHGRWDLLSESVGISAMHMQLMHDNKVVIYDRTDFGPSNISLPGGLCRADP  84

Query  266   YEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRV  445
             Y+  +K+DCTAHS+ YD   +T RPLM+QTD WCSS AV+P+GTL+QTGG++DGD+V R+
Sbjct  85    YDDALKIDCTAHSILYDTITDTYRPLMIQTDTWCSSGAVLPNGTLVQTGGFHDGDNVTRM  144

Query  446   FNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYN  625
             F PC +  CDWVE P  L R RWYATN ILPDGR IIIGGR EFNYEF+P++      + 
Sbjct  145   FTPCTNDSCDWVEFPKYLSRRRWYATNQILPDGRIIIIGGRREFNYEFFPRS-SPRRTFQ  203

Query  626   LPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRS  805
             L FL ET +   ENNLYP+  L  DG+LFIFAN ++IL+DY ++ VVR +P++P G PR+
Sbjct  204   LSFLRETREGDVENNLYPFAHLLPDGNLFIFANTRSILFDYNQNRVVREFPSIPGGDPRN  263

Query  806   YPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNP  985
             YPSTGS+VLLPL   +   I  EVL+CGGAP GAF  + RG F+ A  TCGR+R+TD N 
Sbjct  264   YPSTGSSVLLPLDENEY-RIDPEVLVCGGAPNGAFQLAARGTFVRATPTCGRLRVTDQNA  322

Query  986   VWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRF  1165
              W METMP+ R MGDM+ LP G++++ING   G+AG+  GR P   PV+YH  +P   RF
Sbjct  323   SWVMETMPIPRAMGDMLLLPTGDVIVINGVQLGTAGWELGRLPATRPVIYHPSHPSDQRF  382

Query  1166  EILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAA  1345
              ++ PS  PRMYHS AILL D RVLVGG NPH  Y F N  ++PT+L LE FSPPYL   
Sbjct  383   SVMPPSPRPRMYHSAAILLADGRVLVGGGNPHVYYNFTN-VVYPTDLSLETFSPPYLSTD  441

Query  1346  TAGIRPHI-TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLL  1522
              A +RP I ++ G+ S+   G+   + F+    +  ++++V +VAPSFTTHSFS +QR++
Sbjct  442   YASVRPVILSVDGTISR---GQRFLVSFSVEEYLTQSVLSVRIVAPSFTTHSFSMNQRMV  498

Query  1523  DLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              L     +     ++Y  +   P S  ++P GYYMLFVVH GIPS G+W+++
Sbjct  499   VLKIDDIIYD-DTSSYTSSVFGPSSSEIAPPGYYMLFVVHSGIPSSGVWVRI  549



>ref|XP_006828863.1| hypothetical protein AMTR_s00001p00165980 [Amborella trichopoda]
 gb|ERM96279.1| hypothetical protein AMTR_s00001p00165980 [Amborella trichopoda]
Length=546

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/525 (54%), Positives = 366/525 (70%), Gaps = 11/525 (2%)
 Frame = +2

Query  113   GGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDC  292
             GGG WE+L  +IGI+AMHMQL+ NDKVV+FDRTDFG SNI L  G+CR DP++  +  DC
Sbjct  29    GGGAWEVLQQSIGISAMHMQLMPNDKVVMFDRTDFGSSNISLPSGQCRTDPHQEALTHDC  88

Query  293   TAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKC  472
             +AHSVEY +A N++RPL +QTD WCSS ++  +G LIQTGG+ DGD VVR  + C+   C
Sbjct  89    SAHSVEYTIATNSIRPLTIQTDTWCSSGSLDRNGQLIQTGGFRDGDRVVRTISSCD--AC  146

Query  473   DWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETND  652
             DW E P  L   RWYAT+ ILPDGR II+GGR ++NYEFYP+      L+ L FL ET+D
Sbjct  147   DWTEYPENLAVRRWYATDLILPDGRIIIVGGRRQYNYEFYPQQNPN--LFELGFLRETSD  204

Query  653   PGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVL  832
                ENNLYP++ L  DG LFIF N +A+L+DY  + V+R  PA+P G+PR+YPS+GS+VL
Sbjct  205   QD-ENNLYPFLHLLPDGTLFIFTNTRAVLFDYNGNRVLRELPAIPGGEPRNYPSSGSSVL  263

Query  833   LPLKNLQAPGIVA--EVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             LPL      G     E+L+CGGAP G+F  + +G F+ A +TCGRIR  DP   W METM
Sbjct  264   LPLTLTGEAGQETDPEILLCGGAPFGSFDKAVQGEFLEASSTCGRIRPMDPQAQWAMETM  323

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             PM R+MGDM+ LPNG +LIINGA  G+AG+  GRNPV+TPV+Y    P+G RF++LNPS 
Sbjct  324   PMGRVMGDMLLLPNGEVLIINGAGNGTAGWEFGRNPVKTPVIYSPSLPLGQRFQVLNPSS  383

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
              PR+YHSTA ++ D RVLVGGSNPH  Y F N   FPT+L LEAF PPYL       RP 
Sbjct  384   TPRLYHSTATVIPDGRVLVGGSNPHTLYQFYNQE-FPTDLSLEAFLPPYLSMQHLTRRPR  442

Query  1367  ITLPGSHSK-FGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
             I    S+++   Y +  E+ +  A P+    +TV ++APSFTTHSF  +QRLL L   G 
Sbjct  443   IV--SSYTQPLSYAQPTEVMYFLADPLPMGEITVRLLAPSFTTHSFGMNQRLLTLKVAGE  500

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             V  + + TY +T + P + N++P GYYM+FVVH G+PS G+W+QM
Sbjct  501   VVQLSLFTYRVTVLAPPNPNIAPPGYYMMFVVHSGVPSAGVWVQM  545



>ref|XP_003561804.1| PREDICTED: galactose oxidase-like [Brachypodium distachyon]
Length=569

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/540 (54%), Positives = 361/540 (67%), Gaps = 27/540 (5%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RW++L  +IG++AMHMQLL ND+V+IFDRTDFG SN+ L  GRCR++P+E V+ VDCTAH
Sbjct  34    RWDILQHSIGVSAMHMQLLRNDRVIIFDRTDFGPSNLSLPDGRCRRNPHERVLPVDCTAH  93

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWV  481
             S EYDV  N  RPL V TD WCSS  V PDGTL+QTGGWNDG    R   PC D  CDW 
Sbjct  94    SAEYDVRTNAFRPLSVFTDTWCSSGTVSPDGTLVQTGGWNDGYRNARTMAPCVDGTCDWN  153

Query  482   EIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPG--GDLLYNLPFLAETNDP  655
             E  +AL   RWYATN ILPDGR  I+GGR +F+YEFYPK      D +  LPFL +T DP
Sbjct  154   ETQDALAANRWYATNQILPDGRAFIVGGRRQFSYEFYPKQADHPSDAI-ALPFLVQTKDP  212

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP+V LN+DG+LFIFA N+A+L DY ++ +VR YP +  G PR+YPS+GS+VLL
Sbjct  213   -EENNLYPFVHLNIDGNLFIFAKNRAVLLDYKRNKIVRTYPELAGGDPRNYPSSGSSVLL  271

Query  836   PLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMA  1015
             PLK   +P   AEVL+CGGAP G++ A++   F  AL TCGRIRITD  P W +ETMP  
Sbjct  272   PLK--PSP-TEAEVLVCGGAPAGSYNATKDKSFPPALTTCGRIRITDAAPSWTIETMPSP  328

Query  1016  RLMGDMVTLPNG-NILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIP  1192
             R+MGDM+ LPNG  + IINGA  GSAG+     P   P++Y  D+  G RFE  + SGI 
Sbjct  329   RVMGDMILLPNGAEVAIINGATDGSAGWESANTPAYAPLIYRPDHAPGDRFEEQSASGIA  388

Query  1193  RMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHIT  1372
             R+YHS+A+LLRD RVLVGGSNPH  Y F N   +PTEL LEAFSP YLD     +RP IT
Sbjct  389   RLYHSSAVLLRDGRVLVGGSNPHVYYNFSN-VRYPTELSLEAFSPEYLDRTNDVLRPAIT  447

Query  1373  LP---GSHSKFGYGKVIEIQFTA-AGPVDGN-------------LVTVTMVAPSFTTHSF  1501
              P   G+ +   YG  + +QF+  A P   +              V+VTMVAPSFTTHSF
Sbjct  448   DPSPTGAPASVTYGGSMTLQFSVPAAPAPSSRRAHGGGGGGGLGFVSVTMVAPSFTTHSF  507

Query  1502  SQHQRLLDLGGGGTVKPVGI-NTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               +QRLL L    T         Y ++ V P +  ++P GYY++FVV+  IPSEGIW+ +
Sbjct  508   GMNQRLLFLDVLETAASSSTPGAYEVSVVMPATAVIAPPGYYLVFVVNGHIPSEGIWVHI  567



>ref|XP_009779182.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=596

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/524 (53%), Positives = 373/524 (71%), Gaps = 12/524 (2%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G+W LL  +IG++AMHMQLL+N+KVVIFDRTDFG SN+ L  G+CR +  +  ++VDCTA
Sbjct  80    GKWILLQKSIGVSAMHMQLLHNNKVVIFDRTDFGASNLSLPQGQCRYN--DEAIRVDCTA  137

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCD  475
             HS+ YDVA NT RPLMV TDVWCSS AV P+GTLIQTGG++ G+  +R+F+PCN D+ CD
Sbjct  138   HSILYDVATNTYRPLMVTTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCNNDEHCD  197

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDP  655
             W E+P  L   RWY+++HILPDGR II+GGR  F+YEF+P+    + ++ LPFL ET DP
Sbjct  198   WTELPQNLTVKRWYSSDHILPDGRVIIVGGRRAFSYEFFPQNSQNNGIFYLPFLKETTDP  257

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP+++L  DG+++IFAN ++I+ DY+ + ++R +P +P G+ R+YP+TGS+V+L
Sbjct  258   KEENNLYPFLYLLPDGNIYIFANQRSIVLDYVNNKIIREFPPIP-GEKRTYPATGSSVML  316

Query  836   PLKNL-QAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPM  1012
             P+K +  A   V EV++CGGA  GAF  +E+GVF+ A  TCGR+RITDP+PVW ME MPM
Sbjct  317   PMKLVASASSPVVEVMVCGGANGGAFSQAEKGVFLPASRTCGRMRITDPDPVWVMEDMPM  376

Query  1013  ARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDN-PVGTRFEILNPSGI  1189
              R+M DM+ LP G+++I+NGA++G+AG+    +PV  PVLY  +   +  RF +L PS I
Sbjct  377   GRVMPDMLLLPTGDVIILNGASKGTAGWESAIDPVLNPVLYKPNELDLSKRFTVLKPSNI  436

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHS A LL D R++VGGSNPH  Y F  G  +PTEL LEAF PPYL    + +RP I
Sbjct  437   PRMYHSAATLLPDGRIVVGGSNPHIRYNF-TGVQYPTELSLEAFRPPYLAPEHSHLRPSI  495

Query  1370  -TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTV  1546
              T+ G  S   YG+   I FT         + V+M+ PSFTTHSF+ +QRLL L   G V
Sbjct  496   LTVEGPVS---YGQKFSITFTLGFYQPAKELMVSMIPPSFTTHSFAMNQRLLILDVVG-V  551

Query  1547  KPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             + + +    +T   P S N++P GYYM+FVVH+G+P    WI+M
Sbjct  552   QRLSLFAQKITVCAPPSRNIAPPGYYMVFVVHRGVPGHSSWIRM  595



>ref|XP_006290310.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
 gb|EOA23208.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
Length=547

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/520 (50%), Positives = 357/520 (69%), Gaps = 11/520 (2%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWE+LLP+IGI+AMHMQLL+N  V++FDRTDFG SN+ L GG CR DP +  VK DC+AH
Sbjct  37    RWEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGTSNVSLPGGVCRYDPTDTAVKFDCSAH  96

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDV  NT RPL VQTD WCSS AV+P+GTL+QTGG+NDG+   R F PC   + CDW
Sbjct  97    SVLYDVVSNTFRPLQVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARTFTPCGYSETCDW  156

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPG  658
             +E P  L + RWYATN ILPDGR I++GGR +FN+EF+P+           FL ET+D  
Sbjct  157   IEFPQYLSQRRWYATNQILPDGRIIVVGGRRQFNFEFFPRHSSRSRSSRFEFLRETSDGS  216

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
              ENNLYP++ L  DG+LF+FAN ++I++DY ++ VV+ +P +P G PR+YPS+GS++L P
Sbjct  217   NENNLYPFIHLLPDGNLFVFANTRSIVFDYKRNRVVKEFPEIPGGDPRNYPSSGSSILFP  276

Query  839   LKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMAR  1018
             L       +  E+++CGG+P+G F    RG F  A +TCGR++++D NP W METMP+ R
Sbjct  277   LDETNGTDVQVEIMVCGGSPRGGF---SRG-FTRATSTCGRLKLSDQNPSWEMETMPLPR  332

Query  1019  LMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRM  1198
             +MGDM+ LP G+++I+NGA  G+AG+   R+PV  P++YH   P    F +++    PRM
Sbjct  333   VMGDMLLLPTGDVIIVNGAGTGTAGWEKARDPVIQPLIYH---PFDRLFSVMSTPTRPRM  389

Query  1199  YHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLP  1378
             YHS+A+LL D RVLVGGSNPH  Y F N   +PT+L LEA+SPPYL   +  IRP I   
Sbjct  390   YHSSAVLLPDGRVLVGGSNPHVYYNFTN-VEYPTDLSLEAYSPPYLSFTSDPIRPKILT-  447

Query  1379  GSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVG  1558
              S    GY ++  I F+    +  +L++V +VAPSFTTHSF+ +QR++ L      +   
Sbjct  448   -SDKVLGYKRLFNIDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILNLLSVTRDQL  506

Query  1559  INTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              N+Y +  + P +  ++P GYYM+F+VH GIPS   W+Q+
Sbjct  507   TNSYRVNVLGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQI  546



>ref|XP_002876427.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52686.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/520 (50%), Positives = 358/520 (69%), Gaps = 10/520 (2%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWE+LLP+IGI+AMHMQLL+N  VV+FDRTDFG SN+ L GG CR DP +  VK DC+AH
Sbjct  36    RWEMLLPSIGISAMHMQLLHNGMVVMFDRTDFGTSNVSLPGGICRYDPTDTAVKFDCSAH  95

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDV  NT RPL VQTD WCSS AV+P+GTL+QTGG+NDG+   R+F PC   + CDW
Sbjct  96    SVLYDVVSNTYRPLNVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDW  155

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPG  658
             +E P  L + RWYATN I+PDGR I++GGR +FNYE +P+           FL ET+D  
Sbjct  156   IEFPQYLSQRRWYATNQIIPDGRIIVVGGRRQFNYELFPRHDSRSRSSRFEFLRETSDGS  215

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
              ENNLYP++ L  DG+LF+FAN ++I++DY K+ +V+ +P +P G PR+YPS+GS++L P
Sbjct  216   NENNLYPFLHLLPDGNLFVFANTRSIVFDYKKNRIVKEFPEIPGGDPRNYPSSGSSILFP  275

Query  839   LKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMAR  1018
             L       I  E+++CGG+PKG F       F  A +TCGR++++D NP+W ME+MP+ R
Sbjct  276   LDETNNTDIEVEIMVCGGSPKGGFSHG----FTRATSTCGRLKLSDQNPIWEMESMPLPR  331

Query  1019  LMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRM  1198
             +MGDM+ LP G+++I+NGA  G+AG+   R+PV  PV+Y    P    F +++    PRM
Sbjct  332   VMGDMLLLPTGDVIIVNGAGAGTAGWEKARDPVIQPVIYQ---PFDHLFSVMSTPSRPRM  388

Query  1199  YHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLP  1378
             YHS+A+LL D RVLVGGSNPH  Y F N   +PT+L LEA+SPPYL   +  IRP I L 
Sbjct  389   YHSSAVLLPDGRVLVGGSNPHVYYNFTN-VEYPTDLSLEAYSPPYLSFTSDPIRPKILL-  446

Query  1379  GSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVG  1558
              +     Y ++  + F+ A  +  +L++V +VAPSFTTHSF+ +QR++ L      +   
Sbjct  447   TNDKVLSYKRLFNVDFSIAQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQL  506

Query  1559  INTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              N+Y ++A+ P +  ++P GYYM+F+VH GIPS   W+Q+
Sbjct  507   TNSYRISALGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQI  546



>ref|NP_191321.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 emb|CAB41193.1| putative protein [Arabidopsis thaliana]
 gb|AEE79679.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/520 (50%), Positives = 360/520 (69%), Gaps = 10/520 (2%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWE+LLP+IGI+AMHMQLL+N  V++FDRTDFG SN+ L GG CR DP +   K DC+AH
Sbjct  36    RWEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGTSNVSLPGGICRYDPTDTAEKFDCSAH  95

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDV  NT RPL VQTD WCSS AV+P+GTL+QTGG+NDG+   R+F+PC     CDW
Sbjct  96    SVLYDVVSNTYRPLNVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFSPCGYSDTCDW  155

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPG  658
             +E P  L + RWYATN ILPDGR I++GGR +FNYE +P+         L FL ET+D  
Sbjct  156   IEFPQYLSQRRWYATNQILPDGRIIVVGGRRQFNYELFPRHDSRSRSSRLEFLRETSDGS  215

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
              ENNLYP++ L  DG+LF+FAN ++I++DY K+ +V+ +P +P G PR+YPS+GS++L P
Sbjct  216   NENNLYPFIHLLPDGNLFVFANTRSIVFDYKKNRIVKEFPEIPGGDPRNYPSSGSSILFP  275

Query  839   LKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMAR  1018
             L +     +  E+++CGG+PKG F    RG F  A +TCGR++++D +P W METMP+ R
Sbjct  276   LDDTNDANVEVEIMVCGGSPKGGF---SRG-FTRATSTCGRLKLSDQSPSWEMETMPLPR  331

Query  1019  LMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRM  1198
             +MGDM+ LP G+++I+NGA  G+AG+   R+P+  PV+Y    P    F +++    PRM
Sbjct  332   VMGDMLLLPTGDVIIVNGAGAGTAGWEKARDPIIQPVIYQ---PFDHLFTVMSTPSRPRM  388

Query  1199  YHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLP  1378
             YHS+AILL D RVLVGGSNPH  Y F N   +PT+L LEA+SPPYL   +  IRP I L 
Sbjct  389   YHSSAILLPDGRVLVGGSNPHVYYNFTN-VEYPTDLSLEAYSPPYLFFTSDPIRPKILL-  446

Query  1379  GSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVG  1558
              S     Y ++  + F+ A  +  +L++V +VAPSFTTHSF+ +QR++ L      +   
Sbjct  447   TSDKVLSYKRLFNVDFSIAQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQL  506

Query  1559  INTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              N+Y ++A+ P +  ++P GYYM+F+VH GIPS   W+Q+
Sbjct  507   TNSYRVSALGPSTAEIAPPGYYMIFLVHAGIPSSAAWVQI  546



>ref|XP_004243010.2| PREDICTED: galactose oxidase [Solanum lycopersicum]
Length=527

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/521 (52%), Positives = 367/521 (70%), Gaps = 8/521 (2%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G W LL  +IGI AMHMQLL+N+KVVIFDRTDFG SN+ L  GRCR + +++ ++ DC+A
Sbjct  10    GEWRLLHESIGITAMHMQLLHNNKVVIFDRTDFGHSNLSLPRGRCRYNSHDLALQKDCSA  69

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDW  478
             HSV YD+  NT RPLMVQTD WCSS AV+P+GTL+QTGG+NDGDH+VR   PC D+ CDW
Sbjct  70    HSVLYDIVSNTFRPLMVQTDTWCSSGAVLPNGTLVQTGGFNDGDHIVRSLAPCTDENCDW  129

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPG  658
              E+P  L + RWY+T+HILPD R I+IGGR+++NYEFYPK   GD  ++L FL  T +  
Sbjct  130   FELPRTLVQRRWYSTDHILPDARIIVIGGRKQYNYEFYPKNSRGDSAFSLQFLKSTLE-R  188

