BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8313_g1_i1 len=2102 path=[1:0-574 576:575-598 4620:599-2101]

Length=2102
                                                                      Score     E

ref|XP_010663077.1|  PREDICTED: uncharacterized protein LOC100253501    744   0.0      
ref|XP_008367509.1|  PREDICTED: uncharacterized protein LOC103431143    721   0.0      
ref|XP_008239597.1|  PREDICTED: uncharacterized protein LOC103338188    716   0.0      
ref|XP_007137990.1|  hypothetical protein PHAVU_009G171700g             708   0.0      
emb|CDP12684.1|  unnamed protein product                                707   0.0      
ref|XP_011087000.1|  PREDICTED: galactose oxidase-like                  707   0.0      
ref|XP_007037788.1|  Glyoxal oxidase-related protein                    704   0.0      
ref|XP_004501852.1|  PREDICTED: uncharacterized protein LOC101503410    718   0.0      
ref|XP_003528130.2|  PREDICTED: uncharacterized protein LOC100814200    698   0.0      
gb|AEA52292.1|  glyoxal oxidase-related protein                         695   0.0      
ref|XP_006351423.1|  PREDICTED: uncharacterized protein LOC102595893    691   0.0      
ref|XP_004236288.1|  PREDICTED: uncharacterized protein LOC101250105    684   0.0      
gb|KHN07971.1|  E3 ubiquitin-protein ligase RGLG2                       695   0.0      
ref|XP_004138264.1|  PREDICTED: uncharacterized protein LOC101204692    679   0.0      
ref|XP_008464498.1|  PREDICTED: uncharacterized protein LOC103502362    674   0.0      
gb|KEH35019.1|  glyoxal oxidase amino-terminal protein                  669   0.0      
ref|XP_004299160.1|  PREDICTED: uncharacterized protein LOC101293298    670   0.0      
ref|XP_010026976.1|  PREDICTED: uncharacterized protein LOC104417381    669   0.0      
ref|XP_004301024.1|  PREDICTED: uncharacterized protein LOC101292420    669   0.0      
ref|XP_010102932.1|  hypothetical protein L484_018951                   655   0.0      
ref|XP_007209962.1|  hypothetical protein PRUPE_ppa004880mg             650   0.0      
ref|XP_010251352.1|  PREDICTED: uncharacterized protein LOC104593293    651   0.0      
gb|KCW83241.1|  hypothetical protein EUGRSUZ_B00180                     644   0.0      
ref|XP_010904553.1|  PREDICTED: galactose oxidase-like                  606   0.0      
ref|XP_008793761.1|  PREDICTED: galactose oxidase-like                  596   0.0      
gb|EYU17749.1|  hypothetical protein MIMGU_mgv1a003984mg                583   0.0      
ref|XP_009394071.1|  PREDICTED: uncharacterized protein LOC103979627    565   0.0      
ref|XP_006848962.1|  hypothetical protein AMTR_s00166p00070030          558   0.0      
ref|XP_010686035.1|  PREDICTED: uncharacterized protein LOC104900331    561   0.0      
ref|XP_002280559.1|  PREDICTED: galactose oxidase                       476   2e-156   Vitis vinifera
ref|XP_002973684.1|  hypothetical protein SELMODRAFT_413959             468   2e-153   
ref|XP_010652487.1|  PREDICTED: galactose oxidase                       459   1e-149   
ref|XP_010061025.1|  PREDICTED: galactose oxidase-like                  452   4e-147   
ref|XP_008221311.1|  PREDICTED: galactose oxidase-like                  451   4e-147   
ref|XP_008221312.1|  PREDICTED: galactose oxidase-like                  452   5e-147   
ref|XP_009388162.1|  PREDICTED: galactose oxidase-like                  451   8e-147   
ref|XP_004304717.1|  PREDICTED: uncharacterized protein LOC101300467    451   9e-147   
ref|XP_006357288.1|  PREDICTED: galactose oxidase-like                  452   9e-147   
ref|XP_008218222.1|  PREDICTED: galactose oxidase                       451   1e-146   
ref|XP_010674901.1|  PREDICTED: galactose oxidase                       451   1e-146   
ref|XP_004289629.1|  PREDICTED: galactose oxidase-like                  451   1e-146   
ref|XP_004494672.1|  PREDICTED: galactose oxidase-like                  451   2e-146   
ref|XP_008221409.1|  PREDICTED: galactose oxidase-like                  450   2e-146   
ref|XP_007017716.1|  Glyoxal oxidase-related protein                    449   4e-146   
ref|XP_007046239.1|  Glyoxal oxidase-related protein, putative          449   8e-146   
ref|XP_004489989.1|  PREDICTED: uncharacterized protein LOC101500908    450   1e-145   
ref|XP_009337676.1|  PREDICTED: galactose oxidase-like                  447   1e-145   
emb|CDP08591.1|  unnamed protein product                                447   2e-145   
gb|KDP21232.1|  hypothetical protein JCGZ_21703                         447   2e-145   
ref|XP_007208189.1|  hypothetical protein PRUPE_ppa020922mg             446   5e-145   
ref|XP_004291825.1|  PREDICTED: galactose oxidase-like                  447   5e-145   
gb|KDP38596.1|  hypothetical protein JCGZ_04521                         446   6e-145   
ref|XP_009594288.1|  PREDICTED: uncharacterized protein LOC104090813    447   8e-145   
ref|XP_009782130.1|  PREDICTED: galactose oxidase-like                  447   1e-144   
ref|XP_009337669.1|  PREDICTED: galactose oxidase-like                  445   1e-144   
ref|XP_006438575.1|  hypothetical protein CICLE_v10031195mg             445   1e-144   
ref|XP_006838081.1|  hypothetical protein AMTR_s00225p00021580          445   1e-144   
ref|XP_010271447.1|  PREDICTED: galactose oxidase-like                  445   2e-144   
ref|XP_004237211.1|  PREDICTED: galactose oxidase-like                  446   2e-144   
ref|XP_007030653.1|  Glyoxal oxidase-related protein                    445   3e-144   
ref|XP_007136064.1|  hypothetical protein PHAVU_009G014800g             445   3e-144   
ref|XP_007147126.1|  hypothetical protein PHAVU_006G098100g             444   4e-144   
ref|XP_004239377.1|  PREDICTED: galactose oxidase-like                  445   4e-144   
ref|XP_006344285.1|  PREDICTED: galactose oxidase-like                  445   4e-144   
ref|XP_010111102.1|  hypothetical protein L484_008478                   444   4e-144   
ref|XP_009335425.1|  PREDICTED: galactose oxidase-like                  444   5e-144   
gb|EYU22441.1|  hypothetical protein MIMGU_mgv1a024085mg                446   5e-144   
ref|XP_002975736.1|  hypothetical protein SELMODRAFT_232564             442   6e-144   
ref|XP_003523554.1|  PREDICTED: galactose oxidase-like                  443   7e-144   
ref|XP_010916153.1|  PREDICTED: galactose oxidase-like                  443   8e-144   
ref|XP_006392509.1|  hypothetical protein EUTSA_v10023396mg             443   8e-144   
ref|XP_011071032.1|  PREDICTED: galactose oxidase-like                  445   9e-144   
ref|XP_007160695.1|  hypothetical protein PHAVU_001G009200g             443   1e-143   
ref|XP_009335433.1|  PREDICTED: galactose oxidase-like                  442   1e-143   
ref|XP_007225625.1|  hypothetical protein PRUPE_ppa003824mg             443   1e-143   
ref|XP_004291826.1|  PREDICTED: galactose oxidase-like                  443   2e-143   
ref|XP_003527766.1|  PREDICTED: galactose oxidase-like                  442   2e-143   
ref|XP_008387971.1|  PREDICTED: galactose oxidase-like                  442   2e-143   
ref|XP_010105252.1|  hypothetical protein L484_019394                   442   3e-143   
ref|XP_008347351.1|  PREDICTED: galactose oxidase-like                  441   3e-143   
ref|XP_006483245.1|  PREDICTED: galactose oxidase-like                  442   4e-143   
ref|XP_008466509.1|  PREDICTED: galactose oxidase-like                  442   4e-143   
ref|XP_003519774.1|  PREDICTED: galactose oxidase-like                  442   4e-143   
gb|KHN45905.1|  Galactose oxidase                                       441   6e-143   
ref|XP_010263908.1|  PREDICTED: galactose oxidase-like                  441   7e-143   
ref|XP_009619752.1|  PREDICTED: galactose oxidase-like                  442   1e-142   
gb|KFK35620.1|  hypothetical protein AALP_AA4G014800                    440   1e-142   
ref|XP_004147869.1|  PREDICTED: galactose oxidase-like                  439   3e-142   
ref|XP_008387970.1|  PREDICTED: galactose oxidase-like                  439   3e-142   
ref|XP_011083592.1|  PREDICTED: galactose oxidase-like                  439   4e-142   
gb|KGN60011.1|  hypothetical protein Csa_3G866440                       439   5e-142   
ref|XP_010271448.1|  PREDICTED: galactose oxidase-like                  439   6e-142   
ref|XP_006857804.1|  hypothetical protein AMTR_s00061p00216590          437   7e-142   
ref|XP_009614398.1|  PREDICTED: galactose oxidase-like                  439   7e-142   
gb|KEH36231.1|  glyoxal oxidase amino-terminal protein                  438   1e-141   
ref|XP_006471853.1|  PREDICTED: galactose oxidase-like                  438   1e-141   
ref|XP_009364601.1|  PREDICTED: galactose oxidase                       437   2e-141   
ref|XP_010532190.1|  PREDICTED: galactose oxidase                       437   3e-141   
ref|XP_006343542.1|  PREDICTED: galactose oxidase-like                  437   4e-141   
ref|XP_003553749.1|  PREDICTED: galactose oxidase-like                  436   4e-141   
ref|XP_003527665.1|  PREDICTED: galactose oxidase-like                  436   4e-141   
gb|AET97563.1|  galactose oxidase                                       436   5e-141   
ref|XP_009779182.1|  PREDICTED: galactose oxidase-like                  437   6e-141   
ref|XP_008775019.1|  PREDICTED: galactose oxidase-like                  436   6e-141   
ref|XP_010105253.1|  hypothetical protein L484_019396                   436   8e-141   
ref|XP_002272723.2|  PREDICTED: uncharacterized protein LOC100259927    435   1e-140   Vitis vinifera
ref|XP_006383733.1|  hypothetical protein POPTR_0005s25690g             436   1e-140   
ref|XP_010242442.1|  PREDICTED: galactose oxidase                       436   1e-140   
emb|CBI34589.3|  unnamed protein product                                435   2e-140   
ref|XP_009606830.1|  PREDICTED: galactose oxidase                       435   2e-140   
ref|XP_008389005.1|  PREDICTED: galactose oxidase                       435   2e-140   
ref|XP_008338258.1|  PREDICTED: galactose oxidase-like                  434   3e-140   
ref|XP_009791893.1|  PREDICTED: galactose oxidase-like                  434   3e-140   
ref|XP_010660091.1|  PREDICTED: galactose oxidase                       434   4e-140   
ref|XP_008367966.1|  PREDICTED: galactose oxidase-like                  434   4e-140   
ref|XP_004499224.1|  PREDICTED: galactose oxidase-like                  434   5e-140   
ref|XP_007222145.1|  hypothetical protein PRUPE_ppa004709mg             431   8e-140   
ref|XP_007017717.1|  Glyoxal oxidase-related protein                    433   9e-140   
ref|XP_010061250.1|  PREDICTED: galactose oxidase-like                  433   1e-139   
ref|XP_011069750.1|  PREDICTED: galactose oxidase-like                  433   1e-139   
ref|XP_007017718.1|  Glyoxal oxidase-related protein                    432   2e-139   
gb|KDO82728.1|  hypothetical protein CISIN_1g048017mg                   432   3e-139   
ref|XP_010256224.1|  PREDICTED: galactose oxidase                       432   3e-139   
ref|XP_006649773.1|  PREDICTED: galactose oxidase-like                  432   3e-139   
ref|XP_009408991.1|  PREDICTED: galactose oxidase-like                  431   4e-139   
gb|EYU36763.1|  hypothetical protein MIMGU_mgv1a004035mg                431   4e-139   
ref|XP_004500954.1|  PREDICTED: galactose oxidase-like                  431   6e-139   
ref|XP_011069718.1|  PREDICTED: galactose oxidase-like                  431   9e-139   
gb|EYU23055.1|  hypothetical protein MIMGU_mgv1a021812mg                429   1e-138   
emb|CAN83495.1|  hypothetical protein VITISV_026965                     430   1e-138   Vitis vinifera
ref|XP_003626387.1|  Galactose oxidase                                  431   1e-138   
gb|EAY89314.1|  hypothetical protein OsI_10817                          431   1e-138   Oryza sativa Indica Group [Indian rice]
ref|XP_009801814.1|  PREDICTED: galactose oxidase                       430   1e-138   
ref|XP_004243010.2|  PREDICTED: galactose oxidase                       429   2e-138   
ref|XP_009794042.1|  PREDICTED: galactose oxidase-like                  430   2e-138   
ref|XP_008377171.1|  PREDICTED: galactose oxidase-like                  429   2e-138   
ref|XP_011069751.1|  PREDICTED: galactose oxidase-like                  430   2e-138   
ref|XP_011010793.1|  PREDICTED: galactose oxidase                       429   2e-138   
gb|KEH24796.1|  glyoxal oxidase amino-terminal protein                  428   3e-138   
ref|XP_011045139.1|  PREDICTED: galactose oxidase-like                  429   3e-138   
ref|XP_010096335.1|  hypothetical protein L484_021082                   430   3e-138   
ref|XP_002512263.1|  Galactose oxidase precursor, putative              428   4e-138   Ricinus communis
ref|XP_003613586.1|  hypothetical protein MTR_5g038410                  428   4e-138   
ref|NP_191321.1|  glyoxal oxidase-related protein                       429   4e-138   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001049609.1|  Os03g0258900                                       429   4e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006378160.1|  glyoxal oxidase-related family protein             428   6e-138   
ref|XP_006342233.1|  PREDICTED: galactose oxidase-like                  428   8e-138   
ref|XP_006342711.1|  PREDICTED: galactose oxidase-like                  428   9e-138   
ref|XP_002876427.1|  hypothetical protein ARALYDRAFT_907231             427   2e-137   
ref|XP_008813838.1|  PREDICTED: galactose oxidase-like                  427   2e-137   
ref|XP_010100623.1|  hypothetical protein L484_011554                   426   2e-137   
emb|CDY62245.1|  BnaC01g42480D                                          426   3e-137   
emb|CDP00283.1|  unnamed protein product                                425   4e-137   
ref|XP_006382737.1|  glyoxal oxidase-related family protein             426   4e-137   
ref|XP_011073112.1|  PREDICTED: galactose oxidase                       426   5e-137   
ref|XP_006577272.1|  PREDICTED: galactose oxidase-like                  426   5e-137   
ref|XP_002510488.1|  Galactose oxidase precursor, putative              425   8e-137   Ricinus communis
ref|XP_006290310.1|  hypothetical protein CARUB_v10019204mg             425   8e-137   
ref|XP_011028961.1|  PREDICTED: galactose oxidase-like                  427   9e-137   
ref|XP_010516382.1|  PREDICTED: galactose oxidase-like                  425   9e-137   
ref|XP_009600286.1|  PREDICTED: galactose oxidase-like                  426   9e-137   
ref|XP_002893079.1|  hypothetical protein ARALYDRAFT_472215             424   2e-136   
ref|XP_003544396.1|  PREDICTED: uncharacterized protein LOC100791340    424   2e-136   
ref|XP_006849170.1|  hypothetical protein AMTR_s00027p00175370          425   2e-136   
ref|XP_009119411.1|  PREDICTED: galactose oxidase                       424   3e-136   
emb|CDX81637.1|  BnaC08g39640D                                          424   5e-136   
ref|XP_011074991.1|  PREDICTED: galactose oxidase-like                  423   6e-136   
ref|XP_011092656.1|  PREDICTED: galactose oxidase-like                  423   8e-136   
ref|XP_003589379.1|  Galactose oxidase                                  422   8e-136   
ref|NP_173419.1|  glyoxal oxidase-related protein                       422   9e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009797022.1|  PREDICTED: galactose oxidase-like                  422   1e-135   
ref|XP_009603236.1|  PREDICTED: galactose oxidase-like                  423   1e-135   
emb|CDY44816.1|  BnaCnng11720D                                          422   1e-135   
ref|XP_006849171.1|  hypothetical protein AMTR_s00027p00177380          422   1e-135   
ref|XP_007209012.1|  hypothetical protein PRUPE_ppa023406mg             421   2e-135   
ref|XP_004238618.1|  PREDICTED: galactose oxidase-like                  422   2e-135   
ref|XP_009117902.1|  PREDICTED: galactose oxidase-like                  422   2e-135   
ref|XP_004486272.1|  PREDICTED: galactose oxidase-like                  421   2e-135   
ref|XP_008245383.1|  PREDICTED: galactose oxidase-like                  422   2e-135   
emb|CDY53551.1|  BnaA09g57100D                                          422   3e-135   
ref|XP_010504696.1|  PREDICTED: galactose oxidase-like                  421   3e-135   
gb|KGN62661.1|  hypothetical protein Csa_2G365680                       421   6e-135   
ref|XP_008221748.1|  PREDICTED: galactose oxidase                       421   9e-135   
ref|XP_004164439.1|  PREDICTED: galactose oxidase-like                  420   1e-134   
ref|XP_006833409.1|  hypothetical protein AMTR_s00109p00131490          421   2e-134   
ref|XP_002518913.1|  Galactose oxidase precursor, putative              419   2e-134   Ricinus communis
ref|XP_010496071.1|  PREDICTED: galactose oxidase-like                  420   2e-134   
ref|XP_010476497.1|  PREDICTED: galactose oxidase-like                  419   2e-134   
ref|XP_004152661.1|  PREDICTED: galactose oxidase-like                  419   3e-134   
ref|XP_009774595.1|  PREDICTED: galactose oxidase-like                  419   3e-134   
emb|CDP07430.1|  unnamed protein product                                419   3e-134   
ref|XP_006342231.1|  PREDICTED: galactose oxidase-like                  419   3e-134   
ref|XP_002968445.1|  hypothetical protein SELMODRAFT_89852              418   3e-134   
ref|XP_004252835.1|  PREDICTED: galactose oxidase-like                  419   4e-134   
gb|KFK37635.1|  hypothetical protein AALP_AA3G008700                    418   5e-134   
ref|XP_007039386.1|  Glyoxal oxidase-related protein                    419   5e-134   
ref|XP_009797023.1|  PREDICTED: galactose oxidase-like                  418   6e-134   
ref|XP_006304793.1|  hypothetical protein CARUB_v10012343mg             418   6e-134   
ref|XP_006389311.1|  glyoxal oxidase-related family protein             418   7e-134   
gb|EPS72896.1|  hypothetical protein M569_01859                         416   8e-134   
ref|XP_007227672.1|  hypothetical protein PRUPE_ppa026498mg             418   8e-134   
ref|XP_008444780.1|  PREDICTED: galactose oxidase-like                  418   8e-134   
ref|XP_010458940.1|  PREDICTED: galactose oxidase-like                  418   9e-134   
ref|XP_011003791.1|  PREDICTED: galactose oxidase-like                  417   1e-133   
ref|XP_003561804.1|  PREDICTED: galactose oxidase-like                  417   2e-133   
ref|XP_002301997.2|  glyoxal oxidase-related family protein             415   2e-133   Populus trichocarpa [western balsam poplar]
ref|XP_006390288.1|  hypothetical protein EUTSA_v10018361mg             417   2e-133   
ref|XP_002970610.1|  hypothetical protein SELMODRAFT_93556              416   2e-133   
ref|XP_001771865.1|  predicted protein                                  414   2e-133   
tpg|DAA44472.1|  TPA: glyoxal oxidase                                   417   3e-133   
ref|NP_001149941.1|  glyoxal oxidase precursor                          417   3e-133   Zea mays [maize]
ref|XP_006342232.1|  PREDICTED: galactose oxidase-like                  416   3e-133   
ref|XP_010536366.1|  PREDICTED: galactose oxidase-like                  415   7e-133   
gb|EMT01589.1|  hypothetical protein F775_04099                         416   8e-133   
ref|XP_008350495.1|  PREDICTED: galactose oxidase-like                  414   9e-133   
ref|NP_177692.1|  glyoxal oxidase-related protein                       414   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471675.1|  PREDICTED: galactose oxidase-like isoform X1       414   2e-132   
ref|XP_010554972.1|  PREDICTED: galactose oxidase                       415   2e-132   
ref|XP_010471676.1|  PREDICTED: galactose oxidase-like isoform X2       414   2e-132   
ref|XP_002961909.1|  hypothetical protein SELMODRAFT_77682              414   3e-132   
ref|XP_006300296.1|  hypothetical protein CARUB_v10021300mg             414   3e-132   
ref|NP_172895.2|  glyoxal oxidase-related protein                       414   3e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625411.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    413   4e-132   
ref|XP_010924630.1|  PREDICTED: uncharacterized protein LOC105047413    414   5e-132   
ref|XP_002520142.1|  conserved hypothetical protein                     413   6e-132   Ricinus communis
gb|KGN60010.1|  hypothetical protein Csa_3G865940                       413   6e-132   
ref|XP_004298452.1|  PREDICTED: galactose oxidase-like                  414   7e-132   
ref|XP_011045140.1|  PREDICTED: galactose oxidase-like                  411   1e-131   
ref|XP_006433075.1|  hypothetical protein CICLE_v10000768mg             412   1e-131   
ref|XP_010670858.1|  PREDICTED: galactose oxidase-like                  412   1e-131   
ref|XP_010540180.1|  PREDICTED: galactose oxidase-like                  412   2e-131   
ref|XP_008466667.1|  PREDICTED: galactose oxidase-like                  415   2e-131   
ref|XP_006342230.1|  PREDICTED: galactose oxidase-like                  411   2e-131   
ref|XP_002890054.1|  hypothetical protein ARALYDRAFT_888820             412   3e-131   
ref|XP_001783776.1|  predicted protein                                  410   3e-131   
gb|AAG12543.1|AC007797_3  Unknown Protein                               409   3e-131   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43688.1|  hypothetical protein AALP_AA1G160100                    411   4e-131   
ref|XP_006477507.1|  PREDICTED: galactose oxidase-like                  411   4e-131   
ref|XP_010041767.1|  PREDICTED: galactose oxidase                       410   4e-131   
ref|XP_004147870.1|  PREDICTED: galactose oxidase-like                  410   5e-131   
ref|XP_002889034.1|  hypothetical protein ARALYDRAFT_895435             410   5e-131   
ref|XP_002468154.1|  hypothetical protein SORBIDRAFT_01g040550          411   6e-131   Sorghum bicolor [broomcorn]
ref|XP_007157402.1|  hypothetical protein PHAVU_002G066900g             409   9e-131   
ref|XP_011026783.1|  PREDICTED: galactose oxidase-like                  409   1e-130   
ref|XP_009337677.1|  PREDICTED: galactose oxidase-like                  409   2e-130   
ref|XP_004984953.1|  PREDICTED: galactose oxidase-like                  410   2e-130   
emb|CDY47509.1|  BnaAnng09070D                                          409   2e-130   
ref|XP_009106213.1|  PREDICTED: galactose oxidase isoform X2            408   4e-130   
ref|XP_004238617.1|  PREDICTED: galactose oxidase-like                  408   5e-130   
ref|XP_006439219.1|  hypothetical protein CICLE_v10024435mg             408   5e-130   
ref|XP_010541897.1|  PREDICTED: galactose oxidase-like                  408   6e-130   
ref|XP_010477216.1|  PREDICTED: galactose oxidase-like                  407   7e-130   
emb|CDY39045.1|  BnaA02g17340D                                          407   8e-130   
ref|XP_010416450.1|  PREDICTED: galactose oxidase-like isoform X1       407   8e-130   
ref|XP_009393211.1|  PREDICTED: galactose oxidase-like                  407   9e-130   
gb|KDP25206.1|  hypothetical protein JCGZ_20362                         407   9e-130   
ref|XP_009128116.1|  PREDICTED: galactose oxidase-like                  407   1e-129   
ref|XP_008348975.1|  PREDICTED: galactose oxidase-like                  407   1e-129   
ref|XP_010670864.1|  PREDICTED: galactose oxidase-like                  409   1e-129   
ref|XP_010428587.1|  PREDICTED: galactose oxidase-like                  407   1e-129   
ref|XP_009360496.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    408   1e-129   
ref|XP_009106212.1|  PREDICTED: galactose oxidase isoform X1            407   2e-129   
ref|XP_009797024.1|  PREDICTED: galactose oxidase-like                  406   3e-129   
ref|XP_006828863.1|  hypothetical protein AMTR_s00001p00165980          405   4e-129   
ref|XP_009149487.1|  PREDICTED: galactose oxidase                       405   5e-129   
ref|XP_006304526.1|  hypothetical protein CARUB_v10011386mg             405   5e-129   
ref|XP_002972585.1|  hypothetical protein SELMODRAFT_97196              405   6e-129   
ref|XP_002972039.1|  hypothetical protein SELMODRAFT_441651             405   6e-129   
ref|XP_006416454.1|  hypothetical protein EUTSA_v10007284mg             405   8e-129   
emb|CDX73183.1|  BnaC06g36310D                                          404   1e-128   
ref|XP_004309580.1|  PREDICTED: galactose oxidase-like                  404   1e-128   
gb|KHN04050.1|  Galactose oxidase                                       402   1e-128   
ref|XP_004238325.1|  PREDICTED: galactose oxidase-like                  404   1e-128   
emb|CDY13556.1|  BnaC02g23670D                                          404   2e-128   
ref|XP_010498415.1|  PREDICTED: galactose oxidase                       403   2e-128   
ref|XP_010459669.1|  PREDICTED: galactose oxidase-like                  403   4e-128   
ref|XP_003567916.1|  PREDICTED: galactose oxidase-like                  405   4e-128   
ref|XP_010688268.1|  PREDICTED: uncharacterized protein LOC104902254    403   4e-128   
ref|XP_010536368.1|  PREDICTED: galactose oxidase-like                  403   6e-128   
ref|XP_009607831.1|  PREDICTED: galactose oxidase-like                  403   6e-128   
ref|XP_001784508.1|  predicted protein                                  402   7e-128   
ref|XP_009336703.1|  PREDICTED: galactose oxidase-like                  403   9e-128   
ref|XP_010539855.1|  PREDICTED: galactose oxidase-like                  400   1e-127   
emb|CDY62590.1|  BnaA08g31280D                                          401   1e-127   
ref|XP_010656292.1|  PREDICTED: galactose oxidase                       404   2e-127   
ref|XP_006381726.1|  hypothetical protein POPTR_0006s16390g             402   3e-127   
ref|XP_001778975.1|  predicted protein                                  400   4e-127   
ref|XP_009774166.1|  PREDICTED: galactose oxidase                       400   4e-127   
gb|KDO76728.1|  hypothetical protein CISIN_1g0433692mg                  399   5e-127   
ref|XP_006417012.1|  hypothetical protein EUTSA_v10007241mg             400   5e-127   
ref|XP_008781649.1|  PREDICTED: uncharacterized protein LOC103701389    401   5e-127   
ref|XP_009103375.1|  PREDICTED: galactose oxidase-like                  400   5e-127   
ref|XP_010533609.1|  PREDICTED: galactose oxidase-like                  400   6e-127   
ref|XP_009392205.1|  PREDICTED: galactose oxidase-like                  400   6e-127   
emb|CDP00282.1|  unnamed protein product                                398   1e-126   
ref|XP_007136065.1|  hypothetical protein PHAVU_009G014900g             399   1e-126   
ref|XP_010536365.1|  PREDICTED: galactose oxidase-like                  399   1e-126   
ref|XP_010523439.1|  PREDICTED: galactose oxidase-like isoform X1       399   1e-126   
ref|XP_010930930.1|  PREDICTED: uncharacterized protein LOC105051966    399   2e-126   
ref|XP_004238324.1|  PREDICTED: galactose oxidase-like                  398   3e-126   
ref|XP_009110252.1|  PREDICTED: galactose oxidase-like                  397   5e-126   
ref|XP_010254463.1|  PREDICTED: galactose oxidase                       399   7e-126   
ref|XP_008340335.1|  PREDICTED: uncharacterized protein LOC103403295    409   8e-126   
ref|XP_001757263.1|  predicted protein                                  396   9e-126   
ref|XP_010670846.1|  PREDICTED: galactose oxidase-like                  396   9e-126   
emb|CDY44191.1|  BnaC05g15480D                                          404   1e-125   
ref|XP_006435123.1|  hypothetical protein CICLE_v10003275mg             395   1e-125   
ref|XP_001759192.1|  predicted protein                                  396   1e-125   
ref|XP_002299426.2|  hypothetical protein POPTR_0001s11390g             397   1e-125   
ref|XP_004249644.1|  PREDICTED: galactose oxidase                       397   1e-125   
ref|XP_004963606.1|  PREDICTED: galactose oxidase-like                  399   2e-125   
ref|XP_011009462.1|  PREDICTED: galactose oxidase-like                  398   2e-125   
ref|XP_006349488.1|  PREDICTED: galactose oxidase-like                  395   2e-125   
ref|XP_009103376.1|  PREDICTED: galactose oxidase-like                  396   2e-125   
ref|XP_009337697.1|  PREDICTED: galactose oxidase-like                  394   2e-125   
ref|XP_003516307.1|  PREDICTED: galactose oxidase-like                  395   3e-125   
gb|KCW65018.1|  hypothetical protein EUGRSUZ_G02553                     396   3e-125   
gb|ACG29670.1|  glyoxal oxidase                                         397   3e-125   
ref|XP_008649992.1|  PREDICTED: uncharacterized protein LOC103630723    397   5e-125   
ref|XP_006473606.1|  PREDICTED: galactose oxidase-like                  394   5e-125   
ref|XP_010262660.1|  PREDICTED: galactose oxidase                       394   9e-125   
gb|KDO84767.1|  hypothetical protein CISIN_1g009420mg                   394   1e-124   
emb|CDY01391.1|  BnaA07g11640D                                          394   1e-124   
ref|XP_008377179.1|  PREDICTED: galactose oxidase-like                  393   1e-124   
ref|XP_001762682.1|  predicted protein                                  392   2e-124   
gb|KFK26190.1|  hypothetical protein AALP_AA8G214300                    394   2e-124   
ref|XP_009336713.1|  PREDICTED: galactose oxidase-like                  392   2e-124   
ref|XP_004292851.1|  PREDICTED: uncharacterized protein LOC101303486    394   4e-124   
ref|XP_008801460.1|  PREDICTED: galactose oxidase-like                  394   4e-124   
ref|NP_001150444.1|  glyoxal oxidase precursor                          392   5e-124   
ref|XP_001751285.1|  predicted protein                                  391   6e-124   
ref|XP_004288880.1|  PREDICTED: uncharacterized protein LOC101300395    394   7e-124   
ref|XP_006654771.1|  PREDICTED: uncharacterized protein LOC102716970    394   9e-124   
emb|CBI28031.3|  unnamed protein product                                402   1e-123   
ref|XP_011048365.1|  PREDICTED: galactose oxidase                       393   1e-123   
ref|XP_008350494.1|  PREDICTED: galactose oxidase-like                  390   2e-123   
ref|XP_009381768.1|  PREDICTED: uncharacterized protein LOC103969853    392   2e-123   
ref|XP_001771982.1|  predicted protein                                  391   2e-123   
ref|XP_009367892.1|  PREDICTED: uncharacterized protein LOC103957460    392   2e-123   
ref|XP_009602919.1|  PREDICTED: galactose oxidase                       390   2e-123   
ref|XP_006400518.1|  hypothetical protein EUTSA_v10012975mg             392   3e-123   
ref|XP_006287335.1|  hypothetical protein CARUB_v10000533mg             391   4e-123   
ref|XP_009336933.1|  PREDICTED: galactose oxidase-like                  393   4e-123   
ref|XP_006850437.1|  hypothetical protein AMTR_s00165p00057230          389   9e-123   
ref|XP_004969528.1|  PREDICTED: uncharacterized protein LOC101774211    391   1e-122   
emb|CDY44928.1|  BnaA02g04330D                                          390   1e-122   
ref|XP_007226541.1|  hypothetical protein PRUPE_ppa024999mg             389   2e-122   
ref|XP_009126377.1|  PREDICTED: galactose oxidase-like                  389   3e-122   
ref|XP_010100201.1|  hypothetical protein L484_015346                   387   3e-122   
ref|XP_010051583.1|  PREDICTED: galactose oxidase-like                  390   3e-122   
ref|XP_010088559.1|  hypothetical protein L484_016951                   387   4e-122   
ref|XP_009407008.1|  PREDICTED: uncharacterized protein LOC103989784    387   4e-122   
gb|EEC71262.1|  hypothetical protein OsI_03252                          390   5e-122   
ref|XP_007134016.1|  hypothetical protein PHAVU_010G012100g             387   5e-122   
ref|XP_001776127.1|  predicted protein                                  387   5e-122   
ref|XP_008362947.1|  PREDICTED: galactose oxidase-like                  390   6e-122   
ref|NP_001043851.1|  Os01g0677000                                       389   7e-122   
ref|XP_008220102.1|  PREDICTED: uncharacterized protein LOC103320236    387   8e-122   
ref|XP_002456130.1|  hypothetical protein SORBIDRAFT_03g031030          389   1e-121   
emb|CDY42279.1|  BnaC02g08850D                                          387   1e-121   
ref|XP_010424026.1|  PREDICTED: galactose oxidase-like                  385   1e-121   
ref|XP_002324431.2|  hypothetical protein POPTR_0018s09110g             388   1e-121   
ref|XP_003520957.1|  PREDICTED: uncharacterized protein LOC100776515    385   2e-121   
ref|XP_001763031.1|  predicted protein                                  385   2e-121   
emb|CDY29385.1|  BnaA06g14110D                                          384   3e-121   
ref|XP_010107380.1|  hypothetical protein L484_003656                   387   4e-121   
ref|XP_010420764.1|  PREDICTED: galactose oxidase-like isoform X1       386   4e-121   
ref|XP_010454240.1|  PREDICTED: galactose oxidase-like                  386   5e-121   
ref|XP_010044010.1|  PREDICTED: galactose oxidase                       384   5e-121   
emb|CBI19807.3|  unnamed protein product                                382   6e-121   
ref|XP_010493033.1|  PREDICTED: galactose oxidase-like                  385   6e-121   
ref|XP_009367481.1|  PREDICTED: uncharacterized protein LOC103957109    385   9e-121   
ref|XP_002440240.1|  hypothetical protein SORBIDRAFT_09g028310          385   1e-120   
gb|KEH28959.1|  glyoxal oxidase amino-terminal protein                  382   2e-120   
ref|XP_006429215.1|  hypothetical protein CICLE_v10011448mg             383   2e-120   
ref|XP_006480899.1|  PREDICTED: galactose oxidase-like                  382   2e-120   
gb|AAL84955.1|  AT5g19580/T20D1_100                                     384   2e-120   
ref|XP_002873953.1|  hypothetical protein ARALYDRAFT_488852             384   3e-120   
ref|NP_197459.1|  glyoxal oxidase-related protein                       384   3e-120   
gb|KDO57956.1|  hypothetical protein CISIN_1g044265mg                   381   3e-120   
ref|XP_004298451.1|  PREDICTED: galactose oxidase-like                  383   3e-120   
ref|XP_008242563.1|  PREDICTED: uncharacterized protein LOC103340881    387   4e-120   
ref|XP_002970607.1|  hypothetical protein SELMODRAFT_411320             381   4e-120   
ref|NP_001170492.1|  hypothetical protein precursor                     384   5e-120   
ref|XP_008367891.1|  PREDICTED: galactose oxidase-like                  385   6e-120   
ref|XP_009352508.1|  PREDICTED: galactose oxidase-like                  385   6e-120   
ref|XP_004137754.1|  PREDICTED: galactose oxidase-like                  381   6e-120   
ref|XP_004513017.1|  PREDICTED: uncharacterized protein LOC101505637    383   9e-120   
emb|CDP06561.1|  unnamed protein product                                380   1e-119   
ref|XP_003569556.2|  PREDICTED: uncharacterized protein LOC100835848    382   2e-119   
ref|XP_002968444.1|  hypothetical protein SELMODRAFT_231119             379   2e-119   
gb|KDP24540.1|  hypothetical protein JCGZ_25104                         379   3e-119   
ref|XP_008442498.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    379   5e-119   
ref|XP_002322929.1|  glyoxal oxidase-related family protein             379   5e-119   
ref|XP_007203106.1|  hypothetical protein PRUPE_ppa023837mg             385   8e-119   
ref|XP_001777189.1|  predicted protein                                  378   8e-119   
ref|XP_001754066.1|  predicted protein                                  377   8e-119   
ref|XP_007026880.1|  Glyoxal oxidase-related protein                    385   1e-118   
ref|XP_010674911.1|  PREDICTED: uncharacterized protein LOC104890981    378   1e-118   
ref|XP_001774105.1|  predicted protein                                  377   2e-118   
ref|XP_004503455.1|  PREDICTED: uncharacterized protein LOC101501825    380   3e-118   
ref|XP_001765643.1|  predicted protein                                  377   3e-118   
gb|EYU41788.1|  hypothetical protein MIMGU_mgv1a004290mg                377   3e-118   
ref|XP_008240187.1|  PREDICTED: galactose oxidase                       377   4e-118   
ref|XP_003620657.1|  Galactose oxidase                                  378   4e-118   
ref|XP_010535983.1|  PREDICTED: galactose oxidase-like                  378   5e-118   
gb|EAY98991.1|  hypothetical protein OsI_20949                          379   5e-118   
ref|XP_011006630.1|  PREDICTED: galactose oxidase                       376   6e-118   
ref|NP_001056298.1|  Os05g0559000                                       379   6e-118   
ref|NP_001176372.1|  Os11g0169700                                       377   7e-118   
ref|XP_001769885.1|  predicted protein                                  375   8e-118   
ref|XP_002514260.1|  Galactose oxidase precursor, putative              378   9e-118   
ref|XP_008460895.1|  PREDICTED: galactose oxidase                       378   9e-118   
ref|XP_006400519.1|  hypothetical protein EUTSA_v10012975mg             378   9e-118   
emb|CDM83959.1|  unnamed protein product                                377   1e-117   
ref|XP_004978797.1|  PREDICTED: galactose oxidase-like                  376   1e-117   
ref|XP_004139435.1|  PREDICTED: galactose oxidase-like                  378   1e-117   
emb|CDY59162.1|  BnaC06g42590D                                          375   1e-117   
ref|XP_004305171.1|  PREDICTED: galactose oxidase-like                  375   1e-117   
gb|KHG09161.1|  galactose oxidase                                       372   1e-117   
ref|XP_010416451.1|  PREDICTED: galactose oxidase-like isoform X2       374   3e-117   
ref|XP_001758038.1|  predicted protein                                  373   5e-117   
gb|EAY80097.1|  hypothetical protein OsI_35269                          375   5e-117   
gb|EYU38846.1|  hypothetical protein MIMGU_mgv1a027114mg                372   6e-117   
ref|XP_010535982.1|  PREDICTED: galactose oxidase-like                  373   9e-117   
gb|ABA42922.1|  glyoxal oxidase                                         372   1e-116   
ref|XP_007208466.1|  hypothetical protein PRUPE_ppa003992mg             372   1e-116   
gb|ACV49899.1|  glyoxal oxidase                                         372   2e-116   
ref|XP_002281387.1|  PREDICTED: uncharacterized protein LOC100256065    374   2e-116   
ref|XP_001774194.1|  predicted protein                                  372   2e-116   
ref|XP_007152887.1|  hypothetical protein PHAVU_004G168600g             375   2e-116   
ref|XP_006391296.1|  hypothetical protein EUTSA_v10018300mg             374   2e-116   
ref|XP_002274763.1|  PREDICTED: galactose oxidase                       372   2e-116   
emb|CDX67577.1|  BnaA07g16170D                                          372   3e-116   
ref|XP_001762124.1|  predicted protein                                  371   3e-116   
ref|XP_009103886.1|  PREDICTED: galactose oxidase                       372   3e-116   
ref|XP_002876232.1|  hypothetical protein ARALYDRAFT_485786             372   4e-116   
ref|XP_001759194.1|  predicted protein                                  371   4e-116   
ref|XP_010504181.1|  PREDICTED: galactose oxidase-like                  371   6e-116   
gb|KFK41129.1|  hypothetical protein AALP_AA2G089900                    374   7e-116   
ref|XP_010515903.1|  PREDICTED: galactose oxidase-like                  371   8e-116   
ref|XP_002449081.1|  hypothetical protein SORBIDRAFT_05g004490          371   8e-116   
gb|ACV49898.1|  glyoxal oxidase                                         370   9e-116   
gb|KFK34638.1|  hypothetical protein AALP_AA5G172000                    370   1e-115   
ref|XP_009127543.1|  PREDICTED: galactose oxidase-like                  372   2e-115   
ref|XP_011094925.1|  PREDICTED: galactose oxidase                       369   2e-115   
gb|ACV49897.1|  glyoxal oxidase                                         369   2e-115   
ref|XP_003630749.1|  Galactose oxidase                                  372   2e-115   
ref|XP_007160315.1|  hypothetical protein PHAVU_002G311300g             372   3e-115   
emb|CDX96101.1|  BnaA07g26300D                                          371   3e-115   
emb|CDY51183.1|  BnaC02g45610D                                          371   3e-115   
ref|NP_190963.1|  glyoxal oxidase-related protein                       369   3e-115   
emb|CDY43432.1|  BnaC07g14990D                                          367   4e-115   
ref|XP_010427056.1|  PREDICTED: galactose oxidase-like                  369   4e-115   
ref|XP_009105271.1|  PREDICTED: galactose oxidase                       370   4e-115   
ref|XP_009421296.1|  PREDICTED: galactose oxidase                       369   8e-115   
ref|XP_006290869.1|  hypothetical protein CARUB_v10016978mg             367   1e-114   
ref|XP_004507195.1|  PREDICTED: galactose oxidase-like                  367   1e-114   
dbj|BAL41451.1|  glyoxal oxidase 2                                      372   2e-114   
ref|XP_002888587.1|  hypothetical protein ARALYDRAFT_475824             369   3e-114   
tpg|DAA44471.1|  TPA: hypothetical protein ZEAMMB73_122663              367   4e-114   
ref|XP_010541740.1|  PREDICTED: galactose oxidase-like                  368   6e-114   
emb|CDY01797.1|  BnaC06g28370D                                          367   6e-114   
ref|XP_010553274.1|  PREDICTED: galactose oxidase                       365   8e-114   
gb|KDP29259.1|  hypothetical protein JCGZ_16648                         368   1e-113   
ref|XP_010532465.1|  PREDICTED: galactose oxidase-like                  366   3e-113   
ref|XP_001756237.1|  predicted protein                                  363   3e-113   
ref|XP_010511646.1|  PREDICTED: galactose oxidase-like                  365   4e-113   
ref|XP_001760507.1|  predicted protein                                  362   8e-113   
ref|XP_010535981.1|  PREDICTED: galactose oxidase-like                  363   9e-113   
ref|XP_003516476.1|  PREDICTED: uncharacterized protein LOC100797716    364   1e-112   
gb|KDP33710.1|  hypothetical protein JCGZ_07281                         368   1e-112   
ref|NP_176897.1|  glyoxal oxidase-related protein                       364   1e-112   
ref|XP_006301879.1|  hypothetical protein CARUB_v10022352mg             368   2e-112   
gb|KDP33711.1|  hypothetical protein JCGZ_07282                         363   6e-112   
dbj|BAL41452.1|  glyoxal oxidase 3                                      363   1e-111   
ref|XP_010470629.1|  PREDICTED: galactose oxidase-like isoform X1       361   1e-111   
gb|EPS61181.1|  glyoxal oxidase                                         359   1e-111   
ref|XP_008811510.1|  PREDICTED: galactose oxidase                       360   1e-111   
gb|KFK44113.1|  hypothetical protein AALP_AA1G217400                    358   2e-111   
ref|XP_008359690.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    358   3e-111   
ref|XP_006341271.1|  PREDICTED: uncharacterized protein LOC102605018    358   5e-111   
ref|XP_010905399.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    358   7e-111   
ref|XP_006646198.1|  PREDICTED: uncharacterized protein LOC102719070    355   3e-110   
ref|XP_009766667.1|  PREDICTED: uncharacterized protein LOC104217988    358   4e-110   
gb|KDO54103.1|  hypothetical protein CISIN_1g039705mg                   355   4e-110   
ref|XP_007013099.1|  Glyoxal oxidase-related protein, putative          358   4e-110   
ref|XP_006420316.1|  hypothetical protein CICLE_v10006853mg             357   5e-110   
ref|XP_001774885.1|  predicted protein                                  355   8e-110   
dbj|BAL41453.1|  glyoxal oxidase 4                                      357   3e-109   
emb|CDY58964.1|  BnaC09g38100D                                          354   3e-109   
ref|XP_001782509.1|  predicted protein                                  352   6e-109   
ref|XP_004242940.2|  PREDICTED: uncharacterized protein LOC101252095    352   1e-108   
ref|XP_006584818.1|  PREDICTED: uncharacterized protein LOC100808336    354   3e-108   
ref|XP_006451227.1|  hypothetical protein CICLE_v10007862mg             351   5e-108   
ref|XP_001772413.1|  predicted protein                                  350   5e-108   
ref|XP_011078295.1|  PREDICTED: uncharacterized protein LOC105162074    352   9e-108   
ref|XP_002446737.1|  hypothetical protein SORBIDRAFT_06g021520          350   9e-108   
ref|XP_011078293.1|  PREDICTED: uncharacterized protein LOC105162073    352   2e-107   
ref|XP_003576251.1|  PREDICTED: galactose oxidase-like                  350   4e-107   