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
              ENNLYP+VFL  DG+L IFAN +AI+ +Y ++ VVR  P++P  +PR+YPSTGSAVLLP
Sbjct  189   YENNLYPFVFLLPDGNLVIFANTRAIILNYKENQVVRELPSIPGDEPRNYPSTGSAVLLP  248

Query  839   LKNLQAPGIVAEVLICGGAPKGAFPASER-GVFMGALNTCGRIRITDPNPVWFMETMPMA  1015
             L   +   + AE+++CGGAP+ A+  +++  ++M AL++CGRI + D + +W METMP  
Sbjct  249   LD--ENRPMEAEIMVCGGAPRRAYRYADKYKMYMKALSSCGRINVIDDHGIWEMETMPTR  306

Query  1016  RLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPR  1195
             R+M DM+ LP+G+I+IINGA++G+AG+ +  +PV TPV+Y  +     RF I+  +  PR
Sbjct  307   RVMSDMLILPDGDIIIINGASRGTAGWNNAISPVTTPVIYRPNVRRDNRFSIMKAASRPR  366

Query  1196  MYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITL  1375
             +YHS+AIL+ D RVLVGGSNP   Y F  G  FPT+L LEAFSPPYL    + ++P  T+
Sbjct  367   LYHSSAILMTDGRVLVGGSNPQEYYNF-TGVEFPTDLSLEAFSPPYLARKHSHLKP--TV  423

Query  1376  PGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPV  1555
                     Y       FT    +    V++ ++APSFTTHSFS +QR++ +  G  V  +
Sbjct  424   LSIDEILTYKSSFSATFTVPTFLRIGTVSIRIIAPSFTTHSFSMNQRMV-VLKGVVVVAI  482

Query  1556  GINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               N+Y  TA  P +  ++P GYYMLFVVH GIPS G+W+++
Sbjct  483   SDNSYKFTAFAPSTKEIAPPGYYMLFVVHAGIPSSGVWVKI  523



>ref|XP_010504696.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=547

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/520 (50%), Positives = 359/520 (69%), Gaps = 11/520 (2%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWE+LLP+IGI+AMHMQLL+N  V++FDRTDFG+SN+ L GG CR DP +  VK DCTAH
Sbjct  37    RWEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNVSLPGGICRYDPTDTAVKFDCTAH  96

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDV  N+ RPL VQTD WCSS AV+P+GTL+QTGG+NDG+   R+F PC   + CDW
Sbjct  97    SVLYDVVSNSYRPLQVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDW  156

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPG  658
             +E P  L + RWYATN ILPDGR I++GGR +FNYE +P+           FL ET+D  
Sbjct  157   MEFPQYLSQRRWYATNQILPDGRIIVVGGRRQFNYEIFPRHNSRSRSSRFEFLRETSDGS  216

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
              ENNLYP++ L  DG+LF+FAN ++I++DY  + VV+ +P +P G PR+YPS+GS+VL P
Sbjct  217   NENNLYPFIHLLPDGNLFVFANTRSIVFDYKTNRVVKEFPEIPGGDPRNYPSSGSSVLFP  276

Query  839   LKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMAR  1018
             L       +  E+++CGG+P+G F    RG F+ A +TCGR+R++D NP W METMP+ R
Sbjct  277   LDETNDTNVQVEIMVCGGSPRGGF---SRG-FVRATSTCGRLRLSDQNPSWEMETMPLPR  332

Query  1019  LMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRM  1198
             +MGDM+ LP G+++I+NGA  G+AG+   R+ V  P++YH   P    F +++    PRM
Sbjct  333   VMGDMLLLPTGDVIIVNGAGTGTAGWEKARDLVIQPLIYH---PFDHLFSVMSTPTRPRM  389

Query  1199  YHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLP  1378
             YHS+A+LL D RVLVGGSNPH  Y F N   +PT+L LEA+SPPYL   +  IRP I   
Sbjct  390   YHSSAVLLPDGRVLVGGSNPHVYYNFTN-VEYPTDLSLEAYSPPYLSFTSDPIRPKIL--  446

Query  1379  GSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVG  1558
              S    GY ++  + F+    +  +L++V +VAPSFTTHSF+ +QR++ L      +   
Sbjct  447   TSDKVLGYKRLFNVDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQL  506

Query  1559  INTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              N+Y ++A+ P +  ++P GYYM+F+VH GIPS   W+Q+
Sbjct  507   TNSYRVSALGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQI  546



>ref|XP_009782130.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=588

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/539 (51%), Positives = 377/539 (70%), Gaps = 17/539 (3%)
 Frame = +2

Query  92    NMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYE  271
             + F +   GG W  L  +IG++AMHMQLL N+KVVIFDRTDFG SN+ L  G+CR +  +
Sbjct  56    SFFTSTESGGEWVTLQESIGVSAMHMQLLYNNKVVIFDRTDFGPSNLSLPDGKCRYN--D  113

Query  272   VVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFN  451
               + VDCTAHS+ YDV+ NT RPLMVQTDVWCSS AV  DGTLIQTGG++ GDH +R+F+
Sbjct  114   EALDVDCTAHSLLYDVSSNTFRPLMVQTDVWCSSGAVNSDGTLIQTGGYHAGDHKIRLFS  173

Query  452   PCND-KKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK-TPGGDLLYN  625
             PC+D   CDW E+P  L   RWYA++HILPDGR II+GGR  F+YEF+PK     D ++ 
Sbjct  174   PCDDVDDCDWTELPQNLTVQRWYASDHILPDGRVIIVGGRRAFSYEFFPKNVNNNDGVFY  233

Query  626   LPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRS  805
             L FL ET D   ENNLYP++++  DG+L++FAN ++++ DY+ + +V+ +P +P G+ RS
Sbjct  234   LQFLKETTDFKEENNLYPFLYILPDGNLYMFANQRSVVLDYVNNRIVKEFPVIP-GEKRS  292

Query  806   YPSTGSAVLLPLK-----NLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRI  970
             YP+TGS+V+LPL+     + Q P  V EV+ICGGA  GA+  +++GVF+ A +TCGR+R+
Sbjct  293   YPATGSSVMLPLRLSAGDSAQNP--VVEVMICGGASGGAYIKAQKGVFVRASSTCGRMRL  350

Query  971   TDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNP  1150
             TDP+P W ME MPM R+M DM+ LP G+++I+NGA++G+AG+ +  +PV  PVLY  + P
Sbjct  351   TDPDPKWVMEDMPMGRVMPDMLLLPTGDVIILNGASKGTAGWENAFDPVLNPVLYSPNEP  410

Query  1151  V-GTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSP  1327
                 RF +LNPS IPRMYHS+  LL D R+LVGGSNPH  Y F  G  +PTEL LEAFSP
Sbjct  411   DPSKRFSVLNPSTIPRMYHSSVTLLPDGRILVGGSNPHVRYNF-TGVRYPTELSLEAFSP  469

Query  1328  PYLDAATAGIRPHI-TLPGSHSKF-GYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSF  1501
             PYL    + +RP I  + G  S F  YG+   I FT         + V+M+APSFTTHSF
Sbjct  470   PYLAPQNSHLRPSILAVEGQISGFLSYGQQFSITFTLGFYQPEEELMVSMIAPSFTTHSF  529

Query  1502  SQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
               +QRLL L     ++ + +  Y +T V P S N++P GYYM+FVVH+ +P + +W+++
Sbjct  530   GMNQRLLVL-DILEIEQLSMFAYKVTVVAPPSRNIAPPGYYMIFVVHQNVPGQCVWVRI  587



>ref|XP_008389005.1| PREDICTED: galactose oxidase [Malus domestica]
Length=556

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/534 (51%), Positives = 371/534 (69%), Gaps = 10/534 (2%)
 Frame = +2

Query  92    NMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYE  271
             ++  ++   G+W LL  ++GI+AMHMQLL  +KV++FDRTD+G SNI L  G+CR+DP +
Sbjct  27    DLRPSSGNQGQWHLLHSSVGISAMHMQLLRTNKVIMFDRTDYGPSNISLPRGQCRRDPND  86

Query  272   VVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFN  451
              V+KVDCTAHS+ YD+  NT RPL V TD WCSS +++PDGTL+QTGG+NDGD VVR F+
Sbjct  87    TVLKVDCTAHSILYDLGSNTFRPLTVHTDTWCSSGSILPDGTLVQTGGYNDGDRVVRTFS  146

Query  452   PCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTP---GGDLLY  622
             PCN+  CDW+E+PN L + RWYATN ILPDGR II+GGR +FNYEFYP++    GG    
Sbjct  147   PCNNDNCDWLELPNYLIQRRWYATNQILPDGRVIIVGGRRQFNYEFYPRSSQNQGGPHTI  206

Query  623   NLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPR  802
              L FL +T D   ENNLYP++ L  DG+LFIFAN K+I++DY ++AVVR  P +P G PR
Sbjct  207   WLEFLRQTTDQD-ENNLYPFLHLLPDGNLFIFANAKSIIFDYSQNAVVRELPDIPGGDPR  265

Query  803   SYPSTGSAVLLPL-KNLQAPG-IVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITD  976
             +YPSTGS+VLLPL +N  + G +  E+++CGG P+ +   +  G F+ AL TCGR+ + D
Sbjct  266   NYPSTGSSVLLPLDENTPSNGNMEVEIMVCGGTPRNSHVLALHGEFISALGTCGRLNVYD  325

Query  977   PNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVG  1156
             PNP W +E MP+ R+M DM+ LP G+++IINGAA G+AG+ +GR+PV TPV+Y     + 
Sbjct  326   PNPRWVVEFMPVPRVMADMLLLPTGDVIIINGAALGAAGWENGRDPVTTPVIYRPSEVLN  385

Query  1157  TRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYL  1336
              RF ++  S   R+YHS A+L+ D R+LVGGSNPH  Y F  G  +PT+L LEAFSPPYL
Sbjct  386   RRFSVMTGSSRARLYHSAAVLVPDGRILVGGSNPHIYYNF-TGVEYPTDLSLEAFSPPYL  444

Query  1337  DAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQR  1516
                   +RP I        FGY ++I ++      +   +++  +VAPSFTTHSF+ +QR
Sbjct  445   SDEYDPVRPRIA--AIEDVFGYRQLISVEILVPEFLSVRVLSARLVAPSFTTHSFAMNQR  502

Query  1517  LLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             ++ L   G V  V   TY ++ V P +  ++P GYY+LFVVH  IPS   W+++
Sbjct  503   MVVLKLIG-VTHVAAGTYRVSLVGPSTAEIAPPGYYLLFVVHSDIPSSAAWVRV  555



>ref|XP_010532190.1| PREDICTED: galactose oxidase [Tarenaya hassleriana]
Length=555

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/523 (51%), Positives = 363/523 (69%), Gaps = 11/523 (2%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RW+LL  NIGI+AMHMQLL+ND V++FDRTDFG SNI L GG CR DPY+  VK DCTAH
Sbjct  39    RWQLLQSNIGISAMHMQLLHNDMVIMFDRTDFGTSNISLPGGLCRYDPYDTAVKFDCTAH  98

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDV  NT RPL VQTD WCSS +V+P+GTL+QTGG+NDG+ V+R+F PC   + CDW
Sbjct  99    SVIYDVVSNTYRPLKVQTDTWCSSGSVLPNGTLVQTGGYNDGERVMRMFTPCGYGETCDW  158

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPG  658
             +E P  L   RWYATN ILPDGR I++GGR +FN+EF+P+       +   FL ET+D  
Sbjct  159   IEFPRYLANRRWYATNQILPDGRIIVVGGRRQFNFEFFPRVQSNIRGFRFDFLRETSDGS  218

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
              ENNLYP+V L  DG+LF+FAN ++IL+DY ++ + + YP +P G PR+YPS+GS++LLP
Sbjct  219   NENNLYPFVHLLPDGNLFVFANTRSILFDYRRNKITKEYPEIPGGDPRNYPSSGSSILLP  278

Query  839   LKNLQAP--GIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             L+    P   I  EV++CGGAPKG+F  A+++  F  A++TCGR+R+TD NP W METMP
Sbjct  279   LQETYNPNKSIEVEVMVCGGAPKGSFTKANKQQTFARAVSTCGRMRLTDENPSWQMETMP  338

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
             + R+M DM+ LP G+++I+NGAA G+AG+ +  +PV  P++Y    P   RF +++ S  
Sbjct  339   LPRVMSDMLLLPTGDVIIVNGAASGTAGWENAHDPVTRPIIYR---PYDHRFSVMSTSAR  395

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PRMYHS+AILL D R+LVGGSNPH  Y F N   +PT+L LE +SPPY+ +     RP I
Sbjct  396   PRMYHSSAILLSDGRILVGGSNPHIYYNFTN-VEYPTDLSLEVYSPPYISSIYDPFRPKI  454

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
                       Y ++  + F+    +  + ++V +++PSFTTHSF+ +QR++ L     V 
Sbjct  455   L--NYDKILNYERLNILCFSIQEFISLDRLSVRIISPSFTTHSFAMNQRMVVL-RLHEVA  511

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                   Y +TA  P +  ++P GYYM+FVVH G+PS G+W+++
Sbjct  512   HHESGPYWITAFGPSTAEIAPPGYYMMFVVHAGVPSSGVWVKL  554



>ref|XP_010516382.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=546

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/520 (50%), Positives = 358/520 (69%), Gaps = 11/520 (2%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWE+LLP+IGI+AMHMQLL+N  V++FDRTDFG+SN+ L GG CR DP +  VK DC+AH
Sbjct  36    RWEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNVSLPGGICRYDPTDTAVKFDCSAH  95

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDV  NT RPL VQTD WCSS AV+P+GTL+QTGG+NDG+   R+F PC   + CDW
Sbjct  96    SVLYDVVSNTYRPLQVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFTPCGYSETCDW  155

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPG  658
             +E P  L + RWYATN ILPDGR I++GGR +FNYE +P+           FL ET+D  
Sbjct  156   MEFPQYLSQRRWYATNQILPDGRIIVVGGRRQFNYEIFPRHSSRSRSSRFEFLRETSDGS  215

Query  659   AENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLP  838
              ENNLYP++ L  DG+LF+FAN ++I++DY  + VV+ +P +P G PR+YPS+GS+VL P
Sbjct  216   DENNLYPFIHLLPDGNLFVFANTRSIVFDYKTNRVVKEFPEIPGGDPRNYPSSGSSVLFP  275

Query  839   LKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMAR  1018
             L       +  E+++CGG+P+G F    RG F+ A +TCGR++++D NP W METMP+ R
Sbjct  276   LDETNDTNVQVEIMVCGGSPRGGF---SRG-FVRATSTCGRLKLSDQNPSWEMETMPLPR  331

Query  1019  LMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRM  1198
             +MGDM+ LP G+++I+NGA  G+AG+   R+PV  P++YH   P    F +++    PRM
Sbjct  332   VMGDMLLLPTGDVIIVNGAGTGTAGWEKARDPVIQPLIYH---PFDHLFSVMSTPMRPRM  388

Query  1199  YHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLP  1378
             YHS+ +LL D RVLVGGSNPH  Y F N   +PT+L LEA+SPPYL   +  IRP I   
Sbjct  389   YHSSTVLLPDGRVLVGGSNPHVYYNFTN-VEYPTDLSLEAYSPPYLSFTSDPIRPKIL--  445

Query  1379  GSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVG  1558
              S     Y ++  + F+    +  +L++V +VAPSFTTHSF+ +QR++ L      +   
Sbjct  446   TSDKVLSYKRLFNVDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQL  505

Query  1559  INTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              N+Y ++A+ P +  ++P GYYM+F+VH GIPS   W+Q+
Sbjct  506   TNSYRVSALGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQI  545



>ref|XP_006392509.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
 gb|ESQ29795.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
Length=548

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/522 (51%), Positives = 362/522 (69%), Gaps = 10/522 (2%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
             RWELL+PNIGI+AMHMQLL+N  V++FDRTDFG+SN+ L GG CR DP +  VK DC+AH
Sbjct  33    RWELLVPNIGISAMHMQLLHNGMVIMFDRTDFGVSNLSLPGGICRFDPSDTAVKFDCSAH  92

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCDW  478
             SV YDV  NT R L VQTD WCSS +V+P+GTL+QTGG+NDG+   R+F+PC   + CDW
Sbjct  93    SVLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERATRMFSPCGYGETCDW  152

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLL-YNLPFLAETNDP  655
             +E P  L + RWYATN ILPDGR I++GGR +FN+EF+P+            FL ET D 
Sbjct  153   IEFPQYLAQRRWYATNQILPDGRIIVVGGRRQFNFEFFPRPDHHRYRGSRFDFLRETTDG  212

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP++ L  DG+LF+FAN ++I++DY  + +VR +P +P G PR+YPS+GS++L 
Sbjct  213   SNENNLYPFLHLLPDGNLFVFANTRSIVFDYKSNRIVREFPEIPGGDPRNYPSSGSSILF  272

Query  836   PLKNLQAPGIVAEVLICGGAPKGAFP-ASERGVFMGALNTCGRIRITDPNPVWFMETMPM  1012
             P+   +   +  E+++CGGAPKGAF  A  +  F  A++TCGR+++TD NP W METMP+
Sbjct  273   PIDETKN-TMEVEIMVCGGAPKGAFSRAKSQHGFTRAISTCGRLKLTDQNPSWEMETMPL  331

Query  1013  ARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIP  1192
              R+MGDM+ LP GN++I+NGA  G+AG+ +  +PV  PV+YH   P   RF I++ S  P
Sbjct  332   PRVMGDMLLLPTGNVIIVNGAGAGTAGWENACDPVTRPVIYH---PFDRRFSIMSTSSRP  388

Query  1193  RMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHIT  1372
             RMYHS+A+LL D RVLVGGSNPH  Y F N   +PTEL LEA+SPPYL   +  IRP I 
Sbjct  389   RMYHSSAVLLPDGRVLVGGSNPHIYYNFTN-VEYPTELSLEAYSPPYLSFTSDSIRPKIL  447

Query  1373  LPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKP  1552
                +     Y ++  + F+    +  +L++V +VAPSFTTHS + +QR++ L      + 
Sbjct  448   T--NDKVVSYKRLFNVDFSIPQFLTTDLLSVRIVAPSFTTHSLAMNQRMVILKLLSVTRE  505

Query  1553  VGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                N+Y + A+ P +  ++P GYYM+F+VH G+PS G W+Q+
Sbjct  506   GLTNSYRINALGPSTAEIAPPGYYMMFLVHAGVPSVGAWVQI  547



>ref|XP_010041767.1| PREDICTED: galactose oxidase [Eucalyptus grandis]
 gb|KCW84906.1| hypothetical protein EUGRSUZ_B01735 [Eucalyptus grandis]
Length=551

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/526 (55%), Positives = 366/526 (70%), Gaps = 15/526 (3%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G W LL P+IGI+AMHMQLL N+KVV+FDRTDFG SNI L GGRCR D  +  +KVDCTA
Sbjct  34    GEWRLLRPSIGISAMHMQLLRNNKVVVFDRTDFGPSNISLPGGRCRYDSNDTALKVDCTA  93

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDW  478
             HSV YDV  N+ RPLMVQTD WCSS AV P G+L+QTGG+NDGDH VR+F PCN   CDW
Sbjct  94    HSVLYDVETNSFRPLMVQTDTWCSSGAVSPGGSLVQTGGFNDGDHAVRIFTPCNADSCDW  153

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT----PGGDLLYNLPFLAET  646
             VE P  L R RWYATN ILPDGR IIIGGR EFNYEFYPK           + L FL ET
Sbjct  154   VEYPGYLSRRRWYATNQILPDGRIIIIGGRREFNYEFYPKNEDPYSASSGSFWLQFLLET  213

Query  647   NDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
              D  +ENNLYP+V L  DG+LFIFAN ++I  DY ++ VV+ +P +P   PR+YPS+GS+
Sbjct  214   RDE-SENNLYPFVHLLPDGNLFIFANTRSISLDYNRNRVVKEFPPIPISDPRNYPSSGSS  272

Query  827   VLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             VLLP+   QA  I AE++ICGGAP+GAF  + RG F+ A ++CGR+R++D +P W ME M
Sbjct  273   VLLPIDENQA--IEAEIMICGGAPRGAFAEAGRGNFVRASSSCGRLRVSDEDPRWVMENM  330