>ref|XP_010663077.1| PREDICTED: uncharacterized protein LOC100253501 [Vitis vinifera]
Length=597

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/542 (65%), Positives = 437/542 (81%), Gaps = 2/542 (0%)
 Frame = +1

Query  355   ASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTR  534
              + +   +   +G+WQ L+ NTGVV MHMALTH  TV+ FDQ G G+SGY LRRR+NGTR
Sbjct  58    CTAVAGSSGGKKGKWQLLLNNTGVVGMHMALTHHGTVIIFDQIGVGQSGYGLRRRYNGTR  117

Query  535   CKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSK  714
             C  ++ DL+D SC+AHSVEYD+  N +RPLR  +D WCSSG+ LSNGT++QTGGY  GS+
Sbjct  118   CMNTQHDLTDWSCFAHSVEYDMSLNKVRPLRLDTDPWCSSGSFLSNGTLLQTGGYGRGSR  177

Query  715   RIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPN  894
             RI++F PC +  C+W+  K  L D+RWYAS+QILP K DR I+VGGR+  +YEFVP+  +
Sbjct  178   RIRYFRPCENGHCDWRQSKTLLSDDRWYASSQILPEK-DRAIVVGGRQVFSYEFVPKLHS  236

Query  895   MQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRM  1074
               +S DLPFLH+T  +N GGNNLYPF+HLSSDG LFIFANRDSILFNY++NRV K FPR+
Sbjct  237   NHRSFDLPFLHRTTNKNEGGNNLYPFVHLSSDGNLFIFANRDSILFNYKRNRVVKSFPRI  296

Query  1075  PGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
             PG GSR+YPS+GSSV+LPLDH +RF KVEVM+CGGA++GA+  A+QG+F++GL SCGRMV
Sbjct  297   PGAGSRNYPSSGSSVILPLDHGDRFHKVEVMVCGGAASGAHQAAEQGKFLKGLSSCGRMV  356

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+GN HKWNMENMPGPR++NDM+ILPTG ILIING KRGCAGW N A P+L+PY+Y P K
Sbjct  357   ITGNTHKWNMENMPGPRLLNDMLILPTGDILIINGAKRGCAGWKNAADPSLQPYLYKPKK  416

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
             T+G+RFSVL++TKIARMYHSSA L PDGRVL+AGSNPN+ Y F NV +PTELRLQAFVP 
Sbjct  417   TLGRRFSVLKSTKIARMYHSSAILTPDGRVLVAGSNPNNKYTFRNVRYPTELRLQAFVPA  476

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHS  1794
             YMDR++ N RP NVS++        V YG+ F VRFWL KK PS+ +EFSAY+PPFTTHS
Sbjct  477   YMDRQYHNTRPGNVSIHYGSGTNGGVRYGEGFSVRFWLGKK-PSKTVEFSAYAPPFTTHS  535

Query  1795  VAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFA  1974
             ++MNQRMLKLRC SM RG+ G +NA + APPSP  AP GYYM+TV+N GIPSIS+W++  
Sbjct  536   ISMNQRMLKLRCKSMVRGEGGWINAALEAPPSPNVAPSGYYMLTVINGGIPSISQWIRII  595

Query  1975  NA  1980
             +A
Sbjct  596   HA  597



>ref|XP_008367509.1| PREDICTED: uncharacterized protein LOC103431143 [Malus domestica]
Length=551

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/532 (64%), Positives = 428/532 (80%), Gaps = 2/532 (0%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A S +G+WQ L+ NTGVVAMHMALTH NTV+ FDQ  +G SGY+LR R NG RC  +R+D
Sbjct  19    AGSRKGQWQQLLNNTGVVAMHMALTHHNTVIMFDQTEAGPSGYRLRTRHNGNRCTDNRDD  78

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             ++D SCYAHSVEYD+ +N +RPLR  +DTWCSSG+ LSNGT++QTGGY  G++RI+++ P
Sbjct  79    VADSSCYAHSVEYDISSNKVRPLRLYTDTWCSSGSFLSNGTLLQTGGYGSGTRRIRYYRP  138

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
             C +  CNW+  ++ L  +RWYASNQ+LP ++DRVI+VGGRR  TYEFVP+  + + S +L
Sbjct  139   CGNGKCNWRQSERSLSKDRWYASNQLLP-EHDRVIVVGGRRTFTYEFVPKMSSNEGSHEL  197

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
              FLHQTY+ N GGNNLYPFLHLSSDG LFIFANR+SILF+Y +NRV K FPR+PG+GSR+
Sbjct  198   SFLHQTYDPNEGGNNLYPFLHLSSDGNLFIFANRNSILFDYERNRVIKTFPRIPGDGSRN  257

Query  1096  YPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHK  1275
             YP +GSSV+LPLDH NRF+KVEVM+CGGA++GAY   +Q RF++GL SCGRMVI+GN+HK
Sbjct  258   YPGSGSSVILPLDHANRFEKVEVMVCGGAASGAYRATRQNRFLKGLSSCGRMVITGNRHK  317

Query  1276  WNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFS  1455
             WNMENMPGPR++NDM+ILPTG +LIING KRG  GW N  + +L PY+Y P   +GKRFS
Sbjct  318   WNMENMPGPRLLNDMLILPTGNVLIINGAKRGSGGWNNARNASLRPYLYKPNXKLGKRFS  377

Query  1456  VLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFD  1635
             VL++TKIARMYHSSA LLPDGRVL+ G NP+D Y F+NV +PTELRLQAFVP YM R++ 
Sbjct  378   VLKSTKIARMYHSSAVLLPDGRVLVGGGNPHDRYTFSNVAYPTELRLQAFVPHYMRRKYH  437