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P+AR+MGDM+ L  G+++IING  +G+AG+  G++PV  PV+Y  +     RF +++ S 
Sbjct  331   PIARVMGDMLLLATGDVIIINGVERGTAGWELGQSPVTRPVVYRPNGNPDWRFSVMSASP  390

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPR+YHS+AILL D RVLVGGSNPH  Y F N   +PT+L LEAFSPPYL       RP 
Sbjct  391   IPRLYHSSAILLADGRVLVGGSNPHRYYNFAN-VEYPTDLSLEAFSPPYLSIEHKPFRPQ  449

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRL--LDLGGGG  1540
             I+    +     G+   + F     +  NL++V +VAPSFTTHS + +QR+  L L G  
Sbjct  450   IS--SVNEILMLGQPFSLTFFVPLYLSENLLSVRIVAPSFTTHSLAMNQRMVVLKLVGVS  507

Query  1541  TVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              + P   ++Y +TAV P +  + P GYYMLFVVH GIPS G W+++
Sbjct  508   RLTP---DSYQLTAVGPSTAEIGPPGYYMLFVVHAGIPSWGSWVKI  550



>ref|XP_008218222.1| PREDICTED: galactose oxidase [Prunus mume]
Length=553

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/536 (50%), Positives = 362/536 (68%), Gaps = 15/536 (3%)
 Frame = +2

Query  80    PWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQ  259
             P+S N+       G+W LL  +IGI+AMHMQLL  + V++FDRTD+G SNI L   +CR 
Sbjct  29    PYSSNL-------GQWHLLHSSIGISAMHMQLLRTNMVIMFDRTDYGRSNISLPRRQCRH  81

Query  260   DPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVV  439
             DP + ++KVDCTAHS+ YD+  NT+RPL VQTD WCSS AV PDGTL+QTGG+NDGDHVV
Sbjct  82    DPNDTLLKVDCTAHSILYDIGTNTLRPLTVQTDTWCSSGAVFPDGTLVQTGGYNDGDHVV  141

Query  440   RVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDL  616
             R F PC    CDW+E PN L + RWYA+N ILPDGR II+GGR +FNYEFYP++      
Sbjct  142   RTFTPCTGDNCDWLEFPNYLVQRRWYASNQILPDGRIIIVGGRRQFNYEFYPRSFQNPPR  201

Query  617   LYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQ  796
              + L  L +T D   ENNLYP++ L  DG+LFIFAN K+IL++Y ++ VVR +P +P G+
Sbjct  202   TFWLDILRQTKDQD-ENNLYPFLHLLPDGNLFIFANTKSILFNYNQNVVVREFPEIPGGE  260

Query  797   PRSYPSTGSAVLLPLKNLQAP--GIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRI  970
             PR+YPSTGS+VLLPL   +     I AE+++CGGAP+ +F  + RG F+ AL TCGR+++
Sbjct  261   PRNYPSTGSSVLLPLDENKPANVNIEAEIMVCGGAPRNSFVLASRGEFIDALGTCGRLKV  320

Query  971   TDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNP  1150
             +D NP W ME MP+ R+M DM+ LP G+++IINGAA G+AG+  GR+PV  PV+Y     
Sbjct  321   SDQNPSWVMEEMPVPRVMADMLLLPTGDVVIINGAALGTAGWEYGRDPVTKPVIYRPSEN  380

Query  1151  VGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPP  1330
                RF ++  S  PR+YHS A+L+ D RVLV GSNPH  Y F     +PT+L LEAFSPP
Sbjct  381   PNRRFSVMAGSQRPRLYHSAAVLVPDGRVLVSGSNPHVYYNF-TCVEYPTDLSLEAFSPP  439

Query  1331  YLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQH  1510
             Y        RP I         GY +   + F     +  ++++V +VAPSFTTHSF+ +
Sbjct  440   YTSVEYEPARPRIV--SVKEVLGYRQFFSVAFAVPELLSVSVLSVRLVAPSFTTHSFAMN  497

Query  1511  QRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             QR++ +   G  + V   TY ++ V P +G ++P GYY+LFVVH  IPS   W+++
Sbjct  498   QRMIVMKLIGVTR-VAPETYEISLVGPSTGEIAPPGYYLLFVVHADIPSSAAWVKL  552



>ref|XP_006433075.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
 gb|ESR46315.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
Length=546

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/529 (51%), Positives = 362/529 (68%), Gaps = 22/529 (4%)
 Frame = +2

Query  107   AAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKV  286
             A   G W LL  +IGI+AMHMQLL++++V++FDRTDFG SN+ L  GRCR DPY+ V+  
Sbjct  34    AGSQGEWNLLHESIGISAMHMQLLHDNRVIMFDRTDFGQSNLSLSSGRCRFDPYDTVLHT  93

Query  287   DCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDK  466
             DCTAHS+ YDVA N  RPLMVQTD WCSS +V+P+GTL+Q+GG+NDGDHVVR F PC+D 
Sbjct  94    DCTAHSILYDVATNAYRPLMVQTDTWCSSGSVLPNGTLVQSGGYNDGDHVVRTFTPCDDD  153

Query  467   KCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDL----LYNLPF  634
             +CDW+E+P  L   RWYATN ILPDGR IIIGGR +FNYEFYPK+   DL     + L F
Sbjct  154   QCDWIELPQHLSERRWYATNQILPDGRIIIIGGRRQFNYEFYPKS-DEDLSFPQTFMLHF  212

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L ET D  AENNLYP+V L  DG+LFIFAN ++IL+DY ++ V++ YP +P   PR+YPS
Sbjct  213   LLETRD-YAENNLYPFVHLLPDGNLFIFANTRSILFDYKQNKVLKEYPEIPGADPRNYPS  271

Query  815   TGSAVLLPLKNLQ-APGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVW  991
             TGS+VLLPL     +  + AE++ICGGA   +F  + +GVF+ A++TCGR+ ++  NP W
Sbjct  272   TGSSVLLPLDERNGSTSVQAEIMICGGAQNASFALATQGVFIRAISTCGRLVVSHANPSW  331

Query  992   FMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEI  1171
              ME MP+ R+MGDM+ LPNG+++IINGA  G+AG+   R P+  P++Y        RF +
Sbjct  332   VMEEMPLPRVMGDMILLPNGDVIIINGAQLGTAGWELARGPMTRPIIYRPSEQTSRRFSV  391

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
             + PS  PRMYHS+AI            NPH  Y F N  ++PT+L LEA+SPPYL A  A
Sbjct  392   MEPSTRPRMYHSSAIF-----------NPHIYYNFTN-VVYPTDLSLEAYSPPYLSAEYA  439

Query  1352  GIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLG  1531
              +RP I     +   GY    +++F+    +   +V+V ++APSFTTHSF  +QR++ L 
Sbjct  440   TVRPKIL--SLNETIGYKATFQVRFSVEEYLSAGVVSVRLIAPSFTTHSFGMNQRMVVL-  496

Query  1532  GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                 V  V    YH+ AV P +  ++P GYY+LFVVH  IPS G+W++M
Sbjct  497   KILEVSHVTSYVYHLAAVAPSTAEIAPPGYYLLFVVHAEIPSSGMWVKM  545



>gb|EYU22441.1| hypothetical protein MIMGU_mgv1a024085mg [Erythranthe guttata]
Length=596

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/547 (51%), Positives = 366/547 (67%), Gaps = 13/547 (2%)
 Frame = +2

Query  53    QLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNI  232
             +L L     P +    AA  G G W LL  ++G++AMHMQLL+N+K+VIFDR DFG SN+
Sbjct  56    ELLLSTISLPTTPRYSAATPGVGEWSLLQESVGVSAMHMQLLHNNKIVIFDRADFGSSNL  115

Query  233   PLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTG  412
              L  G+CR DP     K DCTAHS+ YDV  NT RPLMVQTDVWCSS AV   GTL+QTG
Sbjct  116   SLPAGKCRFDPR--AAKHDCTAHSLLYDVDSNTYRPLMVQTDVWCSSGAVNSLGTLVQTG  173

Query  413   GWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFY  592
             G++DG   +R F PCND  CDWVE+P  L   RWY ++HILPD R I++GGR  ++YEF+
Sbjct  174   GYHDGYKKIRTFTPCNDDTCDWVELPLNLTVQRWYGSDHILPDDRVIVVGGRRAYSYEFF  233

Query  593   PKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRL  772
             P     + ++  P L ET DP  ENNLYP++ L  DG+LF+FAN +++L DY    +VR 
Sbjct  234   PN--NDNRVFPFPLLKETTDPKEENNLYPFLHLLPDGNLFVFANRRSLLLDYKNDRIVRE  291

Query  773   YPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNT  952
             YP +P G+ R+YP+TGS+V+LPLK   +     E+LICGGA  GA+  + RG FM A  +
Sbjct  292   YPEIP-GEKRNYPATGSSVMLPLKLGNSSYPTVEILICGGARGGAYLKALRGRFMAASKS  350

Query  953   CGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVL  1132
             CGRIR+TDP PVW ME MP+ R+M DM+ LP G+++I+NGAA+GSAG+  G  PV +PV+
Sbjct  351   CGRIRVTDPEPVWVMEDMPLRRVMPDMLLLPTGDVIIVNGAARGSAGWECGDEPVLSPVM  410

Query  1133  YHTDNP-VGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELR  1309
             Y+ D P    RF  L+PS  PRMYHS AILL D R+LVGGSNPH  Y F     +PT+L 
Sbjct  411   YYPDEPDPAKRFSALSPSTKPRMYHSAAILLPDGRILVGGSNPHVKYNF-TAEKYPTDLS  469

Query  1310  LEAFSPPYLDAATAGIRPHI-TLPGSH-SKFGYGKVIEIQFTAAG--PVDGNLVTVTMVA  1477
             LEA+SPPYL    A +RP I ++ G+  +   YG+   I F+  G   V G  + VTMVA
Sbjct  470   LEAYSPPYLGTEYAHLRPSILSIDGTEDNAVAYGQQFTISFSLGGFQLVPGEYL-VTMVA  528

Query  1478  PSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPS  1657
             PSFTTHSF+ +QRLL L      + +    Y +T   P + N++P GYYMLFVVH+G+P 
Sbjct  529   PSFTTHSFAMNQRLLVLYVSAEQQ-IAPFAYKVTVNAPPTANIAPPGYYMLFVVHQGVPC  587

Query  1658  EGIWIQM  1678
               +WI++
Sbjct  588   HSVWIKL  594



>ref|XP_007208189.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
 gb|EMJ09388.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
Length=528

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/523 (51%), Positives = 358/523 (68%), Gaps = 8/523 (2%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G+W LL  +IGI+AMHMQLL  + V++FDRTD+G SNI L G +CR DP + ++KVDCTA
Sbjct  10    GQWHLLHSSIGISAMHMQLLRTNMVIMFDRTDYGPSNISLPGRQCRHDPNDTLLKVDCTA  69

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDW  478
             HS+ YD+  NT+RPL VQTD WCSS AV PDGTL+QTGG+NDGDHVVR F PC    CDW
Sbjct  70    HSILYDIGTNTLRPLNVQTDTWCSSGAVFPDGTLVQTGGYNDGDHVVRTFTPCTGDNCDW  129

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNLPFLAETNDP  655
             +E PN L + RWYA+N ILPDGR II+GGR +FNYEFYP+        + L  L +T D 
Sbjct  130   LEFPNYLVQRRWYASNQILPDGRIIIVGGRRQFNYEFYPRNFQDPPRTFWLDILRQTRDQ  189

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP++ L  DG+LFIFAN K+IL++Y ++ VVR +P +P G+PR+YPSTGS+VLL
Sbjct  190   D-ENNLYPFLHLLPDGNLFIFANTKSILFNYNQNVVVREFPEIPGGEPRNYPSTGSSVLL  248

Query  836   PLKNLQAP--GIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             PL   +     I AE+++CGGAP+ +F  +  G F+ AL TCGR++++  NP W ME MP
Sbjct  249   PLDENKPSNVNIEAEIIVCGGAPRNSFVLASGGEFIDALGTCGRLKVSGQNPYWVMEEMP  308

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
             + R+M DM+ LP G+++IINGA+ G+AG+  GR+PV  PV+Y        RF ++  S  
Sbjct  309   VPRVMADMLLLPTGDVIIINGASLGTAGWEYGRDPVTKPVIYRPSEKPNRRFSVMAGSQR  368

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PR+YHS A+L+ D RVLVGGSNPH  Y F     +PT+L LEAFSPPY+      +RP I
Sbjct  369   PRLYHSAAVLVPDGRVLVGGSNPHVYYNF-TCVEYPTDLSLEAFSPPYMSVEYEPVRPRI  427

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
                      GY +   + F     +  ++++V +VAPSFTTHSF+ +QR++ +   G  +
Sbjct  428   V--SVKEVLGYRQFFSVAFAVPELLSVSVLSVRLVAPSFTTHSFAMNQRMIVMKLIGVTR  485

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              V   TY ++ V P +G ++P GYY+LFVVH  IPS   W+++
Sbjct  486   -VAPETYEISLVGPSTGEIAPPGYYLLFVVHADIPSSAAWVKL  527



>ref|XP_004239377.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=567

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/528 (53%), Positives = 374/528 (71%), Gaps = 20/528 (4%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G+W LL  +IGI+AMHMQLL+N+KVVIFDRTDFG SN+ L   +CR +  +  +KVDCTA
Sbjct  51    GKWILLHKSIGISAMHMQLLHNNKVVIFDRTDFGSSNLSLPHDKCRYN--DEAIKVDCTA  108

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK-CD  475
             HS+ Y+VA NT RPL VQTDVWCSS AV P+GTLIQTGG++ G+  +R+F+PC D++ CD
Sbjct  109   HSILYNVATNTYRPLTVQTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCFDEETCD  168

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDP  655
             W E+   L   RWY+T+HILPDGR +IIGGR  ++YEF+P++   D++++LPFL ET DP
Sbjct  169   WTELQQNLTVKRWYSTDHILPDGRIMIIGGRNAYSYEFFPQSSETDVVFHLPFLKETTDP  228

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP+++L  DG+++IFAN ++I  DY K+ VVR +P +P G+ RSYP+TGS+V+L
Sbjct  229   KEENNLYPFLYLLPDGNVYIFANQRSISLDYAKNKVVREFPVIP-GEKRSYPATGSSVML  287

Query  836   PLKNLQ---APGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             P+K +    +P +  EV++CGGA  GAF  +  G FM A  TCGRI+ITDP+P W ME M
Sbjct  288   PMKLVAGDFSPAV--EVMVCGGANGGAFLHAAVGGFMPASRTCGRIKITDPDPKWVMEDM  345

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV-GTRFEILNPS  1183
             P  R+M DM+ LP G+++++NGA++G+AG+    +PV  P LY    P    RF +L+P+
Sbjct  346   PSGRVMLDMLLLPTGDVILLNGASKGTAGWESAIDPVLNPFLYEPGQPDPNERFSVLDPT  405

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              IPRMYHS+A L+ D R+LVGGSNPH  Y F  G  +PTEL LEAF PPYL    + +RP
Sbjct  406   SIPRMYHSSATLMPDGRILVGGSNPHIRYNF-TGVKYPTELSLEAFLPPYLSPHHSNLRP  464

Query  1364  -HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGG  1540
              + T+ G  S   YG+   I FT     D N V VTMVAPSFTTHSF+ +QRLL L    
Sbjct  465   SNTTVEGPVS---YGQEFSITFTLGVSQDTNEVMVTMVAPSFTTHSFAMNQRLLIL---D  518

Query  1541  TVKPVGINTY--HMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              VK   ++++   +T   P S N++P GYYM+FVVH+G+P   IW++M
Sbjct  519   IVKIQQVSSFDQKITVYAPPSRNIAPPGYYMVFVVHQGVPGHSIWVKM  566



>ref|XP_010674901.1| PREDICTED: galactose oxidase [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/525 (52%), Positives = 358/525 (68%), Gaps = 12/525 (2%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G W++L  NIGI+AMHMQL+ N+KV++FDRTDFG SN+ L  GRCR D  ++V+K+DCTA
Sbjct  31    GEWQVLQENIGISAMHMQLMQNNKVIMFDRTDFGPSNLSLPFGRCRNDSSDIVLKIDCTA  90

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDW  478
             HSV YD+A NT RPL V TD WCSS +++PDG+L+QTGG+NDGD VVR F PC D  CDW
Sbjct  91    HSVVYDIATNTFRPLTVNTDTWCSSGSLLPDGSLVQTGGYNDGDRVVRKFTPCKDDNCDW  150

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT----PGGDLLYNLPFLAET  646
             +E PN L   RWYATN ILPDGR IIIGGR  F YEF+P      P     + L FL ET
Sbjct  151   IEYPNYLSDRRWYATNQILPDGRVIIIGGRRVFTYEFFPSNSNSFPTSTSTFWLNFLLET  210

Query  647   NDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
             +D   ENNLYP+V L   G+LFIFAN +AIL+DY  + VV+  P++  G PR+YPSTGS+
Sbjct  211   HD-DEENNLYPFVHLLPTGNLFIFANTRAILFDYTLNVVVKELPSIDGGNPRNYPSTGSS  269

Query  827   VLLPLKNLQAPGIVAEVLICGGAPKGAF-PASERGVFMGALNTCGRIRITDPNPVWFMET  1003
             VLLP+   +   I AE++ICGG+  GAF  AS    F+ A + CGRI++TD NP W ME 
Sbjct  270   VLLPID--ENKPIEAEIMICGGSQHGAFTQASTNRSFIRASSNCGRIKVTDENPHWNMED  327

Query  1004  MPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPS  1183
             MPM R+MGDM+ LP G+ILI+NGA  G+AG+ +  NPV TPV+Y   +    RF +++ S
Sbjct  328   MPMPRVMGDMLLLPTGDILIVNGAELGTAGWENAANPVTTPVIYRLYDNTDKRFYVMSSS  387

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
               PRMYHS AILL D R+LVGGSNPH  Y F N   +PT+L LEA+SPPYL    A +RP
Sbjct  388   PRPRMYHSAAILLTDGRILVGGSNPHIYYNFTN-VEYPTDLSLEAYSPPYLAIEYAPMRP  446

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
             +I         GY +   + F         +V+V +VAPSFTTHS + +QR++ L     
Sbjct  447   NIIY--GDQVVGYEQPFTVTFNVQQYQADEVVSVNLVAPSFTTHSLAMNQRMVVL-RISK  503

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             +  + +  +++  + P + N++P GYY+LFVVH GIPS G+W+++
Sbjct  504   ISQLSLGMFNVGLMGPTTTNIAPPGYYLLFVVHAGIPSSGLWVKI  548



>ref|XP_006849170.1| hypothetical protein AMTR_s00027p00175370 [Amborella trichopoda]
 gb|ERN10751.1| hypothetical protein AMTR_s00027p00175370 [Amborella trichopoda]
Length=560

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/534 (54%), Positives = 366/534 (69%), Gaps = 15/534 (3%)
 Frame = +2

Query  95    MFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEV  274
             + A A+GGG+W+LL  +IGI+AMHM LL N++V++FDRTDFG SN+ L  GRCR+D ++ 
Sbjct  33    VLALASGGGQWKLLKRSIGISAMHMALLPNNRVIMFDRTDFGPSNVSLPNGRCRKDRHDR  92

Query  275   VVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNP  454
              ++ DC AHSVE +   + VRPL + TD WCSS A+ PDG LIQTGG NDG+ VVR F+P
Sbjct  93    ALQTDCWAHSVELNWVTHGVRPLTILTDTWCSSGALAPDGHLIQTGGSNDGERVVRTFSP  152

Query  455   CNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNLP  631
             C    CDW E+P+ L   RWYA+N ILPDGR I++GGR +FNYEF PKT P    +Y L 
Sbjct  153   C--ATCDWAELPDGLAMPRWYASNQILPDGRIIVVGGRGQFNYEFVPKTDPSEHSMYPLE  210

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FL+ET D   ENNLYP++ L  DG LF+FAN KAI  DYI H VVR +PA+P G+ R+YP
Sbjct  211   FLSETRD-DCENNLYPFLHLLPDGTLFLFANTKAISLDYITHRVVRTFPALP-GESRNYP  268