Query  1636  NQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRM  1815
               RP NV++    +    V YG+EF+V F L++K PS+ +EF+AYSPPFTTHS++MNQR+
Sbjct  438   THRPTNVTIQYGQNNYNGVRYGEEFNVTFLLERK-PSDVVEFTAYSPPFTTHSISMNQRL  496

Query  1816  LKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             LKLRC S+ R   G+V+AVV APPS   AP GYYM+TVVN G PS+S WV+F
Sbjct  497   LKLRCKSLVRAQXGLVHAVVEAPPSANVAPSGYYMLTVVNGGTPSMSEWVRF  548



>ref|XP_008239597.1| PREDICTED: uncharacterized protein LOC103338188 [Prunus mume]
Length=568

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/559 (61%), Positives = 438/559 (78%), Gaps = 3/559 (1%)
 Frame = +1

Query  295   AITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFF  474
             A+ +++     +L  C   + +V    A   +G+WQ L+ NTGVVAMHMALTH NTVV F
Sbjct  10    AMKSMIAALFFTLH-CIGFSGAVGRFSAVGQKGQWQLLLNNTGVVAMHMALTHDNTVVIF  68

Query  475   DQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSS  654
             DQ  +G SGY+LRRR NG RC  SR+DL+D SCYAHSVEYD+ +N +RPLR  +DTWCSS
Sbjct  69    DQTEAGPSGYRLRRRHNGNRCTESRDDLADSSCYAHSVEYDISSNKVRPLRLYTDTWCSS  128

Query  655   GTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDR  834
             G+ LSNGT++QTGGY  G++RI++F  C D  C+W+  ++ L D+RWYASNQ+LP ++DR
Sbjct  129   GSFLSNGTLLQTGGYGSGTRRIRYFKSCGDGQCDWRQSERSLADDRWYASNQLLP-EHDR  187

Query  835   VIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFAN  1014
             +I+VGGRR  TYEF+P+  + + S DL FLH+TY+R+ GGNNLYPFLHLSSDG LFIFAN
Sbjct  188   IIVVGGRRTFTYEFIPKMSSNEGSHDLSFLHETYDRSEGGNNLYPFLHLSSDGNLFIFAN  247

Query  1015  RDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGA  1194
             RDSILFNYR N V K FPR+PG+GSR+YP +GSSV+LPLDH N FQ+VEVM+CGGA++GA
Sbjct  248   RDSILFNYRSNIVIKTFPRIPGDGSRNYPGSGSSVILPLDHTNNFQRVEVMVCGGAASGA  307

Query  1195  YTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGC  1374
             +  A Q RF++GL SCGRMVI+GN+HKWNMENMPG R+++DM+ILPTG +LIING KRG 
Sbjct  308   HRAAGQNRFLKGLISCGRMVITGNRHKWNMENMPGSRLLSDMLILPTGNVLIINGAKRGS  367

Query  1375  AGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDG  1554
              GW N  + + +PY+Y+P   +GKRFSVL++TKIARMYHSSA LLPDGRVL+ G NP++ 
Sbjct  368   GGWNNARNASHQPYLYNPNHKLGKRFSVLKSTKIARMYHSSAILLPDGRVLVGGGNPHES  427

Query  1555  YVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDK  1734
             Y F+NV +PTELRLQAF P YM  ++   RP N+++       + V YG +F+V FWL +
Sbjct  428   YTFSNVAYPTELRLQAFAPHYMGMQYHTYRPINLTINYGHGDLSGVRYGGDFNVSFWLGR  487

Query  1735  KWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGY  1914
             K PS+ +EFSAY+PPFTTHS++MNQR+LKLRC  + R + G+V+AV+ APPSP  AP GY
Sbjct  488   K-PSKVVEFSAYAPPFTTHSISMNQRLLKLRCKRLVRAEGGLVHAVLEAPPSPNVAPSGY  546

Query  1915  YMVTVVNEGIPSISRWVKF  1971
             YM+TVVN GIPSIS+WV+F
Sbjct  547   YMLTVVNGGIPSISQWVRF  565



>ref|XP_007137990.1| hypothetical protein PHAVU_009G171700g [Phaseolus vulgaris]
 gb|ESW09984.1| hypothetical protein PHAVU_009G171700g [Phaseolus vulgaris]
Length=554

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/561 (62%), Positives = 440/561 (78%), Gaps = 8/561 (1%)
 Frame = +1

Query  298   ITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFD  477
             ITAL   FLV    C   +    V+ +   +G+WQ L+++TGVV MH+ALT+RNTV+ FD
Sbjct  2     ITALF--FLV----CFGFSDGANVTPSEGRRGQWQLLLKSTGVVGMHVALTYRNTVIMFD  55

Query  478   QRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSG  657
             Q G+G S Y+LR+RFNG RC     D+ D +CYAH+VEYD+  N +RPLR  +D WCSSG
Sbjct  56    QTGAGPSSYELRKRFNGGRCTRGSHDIMDSTCYAHAVEYDISINKVRPLRLDTDPWCSSG  115

Query  658   TILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRV  837
             + LSNGT++QTGG   G+KRI+FF PC +  C+W   KK L D RWYAS+ +LP ++DRV
Sbjct  116   SFLSNGTLLQTGGNDRGAKRIRFFRPCGNDKCDWMQSKKILSDRRWYASSLLLP-EHDRV  174

Query  838   IIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANR  1017
             ++VGGRRA TYEFVP+    +KS DLPFLHQT +RN GGNNLYPFLHLSSDG LFIFANR
Sbjct  175   VVVGGRRALTYEFVPKISPGEKSFDLPFLHQTNDRNEGGNNLYPFLHLSSDGNLFIFANR  234

Query  1018  DSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAY  1197
             DSIL N R+N+V K FPR+PGEGSR+YPS+GSSV+LPLDH++ FQ+VEVM+CGG+S GA+
Sbjct  235   DSILLNLRRNKVIKTFPRIPGEGSRNYPSSGSSVILPLDHRDNFQRVEVMVCGGSSTGAF  294

Query  1198  TEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCA  1377
             T A + RF+ GL+SCGRMVI+GNKHKW+ME+MP PR++++M+ILP G ILIING KRG A
Sbjct  295   TAAAKRRFLVGLRSCGRMVITGNKHKWDMEHMPKPRLLHNMLILPKGDILIINGAKRGSA  354

Query  1378  GWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGY  1557
             G+ N  + +L PY+YSP K +G RF+VL +TKIARMYHSSAALLPDGRVL+AGSNP+  Y
Sbjct  355   GYDNARNASLAPYLYSPKKRLGARFTVLMSTKIARMYHSSAALLPDGRVLVAGSNPHGRY  414

Query  1558  VFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKK  1737
              F NV +PTELRLQAFVP YM+RR+   RP N+++   G+ +  ++YGKEF VRF+L+++
Sbjct  415   TFHNVAYPTELRLQAFVPHYMERRYHTWRPSNLTIQYAGATSHAIEYGKEFTVRFFLERR  474

Query  1738  WPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYY  1917
              PS  + FSAY+PPFTTHS +MNQRMLKLRC SM R  +G V AV+ APPS + AP GYY
Sbjct  475   -PSNVMGFSAYAPPFTTHSFSMNQRMLKLRCRSMVRSGDGWVVAVLEAPPSSLVAPSGYY  533

Query  1918  MVTVVNEGIPSISRWVKFANA  1980
             M+TVVN GIPS+S+WV+F +A
Sbjct  534   MLTVVNGGIPSMSQWVQFGHA  554



>emb|CDP12684.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/543 (65%), Positives = 429/543 (79%), Gaps = 3/543 (1%)
 Frame = +1

Query  352   NASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGT  531
             NA+  +S   + +G+WQ L++N GVVAMHMALTH +TVV  DQ GS +SGY+L+RR NGT
Sbjct  29    NAARELSSRGNRKGKWQLLLKNAGVVAMHMALTHYDTVVILDQIGSQQSGYRLKRRLNGT  88

Query  532   RCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGS  711
             +C     D  D SCYAHSVEYD++ N IRPL   SDTWCSSG+ILS+GTI+QTGGY  GS
Sbjct  89    KCDHRNRDSEDWSCYAHSVEYDIMRNKIRPLHINSDTWCSSGSILSDGTIIQTGGYGGGS  148

Query  712   KRIQFFAPCV-DKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF  888
             +RI++F PC  +  C+WK  K  L D RWYASN +LP K DRVI+VGGRR  TYEFVP+ 
Sbjct  149   RRIRYFKPCDHNGRCDWKQNKHSLSDMRWYASNLLLPDK-DRVIVVGGRRIFTYEFVPKL  207

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
              + +K+ DLPFLH+TYER   GNNLYPFLHLSSDG LFIFANRDSILFNY++ +V K FP
Sbjct  208   SSREKAYDLPFLHKTYERRREGNNLYPFLHLSSDGNLFIFANRDSILFNYKRRKVVKTFP  267

Query  1069  RMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGR  1248
             R+P +G RSYPSTGSSV+LPLDH+N FQKVEVMICGGA+ GAY  A +G+F++GL SCGR
Sbjct  268   RIPKDGGRSYPSTGSSVILPLDHENGFQKVEVMICGGAAPGAYGAADEGKFLKGLSSCGR  327

Query  1249  MVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSP  1428
             MVI+GN+HKW MENMPGPRVM+DM+ILPTG ILIING KRGCAGW N ASPALEPY+Y P
Sbjct  328   MVITGNRHKWKMENMPGPRVMSDMLILPTGHILIINGAKRGCAGWENAASPALEPYLYKP  387

Query  1429  GKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFV  1608
              K  G+RF+VL+A KI RMYHSSA LLPDGRVL+AGSNPN  Y F NV +PTELRLQAFV
Sbjct  388   QKRQGRRFTVLKAAKIPRMYHSSAILLPDGRVLVAGSNPNRRYEFKNVKYPTELRLQAFV  447

Query  1609  PDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             PD+MD++FD++R  N+S+         + YG+EF V FWL  K  S+D+ FS Y+ PFTT
Sbjct  448   PDHMDQKFDHRRAHNLSISTSKGEEN-IGYGREFGVHFWLRGKISSKDVIFSVYAVPFTT  506

Query  1789  HSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             HS++MNQRML+L+C  M + +NG+VNA+V APPS   AP GYY++TVVN GIPS S+W++
Sbjct  507   HSLSMNQRMLRLKCKKMLKDENGLVNAIVEAPPSANVAPAGYYLLTVVNGGIPSKSQWIR  566

Query  1969  FAN  1977
             F +
Sbjct  567   FTH  569



>ref|XP_011087000.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=566

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/575 (61%), Positives = 453/575 (79%), Gaps = 10/575 (2%)
 Frame = +1

Query  259   METHQLRTTLPC-AITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAM  435
             M+T  L +     AIT LL      L   NA+ ++    +   G+G WQ L++NTGVVAM
Sbjct  1     MDTKNLNSHFKVLAITHLL------LHCANAV-STATKPDPDRGKGEWQLLLKNTGVVAM  53

Query  436   HMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTI  615
             HMA+THRNTVV FDQ GSGRSGY+LR+R +GTRC+  R+D +D SCYAHS+EYDVL N+I
Sbjct  54    HMAVTHRNTVVMFDQMGSGRSGYRLRKRHDGTRCRNVRKDFNDSSCYAHSIEYDVLRNSI  113

Query  616   RPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERW  795
             RPL   +DTWCSSG++LSNGT++QTGG+  GS+RI++F PC +  C+W+ G+K L +ERW
Sbjct  114   RPLNIETDTWCSSGSMLSNGTLIQTGGFGSGSRRIRYFKPCQNHHCDWREGRKLLSNERW  173

Query  796   YASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFL  975
             YAS+  LP K+DRVI+VGGR   TYEFVP+    +KS  LPFL +TY+RN GGNNLYP +
Sbjct  174   YASSLKLPDKDDRVIVVGGRDVFTYEFVPKRSPSEKSFILPFLRKTYDRNEGGNNLYPIV  233

Query  976   HLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQK  1155
             HLSSDG+LF+FANRDSILFNY++NRV KKFPR+PG+GSRSYPSTGSSV+LPL + + F+K
Sbjct  234   HLSSDGHLFMFANRDSILFNYKRNRVVKKFPRIPGKGSRSYPSTGSSVILPLHYNDGFRK  293

Query  1156  VEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPT  1335
             VEVMICGG++AGA++ AKQGRF++G ++CGRMVI+GN HKW MENMPGPR+M+DM+ LPT
Sbjct  294   VEVMICGGSAAGAFSAAKQGRFLKGSRTCGRMVITGNNHKWKMENMPGPRLMHDMITLPT  353

Query  1336  GQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPD  1515
             G +LIING K GC GW   ++P+L+PY+Y+P K +G+RF++L++TKIARMYHSSA LLPD
Sbjct  354   GHVLIINGAKNGCGGWNYASNPSLQPYLYNPKKMIGRRFTILKSTKIARMYHSSAVLLPD  413

Query  1516  GRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVD  1695
             GRVL+ GSNPN+ Y F NVPHPTELRLQAFVP ++ +  + +RP+NVS+Y  G+   +V 
Sbjct  414   GRVLVGGSNPNNKYTFKNVPHPTELRLQAFVPPHVGKESNGRRPQNVSIYTSGN-DEIVG  472

Query  1696  YGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavv  1875
             YG  FHV+F L  K  S+ L F+AY+ PF THS++MNQRML LRC +++R  +G +NA+V
Sbjct  473   YGGRFHVKFLLKTKL-SKMLAFTAYASPFNTHSISMNQRMLVLRCKNIKRTKDGWLNALV  531

Query  1876  aappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
              APPSP  AP GYYM+TV++ GIPS S W+KF + 
Sbjct  532   EAPPSPKVAPSGYYMLTVLHNGIPSRSHWIKFTHT  566



>ref|XP_007037788.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY22289.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=562

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/537 (64%), Positives = 444/537 (83%), Gaps = 5/537 (1%)
 Frame = +1

Query  376   AASG--QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSR  549
             A+SG  +G WQ L +NTGVVAMHMALT+RNTV+ FDQ G+G S Y+LRRR++G RC  +R
Sbjct  29    ASSGGRKGTWQLLRQNTGVVAMHMALTNRNTVIIFDQTGAGPSRYRLRRRYSGKRCTRAR  88

Query  550   EDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFF  729
             EDL D SCYAHSVEY++  + +R LR  +DTWCSSGT LSNGT++QTGG+  GS+++++F
Sbjct  89    EDLEDWSCYAHSVEYNIDGHNVRSLRLDTDTWCSSGTFLSNGTLLQTGGHGSGSQKVRYF  148

Query  730   APCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST  909
             +PC +  CNW+  K+ L D+RWYASNQ+LP +NDRVI+VGGRR  +YEFVP+  +  +S 
Sbjct  149   SPCSNGQCNWRQSKRSLSDDRWYASNQLLP-ENDRVIVVGGRRVFSYEFVPKLHSSDRSF  207

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
             +LPFL +T  +NAGGNNLYPFLHLSSDG LFIFANRDSILFNYR+++V K FPR+PG GS
Sbjct  208   NLPFLRKTNNKNAGGNNLYPFLHLSSDGNLFIFANRDSILFNYRQHKVIKTFPRIPGGGS  267

Query  1090  RSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNK  1269
             R+YPS+GSSV+LPL+H++RF+KVEVM+CGGA++GAY  A++G F++ L SCGRMVISGN+
Sbjct  268   RNYPSSGSSVILPLNHEDRFRKVEVMVCGGAASGAYEVAERGTFLKALSSCGRMVISGNR  327

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
             HKW MENMPGPR M+DM+ILPTG ILIING KRGCAGW N A+P+L+PY+Y P KT+GKR
Sbjct  328   HKWKMENMPGPRTMHDMLILPTGHILIINGAKRGCAGWNNAATPSLQPYLYKPKKTLGKR  387

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             FSVL++TKIARMYHSSA +LPDGR+L+AG NPN+ Y+F NV +PTELRLQAF+P+YMDR+
Sbjct  388   FSVLKSTKIARMYHSSALVLPDGRILVAGGNPNNRYIFRNVSYPTELRLQAFIPNYMDRQ  447

Query  1630  FDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQ  1809
             + + RP NVS     S   +  YG+EF V+FWL ++ PS+++E+S Y+PPFTTHS++MNQ
Sbjct  448   YHHLRPGNVSTKYRSSSDGIA-YGEEFAVQFWLGRR-PSKEVEYSVYAPPFTTHSISMNQ  505

Query  1810  RMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
             R+LKLR  +  R   G + AV+ APPSP  APPGYY++TVVNEGIPS+S+W++F +A
Sbjct  506   RLLKLRSKNTVRDKGGWMVAVLEAPPSPNVAPPGYYLLTVVNEGIPSLSQWIRFIHA  562



>ref|XP_004501852.1| PREDICTED: uncharacterized protein LOC101503410 [Cicer arietinum]
Length=987

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/565 (61%), Positives = 437/565 (77%), Gaps = 5/565 (1%)
 Frame = +1

Query  298   ITALLVLFLVSLRPC-NALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFF  474
             I   L++ +  L  C +A +A  ++S A  G+G+WQ L++NTGVV MHMALT++NTV+ F
Sbjct  424   IECQLIMRVFVLLICRHAASADKILSHAPFGKGQWQLLLKNTGVVGMHMALTYKNTVIMF  483

Query  475   DQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSS  654
             DQ G+G+S Y+LR+RF+GT C  SR DL D +CYAHS+EYD+ +N IRPLR  +D WCSS
Sbjct  484   DQTGAGQSRYKLRKRFDGTMCSTSRNDLIDSTCYAHSIEYDISSNRIRPLRLDTDPWCSS  543

Query  655   GTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDR  834
             G+ LSNGT++Q GGY  G+KR++F+ PC +  C+WK  KK L DERWYAS+QILPG +DR
Sbjct  544   GSFLSNGTLLQIGGYHQGAKRVRFYRPCGNHQCDWKQSKKSLSDERWYASSQILPG-HDR  602

Query  835   VIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFAN  1014
             V++VGGRR  TYEFVP+    +KS +LPFLHQT +RN+ GNNLYPF HLSSDG LF+FAN
Sbjct  603   VVVVGGRRTFTYEFVPKISPNEKSFELPFLHQTNDRNSEGNNLYPFTHLSSDGNLFVFAN  662

Query  1015  RDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGA  1194
             RDSIL N R+N+V K FPR+PG+GSR+YPS+GSSV+LPLDHK++FQKVEVM+CGG+S GA
Sbjct  663   RDSILLNLRRNKVIKTFPRIPGKGSRNYPSSGSSVLLPLDHKDKFQKVEVMVCGGSSTGA  722

Query  1195  YTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGC  1374
                A++ RFIEGL+SCGRMVI+GNKH W M+ MP PR + DM+ILPTG ILIING K GC
Sbjct  723   LKAARRKRFIEGLRSCGRMVITGNKHTWEMDYMPKPRFLQDMLILPTGNILIINGAKHGC  782

Query  1375  AGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDG  1554
             AG+ N  + +LEPY+YSP K +GKRF VL+ TKIARMYHSSA LLPDGRVL+AG NP+  
Sbjct  783   AGYDNARNASLEPYLYSPNKRLGKRFRVLKETKIARMYHSSATLLPDGRVLVAGGNPHGR  842

Query  1555  YVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSV-YVEGSPA--AVVDYGKEFHVRFW  1725
             Y F NV +PTELRLQAFVP YM++R+   RP N+++ +V G       + YGKEF VRF 
Sbjct  843   YTFHNVAYPTELRLQAFVPHYMEKRYHTWRPSNLTIEHVSGGGGDNHAIGYGKEFSVRFL  902

Query  1726  LDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaap  1905
             L K+    +++FS YSPPFTTH+  MNQRML LRC  M R   G V+AV+ APPS   AP
Sbjct  903   LRKRENDHEVKFSVYSPPFTTHAFGMNQRMLNLRCKRMVRRSEGWVDAVLEAPPSSFVAP  962

Query  1906  pGYYMVTVVNEGIPSISRWVKFANA  1980
              GYY++TVVN GIPS+SRW++F +A
Sbjct  963   SGYYLLTVVNGGIPSMSRWIQFVHA  987



>ref|XP_003528130.2| PREDICTED: uncharacterized protein LOC100814200 [Glycine max]
Length=564

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/565 (61%), Positives = 439/565 (78%), Gaps = 5/565 (1%)
 Frame = +1

Query  286   LPCAITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTV  465
             L C+   + +LF +    C   +  V V  +   +G+WQ L+ NTGVV MH+ALT+++TV
Sbjct  5     LSCSKIMITILFFLV---CFEFSNGVNVRSSEGRKGQWQLLLNNTGVVGMHVALTYKDTV  61

Query  466   VFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTW  645
             + FDQ G+G+SGY+LRRRFNG+RC  +  DL D +CYAHSVEYD+  N +RPLR  +D W
Sbjct  62    IMFDQTGAGQSGYRLRRRFNGSRCTINHHDLLDSTCYAHSVEYDISANKVRPLRLDTDPW  121

Query  646   CSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGK  825
             CSS + LSNGT++QTGG+  G+KR++F+ PC +  C+W   KK L DERWYAS+QILP  
Sbjct  122   CSSASFLSNGTLLQTGGFEKGAKRVRFYRPCGNHQCDWIQSKKTLSDERWYASSQILPEH  181

Query  826   NDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFI  1005
             N  V++ G RR  TYEFVP+    +KS DLPFLHQT +R+ GGNNLYPFLHLSSDG LF+
Sbjct  182   NRVVVVGG-RRVFTYEFVPKTSPGEKSFDLPFLHQTNDRDGGGNNLYPFLHLSSDGNLFV  240

Query  1006  FANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGAS  1185
             FANRDSIL N R+NRV K FPR+PGEGSR+YPS+GSSVMLPLDH++ FQKVEVM+CGG+S
Sbjct  241   FANRDSILLNLRRNRVIKTFPRIPGEGSRNYPSSGSSVMLPLDHRDNFQKVEVMVCGGSS  300

Query  1186  AGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVK  1365
              GA   A++GRF+EGL+SCGRMVI+GN +KW ME MP PR+++DM+ILPTG ILIING K
Sbjct  301   IGALEAARKGRFLEGLRSCGRMVITGNNNKWEMEYMPKPRLLHDMLILPTGNILIINGAK  360

Query  1366  RGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNP  1545
              GCAG+ N  + +LEPY+YSP K +GKRF++L++TKIARMYHSSA LL DGRVL+AG NP
Sbjct  361   HGCAGYENARNASLEPYLYSPNKKLGKRFTMLKSTKIARMYHSSATLLSDGRVLVAGGNP  420

Query  1546  NDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFW  1725
             +  Y+F NV +PTELRLQAFVP YM+ R+ N RP N+++Y  G   A + YGKEF V F+
Sbjct  421   HGRYIFHNVAYPTELRLQAFVPHYMESRYHNWRPSNMTIYGGGGRHA-IGYGKEFRVEFF  479

Query  1726  LDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaap  1905
             L+K+  + ++ FSAY+PPFTTHS AMNQRMLKLRC S++R   G V AV+ APPSP  AP
Sbjct  480   LEKRMQNNEVGFSAYAPPFTTHSFAMNQRMLKLRCKSLDRKGGGWVVAVLEAPPSPNVAP  539

Query  1906  pGYYMVTVVNEGIPSISRWVKFANA  1980
              GYY++TVVN GIPS+S+WV+FA+A
Sbjct  540   SGYYLLTVVNGGIPSMSQWVQFAHA  564



>gb|AEA52292.1| glyoxal oxidase-related protein [Capsicum annuum]
Length=568

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/575 (61%), Positives = 438/575 (76%), Gaps = 11/575 (2%)
 Frame = +1

Query  259   METHQLRTTLPCAITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMH  438
             ME H  R  + C I    +L    +    +  A  +VS +  G+G W  L+ +TGVV +H
Sbjct  1     MEKHSQRL-INCIIIGAALLLHCRI----SYGAKAVVSHSPEGKGTWNLLLNDTGVVGVH  55

Query  439   MALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIR  618
             MALT  NTV+ FD+ GS RSGYQLR RFNGTRCKG+R+D+SDP+C+AHSVEY + NN++R
Sbjct  56    MALTRWNTVILFDRSGSVRSGYQLRHRFNGTRCKGTRDDMSDPACFAHSVEYSISNNSVR  115

Query  619   PLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD-KTCNWKPGKKHLYDERW  795
              L  +SDT+ SSG+ILSNGTI+Q+GG+ D S RI +  PC     C+W   KKHL ++RW
Sbjct  116   YLNLMSDTFSSSGSILSNGTIVQSGGFGDASTRIHYIGPCTSGDGCDWNLDKKHLAEKRW  175

Query  796   YASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFL  975
             YAS+Q+LP  +DR+I+VGGR + +YEFVP+    + +  L FL +T + N G NNLYP +
Sbjct  176   YASSQLLP-TDDRIIVVGGRGSFSYEFVPKMSTNRNAFHLSFLQKTNDGNEG-NNLYPIV  233

Query  976   HLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQK  1155
             HLS DG LFIFANRDS+LFNY++N+VEKKFPR+PG GSRSYPSTGSSVMLPLD K+ F+ 
Sbjct  234   HLSVDGKLFIFANRDSVLFNYKQNKVEKKFPRIPGLGSRSYPSTGSSVMLPLDQKDGFRV  293

Query  1156  VEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPT  1335
             VEVMICGGA++GA   A+QG+F+  L SCGRMVISGNKH+W MENMPGPR+MNDMV+LPT
Sbjct  294   VEVMICGGAASGANAAARQGKFLTALNSCGRMVISGNKHRWKMENMPGPRLMNDMVLLPT  353

Query  1336  GQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPD  1515
             G +LIING KRGC+GWGN A PALEPY+Y+P K VG+RF+VL++TKIARMY SSA L+PD
Sbjct  354   GHVLIINGAKRGCSGWGNAAGPALEPYLYNPKKIVGRRFTVLKSTKIARMYQSSAILVPD  413