Query  812   STGSAVLLPL---KNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPN  982
             STGS+ +LPL    N   P + AEVL+CGGAP  +   + +GVF+ A  TCGRI+ TD +
Sbjct  269   STGSSTMLPLILAVNSTQP-VDAEVLVCGGAPSHSNFQANKGVFLPASRTCGRIKATDES  327

Query  983   PVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTR  1162
             P W +ETMP+ R+MGDMV LP G ILIINGA +G+AG+G GR+PV  PVLY  D P+G R
Sbjct  328   PEWSIETMPLKRVMGDMVMLPTGEILIINGAGKGTAGWGVGRDPVLCPVLYKPDAPIGHR  387

Query  1163  FEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDA  1342
             FE+L+PS  PR+YHS+A LL D RVLVGGSNP+  Y F +G LFPTEL LE FSPPY+  
Sbjct  388   FEVLSPSSTPRLYHSSAQLLSDGRVLVGGSNPNRGYNF-SGVLFPTELSLEFFSPPYIKL  446

Query  1343  ATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNL--VTVTMVAPSFTTHSFSQHQR  1516
               +  RP IT         Y +   I F +       +  + VTMVAPSFTTHS S +QR
Sbjct  447   KWS--RPKITSLKPGRTMSYTQHFYINFYSRKQSTKGVDEILVTMVAPSFTTHSVSMNQR  504

Query  1517  LLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             LL L   G ++      Y +  V P S  L+P GYY+LF+VH G PS G+W+++
Sbjct  505   LLVLRVMG-LEGGHDGAYRVECVPPVSAVLAPPGYYLLFLVHGGSPSRGVWVRL  557



>ref|XP_009117902.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=559

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/530 (53%), Positives = 357/530 (67%), Gaps = 18/530 (3%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCT  295
             GGRW+LL P+IGI+AMHMQLL+N+KVVIFDRTD+G SN+ L    CR          DC+
Sbjct  39    GGRWDLLQPSIGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQTCRN-----ATVFDCS  93

Query  296   AHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCD  475
             AHS+ YDVA NT RPL +++D WCSS ++   G+LIQTGG+  G+ VVR+F PC+   CD
Sbjct  94    AHSLLYDVASNTFRPLTLRSDTWCSSGSLNASGSLIQTGGYGVGERVVRIFTPCDGVSCD  153

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDP  655
             WVE    L   RWY+TN ILPDGR II+GGR  F YEFYPK PG   ++ L FLAET DP
Sbjct  154   WVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNPGKS-VFILRFLAETRDP  212

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP++ L  DG+LFIFAN ++IL+D++ H +V+ +P +P G  R+YPSTGS+VLL
Sbjct  213   NEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPGGDKRNYPSTGSSVLL  272

Query  836   PLK---NLQAPGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRITDPNPVWFM  997
             PL          I AEV++CGGAP GAF  + R    VF+GA  TCGR+++TDPNP W M
Sbjct  273   PLSLTGENNRSKIAAEVMVCGGAPPGAFLKAARTIPKVFVGASRTCGRLKVTDPNPSWVM  332

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT-RFEIL  1174
             E MP  R+M DM+ LPNG+ILIINGA+ G+AG+ D  N V  P+LY  D P  T RFEIL
Sbjct  333   EQMPAPRVMPDMLLLPNGDILIINGASNGTAGWEDATNAVLNPILYMPDEPDPTRRFEIL  392

Query  1175  NPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAG  1354
              P+ IPRMYHS ++LL D RVL+GGSNPH NY F     +PTEL LEA+ P YLD   +G
Sbjct  393   APTRIPRMYHSASLLLADGRVLIGGSNPHRNYNF-TARHYPTELSLEAYLPRYLDPQYSG  451

Query  1355  IRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL  1528
             +RP I          YGK   + F   A G  DG  V+V +VAPSF+THS + +QR+L L
Sbjct  452   VRPSIVTVELAGNMLYGKSFAVTFVIPAFGMFDGR-VSVRLVAPSFSTHSTAMNQRMLVL  510

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                  V+ + +  Y      P +  ++P GYYM+F+VH+G PS  IW+++
Sbjct  511   RVRRVVQ-LSVFAYKADVDGPTNSYVAPPGYYMMFMVHRGTPSVAIWVKV  559



>emb|CDY53551.1| BnaA09g57100D [Brassica napus]
Length=561

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/530 (53%), Positives = 357/530 (67%), Gaps = 18/530 (3%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCT  295
             GGRW+LL P+IGI+AMHMQLL+N+KVVIFDRTD+G SN+ L    CR          DC+
Sbjct  41    GGRWDLLQPSIGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQTCRN-----ATVFDCS  95

Query  296   AHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCD  475
             AHS+ YDVA NT RPL +++D WCSS ++   G+LIQTGG+  G+ VVR+F PC+   CD
Sbjct  96    AHSLLYDVASNTFRPLTLRSDTWCSSGSLNASGSLIQTGGYGVGERVVRIFTPCDGVSCD  155

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDP  655
             WVE    L   RWY+TN ILPDGR II+GGR  F YEFYPK PG   ++ L FLAET DP
Sbjct  156   WVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNPGKS-VFILRFLAETRDP  214

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP++ L  DG+LFIFAN ++IL+D++ H +V+ +P +P G  R+YPSTGS+VLL
Sbjct  215   NEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPGGDKRNYPSTGSSVLL  274

Query  836   PLK---NLQAPGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRITDPNPVWFM  997
             PL          I AEV++CGGAP GAF  + R    VF+GA  TCGR+++TDPNP W M
Sbjct  275   PLSLTGENNRSKIAAEVMVCGGAPPGAFLKAARTIPKVFVGASRTCGRLKVTDPNPSWVM  334

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT-RFEIL  1174
             E MP  R+M DM+ LPNG+ILIINGA+ G+AG+ D  N V  P+LY  D P  T RFEIL
Sbjct  335   EQMPAPRVMPDMLLLPNGDILIINGASNGTAGWEDATNAVLNPILYMPDEPDPTRRFEIL  394

Query  1175  NPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAG  1354
              P+ IPRMYHS ++LL D RVL+GGSNPH NY F     +PTEL LEA+ P YLD   +G
Sbjct  395   APTRIPRMYHSASLLLADGRVLIGGSNPHRNYNF-TARHYPTELSLEAYLPRYLDPQYSG  453

Query  1355  IRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL  1528
             +RP I          YGK   + F   A G  DG  V+V +VAPSF+THS + +QR+L L
Sbjct  454   VRPSIVTVELAGNMLYGKSFAVTFVIPAFGMFDGR-VSVRLVAPSFSTHSTAMNQRMLVL  512

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                  V+ + +  Y      P +  ++P GYYM+F+VH+G PS  IW+++
Sbjct  513   RVRRVVQ-LSVFAYKADVDGPTNSYVAPPGYYMMFMVHRGTPSVAIWVKV  561



>gb|KHN04050.1| Galactose oxidase [Glycine soja]
Length=507

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/513 (52%), Positives = 359/513 (70%), Gaps = 12/513 (2%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLL+NDK+++FDRTDFG S +PL  GRCR DP E+ +KVDC+AHSV YDVA NT RP
Sbjct  1     MHMQLLHNDKIIMFDRTDFGHSYLPLSNGRCRMDPNEIALKVDCSAHSVLYDVATNTFRP  60

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYA  520
             LM+QTD WCSS +V+P+GTL+QTGG+NDG+  +R+F PC  + CDWVE P  L + RWYA
Sbjct  61    LMIQTDTWCSSGSVLPNGTLVQTGGYNDGERSIRMFTPCFGETCDWVEFPGLLSQRRWYA  120

Query  521   TNHILPDGRQIIIGGREEFNYEFY---PKTPGGDLLYNLPFLAETNDPGAENNLYPYVFL  691
             TN ILPD R I++GGR +FNYEF    P          L FL +T+D  +ENNLYP+V L
Sbjct  121   TNQILPDARVIVVGGRRQFNYEFLPKTPSPNSSPSSIPLNFLQQTSD-RSENNLYPFVHL  179

Query  692   NVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPL-KNLQAPGIV  868
               DG+LFIFAN K++L+DY +++V+R +P +P G PR+YPS+GS+VLLPL +NL +  + 
Sbjct  180   LPDGNLFIFANTKSVLFDYKQNSVIREFPPIPGGDPRNYPSSGSSVLLPLDENLDS--LE  237

Query  869   AEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDM--VTL  1042
              EV++CGGAP+G+F  + RG F+ AL TCGRI++TD NP W M+ MPM R MGDM  + L
Sbjct  238   PEVVVCGGAPRGSFENAARGNFVQALGTCGRIKVTDSNPNWVMQNMPMPRAMGDMLLLLL  297

Query  1043  PNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILL  1222
             PNG+++I NG   G+AG+  G +PV  PV++     V  +F ++ P+  PR+YHS+A+LL
Sbjct  298   PNGDVVITNGVGAGTAGWEHGHDPVLLPVIFRPSETV-NQFSVMAPASRPRLYHSSAVLL  356

Query  1223  RDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGY  1402
             RD RVLVGGSNPH  Y F  G  +PT+L LEAFSPPYL    A +RP I    +++  GY
Sbjct  357   RDGRVLVGGSNPHVYYNF-TGVEYPTDLSLEAFSPPYLAPDFAPVRPVIRYITNNNVLGY  415

Query  1403  GKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTA  1582
                  + FT       + V++ +VAPSFTTHSF Q+QR++ L         G   Y+ T 
Sbjct  416   RVFCYVTFTVPNYASVSEVSIRIVAPSFTTHSFGQNQRMVVLKLSAVTYLAG-EAYYATV  474

Query  1583  VTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             + P +  ++P GYY+LFVVHKG+PS G W+Q++
Sbjct  475   MGPSTAEIAPPGYYLLFVVHKGVPSWGSWVQVM  507



>ref|XP_010100623.1| hypothetical protein L484_011554 [Morus notabilis]
 gb|EXB83260.1| hypothetical protein L484_011554 [Morus notabilis]
Length=505

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/510 (53%), Positives = 357/510 (70%), Gaps = 10/510 (2%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLL N KVVI+DRTDFG SN+ LGGGRCR DP +  ++ DCTAHSV YD   NT RP
Sbjct  1     MHMQLLRNTKVVIYDRTDFGPSNLSLGGGRCRFDPLDTALQNDCTAHSVLYDPVLNTFRP  60

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK-CDWVEIPNALHRWRWY  517
             LM+QTD WCSS +V+P+GTL+QTGG+NDGDHV+R F+PC D++ CDW+E PN L + RWY
Sbjct  61    LMLQTDSWCSSGSVLPNGTLVQTGGFNDGDHVIRTFSPCMDEENCDWIETPNYLAQRRWY  120

Query  518   ATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNV  697
             +TN ILPDGR I++GGR +FNYEF+P+  G   L  L FL ET+D   ENNLYP++ L  
Sbjct  121   STNQILPDGRIIVVGGRRQFNYEFFPRNLGDPSLMWLNFLRETSD-SDENNLYPFLHLLP  179

Query  698   DGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVAEV  877
             DG+LFIFAN ++I +DY ++ +V+ +P +P G PR+YPS+GS+VLLPL       + AE+
Sbjct  180   DGNLFIFANTRSISFDYNQNRIVKEFPPIPGGDPRNYPSSGSSVLLPLDE-NKECVEAEI  238

Query  878   LICGGAPKGAFPASERGVFMGALNTCGRIRIT--DPNPV-WFMETMPMARLMGDMVTLPN  1048
             +ICGGAP+GA   +  G F+ AL++CGR+ ++  D NP  W ME MP+ R MGDMV LP+
Sbjct  239   MICGGAPRGAHRLALEGTFVEALSSCGRLIVSYNDQNPSNWVMEDMPLPRAMGDMVILPS  298

Query  1049  GNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRD  1228
             G+++IING  QG+AG+  GR+PV  P++Y  +   G RF ++  S  PR+YHSTAILL D
Sbjct  299   GDVIIINGVGQGTAGWELGRDPVMAPLIYCPNAEPGHRFTLMESSSRPRLYHSTAILLPD  358

Query  1229  SRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGK  1408
              +VLVGGSNPH  Y F  G  +PTEL LEAFSPPYL A    +RP I    +   FGYG+
Sbjct  359   GQVLVGGSNPHVFYNF-TGVEYPTELSLEAFSPPYLSAENGLVRPKIL--AATGVFGYGQ  415

Query  1409  VIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVT  1588
                + FT       + V+  ++APSFTTHSF   QR++ +   GTV  V    Y+ T + 
Sbjct  416   FFSVVFTVPLYNGADAVSFRLIAPSFTTHSFGMSQRMVVM-KVGTVSQVARFAYNATVIG  474

Query  1589  PGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             P +  ++P GYYMLFVVH  IPS G W+++
Sbjct  475   PWTAEIAPPGYYMLFVVHCEIPSFGAWVKL  504



>ref|XP_006344285.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=574

 Score =   536 bits (1381),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 273/525 (52%), Positives = 363/525 (69%), Gaps = 12/525 (2%)
 Frame = +2

Query  119   GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTA  298
             G W LL  +IG++AMHMQLL N+KV+IFDRTDFG SN+ L  G+CR D  + V+ VDC+A
Sbjct  56    GEWVLLHESIGVSAMHMQLLYNNKVIIFDRTDFGASNLSLPQGKCRFD--DEVLDVDCSA  113

Query  299   HSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-DKKCD  475
             HSV YD+  NT RPLMVQTDVWCSS A+  DGTLIQTGG++ GD  +R+F+PC+ D  CD
Sbjct  114   HSVLYDILSNTYRPLMVQTDVWCSSGALNSDGTLIQTGGYHAGDRKIRLFSPCDGDVDCD  173

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT---PGGDLLYNLPFLAET  646
             W E+P  L   RWYA++HILPDGR II+GGR+ F+YEF+PKT    GG  +++LPFL ET
Sbjct  174   WTELPQNLTVQRWYASDHILPDGRVIIVGGRKAFSYEFFPKTMDDNGG--VFHLPFLVET  231

Query  647   NDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
              DP  ENNLYP++++  +G+L+IF+N ++I+ DY+ H V+R +P +P G+ RSYP+TGS+
Sbjct  232   TDPMEENNLYPFLYILPNGNLYIFSNQRSIVLDYVNHNVLREFPMIP-GEKRSYPATGSS  290

Query  827   VLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             V+LPL+  Q   +V EV+ICGGA  GA+  +  G F    ++CGR+ +TDP+P W ME M
Sbjct  291   VMLPLRLRQGQELVVEVMICGGAWGGAYVKALEGEFWRGSSSCGRMTLTDPDPKWVMEEM  350

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV-GTRFEILNPS  1183
             P  R+M DM+ LP G++LI+NGAA G+AG+ +  +PV  PVLY  D P    RF +L P+
Sbjct  351   PSGRVMPDMLLLPTGDVLILNGAANGAAGWENAIDPVLNPVLYRPDEPDPRRRFTVLTPT  410

Query  1184  GIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRP  1363
              I RMYHS+AILL D R+LVGGSNPH  Y F  G  +PTEL LEAFSPPYL    A +RP
Sbjct  411   TIARMYHSSAILLPDGRILVGGSNPHATYNF-TGVKYPTELSLEAFSPPYLATQYAHLRP  469

Query  1364  HITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
                         YG+   I FT   P       V+M+ PSFTTHSF  +QRLL L   G 
Sbjct  470   LNQAVDVGQVLSYGQQFSITFTLPFPQPDAEFMVSMIPPSFTTHSFGMNQRLLFLEIVG-  528

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             V+ + +  Y +    P + N++P GYYM+FVVH+G+P   +W+++
Sbjct  529   VERLFMFGYRVIVFAPPTRNIAPPGYYMVFVVHQGVPGHSVWVKI  573



>ref|XP_004237211.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=572

 Score =   535 bits (1377),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 276/531 (52%), Positives = 360/531 (68%), Gaps = 12/531 (2%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             F  +   G W LL  +IG++AMHMQLL N+KV+IFDRTDFG SN+ L  G+CR D  + V
Sbjct  49    FIPSNVNGEWVLLHESIGVSAMHMQLLYNNKVIIFDRTDFGASNLSLPQGKCRFD--DEV  106

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
             + VDC+AHSV YD+  NT RPLMVQTDVWCSS A+  DGTLIQTGG++ GD  +R+F+PC
Sbjct  107   LDVDCSAHSVLYDILSNTYRPLMVQTDVWCSSGALNSDGTLIQTGGYHTGDRKIRLFSPC  166

Query  458   NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT---PGGDLLYNL  628
              D  CDW E+P  L   RWYA++HILPDGR II+GGR+ F+YEF+PKT    GG   + L
Sbjct  167   -DGDCDWTELPQNLTVQRWYASDHILPDGRVIIVGGRKAFSYEFFPKTMDENGGG--FQL  223

Query  629   PFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSY  808
             PFL ET DP  ENNLYP++++  +G+L+IF+N ++I  DY+ H V+R +P +P G+ RSY
Sbjct  224   PFLVETTDPIEENNLYPFLYILPNGNLYIFSNQRSIELDYVNHNVLREFPMIP-GEKRSY  282

Query  809   PSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPV  988
             P+TGS+V+LPL+  Q    V EV+ICGGA  GA+  +  G F    ++CGR+RITDP+P 
Sbjct  283   PATGSSVMLPLRLRQGQEPVVEVMICGGAWGGAYVKALEGEFWRGSSSCGRMRITDPDPK  342

Query  989   WFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV-GTRF  1165
             W ME MP+ R+M DM+ LP GN+LI+NGAA G+AG+ +  +PV  PVLY  D P    RF
Sbjct  343   WVMEEMPLGRVMPDMLLLPTGNVLILNGAANGAAGWENAIDPVLNPVLYRPDEPDPRRRF  402

Query  1166  EILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAA  1345
              +L P+ I RMYHS+AILL D R+LVGGSNPH  Y F  G  +PTEL LEAFSPPYL   
Sbjct  403   TVLTPTKIARMYHSSAILLPDGRILVGGSNPHATYNF-TGVKYPTELSLEAFSPPYLATQ  461

Query  1346  TAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLD  1525
              A +RP            Y +   I FT   P       V+M+ PSFTTHSF  +QRLL 
Sbjct  462   YAHLRPLNQAIDVGQVISYDQQFSITFTLPFPQPDAEFMVSMIPPSFTTHSFGMNQRLLF  521

Query  1526  LGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             L     V+   +  Y +    P + N++P GYYM+FVVH+G+PS  +W+++
Sbjct  522   L-EIVRVERFFMFGYRVIVFAPPTRNVAPPGYYMVFVVHQGVPSHSVWVKI  571



>emb|CDX81637.1| BnaC08g39640D [Brassica napus]
Length=558

 Score =   533 bits (1373),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 274/530 (52%), Positives = 355/530 (67%), Gaps = 18/530 (3%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCT  295
             GGRW+LL P++GI+AMHMQLL+N+KVVIFDRTD+G SN+ L    CR          DC+
Sbjct  38    GGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQTCRN-----ATVFDCS  92

Query  296   AHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCD  475
             AHS+ YDVA NT RPL +++D WCSS ++   G+LIQTGG+  G+ VVR+F PC+   CD
Sbjct  93    AHSLLYDVASNTFRPLTLRSDTWCSSGSLNASGSLIQTGGYGVGERVVRIFTPCDGVSCD  152

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDP  655
             WVE    L   RWY+TN ILPDGR II+GGR  F YEFYPK PG   ++ L FLAET DP
Sbjct  153   WVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNPGKS-VFILRFLAETRDP  211

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP++ L  DG+LFIFAN ++IL+D++ H +V+ +P +P G  R+YPSTGS+VLL
Sbjct  212   NEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPGGDKRNYPSTGSSVLL  271

Query  836   PLK---NLQAPGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRITDPNPVWFM  997
             PL          I AEV++CGGAP GAF  + R    +F+GA  TCGR+++TDPNP W M
Sbjct  272   PLSLTGENNRSKIAAEVMVCGGAPHGAFLKAARTIPKIFVGASRTCGRLKVTDPNPSWVM  331

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT-RFEIL  1174
             E MP  R+M DM+ LPNG++LIINGA+ G+AG+ D    V  P+LY    P  T RFEIL
Sbjct  332   EQMPAPRVMPDMLLLPNGDVLIINGASNGTAGWEDATKAVLNPILYLPGEPDPTRRFEIL  391