Query  1516  GRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVD  1695
             G VL+AGSNPND Y + NV HPTELRLQAF+PDYM + + +QRP NVS+ ++G    V  
Sbjct  414   GSVLVAGSNPNDQYTYKNVSHPTELRLQAFMPDYMGKEYSHQRPHNVSIDIKGKEGVV--  471

Query  1696  YGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavv  1875
             YG EF VRF ++ + P E L FSAY+PPFTTHS +MNQR+L+LRCT +    NG  NA V
Sbjct  472   YGHEFLVRFLMESQ-PGEYLAFSAYAPPFTTHSQSMNQRLLRLRCTRIISDANGWWNATV  530

Query  1876  aappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
              APPS   AP G+Y+++VVNEGIPSIS WVKF +A
Sbjct  531   EAPPSANVAPSGFYLLSVVNEGIPSISEWVKFIHA  565



>ref|XP_006351423.1| PREDICTED: uncharacterized protein LOC102595893 [Solanum tuberosum]
Length=568

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/568 (62%), Positives = 433/568 (76%), Gaps = 14/568 (2%)
 Frame = +1

Query  277   RTTLPCAI--TALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALT  450
             +T + C I   ALL+  L+S R      A  ++  +A  +G W+ L+ NTGVV + M LT
Sbjct  6     QTRINCIIINAALLLHCLISCR------AKAVLHHSAERKGTWKLLLNNTGVVGVQMVLT  59

Query  451   HRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRF  630
             H NTV+  D+ GSGRSGYQLR R NGTRCKG+R DLSDP+CY HSVEY + NNTIR L  
Sbjct  60    HWNTVILLDRSGSGRSGYQLRHRLNGTRCKGTRGDLSDPTCYVHSVEYSISNNTIRRLNI  119

Query  631   ISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD-KTCNWKPGKKHLYDERWYASN  807
             +SDT+ SSG+ILS+G I+++GG+ D S RI +F PC    +C+W  GKKHL  +RWYAS+
Sbjct  120   MSDTFSSSGSILSDGRIIESGGFGDASTRIHYFGPCKSGDSCDWSLGKKHLSAKRWYASS  179

Query  808   QILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSS  987
             QILP  +DR+I+VGGR + TYEF+P+         L FL QT + N  GNNLYP +HLS 
Sbjct  180   QILP--DDRIIVVGGRGSFTYEFIPKMSTNGNVFHLSFLQQTNDGNEDGNNLYPIVHLSV  237

Query  988   DGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVM  1167
             DG LFIFANRDSILFNY++NRV KKFPR+PG GSRSYPSTGSSV+LPLD K+ F+KVEVM
Sbjct  238   DGKLFIFANRDSILFNYKQNRVVKKFPRIPGIGSRSYPSTGSSVILPLDQKDGFRKVEVM  297

Query  1168  ICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQIL  1347
             ICGGA++GA   A+QG F+ GL SCGRMVI+GN HKW MENMPGPR+MNDMV+LPTG +L
Sbjct  298   ICGGAASGANAAARQGTFLTGLNSCGRMVITGNNHKWKMENMPGPRLMNDMVLLPTGHVL  357

Query  1348  IINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVL  1527
             IING KRGCAGW N A PALEPY+Y+P KT+G+RF+VL++TKIARM+HSSA L+PDG VL
Sbjct  358   IINGAKRGCAGWRNAAGPALEPYLYNPKKTLGRRFTVLKSTKIARMFHSSAILVPDGSVL  417

Query  1528  IAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKE  1707
             +AGSNPN+ Y + N  HPTELRLQAF+PDYM + +++QRP NVS+ + G+    V YG E
Sbjct  418   VAGSNPNNQYTYRNASHPTELRLQAFIPDYMGKEYNHQRPHNVSIDINGTEG--VAYGNE  475

Query  1708  FHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaapp  1887
             F VRF L+ K PS+ L FSAY+PPFTTHS++MNQR+LKLR T +     G  NA V APP
Sbjct  476   FLVRFLLESK-PSKYLSFSAYAPPFTTHSLSMNQRLLKLRSTRIISDAKGWWNATVEAPP  534

Query  1888  spvaappGYYMVTVVNEGIPSISRWVKF  1971
             S   AP G+Y+++VVNEGIPSIS W+KF
Sbjct  535   SANVAPSGFYLLSVVNEGIPSISEWIKF  562



>ref|XP_004236288.1| PREDICTED: uncharacterized protein LOC101250105 [Solanum lycopersicum]
Length=564

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/568 (61%), Positives = 432/568 (76%), Gaps = 18/568 (3%)
 Frame = +1

Query  277   RTTLPCAI--TALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALT  450
             +T + C I   ALL+  L+S R      A  ++  +A  +G W+ L+ NTGVV + M LT
Sbjct  6     QTRINCIIISAALLLHCLISCR------AKTVLHHSAERKGTWKLLLNNTGVVGVQMVLT  59

Query  451   HRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRF  630
             H NTV+  D+ GSGRSGYQLR R NGTRCKGSR+DLSDP+CY HSVEY + NNTIR L  
Sbjct  60    HWNTVILLDRSGSGRSGYQLRHRLNGTRCKGSRDDLSDPTCYVHSVEYSISNNTIRRLNI  119

Query  631   ISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDKTCNWKPGKKHLYDERWYASN  807
             +SDT+ SSG+ILS+G I+++GG+ D S RI +  PC     C+W  GKKHL  +RWYAS+
Sbjct  120   MSDTFSSSGSILSDGRIIESGGFGDASTRIHYIGPCRSGDNCDWSLGKKHLSVKRWYASS  179

Query  808   QILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSS  987
             QILP  +DR+I+VGGR + TYEF+P+         L FL QT +    GNNLYP +HLS 
Sbjct  180   QILP--DDRIIVVGGRGSFTYEFIPKMSTNGNVFHLSFLQQTSD----GNNLYPIVHLSV  233

Query  988   DGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVM  1167
             DG LFIFANRDSILFNY++NRV KKFPR+PG GSRSYPSTGSSV+LPLD K+ F+KVEVM
Sbjct  234   DGKLFIFANRDSILFNYKQNRVVKKFPRIPGIGSRSYPSTGSSVILPLDQKDGFRKVEVM  293

Query  1168  ICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQIL  1347
             ICGGA++GA   AKQG F+ GL SCGRMVI+GN HKW MENMPGPR+MNDMV+LPTG +L
Sbjct  294   ICGGAASGANAAAKQGTFLTGLNSCGRMVITGNNHKWKMENMPGPRLMNDMVLLPTGHVL  353

Query  1348  IINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVL  1527
             IING KRGCAGW N A PALEPY+Y+P KT+G+RF++L++TKIARM+HSSA L+PDG VL
Sbjct  354   IINGAKRGCAGWRNAAGPALEPYLYNPKKTLGRRFTILKSTKIARMFHSSAILVPDGSVL  413

Query  1528  IAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKE  1707
             +AGSNPN+ Y + NV HPTELRLQAF+PDYM + +++QRP NVS+ + G+    V YG E
Sbjct  414   VAGSNPNNQYTYRNVSHPTELRLQAFIPDYMGKEYNHQRPHNVSIDINGTEG--VAYGNE  471

Query  1708  FHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaapp  1887
             F VRF L+ K PS+ L FSAY+PPFTTHS++MNQR+L+LR T +     G  NA V APP
Sbjct  472   FLVRFLLESK-PSKYLAFSAYAPPFTTHSLSMNQRLLRLRSTRIISDAKGWWNATVEAPP  530

Query  1888  spvaappGYYMVTVVNEGIPSISRWVKF  1971
             S   AP G+Y+++VVNEGIPSI+ W+KF
Sbjct  531   SANVAPSGFYLLSVVNEGIPSIAEWIKF  558



>gb|KHN07971.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=867

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/540 (63%), Positives = 429/540 (79%), Gaps = 2/540 (0%)
 Frame = +1

Query  361   VLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK  540
             V V  +   +G+WQ L+ NTGVV MH+ALT+++TV+ FDQ G+G+SGY+LRRRFNG+RC 
Sbjct  330   VNVRSSEGRKGQWQLLLNNTGVVGMHVALTYKDTVIMFDQTGAGQSGYRLRRRFNGSRCT  389

Query  541   GSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
              +  DL D +CYAHSVEYD+  N +RPLR  +D WCSS + LSNGT++QTGG+  G+KR+
Sbjct  390   INHHDLLDSTCYAHSVEYDISANKVRPLRLDTDPWCSSASFLSNGTLLQTGGFEKGAKRV  449

Query  721   QFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
             +F+ PC +  C+W   KK L DERWYAS+QILP  N  V++ G RR  TYEFVP+    +
Sbjct  450   RFYRPCGNHQCDWIQSKKTLSDERWYASSQILPEHNRVVVVGG-RRVFTYEFVPKTSPGE  508

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
             KS DLPFLHQT +R+ GGNNLYPFLHLSSDG LF+FANRDSIL N R+NRV K FPR+PG
Sbjct  509   KSFDLPFLHQTNDRDGGGNNLYPFLHLSSDGNLFVFANRDSILLNLRRNRVIKTFPRIPG  568

Query  1081  EGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
             EGSR+YPS+GSSVMLPLDH++ FQKVEVM+CGG+S GA   A++GRF+EGL+SCGRMVI+
Sbjct  569   EGSRNYPSSGSSVMLPLDHRDNFQKVEVMVCGGSSIGALEAARKGRFLEGLRSCGRMVIT  628

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
             GN +KW ME MP PR+++DM+ILPTG ILIING K GCAG+ N  + +LEPY+YSP K +
Sbjct  629   GNNNKWEMEYMPKPRLLHDMLILPTGNILIINGAKHGCAGYENARNASLEPYLYSPNKKL  688

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             GKRF++L++TKIARMYHSSA LL DGRVL+AG NP+  Y+F NV +PTELRLQAFVP YM
Sbjct  689   GKRFTMLKSTKIARMYHSSATLLSDGRVLVAGGNPHGRYIFHNVAYPTELRLQAFVPHYM  748

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             + R+ N RP N+++Y  G   A + YGKEF V F+L+K+  + ++ FSAY+PPFTTHS A
Sbjct  749   ESRYHNWRPSNMTIYGGGGSHA-IGYGKEFRVEFFLEKRMQNNEVGFSAYAPPFTTHSFA  807

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
             MNQRMLKLRC S++R   G V AV+ APPSP  AP GYY++TVVN GIPS+S+WV+FA+A
Sbjct  808   MNQRMLKLRCKSLDRKGGGWVVAVLEAPPSPNVAPSGYYLLTVVNGGIPSMSQWVQFAHA  867



>ref|XP_004138264.1| PREDICTED: uncharacterized protein LOC101204692 [Cucumis sativus]
 ref|XP_004169872.1| PREDICTED: uncharacterized protein LOC101224281 [Cucumis sativus]
 gb|KGN63522.1| hypothetical protein Csa_1G002910 [Cucumis sativus]
Length=568

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/576 (58%), Positives = 426/576 (74%), Gaps = 10/576 (2%)
 Frame = +1

Query  259   METHQLRTTLPCAITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMH  438
             M  H+  + +   + A +VL L     C  + + V VS A    GRW+ LM NTGV+AMH
Sbjct  1     MANHKHFSAVLNVLKATIVLLL----QCTKIRSVVGVSLATQTAGRWKLLMNNTGVIAMH  56

Query  439   MALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIR  618
             MALTH +TVV FDQ  +G SGY+LRRRF G  C  S  D+ DP+CYAHSVEYD+  N +R
Sbjct  57    MALTHYDTVVIFDQTSAGPSGYRLRRRFGGKICTTSPADMVDPNCYAHSVEYDISKNQVR  116

Query  619   PLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWY  798
              L+  SDTWCSSG+ILSNGT++QTGGY  G++RI+ F PC D  CNW    K L + RWY
Sbjct  117   ALQISSDTWCSSGSILSNGTLLQTGGYGSGARRIRNFRPCKDHHCNWSESNKLLSNARWY  176

Query  799   ASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLH  978
             A+  +LP ++DR+ +VGG+RA  YEFVP+    +KS DLPFLH+T+    GGNNLYPF+H
Sbjct  177   ATTIVLP-EHDRLFVVGGKRAFNYEFVPKM-GKEKSYDLPFLHRTFNSREGGNNLYPFVH  234

Query  979   LSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKV  1158
             LSSDG LFIFANRDSILFNYR+N+V K FPR+PG G R+YP+TGSSVMLPLDH+N+FQ V
Sbjct  235   LSSDGNLFIFANRDSILFNYRRNKVVKTFPRIPGGGGRNYPATGSSVMLPLDHRNKFQVV  294

Query  1159  EVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTG  1338
             EVM+CGG++ GAY  A++G+F++GL+SCGRMVI+GN+HKWNMENMP PR+++DM+ILPTG
Sbjct  295   EVMVCGGSATGAYRAARRGQFMKGLRSCGRMVITGNRHKWNMENMPEPRLLHDMLILPTG  354

Query  1339  QILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDG  1518
              ILIING K GCAGWGN  + +L PY+Y P   + +RFS+LR+TKIARMYHSSA +L DG
Sbjct  355   NILIINGAKTGCAGWGNARNASLRPYLYKPKNQLNRRFSILRSTKIARMYHSSAIVLTDG  414

Query  1519  RVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSV-YVEGSPAAVVD  1695
             R+LIAG N N  Y + NVP+PTELRLQA+ P Y + + +NQRP+NV++ Y  G     + 
Sbjct  415   RILIAGGNTNKNYTYINVPYPTELRLQAYHPHYTESKHNNQRPRNVTIHYARGDYG--IK  472

Query  1696  YGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNG-MVNav  1872
             YG EF VRF L ++   + +EF+ YSPPF THS +MNQR++KLR   M R  NG  ++A+
Sbjct  473   YGGEFRVRFKLGRRRKEDAIEFNIYSPPFATHSFSMNQRLVKLRRKIMAREGNGEWMSAI  532

Query  1873  vaappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
             V  PPS   AP GYY+ TVV  GIPS+SRW++  ++
Sbjct  533   VEGPPSANVAPAGYYLFTVVYGGIPSVSRWIRIIHS  568



>ref|XP_008464498.1| PREDICTED: uncharacterized protein LOC103502362 [Cucumis melo]
Length=575

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/576 (57%), Positives = 428/576 (74%), Gaps = 10/576 (2%)
 Frame = +1

Query  259   METHQLRTTLPCAITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMH  438
             M  H+  + +   + A +VL L     C  + + V VS A    GRW  L+ NTGV+AMH
Sbjct  8     MANHKHFSAVLNVLKATVVLLL----QCTKIRSVVGVSLATQTAGRWNLLLNNTGVIAMH  63

Query  439   MALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIR  618
             MALTH +TVV FDQ  +G SGY+LRRRF G  C  S  D+ DP+CYAHSVEYD+  N +R
Sbjct  64    MALTHYDTVVIFDQTSAGPSGYRLRRRFGGKLCTTSDADMIDPTCYAHSVEYDISKNQVR  123

Query  619   PLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWY  798
              LR  SDTWCSSG+ LSNGT++QTGGY  GS+RI+ F PC D  CNW    K L + RWY
Sbjct  124   ALRISSDTWCSSGSFLSNGTLLQTGGYGSGSRRIRNFRPCKDHHCNWSESNKLLSNARWY  183

Query  799   ASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLH  978
             A+  +LP ++DR+ +VGG+R   YEFVP+    +K  DLPFLH+T+    GGNNLYPF+H
Sbjct  184   ATTIVLP-EHDRLFVVGGKRTFNYEFVPKM-GKEKWYDLPFLHRTFNNREGGNNLYPFVH  241

Query  979   LSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKV  1158
             LS+DG LFIFANRDSILFNYR+N+V K FPR+PG G+R+YP+TGSSVMLPLDH+N+FQ V
Sbjct  242   LSTDGNLFIFANRDSILFNYRRNKVVKTFPRIPGGGARNYPATGSSVMLPLDHRNKFQLV  301

Query  1159  EVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTG  1338
             EVM+CGG+  GAY  A++G+F++GL+SCGRMVI+GN+HKWNMENMP PR+++DM+ILPTG
Sbjct  302   EVMVCGGSVTGAYRAARRGQFMKGLRSCGRMVITGNRHKWNMENMPEPRLLHDMLILPTG  361

Query  1339  QILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDG  1518
              ILIING K GCAGWGN  + +L PY+Y P   + +RFS+LR+TKIARMYHSSA +L DG
Sbjct  362   NILIINGAKTGCAGWGNARNASLRPYLYKPKNQLNRRFSILRSTKIARMYHSSAIVLTDG  421

Query  1519  RVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSV-YVEGSPAAVVD  1695
             R+LIAG N +  Y ++NVP+PTELRLQA+ P Y++ +++ QRPKNV++ Y  G     + 
Sbjct  422   RILIAGGNTHKNYTYSNVPYPTELRLQAYHPHYIESKYNYQRPKNVTIHYARGDYG--IK  479

Query  1696  YGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNG-MVNav  1872
             YG EF V+F L ++   + +EF+ Y+PPF THS +MNQR++KLR   M+R  NG  ++AV
Sbjct  480   YGGEFTVQFKLGRRRKEDAIEFNVYAPPFATHSFSMNQRLVKLRRKRMKRDGNGEWMSAV  539

Query  1873  vaappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
             V APPS   AP GYY++TVV+ GIPS+SRW++  ++
Sbjct  540   VEAPPSANVAPAGYYLLTVVHGGIPSVSRWIRIIHS  575



>gb|KEH35019.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=511

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/518 (63%), Positives = 408/518 (79%), Gaps = 9/518 (2%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFN-GTRCKGSREDLSDPSCYAHSVEYDVLNN  609
             MHMALT++NTV+ FDQ G+G+S Y+LR+RFN GTRC  ++ DL+D +CYAHSVEYD+  N
Sbjct  1     MHMALTYKNTVIMFDQTGAGQSRYKLRKRFNNGTRCTTNQHDLTDSTCYAHSVEYDISAN  60

Query  610   TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDKTCNWKPGKKHLYD  786
              IRPLR  +D WCSSG+ LSNGT++QTGGY  G+KR++F+ PC  +  C+W   +K L D
Sbjct  61    RIRPLRLDTDPWCSSGSFLSNGTLLQTGGYHQGAKRVRFYRPCGNNHQCDWIQSRKSLSD  120

Query  787   ERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLY  966
             ERWYAS+QILP ++DRV++VGGR   TYEFVP+    +K+ DLPFLHQT +RN+ GNNLY
Sbjct  121   ERWYASSQILP-EHDRVVLVGGRGVFTYEFVPKHSPNEKAFDLPFLHQTNDRNSEGNNLY  179

Query  967   PFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNR  1146
             PF HLSSDG LFIFANRDSIL N R+N+V K FPR+PG GSR+YPS+GSSV+LPLDHK++
Sbjct  180   PFTHLSSDGNLFIFANRDSILLNLRRNKVIKTFPRIPGNGSRNYPSSGSSVLLPLDHKDK  239

Query  1147  FQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVI  1326
             FQKVEVM+CGG++ GA   A+  RF+EGL+SCGRMVI+GNKH W M+ MP PR ++DM+I
Sbjct  240   FQKVEVMVCGGSATGALRAARSQRFVEGLRSCGRMVITGNKHSWEMDYMPKPRFLHDMLI  299

Query  1327  LPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAAL  1506
             LPTG ILIING K GCAG+ N  + + EPY+YSP K +GKRFSVL+ T IARMYHSSA L
Sbjct  300   LPTGNILIINGAKHGCAGYDNARNASREPYLYSPNKRLGKRFSVLKRTMIARMYHSSATL  359

Query  1507  LPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAA  1686
             LPDGRVL+AG NP+  Y F NV +PTELRLQAFVP YM++R+   RP N+++        
Sbjct  360   LPDGRVLVAGGNPHGRYTFNNVAYPTELRLQAFVPHYMEKRYHAWRPSNLTI-----ENH  414

Query  1687  VVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVN  1866
              + YGKEF VRF L ++ PS++++FS YSPPFTTHS +MNQRML LRC  M R   G VN
Sbjct  415   AIGYGKEFRVRFLLGRR-PSDEVKFSVYSPPFTTHSFSMNQRMLNLRCKRMVRSSEGWVN  473

Query  1867  avvaappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
             AV+ APPS V AP GYY+ TVVN GIPS+S+W++FA+A
Sbjct  474   AVLEAPPSSVVAPSGYYLFTVVNGGIPSMSQWIQFAHA  511



>ref|XP_004299160.1| PREDICTED: uncharacterized protein LOC101293298 [Fragaria vesca 
subsp. vesca]
Length=569

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/553 (59%), Positives = 423/553 (76%), Gaps = 3/553 (1%)
 Frame = +1

Query  316   LFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGR  495
             +++ SL P + ++  V  S    G+G+WQ L+ENT VVAMHMALTH NTV+ FDQ  +G 
Sbjct  11    IYMTSLFPHHLISPEVKGSSNGDGKGQWQLLLENTEVVAMHMALTHHNTVLIFDQTEAGP  70

Query  496   SGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNG  675
             SG++LRRR+NGTRC   R D+ D SCYAHSVEY++ +N +RPL+  SDTWCSSG+ LSNG
Sbjct  71    SGHRLRRRYNGTRCTSMRRDVEDSSCYAHSVEYNISSNKLRPLKLSSDTWCSSGSFLSNG  130

Query  676   TIMQTGGYRDGSKRIQFFAPCV-DKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGG  852
             T++QTGG+  G++ ++ F+PC  +  C+W+  K  L ++RWYAS+ +LP + DRVI+VGG
Sbjct  131   TLLQTGGHGSGAQGVRSFSPCGGNVNCDWRESKLSLTNDRWYASSLLLPDE-DRVIVVGG  189

Query  853   RRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILF  1032
             RR  TYEF+P+    + S D PFL  TY+R  GGNNLYPFLHL  +G LFIFANRDSILF
Sbjct  190   RRVFTYEFIPKLYTNEGSFDFPFLRNTYQRREGGNNLYPFLHLCPNGRLFIFANRDSILF  249

Query  1033  NYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQ  1212
             NYR+NRV K +PR+PG+GSR+YPS+GSS +LPLD+ N F K EVM+CGGA+ GAY  A++
Sbjct  250   NYRENRVVKHYPRIPGDGSRNYPSSGSSAILPLDYTNNFTKAEVMVCGGAAFGAYRAARE  309

Query  1213  GRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNG  1392
             GR+++GL SCGRMVI+GNKHKWNME MPGPR++ DM++LPTG +LIING K G AGW   
Sbjct  310   GRYLKGLSSCGRMVITGNKHKWNMEFMPGPRLLCDMLLLPTGDVLIINGAKNGAAGWNYA  369

Query  1393  ASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNV  1572
              + + EPY+Y P KT+G+RFSVL++T+I R+YHSSA LLPDGRVL+AGSNP++ Y+F NV
Sbjct  370   RNASHEPYLYRPKKTLGRRFSVLKSTRIPRVYHSSAILLPDGRVLVAGSNPHNRYIFENV  429

Query  1573  PHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSED  1752
               PTELRLQAFVPDYMD      RP NV++    +    V YG+EF+V FWL  + PS  
Sbjct  430   DFPTELRLQAFVPDYMDSPHHRFRPTNVTIRYGHNDRYGVRYGREFNVSFWLGTE-PSNA  488

Query  1753  LEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVV  1932
             +EF+AY+PPF +HS++MNQR+LKLR  S+ R  +G V AV+ APPS   AP GYYM+TVV
Sbjct  489   VEFTAYAPPFASHSISMNQRLLKLRSKSLVRDVHGWVAAVLEAPPSSSVAPAGYYMLTVV  548

Query  1933  NEGIPSISRWVKF  1971
             N GIPS+S+W++ 
Sbjct  549   NGGIPSLSQWMRI  561



>ref|XP_010026976.1| PREDICTED: uncharacterized protein LOC104417381 [Eucalyptus grandis]
Length=556

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/533 (63%), Positives = 421/533 (79%), Gaps = 9/533 (2%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRF-NGTRCKGSREDLSD  564
             +GRWQ L+ NTGVVAMHMA+TH NTV+ FDQ G+G S Y+LRR F +G RC    +D SD
Sbjct  31    KGRWQLLLNNTGVVAMHMAVTHLNTVIMFDQTGAGPSSYRLRRSFTSGRRCA---DDSSD  87

Query  565   PSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD  744
              SCYAHS+EYD+ +N IR +R  +D WCSSG+ LS+GT++QTGGY +GS+RI++F PC D
Sbjct  88    ESCYAHSIEYDISSNYIRAMRLETDPWCSSGSFLSDGTLLQTGGYGNGSRRIRYFRPCQD  147

Query  745   KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFL  924
               C+W   K  +   RWYASNQ LP +NDRV++VGGRR  +YEFVP+   + +S DLPFL
Sbjct  148   GRCDWVQSKTAMSSRRWYASNQKLP-ENDRVLVVGGRRVFSYEFVPKLSLLDESHDLPFL  206

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              QTY+ N G NNLYPFLHLSSDG LFIFANRDSILF+YR+++V K FPRMPG+GSRSYPS
Sbjct  207   RQTYDGNGGENNLYPFLHLSSDGNLFIFANRDSILFDYRRHKVVKTFPRMPGKGSRSYPS  266

Query  1105  TGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             +GSSV+LPL+H ++F+KVEVM+CGGA+ GA+  A +G+F++GLKSCGRM I+GNKHKW M
Sbjct  267   SGSSVILPLEHGHQFRKVEVMVCGGAAPGAHRAAGRGKFLKGLKSCGRMEITGNKHKWKM  326

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             ENMPG R+MNDM+ILPTG ILIING +RG AGW N A P+L PY+Y P KT+G+RFS L 
Sbjct  327   ENMPGRRLMNDMIILPTGHILIINGARRGSAGWNNAADPSLVPYLYKPEKTLGRRFSTLA  386

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
             +T+IAR+YHSSA+LLPDGR+L+AG NPN  Y+F NV +PTELRLQAF+P YMDRR+   R
Sbjct  387   STEIARLYHSSASLLPDGRILVAGGNPNQQYMFENVTYPTELRLQAFIPHYMDRRYHKYR  446

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKL  1824
             P+NV++   G  +  V YG++F VRFWL ++ PS+ +EFS Y+PPFTTHS++MNQR+LKL
Sbjct  447   PENVTIETRGDLS--VKYGEDFTVRFWLGRR-PSKVVEFSVYAPPFTTHSLSMNQRLLKL  503

Query  1825  RCTSMER-GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
                +M R    G VN  V APPSP  AP GYYM+TVVN GIPS S+W++F  A
Sbjct  504   SSKNMVRDATKGWVNVTVEAPPSPNVAPSGYYMLTVVNGGIPSTSQWIRFIRA  556



>ref|XP_004301024.1| PREDICTED: uncharacterized protein LOC101292420 [Fragaria vesca 
subsp. vesca]
Length=578

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/564 (57%), Positives = 428/564 (76%), Gaps = 6/564 (1%)
 Frame = +1

Query  298   ITALLVLFLVSLRPCNALNASVLVSE--AASGQGRWQTLMENTGVVAMHMALTHRNTVVF  471
             + +++     +L      NA   V E   A G+G+WQ L++NT VVAMHMALTHRNTV+ 
Sbjct  11    LNSMIAALFFTLHCIGCTNAKHAVEEPSIADGKGQWQLLLDNTEVVAMHMALTHRNTVLI  70

Query  472   FDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCS  651
             FDQ  +G SG+QLRRR++GTRC   R+D+ D +CYAHSVEYD+ +N +RPL   +DTWCS
Sbjct  71    FDQTEAGPSGHQLRRRYHGTRCTQMRKDVEDSACYAHSVEYDIASNKLRPLTLTTDTWCS  130

Query  652   SGTILSNGTIMQTGGYRDGSKRIQFFAPCV-DKTCNWKPGKKHLYDERWYASNQILPGKN  828
             SG+ LSNGT++QTGG+  G +R+++F+PC  +  C+W+  K+ L ++RW++S+  LP + 
Sbjct  131   SGSFLSNGTLLQTGGHGRGGQRVRYFSPCGGNDHCDWRESKQSLTNDRWFSSSLRLP-EE  189

Query  829   DRVIIVGGRRASTYEFVPR-FPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFI  1005
             D VI+VGGR+  TYEF+P+ + N + S D PFL  TY+   GGNNLYPFLH+  +G LFI
Sbjct  190   DWVIVVGGRKVFTYEFIPKQYSNYEGSFDFPFLRNTYQEGEGGNNLYPFLHICPNGRLFI  249

Query  1006  FANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGAS  1185
             FANRDSILFNYR N V K FPR+PGEGSR++PS+GSSV+LPLD+ N F+K EVM+CGGA+
Sbjct  250   FANRDSILFNYRANVVVKYFPRIPGEGSRNFPSSGSSVILPLDYTNGFEKAEVMVCGGAA  309

Query  1186  AGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVK  1365
              GAY  A++GR+++ L SCGRM+I+GNKHKWNME MPGPR+++DM++LPTG +LIING K
Sbjct  310   NGAYRAAREGRYLKALSSCGRMMITGNKHKWNMEYMPGPRLLSDMLLLPTGDVLIINGAK  369

Query  1366  RGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNP  1545
              G AGW N  + +LEPY+Y P K + +RFSVL+AT+I RMYHSSAALLPDGRVL+AGSNP
Sbjct  370   NGAAGWNNARNASLEPYLYHPRKALSRRFSVLKATRIPRMYHSSAALLPDGRVLVAGSNP  429

Query  1546  NDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFW  1725
             +D Y+F  V +PTEL LQAFVP YM  +    RP NV+V+     +  V YG EF+VRFW
Sbjct  430   HDRYIFEKVAYPTELSLQAFVPPYMVGQHHQSRPTNVTVHYGKYDSNGVRYGGEFNVRFW  489

Query  1726  LDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaap  1905
             L     ++ +EF+AY+PPFT+HS++MNQR+L+LRC S+ R  +G V AV+ APPSP  AP
Sbjct  490   LGTN-STKSVEFTAYAPPFTSHSISMNQRLLRLRCKSLVRDQDGWVAAVLEAPPSPSVAP  548

Query  1906  pGYYMVTVVNEGIPSISRWVKFAN  1977
              GYYM+TVVN GIPS+S+W++  N
Sbjct  549   AGYYMLTVVNGGIPSVSQWMRILN  572



>ref|XP_010102932.1| hypothetical protein L484_018951 [Morus notabilis]
 gb|EXB94450.1| hypothetical protein L484_018951 [Morus notabilis]
Length=583

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/574 (58%), Positives = 426/574 (74%), Gaps = 12/574 (2%)
 Frame = +1

Query  280   TTLPCAITALLVLF-LVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHR  456
             ++L   ++ + V+F L      N + +S         QGRW+ L++N GVVAMHMALTHR
Sbjct  7     SSLIIKLSIIFVIFSLHFFGHVNGVQSSSGADHHDHRQGRWELLLDNVGVVAMHMALTHR  66

Query  457   NTVVFFDQRGSGRSGYQLRRRF-NGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFI  633
             NTVV FDQ  +G S Y+LRRRF +G +C  S +D SD  CYAHSVEYD+ +N IRP+R  
Sbjct  67    NTVVIFDQTRAGPSRYRLRRRFGSGLQCASSGDDASDSGCYAHSVEYDISSNQIRPMRLD  126

Query  634   SDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQI  813
             SD WCSSG+ LSNGT++QTGG   GS+RI++FAPC D +C+W+   + L +ERWYAS+  
Sbjct  127   SDPWCSSGSFLSNGTLLQTGGNGGGSRRIRYFAPCGDHSCDWRQSSRRLSEERWYASSVA  186

Query  814   LPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDG  993
             LP K DRV++VGGRR  +YEFVP+  + + +  LP L  TYER + GNNLYPF+HLSSDG
Sbjct  187   LPEK-DRVMVVGGRRVFSYEFVPKTNSEENAFHLPLLRSTYERRSQGNNLYPFVHLSSDG  245

Query  994   YLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMIC  1173
              LFIFAN+DSILFN+R+NRV + FPR+PG GSR+YPSTGSSV+LPLDH N FQ+VEVMIC
Sbjct  246   NLFIFANQDSILFNHRRNRVVRTFPRIPGGGSRNYPSTGSSVILPLDHHNNFQRVEVMIC  305

Query  1174  GGASAGAYTEAKQG-RFIEGLKSCGRMVISGNKH-----KWNMENMPGPRVMNDMVILPT  1335
             GGA++GAY  A+Q  R++E L SCGRMVI+ N       +W+ME+MP PR+MNDM+ILPT
Sbjct  306   GGAASGAYRSARQSHRYLEALSSCGRMVIADNSSERSEPRWHMEDMPDPRLMNDMIILPT  365

Query  1336  GQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPD  1515
             G +LIING KRG AGW    + +  P++Y P +  G+RFS+LRAT IARMYHSSA LLPD
Sbjct  366   GDVLIINGAKRGAAGWERATNASRRPFLYKPNEARGRRFSLLRATSIARMYHSSAVLLPD  425

Query  1516  GRVLIAGSNPNDGY-VFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSV-YVEGSPAAV  1689
             GRVL+ GSNP++ Y    NV +PTELRLQAFVP YM  ++   RP N+++ Y   S  + 
Sbjct  426   GRVLVGGSNPHNRYRSGRNVAYPTELRLQAFVPHYMHEQYHGYRPTNITIHYAPESHGSG  485

Query  1690  VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNa  1869
               YG+EF V+FWL ++ PS+DLEF+AY PPFTTHS++MNQR+L+LR  S+ER   G V+ 
Sbjct  486   ARYGEEFRVQFWLGRR-PSDDLEFTAYPPPFTTHSMSMNQRLLRLRPRSVERRQGGWVSV  544

Query  1870  vvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             V+ APPSP  AP GYY++TVVN GIPS S+W++F
Sbjct  545   VLEAPPSPNVAPSGYYLLTVVNGGIPSQSQWLRF  578



>ref|XP_007209962.1| hypothetical protein PRUPE_ppa004880mg [Prunus persica]
 gb|EMJ11161.1| hypothetical protein PRUPE_ppa004880mg [Prunus persica]
Length=487

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/466 (64%), Positives = 377/466 (81%), Gaps = 2/466 (0%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNT  612
             MHMALTH NTVV FDQ  +G S Y+LRRR NG RC  S +DL+D SCYAHSVEYD+ +N 
Sbjct  1     MHMALTHDNTVVIFDQTEAGPSVYRLRRRHNGNRCTESHDDLADSSCYAHSVEYDISSNK  60

Query  613   IRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDER  792
             +RPLR  +DTWCSSG+ LSNGT++QTGGY  G++RI++F PC D  C+W+  ++ L D+R
Sbjct  61    VRPLRLYTDTWCSSGSFLSNGTLLQTGGYGSGTRRIRYFKPCGDGQCDWRQSERSLADDR  120

Query  793   WYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPF  972
             WYASNQ+LP ++DR+I+VGGRR  TYEFVP+  + + S DL FLHQTY+R+ GGNNLYPF
Sbjct  121   WYASNQLLP-EHDRIIVVGGRRTFTYEFVPKMSSNEGSHDLSFLHQTYDRSEGGNNLYPF  179

Query  973   LHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ  1152
             LHLSSDG LFIFANRDSILFNYR N V K FPR+PG+GSR+YP +GSSV+LPLDH N F+
Sbjct  180   LHLSSDGNLFIFANRDSILFNYRSNIVIKTFPRIPGDGSRNYPGSGSSVILPLDHTNNFE  239

Query  1153  KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILP  1332
             ++EVM+CGGA++GA+  A Q RF++GL SCGRMVI+GN+HKWNMENMPG R+++DM+ILP
Sbjct  240   RMEVMVCGGAASGAHRAAGQNRFLKGLSSCGRMVITGNRHKWNMENMPGSRLLSDMLILP  299

Query  1333  TGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLP  1512
             TG +LIING KRG  GW N  + +L+PY+Y+P   +GKRFSVL++TKIARMYHSSA LLP
Sbjct  300   TGNVLIINGAKRGSGGWNNARNASLQPYLYNPNHKLGKRFSVLKSTKIARMYHSSAILLP  359

Query  1513  DGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVV  1692
             DGRVL+ G NP++ Y F+NV +PTELRLQAF P YM R++   RP N+++       + V
Sbjct  360   DGRVLVGGGNPHECYTFSNVAYPTELRLQAFAPHYMGRQYHTYRPINLTINYGHGDLSGV  419

Query  1693  DYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRC  1830
              YG +F+V FWL +K PS+ +EF+AY+PPFTTHS++MNQR+LKLRC
Sbjct  420   RYGVDFNVSFWLGRK-PSKVVEFNAYAPPFTTHSISMNQRLLKLRC  464



>ref|XP_010251352.1| PREDICTED: uncharacterized protein LOC104593293 [Nelumbo nucifera]
Length=577

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/554 (61%), Positives = 421/554 (76%), Gaps = 20/554 (4%)
 Frame = +1

Query  361   VLVSEAASG------QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRR-R  519
             +LV  AA G      +GRWQTL+ NTGVVAMH ALTHRNTV+ FDQ  +GRSGY LRR  
Sbjct  23    LLVRSAAGGPPPGAKRGRWQTLLNNTGVVAMHTALTHRNTVMIFDQTRAGRSGYPLRRSH  82

Query  520   FNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGG  696
             ++G+RC  S  + S D SC+AHSVEYD+  NTIR L   +DTWCSSGT LSNGT++QTGG
Sbjct  83    YDGSRCVPSSWNPSVDSSCWAHSVEYDIEGNTIRALNLETDTWCSSGTFLSNGTLLQTGG  142

Query  697   YRDGSKRIQFFAPCVDKTCNWK-PGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYE  873
             +  G +RI++F PC D  C+W+ P    L D RWYASNQILP K DRVIIVGGRR  TYE
Sbjct  143   HGHGYRRIRYFDPCTDHRCDWRSPEALLLADNRWYASNQILPEK-DRVIIVGGRRVFTYE  201

Query  874   FVPRFPNMQKSTD-----LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNY  1038
             F+P+  +   S+      L  L QT  R   GNNLYPFLHLSSDG LFIFANRDSIL +Y
Sbjct  202   FLPKLLSSSSSSRERSFYLSLLRQTNNRKEEGNNLYPFLHLSSDGNLFIFANRDSILLDY  261

Query  1039  RKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGR  1218
              +N+V K FPRMPG GSR+YPS+GSSV++PLDH + FQKVEVM+CGGA+ GAYT AK+  
Sbjct  262   WRNKVVKTFPRMPGGGSRNYPSSGSSVLIPLDHTDGFQKVEVMVCGGATTGAYTAAKRKT  321

Query  1219  FIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGAS  1398
             +++GL SCGR+VI+  K +W ME MPGPR+++D++ILPTG ILIING   GCAGW N A+
Sbjct  322   YLKGLSSCGRIVITEQKPRWEMEEMPGPRLLHDILILPTGNILIINGATHGCAGWNNAAN  381

Query  1399  PALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPH  1578
             P+LEPY+Y P K++G+RFSVL++TK+AR+YHSSA LLPDGRVL+AGSNP+  Y F +V  
Sbjct  382   PSLEPYLYKPNKSLGRRFSVLKSTKVARLYHSSAILLPDGRVLVAGSNPHARYTFKDVKF  441

Query  1579  PTELRLQAFVPDYMDRRFDNQRPKNVSV-YVEGSPAAVVDYGKEFHVRFWLD-KKWPSED  1752
             PTELRLQAF+P YMD+ FD +RP N+S+ Y  G   A   Y +EF ++F LD ++ P +D
Sbjct  442   PTELRLQAFIPYYMDQYFDGRRPNNLSIHYSNGGYGA--RYREEFTIKFRLDLQREPDKD  499

Query  1753  -LEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTV  1929
              ++FSAYSPPFTTH V+MNQRML+L+C S+ R D G + AVV APPSP  AP GYY++TV
Sbjct  500   SIKFSAYSPPFTTHGVSMNQRMLRLKCKSIVREDGGWMRAVVEAPPSPNVAPSGYYLLTV  559

Query  1930  VNEGIPSISRWVKF  1971
             +N GIPSI++WV+F
Sbjct  560   INGGIPSIAQWVRF  573



>gb|KCW83241.1| hypothetical protein EUGRSUZ_B00180 [Eucalyptus grandis]
Length=511

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/518 (63%), Positives = 408/518 (79%), Gaps = 9/518 (2%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRF-NGTRCKGSREDLSDPSCYAHSVEYDVLNN  609
             MHMA+TH NTV+ FDQ G+G S Y+LRR F +G RC    +D SD SCYAHS+EYD+ +N
Sbjct  1     MHMAVTHLNTVIMFDQTGAGPSSYRLRRSFTSGRRCA---DDSSDESCYAHSIEYDISSN  57

Query  610   TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDE  789
              IR +R  +D WCSSG+ LS+GT++QTGGY +GS+RI++F PC D  C+W   K  +   
Sbjct  58    YIRAMRLETDPWCSSGSFLSDGTLLQTGGYGNGSRRIRYFRPCQDGRCDWVQSKTAMSSR  117

Query  790   RWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYP  969
             RWYASNQ LP +NDRV++VGGRR  +YEFVP+   + +S DLPFL QTY+ N G NNLYP
Sbjct  118   RWYASNQKLP-ENDRVLVVGGRRVFSYEFVPKLSLLDESHDLPFLRQTYDGNGGENNLYP  176

Query  970   FLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRF  1149
             FLHLSSDG LFIFANRDSILF+YR+++V K FPRMPG+GSRSYPS+GSSV+LPL+H ++F
Sbjct  177   FLHLSSDGNLFIFANRDSILFDYRRHKVVKTFPRMPGKGSRSYPSSGSSVILPLEHGHQF  236

Query  1150  QKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVIL  1329
             +KVEVM+CGGA+ GA+  A +G+F++GLKSCGRM I+GNKHKW MENMPG R+MNDM+IL
Sbjct  237   RKVEVMVCGGAAPGAHRAAGRGKFLKGLKSCGRMEITGNKHKWKMENMPGRRLMNDMIIL  296

Query  1330  PTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALL  1509
             PTG ILIING +RG AGW N A P+L PY+Y P KT+G+RFS L +T+IAR+YHSSA+LL
Sbjct  297   PTGHILIINGARRGSAGWNNAADPSLVPYLYKPEKTLGRRFSTLASTEIARLYHSSASLL  356

Query  1510  PDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAV  1689
             PDGR+L+AG NPN  Y+F NV +PTELRLQAF+P YMDRR+   RP+NV++   G  +  
Sbjct  357   PDGRILVAGGNPNQQYMFENVTYPTELRLQAFIPHYMDRRYHKYRPENVTIETRGDLS--  414

Query  1690  VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMER-GDNGMVN  1866
             V YG++F VRFWL ++ PS+ +EFS Y+PPFTTHS++MNQR+LKL   +M R    G VN
Sbjct  415   VKYGEDFTVRFWLGRR-PSKVVEFSVYAPPFTTHSLSMNQRLLKLSSKNMVRDATKGWVN  473

Query  1867  avvaappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
               V APPSP  AP GYYM+TVVN GIPS S+W++F  A
Sbjct  474   VTVEAPPSPNVAPSGYYMLTVVNGGIPSTSQWIRFIRA  511



>ref|XP_010904553.1| PREDICTED: galactose oxidase-like [Elaeis guineensis]
Length=539

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/529 (57%), Positives = 398/529 (75%), Gaps = 12/529 (2%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+W+ L+ N+GVVAMHM LTHRNTV+ FDQ  +G S Y+LR   +G RC    +D+ DP+
Sbjct  19    GKWELLLNNSGVVAMHMTLTHRNTVLMFDQTSAGPSQYRLRP--SGKRCT---DDVYDPT  73

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C+AHSVEYD+  NTIRPL   +DTWCSSG  L NGT+ QTGG+ +G++++++F PC D+ 
Sbjct  74    CWAHSVEYDIATNTIRPLVIDTDTWCSSGAFLGNGTLAQTGGFGNGTRKVRYFNPCSDRR  133

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W   +K L   RWYA+NQILP K DRV IVGG  A  YEF+P+    + + +LPFL Q
Sbjct  134   CDWIESEKLLASNRWYATNQILPEK-DRVFIVGGLNAFDYEFLPKSSEKEGAFELPFLRQ  192

Query  931   TYERNAG-GNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             TY+R    GNNLYPF+HLSSDG LFIFANRDSILF++  +++ K FPR+PG+G+R+YPST
Sbjct  193   TYDRMVDKGNNLYPFVHLSSDGNLFIFANRDSILFDHHHHQIIKTFPRIPGDGARNYPST  252

Query  1108  GSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNME  1287
             GSSVMLPL+H++ F+KVE+M+CGG+ +GA   AK+G+F++ L+SCGR+VI+    +W ME
Sbjct  253   GSSVMLPLEHEDVFRKVEIMVCGGSVSGAPRAAKRGQFLDALRSCGRLVITDENPEWAME  312

Query  1288  NMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRA  1467
              MPGPRVMNDM+ILPTG ILIING  +GCAGW      +  P++Y P ++VGKRFSVL +
Sbjct  313   EMPGPRVMNDMLILPTGHILIINGATQGCAGWQMATRASYHPHLYEPKESVGKRFSVLNS  372

Query  1468  TKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRP  1647
             T IARMYHSSA +LPDGR+L+AGSNP   Y F  V +PTELR++AF P YM R FD +R 
Sbjct  373   TGIARMYHSSAIVLPDGRILVAGSNPYRRYTF-GVAYPTELRVEAFTPYYMGRFFDYKRA  431

Query  1648  KNVSV-YVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKL  1824
             +N+S+ Y  GS    + YG+EF V F L++K P++ ++F AYSPPF THS++MNQRMLKL
Sbjct  432   RNLSIQYDRGSDG--IRYGEEFGVWFELERK-PADVVKFYAYSPPFATHSLSMNQRMLKL  488

Query  1825  RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              C SM R   G  +A++ APPS + AP GYY++TVVN GIPS S WV+F
Sbjct  489   ECRSMVRDVGGRTHAILKAPPSSIVAPSGYYLLTVVNGGIPSKSEWVRF  537



>ref|XP_008793761.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=567

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/527 (58%), Positives = 393/527 (75%), Gaps = 11/527 (2%)
 Frame = +1

Query  397   WQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCY  576
             W+ L+ N+GVVAMHM LTHRNTV+ FDQ  +G S Y+LR   +G RC    +   +PSC+
Sbjct  47    WELLLNNSGVVAMHMTLTHRNTVIMFDQTSAGPSQYRLRP--SGKRCD---DRGYEPSCW  101

Query  577   AHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCN  756
             AHSVEYD+  NTIRPL   +DTWCSSG  L NGT+ QTGG+ +GS+++++F PC D+ C 
Sbjct  102   AHSVEYDIATNTIRPLVIETDTWCSSGAFLGNGTLAQTGGFGNGSRKVRYFNPCSDRRCE  161

Query  757   WKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST-DLPFLHQT  933
             W   +K L   RWYA+N ILP + DRV+IVGG  A +YEF+PR    ++   +LPFL +T
Sbjct  162   WIESEKLLAANRWYATNHILP-EEDRVVIVGGLDAFSYEFLPRSSEKEEGAFELPFLRRT  220

Query  934   YERNAG-GNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
              +R    GNNLYPF+H+SSDG LFIFANRDSILF+Y +++V K FPR+PG+G+R+YPSTG
Sbjct  221   RDRMVDKGNNLYPFVHVSSDGNLFIFANRDSILFDYHRHQVVKNFPRIPGDGARNYPSTG  280

Query  1111  SSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMEN  1290
             SSVMLPL+H++ F+KVEVM+CGGA A A   AK G+F++ L SCGR+VI+    +W ME 
Sbjct  281   SSVMLPLEHEDGFRKVEVMVCGGAVARAPRAAKGGQFLDALSSCGRLVITDENPEWAMEE  340

Query  1291  MPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRAT  1470
             MPGPRVMNDM+ILPTG ILIING K+GCAGW    + +  PY+Y P +++G RFSVL +T
Sbjct  341   MPGPRVMNDMLILPTGHILIINGAKQGCAGWQMATTASYNPYLYEPKESLGNRFSVLNST  400

Query  1471  KIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPK  1650
              IARMYHSSA +LPDGR+L+AGSNP   Y F  V +PTELR++AF P YM R FD++RP 
Sbjct  401   GIARMYHSSAIVLPDGRILVAGSNPYRLYTF-GVAYPTELRVEAFTPYYMGRFFDDKRPW  459

Query  1651  NVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRC  1830
             N+S+  +     +  YG+EF V F L++K P++ +EF AY+PPF THS++MNQRMLKL C
Sbjct  460   NLSIQCDHGSDGIT-YGEEFGVWFELERK-PADVVEFYAYAPPFATHSLSMNQRMLKLEC  517

Query  1831  TSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              SM R  +G  +AV+ APPSPV AP GYY++TVVN GIPS S WV+F
Sbjct  518   RSMVRDVSGRTHAVLKAPPSPVVAPSGYYLLTVVNGGIPSKSEWVRF  564



>gb|EYU17749.1| hypothetical protein MIMGU_mgv1a003984mg [Erythranthe guttata]
Length=551

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/543 (57%), Positives = 396/543 (73%), Gaps = 21/543 (4%)
 Frame = +1

Query  358   SVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRC  537
             S   SEA   +GRW TL+ +TGVVAMHMALTH NTVV FDQ G G +GY+L  R NG   
Sbjct  22    STNASEAT--KGRWDTLLNSTGVVAMHMALTHHNTVVMFDQTGQGPTGYRLPARRNG---  76

Query  538   KGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKR  717
                      P  YAHSVEYD+L N IRP+   SDT CSSG+ILSNG+++QTGG+  GS+R
Sbjct  77    ---------PRRYAHSVEYDLLRNRIRPIEIESDTLCSSGSILSNGSLIQTGGFGSGSRR  127

Query  718   IQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVP-RFPN  894
             I+FF  C +  C+W+  + HL ++RW+ASN  LP  +DRVI++GG    +YEFVP R PN
Sbjct  128   IRFFRSCGNGRCDWREERSHLSEDRWFASNLRLPENDDRVIVLGGDNVFSYEFVPKRVPN  187

Query  895   MQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRM  1074
              ++  +LPFLH TYERN GGNNLYP +HL+SDG LF+FANRDSIL +Y++++V K +PR+
Sbjct  188   -ERPFNLPFLHNTYERNEGGNNLYPIIHLASDGNLFVFANRDSILLDYKRDKVVKTYPRI  246

Query  1075  PGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
             PG GSRSYPS+GSSV+LPL HKN F +VEVMICGGA+ GA   A++G F+   ++CGRMV
Sbjct  247   PGRGSRSYPSSGSSVILPLSHKNNFDEVEVMICGGAAYGALAAAQRGNFLAAKRTCGRMV  306

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+G+ H+W ME+MPGPRVMNDM++LP G ILIING + GC+G   G++P+L PY+Y P +
Sbjct  307   ITGHHHRWEMESMPGPRVMNDMIVLPNGNILIINGARHGCSGSNYGSNPSLVPYLYKPKR  366

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
               G RF+ L +T+IARMYHSSA LLPDGRVL+AGSNPN  Y F  VPHPTELRLQAF P 
Sbjct  367   PTGSRFTTLASTRIARMYHSSAVLLPDGRVLVAGSNPNHQYAFGGVPHPTELRLQAFSPA  426