Query  1175  NPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAG  1354
              P+ IPRMYHS ++LL D RVL+GGSNPH NY F     +PTEL LEA+ P YLD   +G
Sbjct  392   APTRIPRMYHSASLLLADGRVLIGGSNPHRNYNF-TARHYPTELSLEAYLPRYLDPQYSG  450

Query  1355  IRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL  1528
             +RP I          YGK   + F   A G  DG  V+V +VAPSF+THS + +QR+L L
Sbjct  451   VRPSIVTVELAGNMLYGKSFAVTFVIPAFGMFDGR-VSVRLVAPSFSTHSTAMNQRMLVL  509

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                  V+ + +  Y      P +  ++P GYYM+F+VH+G PS  IW+++
Sbjct  510   RVRRVVQ-LSVFAYKADVDGPTNSYVAPPGYYMMFMVHRGTPSVAIWVKV  558



>ref|XP_002512263.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF49715.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=533

 Score =   529 bits (1362),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 263/536 (49%), Positives = 350/536 (65%), Gaps = 25/536 (5%)
 Frame = +2

Query  77    PPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCR  256
             P  S+ + +     G W  L  NIGI AMHMQLL+++KV+I+DRTDFG SN+ L   RCR
Sbjct  20    PATSQTLPSYPGRQGEWNQLQSNIGITAMHMQLLHDNKVIIYDRTDFGRSNVSLPHRRCR  79

Query  257   QDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHV  436
              D  +  ++VDCTAH++ YD+  N+ RPL +QTDVWCSSA+V+P+GTLIQTGG+NDGDHV
Sbjct  80    HDSRDQALEVDCTAHTILYDLDTNSFRPLTIQTDVWCSSASVIPNGTLIQTGGYNDGDHV  139

Query  437   VRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDL  616
             +R F  C +  CDW+E  + L   RWYA+N ILPDGR II+GGR  + YEFYP       
Sbjct  140   MRSFTSCLNDDCDWIEFRDYLRERRWYASNQILPDGRIIIVGGRRAYTYEFYPSV---SR  196

Query  617   LYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQ  796
              + L FL ET D  +ENNLYP++ L  DG+LFIFAN ++IL DY ++ V+R +P +P+  
Sbjct  197   TFWLSFLRETRDGNSENNLYPFLHLLPDGNLFIFANTRSILLDYNRNHVIREFPRIPNHD  256

Query  797   PRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITD  976
             PR+YPSTGS+VLLPL    +  I AE+LICGGAP+G+F  + R VF GA+++CGR+ +T 
Sbjct  257   PRNYPSTGSSVLLPLDE-NSDSIRAEILICGGAPRGSFERNARRVFEGAISSCGRLVVTR  315

Query  977   PNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVG  1156
              NP W METMP  R+M DM+ LP G+I+IINGA  G+AGY   RNP+  P +Y       
Sbjct  316   HNPSWDMETMPTPRVMSDMLLLPTGDIIIINGAQSGTAGYDAARNPITNPFIYRPHQSSN  375

Query  1157  TRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYL  1336
              RF ++ PS  PRMYHS+AILL D RVLVGG+                 L LE FSPPYL
Sbjct  376   RRFSVMTPSQKPRMYHSSAILLPDGRVLVGGN-----------------LSLETFSPPYL  418

Query  1337  DAATAGIRPHITLPGSHSKFGYG--KVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQH  1510
                   IRP + L    S  GYG      ++F     +  N+++V +VAPSFTTHSF+ +
Sbjct  419   SDEYTQIRPSV-LSLDKSTLGYGNASAFRVRFHVEEYISDNVLSVRIVAPSFTTHSFAMN  477

Query  1511  QRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             QR++ L    +++    NTY +    P +  ++P GYY+LFVVH G PS G W+++
Sbjct  478   QRMVVL-KMNSIEAETSNTYALHVAGPSTVQIAPPGYYLLFVVHAGTPSNGSWVKI  532



>ref|XP_010458940.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score =   530 bits (1364),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 278/537 (52%), Positives = 358/537 (67%), Gaps = 21/537 (4%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A   GGRW+LL P++GI+AMHMQLL+N+KVVIFDRTD+G SN+ L    C+         
Sbjct  37    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHLCQN-----ATV  91

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-  460
              DC+AHS+ YDVA NT RPL ++ D WCSS ++   G+LIQTGG+  G+  VRVF PC+ 
Sbjct  92    FDCSAHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGSGERTVRVFTPCDG  151

Query  461   --DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
                  CDWVE    L   RWY+TN ILPDGR II+GGR  F+YEFYPK PG  + +NL F
Sbjct  152   VGSLSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFSYEFYPKNPGKSV-FNLRF  210

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             LAET DP  ENNLYP++ L  DG+LFIFAN ++IL+D++ H +++ +PA+P G  R+YPS
Sbjct  211   LAETRDPNEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPAIPGGDKRNYPS  270

Query  815   TGSAVLLPL---KNLQAPGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRITD  976
             TGS+VLLPL          I AEV++CGGAP GAF  + R    +F+G   +CGR+++TD
Sbjct  271   TGSSVLLPLLLTGESNRSKIAAEVMVCGGAPPGAFFKAARTIPKIFVGGSRSCGRLKVTD  330

Query  977   PNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVG  1156
             PNP W ME MP  R+MGDM+ LPNG++LIINGAA G+AG+ D  N V  PVLY  D P  
Sbjct  331   PNPRWIMEQMPSPRVMGDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPVLYLPDEPDP  390

Query  1157  T-RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPY  1333
             T RFEIL P+ IPRMYHS ++LL D RVLVGGSNPH NY F   + +PTEL LEA+ P Y
Sbjct  391   TRRFEILAPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNF-TASPYPTELSLEAYLPRY  449

Query  1334  LDAATAGIRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFSQ  1507
             LD     +RP I       K   G+   + F   A G  DG  V+V +VAPSF+THS + 
Sbjct  450   LDPQYVRVRPTIITVELAGKMLNGQGFAVTFVIPAFGMFDGG-VSVRLVAPSFSTHSTAM  508

Query  1508  HQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             +QR+L L     V  + +  Y      P +  ++P GYYM+FVVH+GIPS  +W+++
Sbjct  509   NQRMLVL-RVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  564



>ref|XP_007039386.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY23887.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=569

 Score =   529 bits (1362),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 285/550 (52%), Positives = 356/550 (65%), Gaps = 30/550 (5%)
 Frame = +2

Query  83    WSRNMFAAAAGG----GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGR  250
             +S  +F  A G     G+W+LL  +IGI+AMHM LL N+++V FDRTDFG SNI L  G+
Sbjct  28    YSSVLFNLALGAQTYQGKWKLLKRSIGISAMHMALLPNERIVTFDRTDFGPSNITLPQGK  87

Query  251   CRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGD  430
             C +D    +   DC AHSVE+D A   VRPL + +D WCSS A+  DGTL+Q+GG+  G+
Sbjct  88    CMKD----LQSSDCFAHSVEFDPATRAVRPLTILSDTWCSSGALSQDGTLVQSGGYRLGE  143

Query  431   HVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGG  610
              VVR F PC D  CDW E  N L   RWYA+N ILPDG+ I++GGR +F YEF PK    
Sbjct  144   KVVRYFKPCMD--CDWEEDQNGLLSPRWYASNQILPDGKIIVVGGRYQFTYEFIPKASSS  201

Query  611   DL-LYNLPFLAETN-DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAM  784
             D  LY LPFL ET   P   NNLYP++ L+ DG+LF+FAN++ IL DY+ + V+R YP M
Sbjct  202   DQRLYQLPFLKETRYSPLVSNNLYPFLHLSTDGNLFVFANDRGILLDYVNNKVIRTYPVM  261

Query  785   PDGQPRSYPSTGSAVLLPLK--------NLQAPGIVAEVLICGGAPKGAFPASERGVFMG  940
             P G   +YPSTGS+VLLPLK        N   P   AEVLICGG P  +   +  G+F+ 
Sbjct  262   PGGFSHNYPSTGSSVLLPLKLLSTDNENNTSTPD--AEVLICGGTPPDSNEKANIGIFVP  319

Query  941   ALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQ  1120
             A   CGR+ IT  +P W ME MP+ R+MGDM+ LP G++LIINGAA+GSAG+G  R PV 
Sbjct  320   ASRYCGRLIITAASPEWEMEEMPINRVMGDMIMLPTGDVLIINGAAKGSAGWGVARKPVL  379

Query  1121  TPVLYH-TDNPVG---TRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGA  1288
              PVLY   DNP     TRFE+L+PS IPR+YHSTA LL D RVLVGGSNP+ NY F   A
Sbjct  380   NPVLYRPADNPSSDKNTRFEVLSPSMIPRLYHSTAQLLSDGRVLVGGSNPNMNYNF--SA  437

Query  1289  LFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVT  1468
             L+PTEL LEAF PPYL +     RP I       K GY + + ++FT  G V+   V VT
Sbjct  438   LYPTELSLEAFYPPYLSSTKP--RPSILAVRPGLKLGYKQKVSLEFTLEGNVNQGDVYVT  495

Query  1469  MVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKG  1648
             MVAPSFTTHS + +QRLL L     VK      Y +    P +  L+P GYY LF+VH+G
Sbjct  496   MVAPSFTTHSIAMNQRLLVLALDEGVKKTPSGNYLVKGYAPETAALAPPGYYQLFLVHEG  555

Query  1649  IPSEGIWIQM  1678
             IPS+G W+ +
Sbjct  556   IPSKGTWVHI  565



>ref|XP_010496071.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score =   528 bits (1361),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 277/537 (52%), Positives = 356/537 (66%), Gaps = 21/537 (4%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A   GGRW+LL P++GI+AMHMQLL+N+KVVIFDRTD+G SN+ L    C+         
Sbjct  37    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHLCQN-----ATV  91

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-  460
              DC+AHS+ YDVA NT RPL ++ D WCSS ++   G+LIQTGG+  G+  VRVF PC+ 
Sbjct  92    FDCSAHSILYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGSGERTVRVFTPCDG  151

Query  461   --DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
                  CDWVE    L   RWY+TN ILPDGR II+GGR  F YEFYPK PG  + +NL F
Sbjct  152   VGSLSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNPGKSV-FNLRF  210

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             LAET DP  ENNLYP++ L  DG+LFIFAN ++IL+D++ H +++ +P +P G  R+YPS
Sbjct  211   LAETRDPNEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGGDKRNYPS  270

Query  815   TGSAVLLPL---KNLQAPGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRITD  976
             TGS+VLLPL          I AEV++CGGAP GAF  + R    +F+G   +CGR+++TD
Sbjct  271   TGSSVLLPLLLTGESNRSKIAAEVMVCGGAPPGAFFKAARTIPKIFVGGSRSCGRLKVTD  330

Query  977   PNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVG  1156
             PNP W ME MP  R+MGDM+ LPNG++LIINGAA G+AG+ D  N V  PVLY  D P  
Sbjct  331   PNPRWIMEQMPSPRVMGDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPVLYLPDEPDP  390

Query  1157  T-RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPY  1333
             T RFEIL P+ IPRMYHS ++LL D RVLVGGSNPH NY F   + +PTEL LEA+ P Y
Sbjct  391   TRRFEILAPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNF-TASPYPTELSLEAYLPRY  449

Query  1334  LDAATAGIRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFSQ  1507
             LD     +RP I       K   G+   + F   A G  DG  V+V +VAPSF+THS + 
Sbjct  450   LDPQYVRVRPTIITVELAGKMLNGQGFAVTFVIPAFGMFDGG-VSVRLVAPSFSTHSTAM  508

Query  1508  HQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             +QR+L L     V  + +  Y      P +  ++P GYYM+FVVH+GIPS  +W+++
Sbjct  509   NQRMLVL-RVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  564



>ref|XP_006483245.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=575

 Score =   529 bits (1362),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 271/543 (50%), Positives = 364/543 (67%), Gaps = 14/543 (3%)
 Frame = +2

Query  83    WSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQD  262
             +S N    +  GG+W LL  +IGI+AMHMQ+LNNDKV+IFDRTD G SN+ L   +CR++
Sbjct  35    YSPNNNMPSKSGGQWVLLQSSIGISAMHMQVLNNDKVIIFDRTDMGPSNLSLPIDKCRKE  94

Query  263   PYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVR  442
                 V ++DCTAHSV YD+A NT RPL++QTD WCSS AV+ DGTL+QTGG+N GD V+R
Sbjct  95    --GDVGQLDCTAHSVLYDIASNTFRPLLLQTDTWCSSGAVLSDGTLVQTGGYNVGDRVIR  152

Query  443   VFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLY  622
             +F PCN++ CDWVE+   L   RWYA+N ILPD R I++GGR  F YEFYPK        
Sbjct  153   LFTPCNNEGCDWVELSKNLWDRRWYASNQILPDNRIIVVGGRRVFTYEFYPKIDSLSSSL  212

Query  623   NLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPR  802
              L FL ET DPG ENNLYP++ L  DG+LFIFAN ++IL+DYI + +V+ +P +P    R
Sbjct  213   YLRFLIETRDPGEENNLYPFLHLLPDGNLFIFANRRSILFDYINNKLVKEFPVIPGNDKR  272

Query  803   SYPSTGSAVLLPLK-------NLQAPGIVAEVLICGGAPKGAFPASER-GVFMGALNTCG  958
             +YPSTGS++LLP+K       N  A    AEV++CGGAP GAF  S++  V++ A  TCG
Sbjct  273   NYPSTGSSILLPVKLSAGSDGNGTAVLPDAEVMVCGGAPAGAFIKSDKESVYVEASRTCG  332

Query  959   RIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYH  1138
             R+++TD  PVW ME MPM R+M DM+ LP+G+++IINGA+ G+AG+ D   P   PVLY 
Sbjct  333   RLKVTDKYPVWSMEFMPMPRVMSDMLLLPSGDVIIINGASNGTAGWEDAVGPNLNPVLYS  392

Query  1139  TDNPV-GTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLE  1315
              D      RF +LNPS IPRMYHS+A++L D R+LVGGSNPH  Y F     +PT+L LE
Sbjct  393   PDEEEPDRRFVVLNPSKIPRMYHSSAVVLPDGRILVGGSNPHRRYNF-TAYPYPTDLSLE  451

Query  1316  AFSPPYLDAATAGIRPHI-TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTT  1492
             AF P YLD   A +RP I +L        Y +V+ + F  +       ++V+++ PSFTT
Sbjct  452   AFHPHYLDPENAYMRPSILSLESIGRTVSYNEVLSVTFELSSYSPSGEISVSLMTPSFTT  511

Query  1493  HSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWI  1672
             HSF+ +QRL+ L      + + +  Y +    P +  ++P GYYM+FVVH GIPS  +W+
Sbjct  512   HSFAMNQRLVVLNVVSVSQ-LSVYAYKVVVNGPPTATVAPPGYYMMFVVHAGIPSHAVWV  570

Query  1673  QMV  1681
             ++ 
Sbjct  571   KVT  573



>ref|XP_006417012.1| hypothetical protein EUTSA_v10007241mg [Eutrema salsugineum]
 gb|ESQ35365.1| hypothetical protein EUTSA_v10007241mg [Eutrema salsugineum]
Length=564

 Score =   528 bits (1361),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 286/571 (50%), Positives = 371/571 (65%), Gaps = 24/571 (4%)
 Frame = +2

Query  8     HQMGRRNFTLLFALWQLFLVAAPPPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNND  187
              +  +  + L+ + +  FL +           A   GGRW+LL P++GI+AMHMQLL+N+
Sbjct  4     ERFKKNLYALVLSFFSFFLCSTSDLLLPRSPLAILAGGRWDLLQPSVGISAMHMQLLHNN  63

Query  188   KVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWC  367
             KVVIFDRTD+G SN+PL    CR          DC+AHS+ YDVA NT R L ++ D WC
Sbjct  64    KVVIFDRTDYGPSNLPLPPQMCRN-----ATVFDCSAHSLLYDVASNTFRALTLRYDTWC  118

Query  368   SSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN----DKKCDWVEIPNALHRWRWYATNHIL  535
             SS ++   G+LIQTGG+  G+  VRVF PC+       CDWVE    L   RWY+TN IL
Sbjct  119   SSGSLNASGSLIQTGGYGVGERAVRVFTPCDGVGGSVSCDWVENRAYLSSRRWYSTNQIL  178

Query  536   PDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFI  715
             PDGR II+GGR  F+YEFYPK PG  + Y L FLAET DP  ENNLYP++ L  DG+LFI
Sbjct  179   PDGRIIIVGGRRAFSYEFYPKNPGKSVFY-LRFLAETRDPKEENNLYPFLHLLPDGNLFI  237

Query  716   FANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPL----KNLQAPGIVAEVLI  883
             FAN ++IL+D++ H +V+ +P +P G  R+YPSTGS+VLLPL    +N ++  I AEV++
Sbjct  238   FANRRSILFDFVNHRIVKEFPVIPGGDKRNYPSTGSSVLLPLFLTGENNRS-KIAAEVMV  296

Query  884   CGGAPKGAFPASER---GVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGN  1054
             CGGAP GAF  + R    +F+G+  TCGR+++TD NP W ME MP  R+M DM+ LPNGN
Sbjct  297   CGGAPPGAFLKAARTIPKIFVGSSRTCGRLKVTDRNPQWVMEQMPSPRVMPDMLLLPNGN  356

Query  1055  ILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT-RFEILNPSGIPRMYHSTAILLRDS  1231
             +LIINGAA G+AG+ D  N V  P+LY  D P  T RFEIL P+ IPRMYHS ++LL D 
Sbjct  357   VLIINGAANGTAGWEDATNAVLNPILYLPDEPDPTRRFEILAPTRIPRMYHSASLLLPDG  416

Query  1232  RVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKV  1411
             RVLVGGSNPH NY F     +PTEL LEA+ P YLD   AG+RP I          YGK 
Sbjct  417   RVLVGGSNPHRNYNF-TARPYPTELSLEAYLPRYLDPQNAGVRPTILTVELAGNMLYGKA  475

Query  1412  IEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAV  1585
               + F   A G  +G  V+V +VAPSF+THS + +QRLL L      + + +  Y     
Sbjct  476   FSVTFVIPAFGMFNGE-VSVRLVAPSFSTHSTAMNQRLLVLRVRRVAQ-LSVFAYKADVD  533

Query  1586  TPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              P +  ++P GYYM+FVVH+GIPS GIW+++
Sbjct  534   GPTNSYVAPPGYYMMFVVHRGIPSVGIWVRL  564



>ref|XP_010476497.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score =   528 bits (1360),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 276/537 (51%), Positives = 355/537 (66%), Gaps = 21/537 (4%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A   GGRW+LL P++GI+AMHMQLL+N+KVVIFDRTD+G SN+ L    C+         
Sbjct  37    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHLCQN-----ATV  91

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-  460
              DC+AHS+ YDVA NT RPL ++ D WCSS ++   G+LIQTGG+  G+  VRVF PC+ 
Sbjct  92    FDCSAHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGSGERTVRVFTPCDG  151

Query  461   --DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
                  CDWVE    L   RWY+TN ILPDGR II+GGR  F YEFYPK PG  + +NL F
Sbjct  152   VGSLSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNPGKSV-FNLRF  210

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             LAET DP  ENNLYP++ L  DG+LFIFAN ++IL+D++ H +++ +P +P G  R+YPS
Sbjct  211   LAETRDPNEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGGDKRNYPS  270

Query  815   TGSAVLLPL---KNLQAPGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRITD  976
             TGS+VLLPL          I AEV++CGGAP GAF  + R    +F+G   +CGR+++TD
Sbjct  271   TGSSVLLPLLLTGESNRSKIAAEVMVCGGAPPGAFFKAARTIPKIFVGGSRSCGRLKVTD  330

Query  977   PNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVG  1156
             PNP W ME MP  R+MGDM+ LPNG++LIINGAA G+AG+ D  N V  P+LY  D P  
Sbjct  331   PNPRWIMEQMPSPRVMGDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPILYLPDEPDP  390

Query  1157  T-RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPY  1333
             T RFEIL P+ IPRMYHS ++LL D RVLVGGSNPH NY F     +PTEL LEA+ P Y
Sbjct  391   TRRFEILAPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNF-TARSYPTELSLEAYLPRY  449