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKW----PSEDLEFSAYSPPF  1782
              M R FD++R +NV+V    +    V YG+EF V F L++K       + + F+AY+PPF
Sbjct  427   NMARDFDHRRARNVTVKGRRN-EEWVGYGEEFDVEFSLNEKVRRNNNDDQVVFTAYAPPF  485

Query  1783  TTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRW  1962
              TH ++MNQR+L LRC  + RGD G+  A V APPS   AP GYYM+TVVN GIPS S W
Sbjct  486   NTHGMSMNQRLLVLRCNKLVRGDGGLWRANVVAPPSSKVAPAGYYMITVVNGGIPSRSHW  545

Query  1963  VKF  1971
             ++F
Sbjct  546   IRF  548



>ref|XP_009394071.1| PREDICTED: uncharacterized protein LOC103979627 [Musa acuminata 
subsp. malaccensis]
Length=558

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/542 (54%), Positives = 376/542 (69%), Gaps = 17/542 (3%)
 Frame = +1

Query  361   VLVSEAASGQGR---WQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGT  531
             V+ S  A G GR   W+ L+++TG VAMHMALT+RNTVV FDQ  +G SG  LR    G 
Sbjct  30    VVWSARAGGSGRRGSWELLLDSTGAVAMHMALTYRNTVVMFDQVSAGPSG--LRMPGCGP  87

Query  532   RCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGS  711
                G R      SC+ HSVEYD+  N +RPL   +D WCSSG  LS+G   QTGGY DG 
Sbjct  88    DDDGKR------SCWVHSVEYDIAANAVRPLALETDPWCSSGAFLSDGVFAQTGGYGDGV  141

Query  712   KRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP  891
             +R+++F P  D    W    + L D+RWY+S+ +LP K DRVI+VGG    TYEF+P+  
Sbjct  142   RRVRYFDPS-DPLPRWSESSELLVDKRWYSSDHVLPEK-DRVIVVGGLNVFTYEFIPKTA  199

Query  892   NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPR  1071
               + + +LPFL QT ++   G+NLYPF+HLSSDG LFIFAN DSILF+Y +N+V K FP 
Sbjct  200   QKEGAFELPFLRQTRDKKESGDNLYPFIHLSSDGNLFIFANHDSILFDYNRNQVVKTFPT  259

Query  1072  MPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRM  1251
             MPG G R+YPSTGSSVMLPLD  + F KVEVMICGGA+ GAY   ++G+F   L +CGRM
Sbjct  260   MPGGGPRNYPSTGSSVMLPLDFSDGFLKVEVMICGGAATGAYRAWRRGKFYRALSTCGRM  319

Query  1252  VISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG  1431
             VI+ ++  W ME+MPGPR+MNDM++LPTG +L+ING   GCAGW    +P+  PY+Y P 
Sbjct  320   VITDDEPNWAMEDMPGPRLMNDMLLLPTGDVLLINGATHGCAGWRRAKNPSYAPYLYKPN  379

Query  1432  KTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVP  1611
                G+RFS+L  + IARMYHS+A +LPDGR+L+ GSNP   Y F  VP+PTELRL+AF P
Sbjct  380   NEAGERFSLLNPSSIARMYHSTAIVLPDGRILVGGSNPYKNYTF-GVPYPTELRLEAFTP  438

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTH  1791
              YMD  FD++RP N+SV   G     + YG+EF VRF L +K P + LEF  Y+PPF TH
Sbjct  439   YYMDTFFDSRRPSNLSVQC-GEGRDRIGYGEEFIVRFELGRK-PGK-LEFVVYAPPFATH  495

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             S +MNQRMLKL C+ + R  NG V+AV+ APPS   AP G+Y+++VVN GIPS   W++F
Sbjct  496   SQSMNQRMLKLGCSGLVRETNGAVHAVLKAPPSSTVAPAGFYLLSVVNGGIPSKFEWLRF  555

Query  1972  AN  1977
             A+
Sbjct  556   AH  557



>ref|XP_006848962.1| hypothetical protein AMTR_s00166p00070030 [Amborella trichopoda]
 gb|ERN10543.1| hypothetical protein AMTR_s00166p00070030 [Amborella trichopoda]
Length=542

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/538 (53%), Positives = 372/538 (69%), Gaps = 25/538 (5%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             +V+      G W+ L+ N GVVAMHM LTH NTV+ FDQ  +G SG           C  
Sbjct  22    VVAIGGGKAGTWELLLNNAGVVAMHMTLTHHNTVIIFDQTEAGPSGLP---------CTA  72

Query  544   SREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
             +  D +D  C+ HS+EYD+  NT RPL   +DTWCSSG+ LS+GT++QTGG   GS+RI+
Sbjct  73    ASSDKAD--CWVHSIEYDIATNTFRPLTLHTDTWCSSGSFLSDGTLLQTGGNGSGSRRIR  130

Query  724   FFAPCVDKTCNW-KPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
              F PC DK CNW +   ++L  ERWYASNQ LP K DR I++GG+   +YEFVP+    +
Sbjct  131   KFQPCSDKQCNWVELEDQYLSAERWYASNQALPEK-DRAIVIGGQYNQSYEFVPKSNPDE  189

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
                DLPFL  T      G+NLYPF+ LSSDG LFIFANRDSILF+Y++N+V +KFP++PG
Sbjct  190   GVFDLPFLKDT-----KGDNLYPFIQLSSDGNLFIFANRDSILFDYKRNKVIRKFPKLPG  244

Query  1081  EGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKSCGRMVI  1257
              G+R+YPSTGSSVMLPLDH + F++VEVM+CGG   G+Y EA++ + F  G  +CGRMVI
Sbjct  245   TGARNYPSTGSSVMLPLDHADGFRRVEVMVCGGGVNGSYREARKNKVFRVGQSTCGRMVI  304

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +  + KW ME MP PR+MNDM++LPTG +L+ING  RG AGW    SP  +P++Y P   
Sbjct  305   TDEEPKWAMEKMPQPRLMNDMILLPTGHVLVINGASRGSAGWELATSPLTKPFLYKPDAI  364

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
              G+RFS  + T IARMYHSSA LLPDGR+L+AGSNP+  Y FT V  PTELR+QA+ P Y
Sbjct  365   AGRRFSSAKGTAIARMYHSSAILLPDGRILVAGSNPHAHYRFTGVSFPTELRVQAYTPYY  424

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
             MD  FD++R  N+++       A V Y + F + FW+ ++     +EF AY+PPF THS 
Sbjct  425   MDPFFDDRRAMNLTI----DGGAGVVYRERFGIEFWMGRR--PGVMEFHAYAPPFATHST  478

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             +MNQRMLKL C S+ R  +G V A++ APPSP+ AP GYY+++VVN G PS ++WV+F
Sbjct  479   SMNQRMLKLECASLVREMSGFVRAMLVAPPSPIVAPSGYYLLSVVNGGFPSKAQWVRF  536



>ref|XP_010686035.1| PREDICTED: uncharacterized protein LOC104900331 [Beta vulgaris 
subsp. vulgaris]
Length=649

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/426 (63%), Positives = 333/426 (78%), Gaps = 1/426 (0%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRC-KGSREDLSD  564
             +G WQ L EN GVVAMHMALTH NTV+ FDQ G+G S Y+L RR  G  C      D+ D
Sbjct  37    EGEWQLLRENIGVVAMHMALTHMNTVLIFDQTGTGPSAYRLTRRARGGECYPNHASDVRD  96

Query  565   PSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD  744
              SCYAHSVEY + +NT+RPLR  SD +CSSG+ LSNGT++QTGGY +G ++I++F PC D
Sbjct  97    SSCYAHSVEYHIPSNTLRPLRIESDPFCSSGSFLSNGTLLQTGGYANGYRKIRYFEPCDD  156

Query  745   KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFL  924
               C+W+  K  L   RWYASNQ+LPG+ +RVI+VGG++  +YEFVPR  +++ S  LPFL
Sbjct  157   DNCDWRLSKDRLAKNRWYASNQLLPGEKERVIVVGGKKVFSYEFVPRKSSLRHSYALPFL  216

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
               TY ++ GGNNLYPFLHLSSDG+LFIFANRDSILFNYR ++V K +PRMPG+GSRSYPS
Sbjct  217   QNTYNKSEGGNNLYPFLHLSSDGHLFIFANRDSILFNYRLDQVIKTYPRMPGKGSRSYPS  276

Query  1105  TGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             +GSSV+LPLDH++ FQKVEVM+CGGA+ GAY  A++G+++EGL SCGRM I+G K+KWNM
Sbjct  277   SGSSVILPLDHRDGFQKVEVMVCGGAAEGAYNAAREGQYLEGLNSCGRMEITGEKNKWNM  336

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MP PR++ DMVILPTG IL+ING ++G  GW N A+PA  P +Y P K +GKRF  L+
Sbjct  337   EEMPHPRLLLDMVILPTGIILLINGAQQGAGGWNNAATPAHRPLLYKPKKPLGKRFYALK  396

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
             AT +ARMYHSSA LLPDGRVL+ G NPN+ YV+ NV +PTEL+LQAF P Y D RF + R
Sbjct  397   ATNVARMYHSSAILLPDGRVLVGGGNPNERYVYHNVRYPTELKLQAFAPQYTDHRFHHIR  456

Query  1645  PKNVSV  1662
             PKNVS+
Sbjct  457   PKNVSI  462


 Score =   104 bits (259),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 82/120 (68%), Gaps = 4/120 (3%)
 Frame = +1

Query  1630  FDNQRPKNVSVYVE---GSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             F +QR +  S+      G  +  + YG +F VRFW+  K   E +EF+AY+PPFTTHS+A
Sbjct  531   FHHQRTRTNSIESNNNNGKDSVNIRYGDDFEVRFWVGSKL-DEKVEFNAYAPPFTTHSIA  589

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
             MNQR+LKLR T +   D+G VNAVV APPS   AP GYYM+ +VN GIPS ++W++F +A
Sbjct  590   MNQRLLKLRSTKIVEDDDGWVNAVVEAPPSSNVAPSGYYMLFLVNGGIPSQAQWIRFVHA  649



>ref|XP_002280559.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=553

 Score =   476 bits (1226),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 247/537 (46%), Positives = 336/537 (63%), Gaps = 16/537 (3%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             +++ AA G+  WQ L++N G+ AMHM L H + VV FD+   G+S   L       +C+ 
Sbjct  31    VLTHAAGGE--WQLLLKNIGITAMHMQLLHNDRVVIFDRTDFGKSNLSLPD----GKCRN  84

Query  544   SREDLSDP-SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
                D   P  C AHSVEYDV  N+IR L   +D WCSSG +++NG ++QTGG+ DG + +
Sbjct  85    DPNDTVLPIDCTAHSVEYDVATNSIRALMVQTDVWCSSGAVMANGNLIQTGGFNDGDRVV  144

Query  721   QFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
             + F PC   +C+W+     L   RWYA+N ILP  +DR I++GGRR   YEF P+     
Sbjct  145   RIFKPC--SSCDWEEVPFGLAARRWYATNHILP--DDRQIVIGGRRQFNYEFYPKTGAAS  200

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
              +  LPFL QT +R    NNLYPF++L +DG LFIF+N  +ILF+Y KN V K FP +PG
Sbjct  201   NAYSLPFLAQTNDRGIE-NNLYPFVYLHTDGNLFIFSNNRAILFDYAKNVVVKTFPTIPG  259

Query  1081  EGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
                R YPSTGS+VMLPL+ +    +VEV++CGGA  G+YT+A +G F+  LK+C R+ I+
Sbjct  260   GDPRCYPSTGSAVMLPLNLQASSIEVEVLVCGGAPTGSYTQASKGNFVGALKTCARIKIT  319

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
              +  +W ME MP  RVM DM +LP G +LIING   G AGW NG  P L+P +Y P K  
Sbjct  320   DSSPQWVMETMPLARVMGDMTLLPNGDVLIINGASAGTAGWENGRDPVLKPVLYKPDKPT  379

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF V+  T I RMYHS+A LL DGRVL+ GSNP+  Y FT V +PTELRL+AF P+Y+
Sbjct  380   GSRFEVMNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYKFTGVLYPTELRLEAFSPEYL  439

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             D  F N RP  +S     +  A + YGK+  VRF +      + +  +  +P FTTHS++
Sbjct  440   DSGFKNLRPTIIS----PTSQAKIGYGKDLTVRFSVTGTLDPDTVSVTMLAPSFTTHSLS  495

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             MNQR+L L   +++  +       V  P S + AP GYY++ VV++GIPS   WV+ 
Sbjct  496   MNQRLLVLGSGNVKNAEKSTFAIAVTTPASAILAPSGYYVLFVVHQGIPSEGIWVQI  552



>ref|XP_002973684.1| hypothetical protein SELMODRAFT_413959 [Selaginella moellendorffii]
 gb|EFJ25344.1| hypothetical protein SELMODRAFT_413959 [Selaginella moellendorffii]
Length=537

 Score =   468 bits (1203),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 261/557 (47%), Positives = 350/557 (63%), Gaps = 29/557 (5%)
 Frame = +1

Query  325   VSLRPCNALNASVLVSEA------ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRG  486
             + LR    L  ++ VS A      AS +G W+ L+EN+GV AMHM ++H N V+ FD+  
Sbjct  1     MELRVITTLVLALWVSGAFRHGSGASPRGSWELLVENSGVSAMHMLVSHTNKVLIFDRTD  60

Query  487   SGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTI  663
              G S  +L       RC+    DL+    C+AHSVE  +    IRPL  ++DTWCSSG  
Sbjct  61    YGPSAIRLPH----GRCRNDSSDLALKIDCWAHSVELQIPTRNIRPLEVLTDTWCSSGAF  116

Query  664   LSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVII  843
              ++GT  QTGG+ DG++ ++ +  C D  CNW      L   RWYASNQILP  ++RVI+
Sbjct  117   RADGTFTQTGGWNDGARVVRHYNFCED--CNWTEQPGGLQRPRWYASNQILP--DNRVIV  172

Query  844   VGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDS  1023
             VGGR A +YEFVP   ++     LPFL  T +  +  NNLYPFLHL  DG LF+FAN +S
Sbjct  173   VGGRVAFSYEFVPGDGHLYS---LPFLRSTSDERSE-NNLYPFLHLLPDGNLFVFANSES  228

Query  1024  ILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTE  1203
             IL +Y+ N+V + +P +PG G+R+YP++GSSVMLPL    RFQ+VEV+ICGGAS  AY +
Sbjct  229   ILLDYKNNKVVRSYPSLPG-GARNYPASGSSVMLPLLASQRFQRVEVLICGGASKTAYKQ  287

Query  1204  AKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGW  1383
             A  G F   LK+CGRMV++ N   W +E MP PRVM DMV LPTG++LIING ++G AGW
Sbjct  288   ASSGSFETALKTCGRMVVTDNNPSWILEEMPLPRVMGDMVNLPTGEVLIINGAQQGTAGW  347

Query  1384  GNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVF  1563
                 +PAL P +YSP  T   +F+ L +  I RMYHS+A LLPD RVL+AGSNPN GY F
Sbjct  348   RFARNPALTPLLYSPSSTSSSKFTTLASASIPRMYHSTAILLPDTRVLVAGSNPNVGYDF  407

Query  1564  TNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWP  1743
             + V  PTELR++AF P Y+D  FD  R +     +      V+ Y  +  + F +     
Sbjct  408   SEVLFPTELRIEAFSPPYLDSYFDGVRAE-----ISSMSKVVIGYNSQITIEFSVSVL--  460

Query  1744  SEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDN-GMVNavvaappspvaappGYYM  1920
               D+E + Y+P F TH+ +MNQR+LKL  +S    +N G    VV APP+   APPGYYM
Sbjct  461   -GDMEATLYAPAFATHAYSMNQRLLKLESSSPVLDENSGYYTFVVRAPPTKTIAPPGYYM  519

Query  1921  VTVVNEGIPSISRWVKF  1971
             + +VN G+PS  +W++ 
Sbjct  520   LFIVNSGVPSTGKWIQM  536



>ref|XP_010652487.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=563

 Score =   459 bits (1180),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 257/564 (46%), Positives = 345/564 (61%), Gaps = 25/564 (4%)
 Frame = +1

Query  310   LVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGS  489
             L+ FL SL P +     +    + +G G W  L  + G+ AMHM + H N ++ FD+   
Sbjct  12    LIKFL-SLMPLSTFGFDISTPSSNNG-GSWFLLHSSIGISAMHMQILHNNKIIIFDRTDF  69

Query  490   GRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTIL  666
             G S   L        C+    D++    C AHS+ YDVL N+IRPL   +DTWCSSG+++
Sbjct  70    GASNLSLP----DGHCRSDPNDMALKVDCTAHSLLYDVLLNSIRPLMLQTDTWCSSGSVI  125

Query  667   SNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIV  846
             ++GT++QTGGY DG +  + F PC D  C+WK   ++L   RWYASNQILP  + R+I+V
Sbjct  126   ADGTLIQTGGYNDGERVARTFTPCNDDQCDWKELPEYLSVRRWYASNQILP--DGRIIVV  183

Query  847   GGRRASTYEFVPRFPNMQKSTDLP-----FLHQTYERNAGGNNLYPFLHLSSDGYLFIFA  1011
             GGR A +YEF P+  N   ST  P     FL  T +     NNLYPFLHL  DG LFIFA
Sbjct  184   GGRNAFSYEFFPK--NTLNSTSQPNYYLKFLKDTRDPKEE-NNLYPFLHLLPDGNLFIFA  240

Query  1012  NRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPL----DHKNRFQKVEVMICGG  1179
             N+ SI F+Y +NRV K+FP +PGE SRSYPSTGSSVMLPL     ++++  +VE+++CGG
Sbjct  241   NKRSISFDYTQNRVVKEFPVIPGEDSRSYPSTGSSVMLPLRLTSGNQSQSPEVEILVCGG  300

Query  1180  ASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIING  1359
             A  G+Y++A++G +I   K+CGR+ ++    KW ME MP PRVM+DM+ILPTG +L+ING
Sbjct  301   APKGSYSKAERGTYISASKTCGRIKVTDPNPKWVMEQMPMPRVMSDMIILPTGDVLLING  360

Query  1360  VKRGCAGWGNGASPALEPYIY-SPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAG  1536
                G AGW +G +P L P +Y S      +RF VL  ++  RMYHS A L+PDGRV++ G
Sbjct  361   ASNGTAGWEDGRNPVLNPVLYRSYASDPSQRFWVLNPSRTPRMYHSGAVLVPDGRVIVGG  420

Query  1537  SNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHV  1716
             SNP+  Y FT  P+PTEL L+AF P Y+  R+   RP  +S+    +P  V+ Y   F +
Sbjct  421   SNPHRVYNFTAYPYPTELGLEAFSPPYLAPRYSYLRPSILSI---ETPQNVLLYRGSFSI  477

Query  1717  RFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspv  1896
                L     S  +E    +P FTTHS AMNQR + L  TSM +        VV+ P    
Sbjct  478   SLTLSLYLRSRGIEVMIMTPSFTTHSFAMNQRAVVLNVTSMAQLSLFAYKLVVSGPQKTA  537

Query  1897  aappGYYMVTVVNEGIPSISRWVK  1968
              APPGYYM+ VV+ G PS   WVK
Sbjct  538   IAPPGYYMLFVVHAGTPSQGVWVK  561



>ref|XP_010061025.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
Length=565

 Score =   452 bits (1164),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 240/529 (45%), Positives = 322/529 (61%), Gaps = 13/529 (2%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSC  573
             RWQ L  N G+VAMHM L H + VV +D+   G+S   L    +G       E +    C
Sbjct  46    RWQLLQSNIGIVAMHMQLLHNDRVVIYDRTDFGKSNLSLP---DGKCRHDPSEAVVVDDC  102

Query  574   YAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTC  753
              AHSVEYDV +N+ RPL   +D WCSSG + S+GT++QTGGY DG ++++ FAPC D+ C
Sbjct  103   TAHSVEYDVASNSFRPLMVQTDVWCSSGAVTSDGTLVQTGGYNDGERQVRTFAPCSDRRC  162

Query  754   NWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQT  933
             +W+  +  L   RWYA+NQILP  + R I++GGRR   YEF P+  +      LPFL QT
Sbjct  163   DWQEIRNGLAARRWYATNQILP--DGRQIVIGGRRQFNYEFYPKSSSAPNVYSLPFLVQT  220

Query  934   YERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGS  1113
              +     NNLYPF+HL+ DG LFIFAN  +ILF+Y   +V + +P MPG   R YPSTGS
Sbjct  221   NDPGLE-NNLYPFVHLNVDGNLFIFANNRAILFDYVNQKVVRTYPTMPGGDPRCYPSTGS  279

Query  1114  SVMLPLDHKNRFQ---KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             SV+LPL    R     + EV++CGGA  GA+ +A  G+F+  L +CGR+ I+    +W M
Sbjct  280   SVLLPLKTAGRPTGNVEAEVLVCGGAPKGAFKQASGGKFLGALNTCGRIKITDPNPQWAM  339

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MPG R M DMV+LP G +LIINGV  G AGW  G +P L P IY P    G RF++  
Sbjct  340   ETMPGARAMGDMVLLPNGDVLIINGVAAGTAGWEFGRNPVLNPVIYKPDGPAGGRFALQD  399

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
              + I R+YHS+A LL DGRVL+ GSNP+  Y FT V  PTELRL+AF P Y+D      R
Sbjct  400   PSGIPRVYHSTAVLLRDGRVLVGGSNPHIFYNFTGVIFPTELRLEAFRPPYLDPEHSGSR  459

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKL  1824
             P+     +  +  A + Y ++F VRF +      + +  +  +PPF THS +MNQR+L +
Sbjct  460   PR----IIYPTSQAKIGYSQKFSVRFTVTGNVSLDAVAVTMVAPPFNTHSFSMNQRLLVI  515

Query  1825  RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
                ++ +  N    A   AP S   AP GYY++ VV++GIPS   WV+ 
Sbjct  516   GSGTVVKVGNSAYAAQAVAPGSHNLAPAGYYLLFVVHQGIPSEGIWVQI  564



>ref|XP_008221311.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=535

 Score =   451 bits (1161),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 238/528 (45%), Positives = 320/528 (61%), Gaps = 21/528 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+WQ L +N G+ AMHM L H + VV FD+   G+S   L       +C G+        
Sbjct  27    GKWQLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLP----DGKCVGN-------D  75

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS EYDV  NT RPL  +SD WCSSG++  +G ++QTGG+ +G +R++ F PC    
Sbjct  76    CTAHSAEYDVTTNTFRPLTLLSDVWCSSGSVAPDGRLIQTGGFTNGERRVRIFEPCTG--  133

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+WK  +  L   RWYA++ ILP  + R II+GGRR   YEF P+  +  K   LPFL Q
Sbjct  134   CDWKEIENGLAARRWYATDHILP--DGRQIIIGGRRQFNYEFYPKSASTNKVFSLPFLVQ  191

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T + +A  NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K +P++PG   RSYPSTG
Sbjct  192   TNDPDAE-NNLYPFVFLNVDGNLFIFANNRAILFDYVKNNVVKTYPQIPGGDPRSYPSTG  250

Query  1111  SSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNME  1287
             S+V+LPL + K R  + EV++CGGA  G+Y +A +G F   L +C R+ I+    +W +E
Sbjct  251   SAVLLPLKNLKARSIEAEVLVCGGAPTGSYIKATKGTFTGALNTCARIKITDPNPQWVLE  310

Query  1288  NMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRA  1467
              MP  RVM DM +LP G +L+ING   G AGW  G +P L P +Y P    G RF     
Sbjct  311   TMPQARVMGDMTLLPDGTVLLINGASNGAAGWELGRNPVLNPVVYRPDNAAGSRFEQQNP  370

Query  1468  TKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRP  1647
             T I RMYHS+A LL DGRVL+ GSNP+  Y FTNV  PTELR++AF PDY+D ++ N RP
Sbjct  371   TTIPRMYHSTAVLLRDGRVLVGGSNPHPNYEFTNVLFPTELRVEAFSPDYLDAKYANVRP  430

Query  1648  KNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLR  1827
             K VS   +    A ++YGK+  +RF +     +  +  +  +P FTTHS +MN R L L 
Sbjct  431   KIVSPKSQ----AKINYGKKLTIRFSMTGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLA  486

Query  1828  CTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
               +++          V  P S   AP GYY++ VV++ IPS   WV+ 
Sbjct  487   SENVKSVGKSAYEVEVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQI  534



>ref|XP_008221312.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=546

 Score =   452 bits (1162),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 242/537 (45%), Positives = 325/537 (61%), Gaps = 15/537 (3%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             +S   +  G+W  L +N G+ AMHM L H + VV FD+   G+S   L +     +C+  
Sbjct  22    ISLTHAAGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPK----GKCRND  77

Query  547   RED-LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
               D +    C AHS EYDV  N+ RPL   +D WCSSG++  +G+++QTGG+ DG +R++
Sbjct  78    PNDTVLKVDCTAHSAEYDVPTNSFRPLMVQTDVWCSSGSVAQDGSLIQTGGFNDGERRVR  137

Query  724   FFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQK  903
              F  C    C+WK     L   RWYA+N ILP    R II+GGRR   YEF P+  +   
Sbjct  138   IFQSCTG--CDWKEYDNGLAARRWYATNHILP--EGRQIIIGGRRQFNYEFYPKSESSSN  193

Query  904   STDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
                LPFL QT +     NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K +P++PG 
Sbjct  194   VHSLPFLVQTNDPKVE-NNLYPFVFLNVDGNLFIFANNRAILFDYVKNVVVKTYPQIPGG  252

Query  1084  GSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
               RSYPSTGS+V+LPL + + RF + EV++CGGA  G+Y +A  G F+E LK+CGR+ I+
Sbjct  253   EPRSYPSTGSAVLLPLKNLQARFVEAEVLVCGGAPKGSYAKAVNGTFVEALKTCGRIKIT  312

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
                 +W +E MP  RVM DM +LP G +LIING   G AGW  G +P L P IY P K V
Sbjct  313   DPNPQWVVETMPQARVMGDMTLLPDGTVLIINGAAVGTAGWEFGRNPVLNPVIYQPDKAV  372

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF     T I RMYHS+A LL DGRVL+ GSNP+  Y FTNV  PTELRL++F PDY+
Sbjct  373   GSRFEQQNPTTIPRMYHSAAVLLRDGRVLVGGSNPHIYYEFTNVLFPTELRLESFNPDYL  432

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             D  + N RPK V+   +    A +++G++  VRF+++       +  +  +P FTTHS +
Sbjct  433   DAMYVNLRPKIVAPQSQ----AKINHGQKLAVRFYVEGTVAPNLVSVTMVAPSFTTHSFS  488

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             MNQR+L L   S+           V  P S   AP GYY++ VV++ IPS   WV+ 
Sbjct  489   MNQRLLVLAAESVTNVAKSTYQVQVTTPGSGNLAPSGYYILYVVHQQIPSEGIWVQI  545



>ref|XP_009388162.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=544

 Score =   451 bits (1160),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 249/540 (46%), Positives = 328/540 (61%), Gaps = 24/540 (4%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLR--RRFNGTRC  537
             +V+  A+G G+W  L  + GV AMHM L H + VV FD+   G S   L   +  N    
Sbjct  18    VVAATAAGGGQWALLQRSIGVSAMHMQLLHNDRVVVFDRTDFGPSNLSLPVGKCRNDPDE  77

Query  538   KGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKR  717
             K  R D     C AHSVEYDV  NT RPL  ++D WCSSGT+  +GT++QTGG+ DG + 
Sbjct  78    KALRVD-----CTAHSVEYDVAANTFRPLMLLTDAWCSSGTVAPDGTLVQTGGFNDGERA  132

Query  718   IQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM  897
              + F PC D  CNW    + L   RWYA+NQILP  + R I+VGGRR   YEF P+ P+ 
Sbjct  133   SRTFRPCDDCRCNWVEVPQALAVRRWYATNQILP--DGRAIVVGGRRQFNYEFYPKSPDA  190

Query  898   Q--KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPR  1071
                ++  LPFL  T  R+A  NNLYPF+HL+ DG LF+FAN  +IL +Y KN V K +P+
Sbjct  191   SDLRTIALPFLRDT--RDAVENNLYPFVHLNIDGNLFVFANNRAILLDYTKNTVVKTYPK  248

Query  1072  MPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKSCGR  1248
             MPG   R+YPSTGSSV+LPL  K   ++ EV+ICGGA  G+Y +A Q R F+  L +CGR
Sbjct  249   MPGGEPRNYPSTGSSVLLPL--KPSPKEAEVLICGGAPMGSYVQALQSRGFVRALDTCGR  306

Query  1249  MVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSP  1428
             + I+     W+ME MP PRVM DMV+LP+G++L+ING   G AGW     P L P +Y P
Sbjct  307   IKITEAAASWSMETMPVPRVMGDMVLLPSGEVLMINGAAAGTAGWELARDPVLTPVVYRP  366

Query  1429  GKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFV  1608
              +  G RF +   +   R+YHS+A LL DGRVL+ GSNPN  Y F+ V  PTEL L+AF 
Sbjct  367   ERPAGARFDIQSPSTTPRLYHSTAVLLRDGRVLVGGSNPNVNYNFSGVEFPTELSLEAFS  426

Query  1609  PDYMDRRFDNQRPKNVSVYVEGSPAAV-VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFT  1785
             P Y+      +RP+ V+     SP+ + + YGK F ++F        E +  +  +P F 
Sbjct  427   PAYLSPAHSARRPRIVT-----SPSPLRLSYGKRFSLQFTAGAVG-DEGVRVTMVAPSFA  480

Query  1786  THSVAMNQRMLKLRCTSMER-GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRW  1962
             THS +MNQR+L L   +  +  D+G    +  AP S + AP GYYMV VVN G+PS S W
Sbjct  481   THSFSMNQRLLVLETEAAAKAADSGTYQVMAMAPASAILAPSGYYMVFVVNGGVPSESNW  540



>ref|XP_004304717.1| PREDICTED: uncharacterized protein LOC101300467 [Fragaria vesca 
subsp. vesca]
Length=546

 Score =   451 bits (1160),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 244/541 (45%), Positives = 332/541 (61%), Gaps = 22/541 (4%)
 Frame = +1

Query  364   LVSEAASG-QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK  540
             + S+  SG QG+W+ L  + G+ AMHM L H N V+ FD+   G S   L     G +C 
Sbjct  22    ISSQTYSGNQGQWRLLQSSIGISAMHMQLLHNNKVIMFDRTDFGASNISLP----GGKC-  76

Query  541   GSREDLSDPS----CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDG  708
               RED +D +    C AHSV YD+  NT RPL   +D WCSSG +L +GT++QTGGY DG
Sbjct  77    --REDPNDTALQRDCTAHSVLYDIGQNTFRPLTIQTDPWCSSGAVLPDGTLLQTGGYNDG  134

Query  709   SKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF  888
              + ++ F+PC D+ C+W     +L   RWYASNQILP  + R+IIVGGRR   YEF PR 
Sbjct  135   DRSLRTFSPCNDEKCDWNEEPNYLLTRRWYASNQILP--DGRIIIVGGRRQYNYEFYPR-  191

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
              +   +  L  L QT ++    NNLYPFLHL  DG LFIFAN  +ILF+Y++N V K+ P
Sbjct  192   GSSSSTIWLEHLRQTRDQRIE-NNLYPFLHLLPDGNLFIFANTKAILFDYKRNAVVKELP  250

Query  1069  RMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGR  1248
              +PG+  R+YPSTGSSV+LPLD    F + E+++CGGA  G++  A+ G F + L +CGR
Sbjct  251   EIPGQDPRNYPSTGSSVLLPLDENQPFLQAEIVVCGGAPRGSFVLAENGTFQKTLGTCGR  310

Query  1249  MVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSP  1428
             + ++     W ME+MP PR M DM+ILP G +LI+NGV  G AGW  G +P   P IY P
Sbjct  311   INMNHANPNWVMEDMPVPRAMGDMLILPNGDVLILNGVGLGTAGWELGRNPVTTPVIYRP  370

Query  1429  GKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFV  1608
              +  G+RF V+  +   R+YHSSA L+ DGRVL+ GSNP+ GY FT V +PT+L L+AF 
Sbjct  371   SELPGRRFRVMAESNRPRLYHSSAVLVTDGRVLVGGSNPHVGYNFTGVDYPTDLSLEAFS  430

Query  1609  PDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             P Y+ R ++  RP+ VSV         + Y ++F V F + +   S  +  +  +P FTT
Sbjct  431   PPYLARDYETVRPRIVSVLEN------IGYREQFSVAFAVPEYVHSSVVSVTLVAPSFTT  484

Query  1789  HSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             HS AMNQRM+ ++   +           V  P +   APPGYY++ VV+  IPS + WVK
Sbjct  485   HSFAMNQRMVVMKLGEVRELSLDTYEVAVMGPSAKEIAPPGYYLLFVVHADIPSSAMWVK  544

Query  1969  F  1971
              
Sbjct  545   L  545



>ref|XP_006357288.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=570

 Score =   452 bits (1162),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 248/531 (47%), Positives = 339/531 (64%), Gaps = 19/531 (4%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP  567
             +G+W  L ++ G+ AMHM L H N VV FD+   G S   L R     +C+ + E +   
Sbjct  53    KGKWILLHKSIGISAMHMQLLHNNKVVIFDRTDFGSSNLSLPR----GKCRYNDEAIKV-  107

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              C AHS+ Y+V  NT RPL   +D WCSSG + SNGT++QTGGY DG ++I+ F+PC D+
Sbjct  108   DCTAHSILYNVATNTYRPLMVQTDVWCSSGAVNSNGTLIQTGGYHDGERKIRLFSPCNDE  167

Query  748   -TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFL  924
              TC+W   +++L  +RWY+++ ILP  + R++I+GGR A +YEF P+  N      LPFL
Sbjct  168   ETCDWTELQQNLTVKRWYSTDHILP--DGRIMIIGGRNAYSYEFFPQNSNTNYVFHLPFL  225

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              +T +     NNLYPFL+L  DG ++IFAN+ SI+ +Y KNRV ++FP +PGE  RSYP+
Sbjct  226   KETTDPKEE-NNLYPFLYLLPDGNVYIFANQRSIVLDYAKNRVVREFPVIPGE-KRSYPA  283

Query  1105  TGSSVMLP--LDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             TGSSVMLP  L   +    VEVM+CGGA+ GA+ +A  G F+   ++CGR+ I+    KW
Sbjct  284   TGSSVMLPMKLVAGDFSPVVEVMVCGGANGGAFLQAAVGGFMPASRTCGRIKITDPDPKW  343

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFS  1455
              ME+MP  RVM DM++LPTG ++I+NG  +G AGW +   P L P +Y P +    KRFS
Sbjct  344   VMEDMPSGRVMPDMLLLPTGDVIILNGASKGTAGWESAIDPVLNPVLYEPDQPDPNKRFS  403

Query  1456  VLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFD  1635
             VL  T I RMYHSSA LLPDGR+L+ GSNP+  Y FT V +PTEL L+AF+P Y+     
Sbjct  404   VLNPTSIPRMYHSSATLLPDGRILVGGSNPHIRYNFTGVKYPTELSLEAFMPPYLSPHHS  463

Query  1636  NQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRM  1815
               RP N +  VEG     V YG++F V F L      +++  +  +P FTTHS AMNQR+
Sbjct  464   QLRPSNTT--VEGP----VSYGQKFSVTFTLGVSQDMKEVMVTMIAPSFTTHSFAMNQRL  517

Query  1816  LKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             L L    +++  +     +V APPS   AP GYYMV VV++G+P  S WVK
Sbjct  518   LILDIVEIQQLSSFTQKIMVYAPPSRNIAPLGYYMVFVVHKGVPGHSIWVK  568



>ref|XP_008218222.1| PREDICTED: galactose oxidase [Prunus mume]
Length=553

 Score =   451 bits (1160),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 243/536 (45%), Positives = 323/536 (60%), Gaps = 19/536 (4%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED-  555
             +S  G+W  L  + G+ AMHM L   N V+ FD+   GRS   L RR    +C+    D 
Sbjct  31    SSNLGQWHLLHSSIGISAMHMQLLRTNMVIMFDRTDYGRSNISLPRR----QCRHDPNDT  86

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             L    C AHS+ YD+  NT+RPL   +DTWCSSG +  +GT++QTGGY DG   ++ F P
Sbjct  87    LLKVDCTAHSILYDIGTNTLRPLTVQTDTWCSSGAVFPDGTLVQTGGYNDGDHVVRTFTP  146

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR-FPNMQKSTD  912
             C    C+W     +L   RWYASNQILP  + R+IIVGGRR   YEF PR F N  ++  
Sbjct  147   CTGDNCDWLEFPNYLVQRRWYASNQILP--DGRIIIVGGRRQFNYEFYPRSFQNPPRTFW  204

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             L  L QT +++   NNLYPFLHL  DG LFIFAN  SILFNY +N V ++FP +PG   R
Sbjct  205   LDILRQTKDQDE--NNLYPFLHLLPDGNLFIFANTKSILFNYNQNVVVREFPEIPGGEPR  262

Query  1093  SYPSTGSSVMLPLDHK---NRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISG  1263
             +YPSTGSSV+LPLD     N   + E+M+CGGA   ++  A +G FI+ L +CGR+ +S 
Sbjct  263   NYPSTGSSVLLPLDENKPANVNIEAEIMVCGGAPRNSFVLASRGEFIDALGTCGRLKVSD  322

Query  1264  NKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVG  1443
                 W ME MP PRVM DM++LPTG ++IING   G AGW  G  P  +P IY P +   
Sbjct  323   QNPSWVMEEMPVPRVMADMLLLPTGDVVIINGAALGTAGWEYGRDPVTKPVIYRPSENPN  382

Query  1444  KRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMD  1623
             +RFSV+  ++  R+YHS+A L+PDGRVL++GSNP+  Y FT V +PT+L L+AF P Y  
Sbjct  383   RRFSVMAGSQRPRLYHSAAVLVPDGRVLVSGSNPHVYYNFTCVEYPTDLSLEAFSPPYTS  442

Query  1624  RRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
               ++  RP+ VSV        V+ Y + F V F + +      L     +P FTTHS AM
Sbjct  443   VEYEPARPRIVSV------KEVLGYRQFFSVAFAVPELLSVSVLSVRLVAPSFTTHSFAM  496

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             NQRM+ ++   + R         +  P +   APPGYY++ VV+  IPS + WVK 
Sbjct  497   NQRMIVMKLIGVTRVAPETYEISLVGPSTGEIAPPGYYLLFVVHADIPSSAAWVKL  552



>ref|XP_010674901.1| PREDICTED: galactose oxidase [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   451 bits (1160),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 245/533 (46%), Positives = 326/533 (61%), Gaps = 21/533 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             G WQ L EN G+ AMHM L   N V+ FD+   G S   L       RC+    D+    
Sbjct  31    GEWQVLQENIGISAMHMQLMQNNKVIMFDRTDFGPSNLSLPF----GRCRNDSSDIVLKI  86

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              C AHSV YD+  NT RPL   +DTWCSSG++L +G+++QTGGY DG + ++ F PC D 
Sbjct  87    DCTAHSVVYDIATNTFRPLTVNTDTWCSSGSLLPDGSLVQTGGYNDGDRVVRKFTPCKDD  146

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR----FPNMQKSTDL  915
              C+W     +L D RWYA+NQILP  + RVII+GGRR  TYEF P     FP    +  L
Sbjct  147   NCDWIEYPNYLSDRRWYATNQILP--DGRVIIIGGRRVFTYEFFPSNSNSFPTSTSTFWL  204

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
              FL +T++     NNLYPF+HL   G LFIFAN  +ILF+Y  N V K+ P + G   R+
Sbjct  205   NFLLETHDDEE--NNLYPFVHLLPTGNLFIFANTRAILFDYTLNVVVKELPSIDGGNPRN  262

Query  1096  YPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKSCGRMVISGNKH  1272
             YPSTGSSV+LP+D +N+  + E+MICGG+  GA+T+A   R FI    +CGR+ ++    
Sbjct  263   YPSTGSSVLLPID-ENKPIEAEIMICGGSQHGAFTQASTNRSFIRASSNCGRIKVTDENP  321

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
              WNME+MP PRVM DM++LPTG ILI+NG + G AGW N A+P   P IY       KRF
Sbjct  322   HWNMEDMPMPRVMGDMLLLPTGDILIVNGAELGTAGWENAANPVTTPVIYRLYDNTDKRF  381

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
              V+ ++   RMYHS+A LL DGR+L+ GSNP+  Y FTNV +PT+L L+A+ P Y+   +
Sbjct  382   YVMSSSPRPRMYHSAAILLTDGRILVGGSNPHIYYNFTNVEYPTDLSLEAYSPPYLAIEY  441

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
                RP    +Y +     VV Y + F V F + +    E +  +  +P FTTHS+AMNQR
Sbjct  442   APMRPN--IIYGD----QVVGYEQPFTVTFNVQQYQADEVVSVNLVAPSFTTHSLAMNQR  495

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             M+ LR + + +   GM N  +  P +   APPGYY++ VV+ GIPS   WVK 
Sbjct  496   MVVLRISKISQLSLGMFNVGLMGPTTTNIAPPGYYLLFVVHAGIPSSGLWVKI  548



>ref|XP_004289629.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=547

 Score =   451 bits (1159),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 239/541 (44%), Positives = 330/541 (61%), Gaps = 14/541 (3%)
 Frame = +1

Query  355   ASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTR  534
             A+ L S   +  G+W+ L +N G+ AMHM L H + VV FD+   G S   L    NG  
Sbjct  18    ATFLSSSTHAAVGKWELLTKNVGISAMHMQLLHNDRVVMFDRTDFGASNLSLP---NGV-  73

Query  535   CKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGS  711
             C+ +  D +    C AHS EYDV +NT+RPL   +DTWCSSG +  NG+++QTGGY DG 
Sbjct  74    CRNNPNDTTLKVDCTAHSAEYDVASNTVRPLFVFTDTWCSSGAVNPNGSLVQTGGYNDGE  133

Query  712   KRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP  891
             K ++ F PC   TC+W+     L + RWYA++ ILP  + R II+GGR   +YEF P+  
Sbjct  134   KMVRVFTPCA--TCDWEEIGNVLANWRWYATDHILP--DGRQIIIGGRGQFSYEFYPKSE  189

Query  892   NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPR  1071
                 S +LPFL +T +  A  NNLYPF+ L+ DG LFIFAN  +ILF+Y  ++  K +P 
Sbjct  190   GSMTSLNLPFLQETSDGAAIENNLYPFVFLNVDGNLFIFANNRAILFDYVASKTVKTYPT  249

Query  1072  MPGEGSRSYPSTGSSVMLPLDHKN-RFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGR  1248
             +PG   RSYPSTGS+V+LPL   N +  + EV++CGGA  GAYT+A +  +++ LKSC R
Sbjct  250   IPGGEPRSYPSTGSAVLLPLKSTNGQAAEAEVLVCGGAPFGAYTKALKKTYMDSLKSCAR  309

Query  1249  MVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSP  1428
             + I+    +W ME+MP  R+M DM +LP G +LIING  +G AGW  G  P   P +Y P
Sbjct  310   IKITDPNPEWVMEDMPLARIMGDMTLLPNGDVLIINGAAQGTAGWELGRHPVRTPVVYKP  369

Query  1429  GKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFV  1608
                 G RF +   + I+RMYHS+A LL DGRVL+ GSNP++ YVF+NV  PT+L L+AF 
Sbjct  370   DNATGSRFELQNPSAISRMYHSTAVLLRDGRVLVGGSNPHERYVFSNVLFPTDLSLEAFS  429

Query  1609  PDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             P+Y+D +F + RP  +S     S  A V YG++  V F +      + +  +  SP FTT
Sbjct  430   PNYLDSKFASVRPTTLS----PSSQAEVGYGEKLTVSFSITGTIALDTVSVTMVSPSFTT  485

Query  1789  HSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             HS +MNQR++ L   ++    N      V  P S   AP GY+++ VV++ IPS   WVK
Sbjct  486   HSFSMNQRLVILASETVRALGNLTFQVEVTTPASGNLAPSGYFLLYVVHQQIPSAGIWVK  545

Query  1969  F  1971
              
Sbjct  546   I  546



>ref|XP_004494672.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=559

 Score =   451 bits (1159),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 246/550 (45%), Positives = 338/550 (61%), Gaps = 25/550 (5%)
 Frame = +1

Query  349   LNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNG  528
             L +S L+S   S QG+W  L    G+ AMHM LTH + ++ FD+   G S   L    NG
Sbjct  25    LASSSLIS-PPSNQGQWNLLQPTIGISAMHMQLTHNDKIIIFDRTDFGPSNLPLS---NG  80

Query  529   TRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRD  705
               C+    D +    C AHSV YD+  NT R L   +DTWCSSG++L NGT++QTGG+ D
Sbjct  81    -ECRMDPYDTALKTDCTAHSVLYDIYTNTFRSLTIQTDTWCSSGSVLPNGTLIQTGGFND  139

Query  706   GSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR  885
             G +RI+ F PC  + C+W     +L + RWYA+NQILP  ++RVII+GGR+   YEF P+
Sbjct  140   GERRIRMFTPCFHENCDWIEFPSYLIERRWYATNQILP--DNRVIIIGGRKQFNYEFFPK  197

Query  886   ----FPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRV  1053
                   +   S  LPFL +T + N   NNLYPF+HL  +G LFIFAN+ SIL +Y++NRV
Sbjct  198   TITSSESSPSSIHLPFLQETNDPNE--NNLYPFVHLLPNGNLFIFANKRSILLDYKQNRV  255

Query  1054  EKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGL  1233
              K+FP + G   R+YPS+GSSV+LPLD      + E+M+CGGA  GA+ EA +G FI+ L
Sbjct  256   VKEFPEISGGDPRNYPSSGSSVLLPLDENLNSIEAEIMVCGGAPRGAFEEASKGNFIQAL  315

Query  1234  KSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEP  1413
              +CG + ++ +   W M+NMP  RVM DM+ILP G I+IINGV+ G AGW NG  P L P
Sbjct  316   NTCGFLKVTDSNPNWIMKNMPIARVMGDMLILPNGDIIIINGVELGTAGWENGRRPVLTP  375

Query  1414  YIYSPGKTV--GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTE  1587
              IY    TV   +RFS+++     R+YHSSA +L DGRVL+ GSNP+  Y F+ V  PT+
Sbjct  376   VIYRSSVTVTESQRFSIMQRASRPRLYHSSAVVLRDGRVLVGGSNPHVNYNFSGVEFPTD  435

Query  1588  LRLQAFVPDYMDRRFDNQRP--KNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEF  1761
             L L+AF P Y+   FD  RP  ++V+ Y+ G       Y   ++V F + K   + D+  
Sbjct  436   LSLEAFSPPYLSPEFDPVRPIIRHVTSYILG-------YRVFYYVTFTVGKFGSASDVSV  488

Query  1762  SAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEG  1941
                +P F+THS  MNQRM+ L+   +   + G   A V  P +   APPGYY++ +V+EG
Sbjct  489   RILAPSFSTHSYGMNQRMVVLKLIGVTEVNFGTYYATVVGPSTQEIAPPGYYILFLVHEG  548

Query  1942  IPSISRWVKF  1971
             +PS   WV+ 
Sbjct  549   VPSSGTWVQL  558



>ref|XP_008221409.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=540

 Score =   450 bits (1157),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 239/533 (45%), Positives = 321/533 (60%), Gaps = 21/533 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A +  G+WQ L +N G+ AMHM L H + VV FD+   G S   L       +C G+   
Sbjct  27    AHAAGGKWQLLQQNIGISAMHMQLLHNDRVVLFDRTNFGNSNLSLPD----GKCVGN---  79

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
                  C AHS EYDV  NT RPL  +SD WCSSG++  +G ++QTGG+ +G +R++ F P
Sbjct  80    ----DCTAHSAEYDVTTNTFRPLTLLSDVWCSSGSVAPDGRLIQTGGFTNGERRVRIFEP  135

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
             C    C+WK  +  L   RWYA++ ILP  + R II+GGRR   YEF P+  +  K   L
Sbjct  136   CTG--CDWKEIENGLAARRWYATDHILP--DGRQIIIGGRRQFNYEFYPKSASTNKVFSL  191

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             PFL QT + +A  NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K +P++PG   RS
Sbjct  192   PFLVQTNDPDAE-NNLYPFVFLNVDGNLFIFANNRAILFDYVKNNVVKTYPQIPGGDPRS  250

Query  1096  YPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             YPSTGS+V+LPL + K R  + EV++CGGA  G+Y +A +G F   L +C R+ I+    
Sbjct  251   YPSTGSAVLLPLKNLKARSIEAEVLVCGGAPTGSYIKATKGTFTGALNTCARIKITDPNP  310

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
             +W +E MP  RVM DM +LP G +L+ING   G AGW  G +P L P +Y P   VG RF
Sbjct  311   QWVLETMPQARVMGDMTLLPDGTVLLINGASNGAAGWELGRNPVLNPVVYRPDNAVGSRF  370

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
                  T I RMYHS+A LL DGRVL+ GSNP+  Y FTNV  PTEL ++AF PDY+D ++
Sbjct  371   EQQNPTTIPRMYHSTAVLLRDGRVLVGGSNPHPDYEFTNVLFPTELSVEAFNPDYLDAKY  430

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
              N RPK VS   +    A ++YGK+  +RF +     +  +  +  +P FTTHS +MN R
Sbjct  431   TNVRPKIVSSISQ----AKINYGKKLTIRFSVMGTLATNSVSVTMVAPSFTTHSFSMNHR  486

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              L L   +++          V  P S   AP GYY++ VV++ IPS   WV+ 
Sbjct  487   SLVLASENVKSVGKSAYEVEVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQI  539



>ref|XP_007017716.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14941.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   449 bits (1155),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 247/540 (46%), Positives = 331/540 (61%), Gaps = 21/540 (4%)
 Frame = +1

Query  361   VLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK  540
             +L+S A    GRWQ L ++ GV AMHM L   + VV FD+   G+S   L    NG +C+
Sbjct  24    ILISAA---DGRWQLLQKSIGVSAMHMQLLRNDRVVMFDRTDFGKSNLPLP---NG-KCR  76

Query  541   GSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKR  717
                 D +    C AHSVEYDVL N  R L   +D WCSSG I+ +G ++QTGG+ DG +R
Sbjct  77    TDPNDTALKVDCTAHSVEYDVLTNKFRALMVQTDVWCSSGAIMPDGNLVQTGGFNDGERR  136

Query  718   IQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM  897
             ++ F+PC   TC+W+     L  +RWYA+N ILP  + R I+VGGRR   YEFVP+  N+
Sbjct  137   VRVFSPC--STCDWQEIPNGLAAKRWYATNHILP--DGRQIVVGGRRQFNYEFVPK--NV  190

Query  898   QKST-DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRM  1074
               +T +LPFL +T +R    NNLYPF+ L+ DG LFIFAN  +IL +Y  N+V K +P +
Sbjct  191   AANTFNLPFLSETNDRGVE-NNLYPFVFLNVDGNLFIFANNRAILLDYVNNKVVKTYPTI  249