Query  1334  LDAATAGIRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFSQ  1507
             LD     +RP I          YG+   + F   A G  DG  V+V +VAPSF+THS + 
Sbjct  450   LDPQYVRVRPTIITVELAGNMLYGQGFAVTFAIPAFGMFDGG-VSVRLVAPSFSTHSTAM  508

Query  1508  HQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             +QR+L L     V  + +  Y      P +  ++P GYYM+FVVH+GIPS  +W+++
Sbjct  509   NQRMLVL-RVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  564



>ref|XP_006438575.1| hypothetical protein CICLE_v10031195mg [Citrus clementina]
 gb|ESR51815.1| hypothetical protein CICLE_v10031195mg [Citrus clementina]
Length=535

 Score =   527 bits (1357),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 269/534 (50%), Positives = 360/534 (67%), Gaps = 14/534 (3%)
 Frame = +2

Query  107   AAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKV  286
             +  GG+W LL  +IGI+AMHMQ+LNNDKV+IFDRTD G SN+ L   +CR++    V ++
Sbjct  3     SKSGGQWVLLQSSIGISAMHMQVLNNDKVIIFDRTDMGPSNLSLPIDKCRKE--GDVGQL  60

Query  287   DCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDK  466
             DCTAHSV YD+A NT RPL++QTD WCSS AV+ DGTL+QTGG+N GD V+R+F PCN++
Sbjct  61    DCTAHSVLYDIASNTFRPLLLQTDTWCSSGAVLSDGTLVQTGGYNVGDRVIRLFTPCNNE  120

Query  467   KCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAET  646
              CDWVE+   L   RWYA+N ILPD R I++GGR  F YEFYPK         L FL ET
Sbjct  121   GCDWVELSKNLWDRRWYASNQILPDNRIIVVGGRRVFTYEFYPKIDSLSSSLYLRFLIET  180

Query  647   NDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
              DPG ENNLYP++ L  DG+LFIFAN ++IL+DYI + +V+ +P +P    R+YPSTGS+
Sbjct  181   RDPGEENNLYPFLHLLPDGNLFIFANRRSILFDYINNKLVKEFPVIPGNDKRNYPSTGSS  240

Query  827   VLLPLK-------NLQAPGIVAEVLICGGAPKGAFPASER-GVFMGALNTCGRIRITDPN  982
             +LLP+K       N  A    AEV++CGGAP GAF  S++  V++ A  TCGR+++TD  
Sbjct  241   ILLPVKLSAGSDGNGTAVLPDAEVMVCGGAPAGAFIKSDKESVYVEASRTCGRLKVTDKY  300

Query  983   PVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV-GT  1159
             PVW ME MPM R+M DM+ LP+G+++IINGA+ G+AG+ D   P   PVLY  D      
Sbjct  301   PVWSMEFMPMPRVMSDMLLLPSGDVIIINGASNGTAGWEDAVGPNLNPVLYSPDEEEPDR  360

Query  1160  RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLD  1339
             RF +LNPS IPRMYHS+A++L D R+LVGGSNPH  Y F     +PT+L LEAF P YLD
Sbjct  361   RFVVLNPSKIPRMYHSSAVVLPDGRILVGGSNPHRRYNF-TAYPYPTDLSLEAFHPHYLD  419

Query  1340  AATAGIRPHI-TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQR  1516
                A +RP I +L        Y +V  + F  +       ++V+++ PSFTTHSF+ +QR
Sbjct  420   PENAYMRPSILSLESIGRTVSYNEVFSVTFELSSYSPSGEISVSLMTPSFTTHSFAMNQR  479

Query  1517  LLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             L+ L      + + +  Y +    P +  ++P GYYM+FVVH GIPS  +W+++
Sbjct  480   LVVLNVVSVSQ-LSVYAYKVVVNGPPTATVAPPGYYMMFVVHAGIPSHAVWVKV  532



>ref|XP_011071032.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=607

 Score =   530 bits (1364),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 270/531 (51%), Positives = 357/531 (67%), Gaps = 14/531 (3%)
 Frame = +2

Query  113   GGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDC  292
             GGG W LL   IG++AMHMQLL N+KV+IFDRTDFG SN+ L  G+CR    +  V  DC
Sbjct  81    GGGEWSLLQETIGVSAMHMQLLYNNKVLIFDRTDFGPSNLTLPSGKCRHS--DEAVSQDC  138

Query  293   TAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKC  472
             TAHS+ YDVA NT RPL+V+TDVWCSS AV  +GTLIQTGG++ G H +R+F PC+D +C
Sbjct  139   TAHSLLYDVASNTYRPLLVKTDVWCSSGAVNSEGTLIQTGGYHGGGHKIRLFRPCDDDQC  198

Query  473   DWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETND  652
             DW+E+   L   RWY+++HILPDGR II+GGR  F+YEF+PK    +  Y  PFL ET D
Sbjct  199   DWIELHQNLTVHRWYSSDHILPDGRVIIVGGRSSFSYEFFPKNTFENSFYYFPFLKETTD  258

Query  653   PGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVL  832
                ENNLYP+++L  DG+LF+FAN +++L +Y K+ +V+ +P +P G+ R+YP+TGS+V+
Sbjct  259   MKEENNLYPFLYLLPDGNLFVFANQRSVLLNYKKNKIVKEFPVIP-GEKRTYPATGSSVM  317

Query  833   LPLK------NLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWF  994
             LPLK      +        EV++CGGA  GA+  +  G+++ A ++CGRIR+TD  P W 
Sbjct  318   LPLKLTAGEWDDSPSHPEVEVMVCGGARGGAYMKAVEGLYVAASSSCGRIRVTDQEPKWE  377

Query  995   METMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT-RFEI  1171
             ME MPM R+M DM+ LP G+++I+NGAA G+AG+    NPV  PV+Y    P  T RF +
Sbjct  378   MEDMPMGRVMPDMLLLPTGDVIIVNGAANGTAGWECAINPVLNPVIYKPYEPDPTKRFSV  437

Query  1172  LNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATA  1351
             LNP+ I RMYHS A LL D RVLVGGSNPH  Y F  G  +PTEL LEAFSPPYL +  A
Sbjct  438   LNPTKIARMYHSAATLLPDGRVLVGGSNPHVRYNF-TGVRYPTELSLEAFSPPYLASEHA  496

Query  1352  GIRPHI--TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLD  1525
              +RP I  T   S++   YG+   I FT           V M APSFTTHSF+ +QRLL 
Sbjct  497   HLRPSILSTEGPSNNVISYGQQFAITFTLGMYQHVGEYMVAMAAPSFTTHSFAMNQRLLV  556

Query  1526  LGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             L      +    + + +T   P + N++P GYYMLFVVH+G+P   +WI++
Sbjct  557   LYVVNAHQLSAFD-HKVTVYAPPTANIAPPGYYMLFVVHQGVPGHCVWIRI  606



>ref|XP_008781649.1| PREDICTED: uncharacterized protein LOC103701389 [Phoenix dactylifera]
Length=576

 Score =   527 bits (1358),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 277/548 (51%), Positives = 363/548 (66%), Gaps = 29/548 (5%)
 Frame = +2

Query  77    PPWSRNMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCR  256
             PPW          GG W+LL  +IGI+AMHMQLL  DKVV+FDRTDFG SNI L GGRCR
Sbjct  40    PPW--------GSGGEWQLLHASIGISAMHMQLLPGDKVVMFDRTDFGPSNISLPGGRCR  91

Query  257   QDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHV  436
              DP ++ + +DCTAHSV  D+    +RPL + +D WCSS A++P+GTL+Q+GG+NDGDH 
Sbjct  92    SDPADLALPIDCTAHSVLLDLPSAALRPLTLLSDTWCSSGALLPNGTLLQSGGFNDGDHS  151

Query  437   VRVFNPCN-DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPK-----  598
             +R+F+  + D   DW E+P+ L   RWYA++ +LPDGR +I+GGR +F+YEF+P      
Sbjct  152   IRLFDSVSGDPLADWQELPSYLAVRRWYASDQLLPDGRVLIVGGRRQFSYEFFPSQESAA  211

Query  599   -TPGGDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLY  775
              + G   L+  PFL ET D  AENNLYP++ L  DG LF+FAN +A++ D   H V+R  
Sbjct  212   GSGGHGALFPFPFLEETRDANAENNLYPFLHLLPDGTLFVFANTRAVILDIASHQVLRRL  271

Query  776   PAMPDGQPRSYPSTGSAVLLPLKNLQAPGIVA----EVLICGGAPKGAFPASERGVFMGA  943
             P +PD  PR+YPS+GS+VLLPL+   APG       EVLICGGAP+G++ ++ RGVF+ A
Sbjct  272   PPIPDDVPRNYPSSGSSVLLPLR--LAPGGTTLPRPEVLICGGAPRGSYESALRGVFLPA  329

Query  944   LNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQT  1123
               TCGRI   DPNP W METMPM R+MGDMV LP G++LI+NGAA G+AG+   R PV  
Sbjct  330   ATTCGRIGPADPNPAWIMETMPMPRVMGDMVLLPTGDVLIVNGAAAGTAGWELAREPVMN  389

Query  1124  PVLYHTDNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTE  1303
             PVLY        RF +LN S IPR+YHSTA+L    RVLVGGSNPH  Y F N   +PTE
Sbjct  390   PVLYSPGASAELRFTVLNGSSIPRLYHSTALLDPYGRVLVGGSNPHVGYNFTN-VTYPTE  448

Query  1304  LRLEAFSPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVD---GNLVTVTMV  1474
             L LEAF PPY+  A+AG R  + +    ++ GYG+V+ ++F     V+     LV V  +
Sbjct  449   LSLEAFRPPYV--ASAGPR-VVAVGAPEAEVGYGEVVAVRFEVVAYVEWTGTGLVEVVAM  505

Query  1475  APSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIP  1654
             AP F TH+   +QR + L   G V  VG   Y   A  P S  ++P GYY+ FVVH G+P
Sbjct  506   APGFATHAVGMNQRAVVL-PVGRVTQVGPFEYVAEAEAPPSPEVAPPGYYLWFVVHAGLP  564

Query  1655  SEGIWIQM  1678
             S+G+W+++
Sbjct  565   SQGVWVRI  572



>ref|NP_172895.2| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAF43943.1|AC012188_20 Weak similarity to glyoxal oxidase (glx2) from Phanerochaete 
chrysosporium gb|L47287 [Arabidopsis thaliana]
 gb|AEE29162.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=564

 Score =   524 bits (1349),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 274/538 (51%), Positives = 359/538 (67%), Gaps = 22/538 (4%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A   GGRW+LL P++GI+AMHMQLL+N+KVVIFDRTD+G SN+ L    C+         
Sbjct  36    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNVSLPSQTCQN-----ATV  90

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-  460
              DC+AHS+ YDVA NT RPL ++ D WCSS ++   G+LIQTGG+ +G+  VRVF PC+ 
Sbjct  91    FDCSAHSILYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGNGERTVRVFTPCDG  150

Query  461   ---DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLP  631
                   CDW+E    L   RWY+TN ILPDGR II+GGR  FNYEFYPK PG + ++NL 
Sbjct  151   GVGSVSCDWIENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFNYEFYPKDPG-ESVFNLR  209

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FLAET DP  ENNLYP++ L  DG+LFIFAN ++IL+D++ H +++ +P +P G  R+YP
Sbjct  210   FLAETRDPNEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPQIPGGDKRNYP  269

Query  812   STGSAVLLPL---KNLQAPGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRIT  973
             STGS+VLLPL    ++    I AEV++CGGAP GAF  + R    +F+    TCGR+++T
Sbjct  270   STGSSVLLPLFLTGDINRTKITAEVMVCGGAPPGAFFKAARTIPKIFVAGSRTCGRLKVT  329

Query  974   DPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV  1153
             DP+P W ME MP  R+M DM+ LPNG++LIINGAA G+AG+ D  N V  P+LY  + P 
Sbjct  330   DPDPKWVMEQMPSPRVMSDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPILYLPEEPD  389

Query  1154  GT-RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPP  1330
              T RFEIL P+ IPRMYHS ++LL D RVLVGGSNPH NY F     +PTEL LEA+ P 
Sbjct  390   QTRRFEILTPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNF-TARPYPTELSLEAYLPR  448

Query  1331  YLDAATAGIRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFS  1504
             YLD   A +RP I          YG+   + F   A G  DG  V+V +VAPSF+THS +
Sbjct  449   YLDPQYARVRPTIITVELAGNMLYGQAFAVTFAIPAFGMFDGG-VSVRLVAPSFSTHSTA  507

Query  1505  QHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              +QRLL L      + + +  Y      P +  ++P GYYM+FVVH+GIPS  +W+++
Sbjct  508   MNQRLLVLRVRRVSQ-LSVFAYKADVDGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  564



>ref|XP_009407008.1| PREDICTED: uncharacterized protein LOC103989784, partial [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   522 bits (1345),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 271/530 (51%), Positives = 354/530 (67%), Gaps = 15/530 (3%)
 Frame = +2

Query  101   AAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV  280
             A   G G W LL  +IGI+AMHMQLL +D VVIFDRTDFG SNI L GGRCR D Y++ +
Sbjct  25    APVKGRGEWRLLRASIGISAMHMQLLPDDTVVIFDRTDFGRSNISLPGGRCRFDSYDLAL  84

Query  281   KVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN  460
               DCTAHSV   +    VRPL + TD WCSS A++P+G+L+QTGG+NDGD V+R+F+P  
Sbjct  85    TTDCTAHSVLLLLPSAAVRPLSLLTDTWCSSGALLPNGSLLQTGGFNDGDRVIRLFSPSR  144

Query  461   DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKT-PGGDLLYNLPFL  637
               + DWVE P  L   RWYA+N +LPDGR II+GGR +F+YEF+P+   G   ++  PFL
Sbjct  145   GGRSDWVERPFYLSVRRWYASNQLLPDGRVIILGGRRQFSYEFFPRELAGSRTVFQFPFL  204

Query  638   AETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPST  817
              +T +   ENNLYP++ L  DG LF+FAN++A++ D I+H V+R  P +P G PRSYPS+
Sbjct  205   LDTWNRETENNLYPFLHLLPDGTLFVFANDRAVVLDAIRHRVLRRLPPVPGG-PRSYPSS  263

Query  818   GSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFM  997
             GS+VLLPL+    PG   EVL+CGG P G++ A+  G F+ AL TC RI+  D +P W +
Sbjct  264   GSSVLLPLR----PGAAPEVLVCGGTPWGSYQAALNGTFLPALRTCARIKPADSDPAWSL  319

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILN  1177
             E MP+ R+MGDM+ LP  ++LI+NGAA G+AG+   RNPV  PVLYH D P G RF +L 
Sbjct  320   EDMPLPRVMGDMLLLPTCDVLIVNGAAAGTAGWELARNPVTRPVLYHPDRPAGRRFAVLK  379

Query  1178  PSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGI  1357
              S IPRMYHSTAIL    RVLVGGSNP  +Y F N  ++PTEL LEAF PPYL A T   
Sbjct  380   RSRIPRMYHSTAILDTYGRVLVGGSNPQAHYAFAN-VMYPTELSLEAFHPPYLAART---  435

Query  1358  RPHITLPGSHSKFGYGKVIEIQFTAAGPVDG---NLVTVTMVAPSFTTHSFSQHQRLLDL  1528
             RP +    +  + GYG+ + ++F AAG        +V V +VAP+F TH+   +QR + L
Sbjct  436   RPRMA--AAPREVGYGERVALRFEAAGHYGAWEELVVEVVVVAPAFATHAVGMNQRAVML  493

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                  V   G   Y    V P S  ++P GYY+ FVVH G+PS G+W+++
Sbjct  494   EASRAVWAWGNFGYVAEVVAPPSPKVAPPGYYLWFVVHAGVPSNGVWVRI  543



>ref|XP_002890054.1| hypothetical protein ARALYDRAFT_888820 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66313.1| hypothetical protein ARALYDRAFT_888820 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score =   522 bits (1345),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 275/539 (51%), Positives = 362/539 (67%), Gaps = 24/539 (4%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A   GGRW+LL P++GI+AMHMQLL+N+KVVIFDRTD+G SN+ L    C+         
Sbjct  36    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQTCQNG-----TV  90

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCND  463
              DC+AHS+ YDVA NT RPL ++ D WCSS ++   G+LIQTGG+  G+  VR+F PC++
Sbjct  91    FDCSAHSILYDVASNTYRPLTLRYDTWCSSGSLNASGSLIQTGGYGAGERTVRIFTPCDE  150

Query  464   K----KCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLP  631
                   CDWVE    L   RWY+TN ILPDGR II+GGR  F YEFYPK PG + ++NL 
Sbjct  151   GVGSVSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNPG-ESVFNLR  209

Query  632   FLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYP  811
             FLAET DP  ENNLYP++ L  DG+LFIFAN ++IL+D++ H +++ +P +P G  R+YP
Sbjct  210   FLAETRDPNEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGGDKRNYP  269

Query  812   STGSAVLLPL----KNLQAPGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRI  970
             STGS+VLLP+    +N ++  I+AEV++CGGAP GAF  + R    +F+GA  TCGR+++
Sbjct  270   STGSSVLLPIFLTGENNRS-KIMAEVMVCGGAPPGAFLKAARTIPKIFVGASRTCGRLKV  328

Query  971   TDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNP  1150
             TDPNP W ME MP  R+M DM+ LPNG++LIINGAA G+AG+ D  N V  P+LY  D P
Sbjct  329   TDPNPKWVMEQMPSPRVMSDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPILYLPDEP  388

Query  1151  VGT-RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSP  1327
               T RFEIL P+ IPRMYH+ ++LL D RVLVGGSNPH NY F     +PTEL LEA+ P
Sbjct  389   DPTRRFEILTPTRIPRMYHAASLLLSDGRVLVGGSNPHRNYNF-TARPYPTELSLEAYLP  447

Query  1328  PYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSF  1501
              YLD   A +RP I          YG+   + F   A G  DG   +V +VAPSF+THS 
Sbjct  448   RYLDPQYARVRPTIITVELAGNMLYGQAFAVTFAIPAFGMFDGG-ASVRLVAPSFSTHST  506

Query  1502  SQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             + +QRLL L      + + +  Y      P +  ++P GYYM+FVVH+GIPS  +W+++
Sbjct  507   AMNQRLLVLRVRRVSQ-LSVFAYKADVDGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  564



>gb|KDP25206.1| hypothetical protein JCGZ_20362 [Jatropha curcas]
Length=545

 Score =   521 bits (1342),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 280/542 (52%), Positives = 359/542 (66%), Gaps = 22/542 (4%)
 Frame = +2

Query  86    SRNMFAAAAGG----GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRC  253
             S ++F +A G     GRW+LL  +IGI++MHMQL+ NDK++ FDRTDFG SN+ L  G+C
Sbjct  14    SASLFISAIGDPLYRGRWKLLKRSIGISSMHMQLVPNDKIITFDRTDFGPSNLSLPEGKC  73

Query  254   RQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDH  433
               +        DC AHSVE+D     VRPL + TD WCSS ++ PDGTL+Q+GG+  G+ 
Sbjct  74    ISESQ----NNDCFAHSVEFDPLNRNVRPLTILTDTWCSSGSLSPDGTLMQSGGYGLGER  129

Query  434   VVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGD  613
             VVR F PC D  CDWVE PN L   RWYA+N +LPDG+ I++GGR +FNYEF PK+   D
Sbjct  130   VVRTFKPCAD--CDWVEDPNGLISPRWYASNQVLPDGKIIVVGGRYQFNYEFIPKSSIND  187

Query  614   L-LYNLPFLAETN-DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMP  787
               LY LPFL ET   P   NNLYP++ L+ DG+LFIFAN++AIL DY+ + VV+ YP MP
Sbjct  188   QKLYQLPFLKETRYSPLIPNNLYPFLHLSPDGNLFIFANDRAILLDYVNNKVVKNYPVMP  247

Query  788   DGQPRSYPSTGSAVLLPL--KNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGR  961
              G  R+YPSTGS+VLLPL   N  +    AEV+ICGG    +   +  G+++ A  +CGR
Sbjct  248   GGISRNYPSTGSSVLLPLVLHNNFSSSPNAEVVICGGTLPDSNEQTNAGIYIAASKSCGR  307

Query  962   IRITDPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHT  1141
             I I   NPVW ME MP+ R+MGDM+ LP G++LIINGAA G+AG+   R PV  PVLY  
Sbjct  308   IAINKENPVWEMEEMPVRRVMGDMIMLPTGDVLIINGAANGTAGWNAAREPVLNPVLYRP  367

Query  1142  DNPVGTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAF  1321
             + P   RFE+++PS IPR+YHS A LL D RVLVGGSNP+ NY F   A++PTEL LEAF
Sbjct  368   NIPTN-RFELMSPSPIPRLYHSAAHLLSDGRVLVGGSNPNRNYNF--TAIYPTELSLEAF  424

Query  1322  SPPYLDAATAGIRPHITLPGSHSKFGYGKVIEIQFTAAGPVDGNL--VTVTMVAPSFTTH  1495
              PPYL   T+  RP IT     +   Y +   + F +      NL  + VTMVAPSFTTH
Sbjct  425   YPPYLSPNTS--RPAITEINPEANLRYKQKFTMGFESKTEKMVNLQKIYVTMVAPSFTTH  482

Query  1496  SFSQHQRLLDLG-GGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWI  1672
             SF+ +QRLL L      V+ VG   Y +   TP +G L+P GYY LFVVH+G+PS G+W+
Sbjct  483   SFAMNQRLLVLALDNNGVQKVGTGKYSVQVNTPVTGALAPPGYYQLFVVHEGVPSRGMWV  542

Query  1673  QM  1678
              +
Sbjct  543   HI  544



>ref|XP_006833409.1| hypothetical protein AMTR_s00109p00131490 [Amborella trichopoda]
 gb|ERM98687.1| hypothetical protein AMTR_s00109p00131490 [Amborella trichopoda]
Length=603

 Score =   523 bits (1347),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 269/525 (51%), Positives = 360/525 (69%), Gaps = 11/525 (2%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVV-KVDC  292
              G WEL   N GI+AMH+QL+ + KVV+FD + FG S I L GGRCR D  E      DC
Sbjct  85    AGSWELASANTGISAMHVQLMPSGKVVMFDASVFGPSKIKLDGGRCRIDKRERRKGNNDC  144

Query  293   TAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKC  472
              AH+VEYDV    VRPLMV+T+ WCSS A+  DG LIQTGG+N+G +VVR++  C D  C
Sbjct  145   WAHAVEYDVDTAAVRPLMVKTNTWCSSGALGADGRLIQTGGFNEGGNVVRLYESCKD--C  202

Query  473   DWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDL-LYNLPFLAETN  649
             DWVE PN+L   RWY+++HILPDG  II+GGR +F+YEF P     +L +Y+LPFL ET 
Sbjct  203   DWVEKPNSLSGQRWYSSDHILPDGNVIIVGGRRKFSYEFIPAEGNSELKVYDLPFLKETT  262

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D   ENNLYP++ L+ DG+LF+FAN+++IL DY  + +VR +P +P G  R+YP++GSAV
Sbjct  263   D-DVENNLYPFLHLSTDGNLFVFANDRSILLDYKNNRIVRTFPVLPGGS-RNYPASGSAV  320

Query  830   LLPLKNLQAPGIV-AEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETM  1006
             LLP++      ++ +EVLICGGA   +   ++RGVF+ AL+TCGRI ITDPN  W +E M
Sbjct  321   LLPIRLRGRENLIPSEVLICGGATPESASQADRGVFVDALDTCGRITITDPNSQWKIERM  380

Query  1007  PMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSG  1186
             P  R+MGDM+ LPN  +LIINGA  G++G+   RNP  +PVLY+  NP   RF+ LNPS 
Sbjct  381   PSRRVMGDMLILPNAQVLIINGAKSGTSGWSFARNPNLSPVLYNPRNPRNQRFQTLNPST  440

Query  1187  IPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPH  1366
             IPRMYHS+ ++L D +VL+ GSN +P Y +   +L+PTELR E FSPPYLD + A  RP+
Sbjct  441   IPRMYHSSGVVLPDGKVLIAGSNTNPKYNY--TSLYPTELRAEKFSPPYLDPSLASHRPN  498

Query  1367  ITLPGSHSKFGYGKVIEIQFTAAGPVDGNL-VTVTMVAPSFTTHSFSQHQRLLDLGGGGT  1543
             I          YG   +IQ + +  +  +  ++VTM AP FTTHS+SQ+QR+L L     
Sbjct  499   ILTELMPKALAYGGGFKIQISLSDQIVADTDLSVTMYAPPFTTHSYSQNQRMLVLRMND-  557

Query  1544  VKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             V+ V   TY ++ V P S  ++P GYY+LFVVH G+PSEG+W+ +
Sbjct  558   VEQVAPGTYQISVVAPPSAVVAPPGYYLLFVVHFGVPSEGVWVHI  602



>gb|KDO82728.1| hypothetical protein CISIN_1g048017mg [Citrus sinensis]
Length=566

 Score =   521 bits (1342),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 265/534 (50%), Positives = 356/534 (67%), Gaps = 26/534 (5%)
 Frame = +2

Query  107   AAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKV  286
             +  GG+W LL  +IGI+AMHMQ+LNNDKV+IFDRTD G SN+ L   +CR++    V ++
Sbjct  48    SKSGGQWVLLQSSIGISAMHMQVLNNDKVIIFDRTDMGPSNLSLPIDKCRKE--GDVGQL  105

Query  287   DCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDK  466
             DCTAHSV YD+A NT RPL++QTD WCSS AV+ DGTL+QTGG+N GD V+R+F PCND+
Sbjct  106   DCTAHSVLYDIASNTFRPLLLQTDTWCSSGAVLSDGTLVQTGGYNVGDRVIRLFTPCNDE  165

Query  467   KCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAET  646
              CDWVE+   L   RWYA+N ILPD R I++GGR  F YEFYPK         L FL ET
Sbjct  166   GCDWVELSKNLWDRRWYASNQILPDNRIIVVGGRRVFTYEFYPKIDSLSSSLYLRFLIET  225

Query  647   NDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSA  826
              DPG ENNLYP++ L  DG+LFIFAN ++IL+DYI + +V+ +P +P    R+YPSTGS+
Sbjct  226   RDPGEENNLYPFLHLLPDGNLFIFANRRSILFDYINNKLVKEFPVIPGNDKRNYPSTGSS  285

Query  827   VLLPLK-------NLQAPGIVAEVLICGGAPKGAFPASER-GVFMGALNTCGRIRITDPN  982
             +LLP+K       N  A    AEV++CGGAP GAF  S++  V++ A  TCGR+++TD  
Sbjct  286   ILLPVKLSAGSDGNGTAALPDAEVMVCGGAPAGAFIKSDKESVYVEASRTCGRLKVTDKY  345

Query  983   PVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTR  1162
             PVW ME MPM R+M DM+ LP+G+++IINGA+ G+AG+ D   P +             R
Sbjct  346   PVWSMEFMPMPRVMSDMLLLPSGDVIIINGASNGTAGWEDAEEPDR-------------R  392

Query  1163  FEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDA  1342
             F +LNPS IPRMYHS+A++L D R+LVGGSNPH  Y F     +PT+L LEAF P YLD 
Sbjct  393   FVVLNPSKIPRMYHSSAVVLPDGRILVGGSNPHRRYNF-TAYPYPTDLSLEAFHPHYLDP  451

Query  1343  ATAGIRPHI-TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRL  1519
               A +RP I +L        Y +V  + F  +       ++V+++ PSFTTHSF+ +QRL
Sbjct  452   ENAYMRPSILSLESIDRTVSYNEVFAVTFELSSYSPSGEISVSLMTPSFTTHSFAMNQRL  511

Query  1520  LDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             + L      + + +  Y +    P +  ++P GYYM+FVVH GIPS  +W+++ 
Sbjct  512   VVLNVVSVSQ-LSVYAYKVVVNGPPTATVAPPGYYMMFVVHAGIPSHAVWVKVT  564



>ref|XP_002973684.1| hypothetical protein SELMODRAFT_413959 [Selaginella moellendorffii]
 gb|EFJ25344.1| hypothetical protein SELMODRAFT_413959 [Selaginella moellendorffii]
Length=537

 Score =   519 bits (1336),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 274/538 (51%), Positives = 351/538 (65%), Gaps = 19/538 (4%)
 Frame = +2

Query  83    WSRNMFAAAAGG---GRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRC  253
             W    F   +G    G WELL+ N G++AMHM + + +KV+IFDRTD+G S I L  GRC
Sbjct  14    WVSGAFRHGSGASPRGSWELLVENSGVSAMHMLVSHTNKVLIFDRTDYGPSAIRLPHGRC  73

Query  254   RQDPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDH  433
             R D  ++ +K+DC AHSVE  +    +RPL V TD WCSS A   DGT  QTGGWNDG  
Sbjct  74    RNDSSDLALKIDCWAHSVELQIPTRNIRPLEVLTDTWCSSGAFRADGTFTQTGGWNDGAR  133

Query  434   VVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGD  613
             VVR +N C D  C+W E P  L R RWYA+N ILPD R I++GGR  F+YEF    PG  
Sbjct  134   VVRHYNFCED--CNWTEQPGGLQRPRWYASNQILPDNRVIVVGGRVAFSYEF---VPGDG  188

Query  614   LLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDG  793
              LY+LPFL  T+D  +ENNLYP++ L  DG+LF+FAN+++IL DY  + VVR YP++P G
Sbjct  189   HLYSLPFLRSTSDERSENNLYPFLHLLPDGNLFVFANSESILLDYKNNKVVRSYPSLPGG  248

Query  794   QPRSYPSTGSAVLLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRIT  973
               R+YP++GS+V+LPL   Q    V EVLICGGA K A+  +  G F  AL TCGR+ +T
Sbjct  249   A-RNYPASGSSVMLPLLASQRFQRV-EVLICGGASKTAYKQASSGSFETALKTCGRMVVT  306

Query  974   DPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV  1153
             D NP W +E MP+ R+MGDMV LP G +LIINGA QG+AG+   RNP  TP+LY   +  
Sbjct  307   DNNPSWILEEMPLPRVMGDMVNLPTGEVLIINGAQQGTAGWRFARNPALTPLLYSPSSTS  366

Query  1154  GTRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPY  1333
              ++F  L  + IPRMYHSTAILL D+RVLV GSNP+  Y F    LFPTELR+EAFSPPY
Sbjct  367   SSKFTTLASASIPRMYHSTAILLPDTRVLVAGSNPNVGYDFSE-VLFPTELRIEAFSPPY  425

Query  1334  LDAATAGIRPHITLPGSHSK--FGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQ  1507
             LD+   G+R  I+   S SK   GY   I I+F+ +  V G++   T+ AP+F TH++S 
Sbjct  426   LDSYFDGVRAEIS---SMSKVVIGYNSQITIEFSVS--VLGDM-EATLYAPAFATHAYSM  479

Query  1508  HQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             +QRLL L     V       Y      P +  ++P GYYMLF+V+ G+PS G WIQM+
Sbjct  480   NQRLLKLESSSPVLDENSGYYTFVVRAPPTKTIAPPGYYMLFIVNSGVPSTGKWIQML  537



>ref|XP_006378160.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP55957.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=544

 Score =   518 bits (1333),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 269/535 (50%), Positives = 348/535 (65%), Gaps = 10/535 (2%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             + +   GG W +L  +IGI+AMHMQ+L N+KV++FDRTDFG SN+ L  G+CR    E V
Sbjct  13    YLSTITGGNWVVLQESIGISAMHMQVLRNNKVIMFDRTDFGRSNLSLPDGKCRYKD-EAV  71

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
                DCTAH+V YD+A NT RPLMVQTD WCSS ++   G LIQTGG+  G+ V+R F PC
Sbjct  72    KPKDCTAHAVLYDIASNTFRPLMVQTDTWCSSGSLDSSGNLIQTGGYKAGEAVIRSFTPC  131

Query  458   NDKKCDWVEIPN-ALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
             +D  CDWVE+ N  L   RWYA+N +LPDGR II+GGR  F YEFYPK P     + LPF
Sbjct  132   DDDSCDWVELSNQVLWNRRWYASNQLLPDGRIIIVGGRRAFTYEFYPKNPQERDNFTLPF  191

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L  T DP  E NLYP++ L  DG+LFIFANN++I  DY ++ V++ YP MP G  R+YP 
Sbjct  192   LIHTRDPQEEINLYPFLHLLPDGNLFIFANNRSISLDYKRNKVIKEYPVMPVGDRRNYPC  251

Query  815   TGSAVLLPLKNLQAPGIV----AEVLICGGAPKGAFPASER-GVFMGALNTCGRIRITDP  979
             TGS+VLLPL+      +     AEV+ICGGA KGA+  S    ++  A  TCGR+++TDP
Sbjct  252   TGSSVLLPLRLTGITNVTDHPEAEVMICGGAQKGAYIKSNYLHIYGQASTTCGRLKVTDP  311

Query  980   NPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT  1159
              P W ME MP+ R+M DM+ LP G+++IINGA  GSAG+ D  NPV  PVLY  D     
Sbjct  312   KPEWVMELMPIPRIMNDMLLLPTGDLIIINGATNGSAGWNDAMNPVYNPVLYQPDEDPTR  371

Query  1160  RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLD  1339
             RF +L+ S I R+YHSTA LL D R+LVGGSNPH  Y    G  +PTEL LEAF   YLD
Sbjct  372   RFVVLSSSKIARLYHSTAALLPDGRILVGGSNPHQGYNM-TGKPYPTELSLEAFYLHYLD  430

Query  1340  AATAGIRPHI-TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQR  1516
                A +RP I T+  S     YG++  + F  +       V+VT++APSFTTHSF  +QR
Sbjct  431   PQYAYLRPSILTVELSDRAVSYGELFSVTFVCSSYRLDLGVSVTVIAPSFTTHSFGMNQR  490

Query  1517  LLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQMV  1681
             ++ L     V+ + +  Y    + P + N++P GYYM+FVVH GIPS  +W+ + 
Sbjct  491   MVVLNVVSVVQ-LSMFAYKANVIGPINVNVAPPGYYMMFVVHAGIPSNAVWVNVC  544



>gb|EPS72896.1| hypothetical protein M569_01859, partial [Genlisea aurea]
Length=516

 Score =   516 bits (1330),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 257/523 (49%), Positives = 345/523 (66%), Gaps = 7/523 (1%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVD  289
             + GG W LL  +IGI+AMHMQLLN+D+VV+FDRTDFG SN+ L  GRCR D +E+V K D
Sbjct  1     SAGGEWRLLQRSIGISAMHMQLLNDDRVVVFDRTDFGPSNLSLPNGRCRYDSHEMVSKKD  60

Query  290   CTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKK  469
             CTAHSV YDV+ NT R L VQTD WCSS AV+P+GTL+Q GG+NDG   VR+ +PC+   
Sbjct  61    CTAHSVLYDVSSNTFRALTVQTDPWCSSGAVLPNGTLLQIGGFNDGAQTVRMQSPCSGGD  120

Query  470   CDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETN  649
             CDWVE P  L R RWYAT  ILPDG  I++GGR E++YEF+P+       +   FL ET+
Sbjct  121   CDWVEFPRVLSRRRWYATAQILPDGDVIVVGGRREYSYEFWPRRSDSG-SFEFDFLRETS  179

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D  +ENNLYP+V L  DG+LFIFAN +++L+DY ++ VVR +P +  G  R+YPS+G++V
Sbjct  180   D-DSENNLYPFVHLLPDGNLFIFANTRSVLFDYRRNDVVREFPEIRGGDARNYPSSGASV  238

Query  830   LLPLKNLQAPGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMP  1009
             LLP+    A    +E++ICGGA   A+ A+ RG F  A +TC R+ +    P W +E MP
Sbjct  239   LLPIDETAAES-NSEIMICGGASPAAYQAALRGTFRRATSTCARLNLAAREPEWKLEHMP  297

Query  1010  MARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNPSGI  1189
               R+M DM+ LP G+ LI+NGA  G+AG+ + R+P   P++Y  +     RF ++  S  
Sbjct  298   TPRVMSDMLILPTGDFLIVNGATSGAAGWENARDPSMRPLIYRPNEQPDGRFSVMAESQR  357

Query  1190  PRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI  1369
             PR+YHSTA+LL D R+LVGGSNPH  Y F  G  +PT+L LE+FSPPYL      +RP I
Sbjct  358   PRLYHSTAVLLADGRILVGGSNPHEYYNF-TGVDYPTDLSLESFSPPYLSPDNDHLRPRI  416

Query  1370  TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVK  1549
             T   +     Y K   + FTA   ++ + VTV ++AP F+THSFS +QR++ L       
Sbjct  417   T--DADRILSYHKPFTVDFTAES-LNPSAVTVRLLAPPFSTHSFSMNQRMVVLKIAAISC  473

Query  1550  PVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                    H+ A  P +  ++P GYY+LFVVH  IPS G WI++
Sbjct  474   DSSRMRCHVNAAAPSTAEIAPPGYYLLFVVHCEIPSHGSWIKI  516



>ref|XP_011010793.1| PREDICTED: galactose oxidase [Populus euphratica]
Length=544

 Score =   517 bits (1331),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 267/534 (50%), Positives = 346/534 (65%), Gaps = 10/534 (2%)
 Frame = +2

Query  98    FAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVV  277
             + +   GG W +L  +IGI+AMHMQ+L N+KV++FDRTDFG SN+ L  G CR    EVV
Sbjct  13    YLSTITGGNWVVLQESIGISAMHMQVLRNNKVIMFDRTDFGRSNLSLPDGECRYKD-EVV  71

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
                DCTAH+V YD+A NT RPLMVQT+ WCSS ++   G LIQTGG+  G+ V+R F PC
Sbjct  72    KPKDCTAHAVLYDIASNTFRPLMVQTNTWCSSGSLDSSGNLIQTGGYKAGEAVIRSFTPC  131

Query  458   NDKKCDWVEIPN-ALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
              D  CDWVE+ N  L   RWYA+N +LPDGR II+GGR  F YEFYPK P     + LPF
Sbjct  132   GDDSCDWVELTNQVLWNRRWYASNQLLPDGRIIIVGGRRAFTYEFYPKNPQERDNFTLPF  191

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             L  T DP  E NLYP++ L  DG+LFIFANN++I  DY ++ V++ YP MP G  R+YP 
Sbjct  192   LIHTRDPQEEINLYPFLHLLPDGNLFIFANNRSISLDYKRNKVIKEYPVMPVGDRRNYPC  251

Query  815   TGSAVLLPLKNLQAPGIV----AEVLICGGAPKGAFPASER-GVFMGALNTCGRIRITDP  979
             TGS+VLLPL+      +     AEV+ICGGA KGA+  S    ++  A  TCGR+++TD 
Sbjct  252   TGSSVLLPLRLTGITNVTDHPEAEVMICGGAQKGAYIKSNYLHIYEQASTTCGRLKVTDT  311

Query  980   NPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT  1159
              P W ME MP+ R+M DM+ LP G+++IINGA  GSAG+ D  NPV  PVLY  D     
Sbjct  312   KPEWVMELMPIPRIMNDMLLLPTGDLIIINGATNGSAGWNDAMNPVYNPVLYQPDEDPTR  371

Query  1160  RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLD  1339
             RF +L+ S I R+YHSTA LL D R+LVGGSNPH  Y    G  +PTEL LEAF   YLD
Sbjct  372   RFVVLSSSKIARLYHSTAALLPDGRILVGGSNPHQRYNM-TGKPYPTELSLEAFYLHYLD  430

Query  1340  AATAGIRPHI-TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQR  1516
                + +RP I T+  S     YG++  + F  +       V+VT++APSFTTHSF  +QR
Sbjct  431   PQYSYLRPSILTVELSDRAVSYGEMFSVTFVCSSYRLDLGVSVTVIAPSFTTHSFGMNQR  490

Query  1517  LLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             ++ L     V+ + +  Y    + P + N++P GYYM+FVVH GIPS  +W+ +
Sbjct  491   MVVLNVLSVVQ-LSMFAYKANVIGPINVNVAPPGYYMMFVVHAGIPSNAVWVNV  543



>emb|CDP00283.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   514 bits (1325),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 270/518 (52%), Positives = 353/518 (68%), Gaps = 16/518 (3%)
 Frame = +2

Query  161   MHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAHSVEYDVAENTVRP  340
             MHMQLL N+KVVIFDRTDFG SNI L  GRCR    +  +++DCTAHSV YD+  NT RP
Sbjct  1     MHMQLLYNNKVVIFDRTDFGRSNISLPFGRCRFS-VDGKLRIDCTAHSVIYDIVTNTFRP  59

Query  341   LMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYA  520
             LMVQTDVWCSSAAV PDG L+QTGG+  G   +R+F PCN+  CDW+E+P  L   RWYA
Sbjct  60    LMVQTDVWCSSAAVNPDGVLVQTGGYRGGADKIRLFTPCNNDFCDWIELPQNLTVRRWYA  119

Query  521   TNHILPDGRQIIIGGREEFNYEFYPKTP---GGDLLYNLPFLAETNDPGAENNLYPYVFL  691
             ++ ILPDGR II+GGR  F+YEF+PK         +Y L FL ET+DP  ENNLYP++ L
Sbjct  120   SDQILPDGRIIIVGGRRAFSYEFFPKNSVFFSNAEVYWLQFLKETSDPREENNLYPFLHL  179

Query  692   NVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLK------NLQ  853
               DG+LF+FAN  +++ DY+ + ++R +P +P G+ RSYPSTGS+VLLPL+       L 
Sbjct  180   LPDGNLFVFANQHSVILDYVNNKILRKFPPIP-GEKRSYPSTGSSVLLPLRLTGSGSRLG  238

Query  854   APGIVAEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFMETMPMARLMGDM  1033
             +P    EV+ICGGA  G++  +  GV++ A  +CGR+R+TDP+P W METMPM R+M DM
Sbjct  239   SPSPEVEVMICGGANGGSYIQARLGVYVAASKSCGRLRVTDPDPEWEMETMPMNRVMPDM  298

Query  1034  VTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYH-TDNPVGTRFEILNPSGIPRMYHST  1210
             + LP G++LI+NGA++GSAG+    +PV  PVLY  ++     RF +LNP+  PR+YHS 
Sbjct  299   LLLPTGDVLILNGASKGSAGWELADDPVLHPVLYRPSEMDPQQRFTVLNPTVNPRLYHSA  358

Query  1211  AILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI-TLPG-S  1384
             A+LL D RVLVGGSNPH  Y F  G  +PT+L LEAF PPYL    + +RP I T  G +
Sbjct  359   AVLLPDGRVLVGGSNPHALYRF-TGVKYPTDLTLEAFLPPYLGPQYSQLRPSILTFEGPT  417

Query  1385  HSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGIN  1564
              +   YG+   I FT      G    VTM+APSFTTHSF+ +QRL+ L   G  + +   
Sbjct  418   DNIISYGQQFSITFTLGLHPPGQDFRVTMIAPSFTTHSFAMNQRLVMLDVVG-YQQLSAF  476

Query  1565  TYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              + +T   P + N++P GYYM FVV+ GIPS G+WI+M
Sbjct  477   AFKVTVCAPPTRNIAPPGYYMTFVVNGGIPSTGVWIRM  514



>gb|KFK43688.1| hypothetical protein AALP_AA1G160100 [Arabis alpina]
Length=560

 Score =   516 bits (1329),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 272/530 (51%), Positives = 351/530 (66%), Gaps = 18/530 (3%)
 Frame = +2

Query  116   GGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCT  295
             GGRW+LL P++GI+AMHMQLL+N+KVVIFDRTD+G SN+ L    C+          DC+
Sbjct  40    GGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLLLPPQTCQN-----ATVFDCS  94

Query  296   AHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCD  475
             AHS+ YDVA NT RPL ++ D WCSS ++   G+LIQTGG+  G+  VR+F PC+   CD
Sbjct  95    AHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGVGEKAVRIFTPCDGVSCD  154

Query  476   WVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPFLAETNDP  655
             WVE    L   RWY+TN ILPDGR II+GGR  F YEFYPK P   + Y L FL ET DP
Sbjct  155   WVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNPRKSVFY-LRFLVETKDP  213

Query  656   GAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLL  835
               ENNLYP++ L  DG+LFIFAN ++IL+D++ H +++ +P +P G  R+YPSTGS+VLL
Sbjct  214   NEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPEIPGGDRRNYPSTGSSVLL  273

Query  836   PLKNLQA---PGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRITDPNPVWFM  997
             PL   Q        AEV++CGGAP GAF  + R    +F+GA  TCGR+++TDPN  W M
Sbjct  274   PLYLTQENNRSQTTAEVMVCGGAPPGAFLKAARTIPQIFVGASRTCGRLKVTDPNATWVM  333

Query  998   ETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGT-RFEIL  1174
             E MP  R+M DM+ LPNG++LIINGA  G+AG+ D  N V  P+LY  D P  T RFE+L
Sbjct  334   EQMPSPRVMPDMILLPNGDVLIINGATNGTAGWEDATNAVLNPILYLPDEPDPTRRFEVL  393

Query  1175  NPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAG  1354
              P+ IPRMYHS ++LL D RVLVGGSNPH NY F     +PTEL LEA+ P YLD   A 
Sbjct  394   APAWIPRMYHSASLLLSDGRVLVGGSNPHRNYNF-TARPYPTELSLEAYHPRYLDPQYAR  452

Query  1355  IRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDL  1528
             +RP I          YGK   + F   A G  DG +V+V +VAPSF+THS + +QRLL L
Sbjct  453   VRPSILTVELAGNMLYGKNFTVTFVIPAYGMFDG-VVSVRLVAPSFSTHSTAMNQRLLVL  511

Query  1529  GGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
                   + + +  Y      P +  ++P GYYM+FVVH+GIPS  +W+++
Sbjct  512   RVRRVNQ-LSVFAYKADVDGPINSYVAPPGYYMMFVVHRGIPSVAVWVKL  560



>ref|XP_007227672.1| hypothetical protein PRUPE_ppa026498mg, partial [Prunus persica]
 gb|EMJ28871.1| hypothetical protein PRUPE_ppa026498mg, partial [Prunus persica]
Length=552

 Score =   516 bits (1328),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 271/535 (51%), Positives = 351/535 (66%), Gaps = 14/535 (3%)
 Frame = +2

Query  110   AGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGR-CRQ---DPYEVV  277
             + GG+W LL  +IG++AMHMQLL NDKV++FDRTD GLSN     G  CR+     +   
Sbjct  19    SAGGQWVLLHKSIGVSAMHMQLLKNDKVILFDRTDMGLSNFSFPSGTGCRKYNDTHHRNR  78

Query  278   VKVDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPC  457
                DCTAHS++YDV    +RPL V +D WCSS A+ P+GTLIQTGG+  G   +R   PC
Sbjct  79    TITDCTAHSLQYDVISGNIRPLYVSSDTWCSSGALDPNGTLIQTGGYGPGIRKIRTVAPC  138

Query  458   NDKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPG-GDLLYNLPF  634
             +D KC+W E+P  L   RWYA+  ILPDGR I++GGR  F+YEFYPKT       Y L F
Sbjct  139   DDGKCEWTELPVNLADGRWYASTQILPDGRVIVVGGRRAFSYEFYPKTDDVSSKRYYLSF  198

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             LAET DP  ENNLYP++ L  DG+LFIFANN++IL DY ++ VV+  P +PDG  R+YPS
Sbjct  199   LAETTDPYEENNLYPFLHLLPDGNLFIFANNRSILLDYKQNRVVKELPVIPDGIKRTYPS  258

Query  815   TGSAVLLPLK-NLQAPGI---VAEVLICGGAPKGAFPASERG-VFMGALNTCGRIRITDP  979
             TGS+VLLPLK N    G     AEVLICGG+P GAF  S    VF+ A N+CGRI++TDP
Sbjct  259   TGSSVLLPLKMNGSLDGSDKPEAEVLICGGSPPGAFNMSNLNRVFVSASNSCGRIKLTDP  318

Query  980   NPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV-G  1156
             +P W ME MPM R+M DM+ LP G+++I+NGA+ G+AG+ D  NPV  PVLY T  P   
Sbjct  319   DPKWVMEEMPMPRVMSDMLLLPTGDVIILNGASNGTAGWEDAANPVFNPVLYKTYEPDPN  378

Query  1157  TRFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYL  1336
              RF +LNPS  PRMYHS+A+LL D  +LVGGSNPH  Y F     FPT+L LEA+ PPYL
Sbjct  379   LRFVVLNPSSTPRMYHSSALLLPDGSILVGGSNPHEMYNF-TARPFPTDLSLEAYQPPYL  437

Query  1337  DAATAGIRPHI-TLPGSHSKFGYGKVIEIQFTAAGPVDGNLVTVTMVAPSFTTHSFSQHQ  1513
                 A +RP I T+    S   YG++  + F  +       ++V ++ PSFTTHSFS +Q
Sbjct  438   GPLLAVLRPSILTIEARDSIVSYGQMFSVTFMLSVYRADPGISVVLITPSFTTHSFSMNQ  497

Query  1514  RLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             R++ L     ++ +    Y + A  P    ++P GYYMLF+VH G PS  +W+++
Sbjct  498   RMVVL-DVARLENLSAFAYKIAAYGPPKTTVAPPGYYMLFLVHAGTPSHAVWVKV  551



>ref|XP_008221748.1| PREDICTED: galactose oxidase [Prunus mume]
Length=585

 Score =   517 bits (1331),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 274/564 (49%), Positives = 359/564 (64%), Gaps = 16/564 (3%)
 Frame = +2

Query  29    FTLLFALWQLFLVAAPPPWSR--NMFAAAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIF  202
              + LF +     +  P P+S      +  + GG+W LL  +IG++AMHMQLL NDKV++F
Sbjct  23    LSYLFMVSHSQYLTNPTPFSSINATTSNVSAGGQWVLLHKSIGVSAMHMQLLKNDKVILF  82

Query  203   DRTDFGLSNIPLGGGR-CRQ---DPYEVVVKVDCTAHSVEYDVAENTVRPLMVQTDVWCS  370
             DRTD G SN     G  CR+     +      DCTAHS++YD+    +RPL V +D WCS
Sbjct  83    DRTDMGPSNFSFPSGTGCRKYNDTHHRNRTITDCTAHSLQYDIISGNIRPLYVSSDTWCS  142

Query  371   SAAVMPDGTLIQTGGWNDGDHVVRVFNPCNDKKCDWVEIPNALHRWRWYATNHILPDGRQ  550
             S A+ P+GTLIQTGG+  G   +R   PC+D KC+W E+P  L   RWYA+  ILPDGR 
Sbjct  143   SGALDPNGTLIQTGGYGSGIRKIRTVAPCDDGKCEWTELPVNLADGRWYASTQILPDGRV  202

Query  551   IIIGGREEFNYEFYPKTPG-GDLLYNLPFLAETNDPGAENNLYPYVFLNVDGHLFIFANN  727
             I++GGR  F+YEFYPKT       Y L FLAET DP  ENNLYP++ L  DG LFIFANN
Sbjct  203   IVVGGRRAFSYEFYPKTDDVSSKRYYLSFLAETTDPYEENNLYPFLHLLPDGSLFIFANN  262

Query  728   KAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAVLLPLK---NLQAPGI-VAEVLICGGA  895
             ++IL DY ++ VV+  P +PDG  R+YPSTGS+VLLPLK   +L       AEVLICGG+
Sbjct  263   RSILLDYKQNRVVKELPVIPDGIKRTYPSTGSSVLLPLKMKGSLDGSDKPEAEVLICGGS  322

Query  896   PKGAFPASERG-VFMGALNTCGRIRITDPNPVWFMETMPMARLMGDMVTLPNGNILIING  1072
             P GAF  S    VF+ A N+CGRI++TDPNP W ME MPM R+M DM+ LP G+++I+NG
Sbjct  323   PPGAFNMSNLNRVFVSASNSCGRIKLTDPNPKWVMEEMPMPRVMSDMLLLPTGDVIILNG  382

Query  1073  AAQGSAGYGDGRNPVQTPVLYHTDNPV-GTRFEILNPSGIPRMYHSTAILLRDSRVLVGG  1249
             A+ G+AG+ D  NPV  PVLY T  P    RF +LNPS  PRMYHS+A+LL D R+LVGG
Sbjct  383   ASNGTAGWEDAANPVFNPVLYKTYEPDPNLRFVVLNPSSTPRMYHSSALLLPDGRILVGG  442

Query  1250  SNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIRPHI-TLPGSHSKFGYGKVIEIQF  1426
             SNPH  Y F     FPT+L LEA+ PPYL    A +RP I T+        YG++  + F
Sbjct  443   SNPHEVYNF-TARPFPTDLSLEAYQPPYLGPLLAALRPSILTIEARDGIVSYGQMFSVTF  501

Query  1427  TAAGPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNL  1606
               +       ++V ++ PSFTTHSFS +QR++ L     ++ +    Y + A  P    +
Sbjct  502   MLSVYRADPGISVVLITPSFTTHSFSMNQRMVVL-DVARLENLSALAYKIAAYGPPKTTV  560

Query  1607  SPAGYYMLFVVHKGIPSEGIWIQM  1678
             +P GYYMLF+VH G PS  +W+++
Sbjct  561   APPGYYMLFLVHAGTPSHAVWVKV  584



>ref|XP_006304526.1| hypothetical protein CARUB_v10011386mg [Capsella rubella]
 gb|EOA37424.1| hypothetical protein CARUB_v10011386mg [Capsella rubella]
Length=563

 Score =   515 bits (1326),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 276/538 (51%), Positives = 359/538 (67%), Gaps = 23/538 (4%)
 Frame = +2

Query  104   AAAGGGRWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVK  283
             A   GGRW+LL P++GI+AMHMQLL+N+KVVIFDRTD+G SN+ L    C+         
Sbjct  36    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHLCQN-----ANV  90

Query  284   VDCTAHSVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNPCN-  460
              DC+AHS+ YDVA NT RPL ++ D WCSS ++   G+LIQTGG+  G+  VRVF PC+ 
Sbjct  91    FDCSAHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGAGERTVRVFTPCDG  150

Query  461   --DKKCDWVEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTPGGDLLYNLPF  634
                  CDWVE    L   RWY+TN ILPDGR II+GGR  F+YEFYPK  G  + +NL F
Sbjct  151   VGAVSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRSFSYEFYPKNTGKSV-FNLSF  209

Query  635   LAETNDPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPS  814
             LAET DP  ENNLYP++ L  DG+LFIFAN ++IL+D++ H +++ +P +P G  R+YPS
Sbjct  210   LAETRDPNQENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGGDKRNYPS  269

Query  815   TGSAVLLPL----KNLQAPGIVAEVLICGGAPKGAFPASER---GVFMGALNTCGRIRIT  973
             TGS+VLLPL    +N ++  I AEV++CGGAP GAF  + R    +F+G   TCGR+++T
Sbjct  270   TGSSVLLPLLLTGENNRS-KIAAEVMVCGGAPPGAFLKAARTIPKIFVGGSRTCGRLKVT  328

Query  974   DPNPVWFMETMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPV  1153
             DPNP+W ME MP  R+MGDM+ LP G++LIINGAA G+AG+ D  N V  P+LY  D P 
Sbjct  329   DPNPIWVMEQMPSPRVMGDMLLLPTGDVLIINGAANGTAGWEDATNAVLNPILYLPDEPD  388

Query  1154  GT-RFEILNPSGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPP  1330
              T RFEIL P+  PRMYHS ++LL D RVLVGGSNPH NY F     +PTEL LEA+ P 
Sbjct  389   PTRRFEILAPTRTPRMYHSASLLLYDGRVLVGGSNPHRNYNF-TARPYPTELSLEAYLPR  447

Query  1331  YLDAATAGIRPHITLPGSHSKFGYGKVIEIQFT--AAGPVDGNLVTVTMVAPSFTTHSFS  1504
             YLD   A +RP I          YG+   + F   A G  DG  V+V +VAPSF+THS +
Sbjct  448   YLDPQYARVRPTIITVELAGNMLYGQGFAVTFAIPAFGMFDGG-VSVRLVAPSFSTHSTA  506

Query  1505  QHQRLLDLGGGGTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
              +QRLL L      + + +  Y      P +  ++P GYYM+FVVH+GIPS  +W+++
Sbjct  507   MNQRLLVLRVRRVSQ-LSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  563



>ref|XP_010930930.1| PREDICTED: uncharacterized protein LOC105051966 [Elaeis guineensis]
Length=569

 Score =   514 bits (1325),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 265/527 (50%), Positives = 356/527 (68%), Gaps = 17/527 (3%)
 Frame = +2

Query  122   RWELLLPNIGIAAMHMQLLNNDKVVIFDRTDFGLSNIPLGGGRCRQDPYEVVVKVDCTAH  301
              W+LL  +IGI+AMHMQLL  +KVV+FDRTDFG SNI L  GRCR DP ++V+ +DCTAH
Sbjct  48    EWQLLHASIGISAMHMQLLPGNKVVMFDRTDFGPSNISLPAGRCRSDPADLVLPLDCTAH  107

Query  302   SVEYDVAENTVRPLMVQTDVWCSSAAVMPDGTLIQTGGWNDGDHVVRVFNP-CNDKKCDW  478
             SV  D+    +RPL + +D WCSS A++P+G+L+Q+GG+NDGDH +R+F+   +D   DW
Sbjct  108   SVLLDLPSTALRPLTILSDTWCSSGALLPNGSLLQSGGFNDGDHSIRLFDSVSSDPTADW  167

Query  479   VEIPNALHRWRWYATNHILPDGRQIIIGGREEFNYEFYPKTP---GGDLLYNLPFLAETN  649
              E+P+ L   RWYA++ +LPDGR +I+GGR +F+YEF+P+     GG  ++  PFL ET 
Sbjct  168   QELPSYLTVRRWYASDQLLPDGRVLIVGGRRQFSYEFFPRQESAGGGGAIFPFPFLEETR  227

Query  650   DPGAENNLYPYVFLNVDGHLFIFANNKAILYDYIKHAVVRLYPAMPDGQPRSYPSTGSAV  829
             D  +ENNLYP++ L  DG LF+FAN +A++ D   H V+   P +PD  PR+YPS+GS+V
Sbjct  228   DGNSENNLYPFLHLLPDGTLFVFANTRAVILDVAGHQVLHRLPPIPDDVPRNYPSSGSSV  287

Query  830   LLPLKNLQAPGIV---AEVLICGGAPKGAFPASERGVFMGALNTCGRIRITDPNPVWFME  1000
             LLPL+ L   G      E+LICGGAP+G++ ++ RG F+ A  TCGRI   DPNP W ME
Sbjct  288   LLPLR-LPPDGTTLPRPEILICGGAPRGSYESALRGNFLPAATTCGRIGPADPNPAWNME  346

Query  1001  TMPMARLMGDMVTLPNGNILIINGAAQGSAGYGDGRNPVQTPVLYHTDNPVGTRFEILNP  1180
             TMPM R+MGDM+ LP G++LI+NGAA G+AG+   R PV  PVLY        RF +LN 
Sbjct  347   TMPMPRVMGDMILLPTGDVLIVNGAAAGTAGWELAREPVMNPVLYSPGASAELRFTVLNG  406

Query  1181  SGIPRMYHSTAILLRDSRVLVGGSNPHPNYVFGNGALFPTELRLEAFSPPYLDAATAGIR  1360
             S IPR+YHSTA+L    RVLVGGSNPH  Y F N   +PTEL LEAF PPYL AA    R
Sbjct  407   SNIPRLYHSTALLDPYGRVLVGGSNPHVRYNFTN-VKYPTELSLEAFHPPYLAAA----R  461

Query  1361  PHITLPGSHSKFGYGKVIEIQFTAA-GPVDGNLVTVTMVAPSFTTHSFSQHQRLLDLGGG  1537
             P +      ++ GYG+V+ ++F A+ G      V V  +AP+F TH+   +QR + L   
Sbjct  462   PRVV--AVVAEVGYGEVVAVRFEASVGWAGAGSVEVVAMAPAFATHAVGMNQRAVVL-PV  518

Query  1538  GTVKPVGINTYHMTAVTPGSGNLSPAGYYMLFVVHKGIPSEGIWIQM  1678
             G V  VG   Y   AV P S  ++P G+Y+ FVVH G+PS+G+W+++
Sbjct  519   GRVTQVGPFAYEAEAVAPPSPEVAPPGFYLWFVVHAGLPSQGVWVRI  565



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5695088958850