Query  1075  PGEGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRM  1251
             PG   RSYPSTGS+V+LPL + K    + EV++CGGA  G+Y EA +G+FI  LK+C RM
Sbjct  250   PGGDPRSYPSTGSAVLLPLKNLKAPAIQAEVLVCGGAPKGSYLEALRGKFIAALKTCARM  309

Query  1252  VISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG  1431
              I+    +W ME MP  RVM+DM++LP G++LIING   G AGW  G +P L P +Y P 
Sbjct  310   TITDPNPQWVMETMPMARVMSDMILLPNGKVLIINGAGSGSAGWELGRNPVLSPALYLPD  369

Query  1432  KTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVP  1611
               +G RF     T I RMYHS+A LL DGRVL+ GSNP+  Y FT V  PTEL L+AF P
Sbjct  370   NKIGSRFQAQTPTTIPRMYHSTAVLLRDGRVLVGGSNPHTFYNFTGVLFPTELSLEAFSP  429

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTH  1791
              Y+D +F+N RP      V    ++ + YGK+  V+  +  K     +  +  +P FTTH
Sbjct  430   AYLDAKFNNLRP----TIVAPKSSSEIQYGKKLTVQVLITGKVAPNLVSVTMVAPSFTTH  485

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             S +MNQR+L L    +   +    N  V  P S   AP G+Y++ VV++ IPS   WVK 
Sbjct  486   SFSMNQRVLVLGNDKVTALEKSTYNIDVTTPRSANLAPAGFYLLFVVHQDIPSQGIWVKL  545



>ref|XP_007046239.1| Glyoxal oxidase-related protein, putative [Theobroma cacao]
 gb|EOY02071.1| Glyoxal oxidase-related protein, putative [Theobroma cacao]
Length=557

 Score =   449 bits (1154),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 255/548 (47%), Positives = 343/548 (63%), Gaps = 29/548 (5%)
 Frame = +1

Query  352   NASVLVSEAAS----GQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRR  519
             N SV V+  +S      G WQ L  + G+ AMH+ L   N V+ FD+  SG S   L   
Sbjct  28    NPSVFVTPTSSLSVVSGGYWQLLQPSVGISAMHVQLLPNNKVIIFDRTDSGPSNLSLPA-  86

Query  520   FNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGY  699
               G+ C  +        C AHS+ YDV++NT RPL  ++DTWCSSG++  NGT++QTGGY
Sbjct  87    --GSFCPKN-------DCTAHSLLYDVVSNTFRPLHVLTDTWCSSGSLDPNGTLIQTGGY  137

Query  700   RDGSKRIQFFAPCVDKTCNW-KPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEF  876
              DG   I+ F+PC    C+W +    HL D RWYA+NQ+LP  + R+II+GGRR  TYEF
Sbjct  138   NDGDHVIRIFSPCDTYACDWYELTATHLIDRRWYATNQVLP--DGRIIILGGRRVFTYEF  195

Query  877   VPR--FPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNR  1050
              P+  F +  KS  L FL +T  R+   NNLYPFLHL  DG LFIFAN+ SILF+Y+K  
Sbjct  196   YPKNDFVSNNKSFYLRFLVET--RDPEENNLYPFLHLLPDGNLFIFANQKSILFDYKKGI  253

Query  1051  VEKKFPRMPGEGSRSYPSTGSSVMLPLDHK-NRFQKVEVMICGGASAGAYTEA-KQGRFI  1224
             V ++FP MPG+  R+YPSTGSSVMLPL         VEV++CGGA AGA+ +A K   F+
Sbjct  254   VLRQFPLMPGDDKRNYPSTGSSVMLPLRLSWTGPPVVEVLVCGGAPAGAFLKADKMKVFV  313

Query  1225  EGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPA  1404
             E  ++CGR+ ++    +W +E MP PRVM+DM++LPTG ++IING   G AGW N  +  
Sbjct  314   EASRTCGRLKVNDPNPQWLIEFMPIPRVMSDMILLPTGDVIIINGAANGTAGWENAVNAV  373

Query  1405  LEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPT  1584
             L P +YS  +   +RF+VL  +KI RMYHS+A LLPDGR+L+ GSNP+  YVFT  P+PT
Sbjct  374   LNPVLYSVNEVPLRRFTVLAPSKIPRMYHSAALLLPDGRILVGGSNPHTRYVFTG-PYPT  432

Query  1585  ELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFS  1764
             +L L+A+ P YMD +F++ RP  +S+     P   + YG+ F V F L   +       +
Sbjct  433   DLSLEAYNPYYMDPKFNSLRPSVLSL----EPGNALVYGQRFGVSFSL-PLYKQGAAYVA  487

Query  1765  AYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGI  1944
               +P FTTHS+ MNQR++ L   S+ +        VV  P +   APPGYYM+ VV+ GI
Sbjct  488   LVAPSFTTHSIGMNQRVVILSTASVVQLSMFNHKLVVVGPTNASVAPPGYYMLFVVHSGI  547

Query  1945  PSISRWVK  1968
             PS + WVK
Sbjct  548   PSHAVWVK  555



>ref|XP_004489989.1| PREDICTED: uncharacterized protein LOC101500908 [Cicer arietinum]
Length=599

 Score =   450 bits (1157),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 253/534 (47%), Positives = 329/534 (62%), Gaps = 18/534 (3%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             G W  L  + G+ AMHM +   N V+ FD+   G S   L    NG  C+ +  D+S   
Sbjct  72    GHWVQLQTSIGISAMHMQVMKDNKVIIFDRTDFGPSNISLS---NG-HCRYNPRDISLKL  127

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD-  744
              C AHS+ YD+ +NT+RPL   +D WCSSG +  NGT++QTGG+ DG  +++ F PC   
Sbjct  128   DCTAHSILYDISSNTLRPLTLQTDAWCSSGALNVNGTLIQTGGFNDGYNKLRTFTPCPQT  187

Query  745   KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFL  924
               C+W    ++L   RWYASNQILP  N R+I+VGGR + +YEFVP+  N      L FL
Sbjct  188   NNCDWNELPQNLTSSRWYASNQILP--NGRIIVVGGRSSFSYEFVPKSLNDVSFFYLRFL  245

Query  925   HQTYERNAGG-NNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
               T + N G  NNLYPFLHL  DG LFIFANR SILF+Y +NRV K+FP +PGE  R+YP
Sbjct  246   QITRDSNPGEENNLYPFLHLLPDGNLFIFANRRSILFDYNRNRVIKEFPIIPGEEKRNYP  305

Query  1102  STGSSVMLPLD----HKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISGN  1266
             STGSSVMLPL+          +VE+M+CGGA  GA+  A K   F+E  ++CGR+ +S  
Sbjct  306   STGSSVMLPLNLTGLGNGSLLEVEIMVCGGAFPGAFELANKHKVFVEASRTCGRLKVSDL  365

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG-KTVG  1443
             K +W ME MP PRVM DM++LPTG ++I+NG   G AGW N A+P   P +Y PG     
Sbjct  366   KPEWVMEVMPMPRVMPDMILLPTGNLIILNGAGNGTAGWENAANPVFYPVLYRPGLADPL  425

Query  1444  KRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMD  1623
              RF +L      RMYHSSA LLPDGR+L+ GSNP+  Y F + P+PTEL L A+ PDY+ 
Sbjct  426   PRFQLLAPASTPRMYHSSAVLLPDGRILVGGSNPHRIYDFRSYPYPTELSLDAYYPDYLG  485

Query  1624  RRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
               F   RP  +SV    + A+   YG  F V F L +      ++ +  +P FTTHS AM
Sbjct  486   PEFGGLRPVIMSVEAVYNTAS---YGGLFSVTFALREVREINGIKVTMVAPSFTTHSFAM  542

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
             NQR+L L  T+ME   N +  A +  P S   APPGYYM+ VV+ GIPS++ WV
Sbjct  543   NQRVLVLEMTAMEEVGNLVYKATIRGPTSLTVAPPGYYMLYVVHAGIPSVAVWV  596



>ref|XP_009337676.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   447 bits (1151),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 237/528 (45%), Positives = 324/528 (61%), Gaps = 21/528 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+WQ L ++ G+ AMHM L   + VV FD+   G+S   L    NG  C   R D     
Sbjct  25    GKWQLLQQSVGISAMHMQLLRNDRVVMFDRTDFGKSNLSLP---NG-EC--VRND-----  73

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS EYDV  NT+R L  ++D WCSSG +  NG ++QTGGY DG + ++ F PC    
Sbjct  74    CTAHSAEYDVKTNTVRALSLLTDVWCSSGAVAPNGRLIQTGGYGDGERNVRVFEPCTG--  131

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+WK  +  L   RWYA++ ILP  N R II+GGRR   YEF P+  +  K   LPFL Q
Sbjct  132   CDWKEFENALGARRWYATDHILP--NGRQIIIGGRREFNYEFYPKTGSSSKVYSLPFLVQ  189

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T +     NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K +P++PG   R YPSTG
Sbjct  190   T-DDAGEENNLYPFVFLNVDGNLFIFANNRAILFDYAKNNVVKTYPQIPGGDPRCYPSTG  248

Query  1111  SSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNME  1287
             S+V+LPL +      + EV++CGGA  G++ +A QG F+E L +C R+ I+  K +W ME
Sbjct  249   SAVLLPLKNLAAPSVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARININNPKPQWVME  308

Query  1288  NMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRA  1467
              MP  RVM DM++LP G +L+ING   G AG+  G +P L P +Y P   +G RF     
Sbjct  309   TMPQARVMGDMLLLPDGTVLLINGASSGTAGYEIGRNPVLNPVVYRPDNAIGSRFEQQNP  368

Query  1468  TKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRP  1647
             T I RMYHS+A LL DGRVL+ GSNP++ Y FTNV  PTELRL+AF PDY+D +++N RP
Sbjct  369   TTIPRMYHSTAILLRDGRVLVGGSNPHEKYEFTNVLFPTELRLEAFSPDYLDAKYNNLRP  428

Query  1648  KNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLR  1827
             + V+   +    A ++YGK+  ++F +     ++ +  S  +P F THS +MNQR+L L 
Sbjct  429   QIVAPISQ----AKINYGKKLSIQFLVKGNLATKSVSVSMVAPSFNTHSFSMNQRLLVLE  484

Query  1828  CTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
               ++++         V  P S   AP GYY++ VV++ IPS + WV+ 
Sbjct  485   AENVKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>emb|CDP08591.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   447 bits (1151),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 243/533 (46%), Positives = 319/533 (60%), Gaps = 18/533 (3%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSR  549
             S A + QG W+ L E  G+ AMHM L H N V+ FD+   G S   L     G RC+   
Sbjct  30    SLATAIQGEWRLLQECIGISAMHMQLLHNNRVIMFDRTDFGNSNISLP----GGRCRRDP  85

Query  550   EDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQF  726
              D++    C AHSV YD+  N  RPL   +DTWCSSG +L +GT++QTGGY DG   ++ 
Sbjct  86    HDVALKTDCTAHSVLYDIGTNNFRPLMVQTDTWCSSGAVLEDGTLVQTGGYNDGDHAVRK  145

Query  727   FAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS  906
             F+PC  + C+W      L   RWYA+NQILP  + R+IIVGGR    YEF  +   +  S
Sbjct  146   FSPCGGEDCDWVEFPNALMRRRWYATNQILP--DGRIIIVGGRGQFNYEFYSQPATV--S  201

Query  907   TDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEG  1086
              DL FL +T  ++ G NNLYPFLHL  DG LFIFAN  SILF+YR+++V ++FP++PG+ 
Sbjct  202   YDLEFLKET--KDEGENNLYPFLHLLPDGNLFIFANTRSILFDYRQSKVVREFPQIPGDA  259

Query  1087  SRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGN  1266
             SR+YPS+GSSV+LP++     +  E+M+CGGA  GA+T A+QG FI    +CGR+ ++  
Sbjct  260   SRNYPSSGSSVLLPINENGPIE-AEIMVCGGAPHGAFTSARQGYFIRASSTCGRLKVTDQ  318

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK  1446
                W ME MP  RVM DM++LPTG ++IING   G AGW N  +P   P IY P      
Sbjct  319   NPAWEMETMPMARVMGDMLLLPTGDVIIINGASSGTAGWENARNPVTRPVIYKPRAMQHN  378

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RFSV+   +  RMYHSSA LL DGRVL+ GSNP+  Y FT V  PT+L L+AF P Y+ +
Sbjct  379   RFSVMETAQRPRMYHSSATLLIDGRVLVGGSNPHVYYKFTGVQFPTDLSLEAFSPPYLAQ  438

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMN  1806
               D  RP+ V +      A  + Y ++F V F ++       L     +P FTTHS +MN
Sbjct  439   LHDPVRPRIVGM------AENITYQRKFSVTFSVNNFLKVASLSVRIIAPSFTTHSFSMN  492

Query  1807  QRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
             QRML L+        +         P SP  AP GYYM+ VV+E IPS   WV
Sbjct  493   QRMLILKFVEAVNVASSTYRITAIGPSSPEIAPKGYYMLFVVHEDIPSTGMWV  545



>gb|KDP21232.1| hypothetical protein JCGZ_21703 [Jatropha curcas]
Length=559

 Score =   447 bits (1151),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 244/534 (46%), Positives = 328/534 (61%), Gaps = 19/534 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W  L E+ GV AMH+ +   N ++ FD+   G S   L    NG +C+ + + +    
Sbjct  37    GSWVLLQESIGVSAMHIQVLKNNKIIIFDRTDFGISNISLP---NG-KCRYNDKYVKPKD  92

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHSV YD+  N++RPL  +++TWCSSG++ + GT++QTGG   G K I+ F PC D +
Sbjct  93    CSAHSVLYDIATNSVRPLMILTNTWCSSGSVDAQGTLIQTGGSSGGEKVIRSFTPCDDDS  152

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W      L   RWYASNQILP  + R+IIVGGRR  TYEF P+   +  +   PFL Q
Sbjct  153   CDWVELSIPLLSRRWYASNQILP--DGRIIIVGGRRVFTYEFYPKESEISDNVLFPFLVQ  210

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T +     NNLYPFLHL  DG LFIFAN  SILF+Y +N V K++P +PG GSR++P TG
Sbjct  211   TRDPKEE-NNLYPFLHLLPDGNLFIFANNRSILFDYTRNEVLKEYPVLPG-GSRNFPCTG  268

Query  1111  SSVMLPLD-----HKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISGNKH  1272
             SSV+LPL        N+  + E+MICGG+  GAYT+A  +  ++E  ++CGR+ +S  K 
Sbjct  269   SSVLLPLRLTGGIDVNKIPETEIMICGGSRPGAYTKAYTEHVYVEATRTCGRLKVSDPKP  328

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
             +W ME MP PRVMNDM++LPTG ++IING   G AGW    +P L P +Y P +   +RF
Sbjct  329   EWIMELMPMPRVMNDMLLLPTGDVIIINGAANGTAGWDVAVNPVLFPVLYLPKEVPTRRF  388

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
              V+  T I RMYHS+AALLPDGR+L+ GSNP+  Y FT  P+ TEL L+AF P Y+D  +
Sbjct  389   VVMNPTNIPRMYHSTAALLPDGRILVGGSNPHARYNFTAYPYKTELSLEAFYPPYLDPMY  448

Query  1633  DNQRPKNVSV-YVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQ  1809
                RP  ++V  VEG+    V Y + F V F L        +     +P FTTHS AMNQ
Sbjct  449   TVFRPSILTVESVEGT----VSYNEMFSVTFVLKVYRSDLGISVVLIAPSFTTHSFAMNQ  504

Query  1810  RMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             RM+ L+  S+E+         V  P +    PPGYYM+ +VN G+PS + W K 
Sbjct  505   RMVVLKTISVEQLSAFGYKVNVIGPTNVNVVPPGYYMLFLVNAGVPSHAVWAKL  558



>ref|XP_007208189.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
 gb|EMJ09388.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
Length=528

 Score =   446 bits (1147),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 242/536 (45%), Positives = 320/536 (60%), Gaps = 19/536 (4%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED-  555
             +  QG+W  L  + G+ AMHM L   N V+ FD+   G S   L     G +C+    D 
Sbjct  6     SGNQGQWHLLHSSIGISAMHMQLLRTNMVIMFDRTDYGPSNISLP----GRQCRHDPNDT  61

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             L    C AHS+ YD+  NT+RPL   +DTWCSSG +  +GT++QTGGY DG   ++ F P
Sbjct  62    LLKVDCTAHSILYDIGTNTLRPLNVQTDTWCSSGAVFPDGTLVQTGGYNDGDHVVRTFTP  121

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR-FPNMQKSTD  912
             C    C+W     +L   RWYASNQILP  + R+IIVGGRR   YEF PR F +  ++  
Sbjct  122   CTGDNCDWLEFPNYLVQRRWYASNQILP--DGRIIIVGGRRQFNYEFYPRNFQDPPRTFW  179

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             L  L QT  R+   NNLYPFLHL  DG LFIFAN  SILFNY +N V ++FP +PG   R
Sbjct  180   LDILRQT--RDQDENNLYPFLHLLPDGNLFIFANTKSILFNYNQNVVVREFPEIPGGEPR  237

Query  1093  SYPSTGSSVMLPLDH---KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISG  1263
             +YPSTGSSV+LPLD     N   + E+++CGGA   ++  A  G FI+ L +CGR+ +SG
Sbjct  238   NYPSTGSSVLLPLDENKPSNVNIEAEIIVCGGAPRNSFVLASGGEFIDALGTCGRLKVSG  297

Query  1264  NKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVG  1443
                 W ME MP PRVM DM++LPTG ++IING   G AGW  G  P  +P IY P +   
Sbjct  298   QNPYWVMEEMPVPRVMADMLLLPTGDVIIINGASLGTAGWEYGRDPVTKPVIYRPSEKPN  357

Query  1444  KRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMD  1623
             +RFSV+  ++  R+YHS+A L+PDGRVL+ GSNP+  Y FT V +PT+L L+AF P YM 
Sbjct  358   RRFSVMAGSQRPRLYHSAAVLVPDGRVLVGGSNPHVYYNFTCVEYPTDLSLEAFSPPYMS  417

Query  1624  RRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
               ++  RP+ VSV        V+ Y + F V F + +      L     +P FTTHS AM
Sbjct  418   VEYEPVRPRIVSV------KEVLGYRQFFSVAFAVPELLSVSVLSVRLVAPSFTTHSFAM  471

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             NQRM+ ++   + R         +  P +   APPGYY++ VV+  IPS + WVK 
Sbjct  472   NQRMIVMKLIGVTRVAPETYEISLVGPSTGEIAPPGYYLLFVVHADIPSSAAWVKL  527



>ref|XP_004291825.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score =   447 bits (1149),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 242/541 (45%), Positives = 322/541 (60%), Gaps = 14/541 (3%)
 Frame = +1

Query  355   ASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTR  534
             ++ L S   +  G+WQ L+ N G+ AMHM L   + VV FD+   G+S   L    NG R
Sbjct  25    STSLFSLTHAAGGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLPLP---NG-R  80

Query  535   CKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGS  711
             C+ +  D +    C AHS EYDV  N IRPL   SD WCSSG++  +GT++QTGG+ DG 
Sbjct  81    CRNNPNDTALKVDCTAHSAEYDVAGNKIRPLFVYSDVWCSSGSVNPSGTLVQTGGFNDGE  140

Query  712   KRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP  891
             KR++ + PC   TC+WK  +  L + RWYA+N  LP  + R II+GGRR   YEF P+  
Sbjct  141   KRVRTYDPCA--TCDWKEIENALTNRRWYATNHELP--DGRQIIIGGRREFNYEFYPKSG  196

Query  892   NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPR  1071
                 +  LPFL +T + NA  NNLYPF+ L+ DG LFIFAN  +ILF+Y   ++ K +P 
Sbjct  197   GSMNAHSLPFLVETSDGNAIENNLYPFVFLNVDGNLFIFANNRAILFDYAAGKIVKTYPT  256

Query  1072  MPGEGSRSYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGR  1248
             +PG   RSYPSTGS+V+LPL   K +    EV++CGGA  G+Y +A  G F+E LK+C R
Sbjct  257   IPGGDPRSYPSTGSAVLLPLKSSKGQVVAAEVLVCGGAPKGSYVKAASGTFVEALKTCAR  316

Query  1249  MVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSP  1428
             + I+    +W ME MP  RVM DM +L  G +LIING   G AGW  G +P L P +Y P
Sbjct  317   IKITDPSPQWGMETMPLARVMGDMTLLANGDVLIINGAGSGTAGWELGRNPVLNPVVYKP  376

Query  1429  GKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFV  1608
                VG RF     + I RMYHS+A LL DGRVL+ GSNP+  Y F+NV  PTEL L+AF 
Sbjct  377   DNAVGSRFEQQNPSTIPRMYHSAAILLRDGRVLVGGSNPHIRYEFSNVLFPTELALEAFS  436

Query  1609  PDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             P Y++ +F + RP   S   +      V YG++  VRF +  K     +  +  SP FTT
Sbjct  437   PSYLESQFASIRPSIFSPLSQ----VTVGYGQKLAVRFSITGKIALNSVSVTMVSPSFTT  492

Query  1789  HSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             HS +MNQR+L L   ++    N      V  P +   AP GYY++ VV++ IPS   WVK
Sbjct  493   HSFSMNQRLLVLASENVIAVGNLKFEVQVTTPATGNLAPSGYYLLYVVHQQIPSEGIWVK  552

Query  1969  F  1971
              
Sbjct  553   I  553



>gb|KDP38596.1| hypothetical protein JCGZ_04521 [Jatropha curcas]
Length=550

 Score =   446 bits (1148),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 244/549 (44%), Positives = 332/549 (60%), Gaps = 20/549 (4%)
 Frame = +1

Query  334   RPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLR  513
             +PC+ +     ++EAA G GRWQ L ++ G+ AMHM L + + VV FD+   G S   L 
Sbjct  20    QPCHRI-----LTEAAGG-GRWQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGISNLSLP  73

Query  514   RRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQT  690
                   +C+    +L     C AHS EYD L N  RPLR +++ WCSSG +  +G ++QT
Sbjct  74    E----GQCRDDPNELVIKTDCTAHSAEYDALTNKFRPLRVLTNVWCSSGAVTPDGRLIQT  129

Query  691   GGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTY  870
             GG+ DG ++++ F+PC    C+W+     L   RWYA+N ILP  N   +I+GGRR  +Y
Sbjct  130   GGFNDGERQVRVFSPCSSTNCDWQEVGNGLKARRWYATNHILPEGNQ--VIIGGRRQFSY  187

Query  871   EFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNR  1050
             EF P+         LPFL QT +RN   NNLYPF+ L+ DG LFIFAN  +ILF+Y+  +
Sbjct  188   EFYPK-TGAADLYSLPFLVQTDDRNIE-NNLYPFVFLNVDGNLFIFANNRAILFDYKLGK  245

Query  1051  VEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIE  1227
             V K +P +PG   RSYPSTGS+V+LPL        + EV++CGGA  G+Y +AK+G F++
Sbjct  246   VVKTYPEIPGGDPRSYPSTGSAVLLPLKKLQATNIEAEVLVCGGAPKGSYVQAKKGNFVK  305

Query  1228  GLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPAL  1407
              L +CGR+ I+    KW MENMP  RVM DM++LP G +LIING   G AGW  G +P L
Sbjct  306   ALDTCGRIKITDPNPKWTMENMPHSRVMGDMILLPNGNVLIINGASAGTAGWEFGRNPVL  365

Query  1408  EPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTE  1587
              P +Y+P K +G RF  L  T I RMYHS+A LL DGRVL+ GSNP+  Y FT V  PTE
Sbjct  366   NPVLYNPDKAIGSRFESLNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYNFTGVLFPTE  425

Query  1588  LRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSA  1767
             L L+AF P Y+D + +N R   VS     +  A + Y ++  VRF +  +  +  +  + 
Sbjct  426   LSLEAFYPPYLDSQNNNLRLTIVS----PASKAKIGYAQKLLVRFKVAGRLDTNTVSVTM  481

Query  1768  YSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIP  1947
              +P FTTHS +MNQR+L L    +        N  V AP SP  APPGYY++ VV++ IP
Sbjct  482   IAPSFTTHSFSMNQRLLVLENEKVTNVGTATYNVEVTAPRSPNIAPPGYYLLYVVHQDIP  541

Query  1948  SISRWVKFA  1974
             S   WV+  
Sbjct  542   SEGIWVQIV  550



>ref|XP_009594288.1| PREDICTED: uncharacterized protein LOC104090813 [Nicotiana tomentosiformis]
Length=581

 Score =   447 bits (1150),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 253/533 (47%), Positives = 334/533 (63%), Gaps = 20/533 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W TL E+ GV AMHM L + N VV FD+   G S   L       +C+ + E L D  
Sbjct  60    GEWVTLQESIGVSAMHMQLLYNNKVVIFDRTDFGPSNLSLP----DGKCRYNDEAL-DVD  114

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD-K  747
             C AHS+ YDV +NT RPL   +D WCSSG + S+GT++QTGGY  G  +I+ F+PC D  
Sbjct  115   CTAHSLLYDVSSNTFRPLMVQTDVWCSSGAVNSDGTLIQTGGYHAGDHKIRLFSPCDDVD  174

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST-DLPFL  924
              C+W    ++L  +RWYAS+ ILP  + RVIIVGGRRA +YEF P+  N+  S   L FL
Sbjct  175   HCDWTELPQNLTVQRWYASDHILP--DGRVIIVGGRRAFSYEFFPK--NVNDSVFYLKFL  230

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              +T +     NNLYPFL++  DG L+IFAN+ S++ +Y  N++ K+FP +PGE  RSYP+
Sbjct  231   KETTDHKEE-NNLYPFLYILPDGNLYIFANQKSVVLDYVNNKIVKEFPMIPGE-KRSYPA  288

Query  1105  TGSSVMLPL----DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             TGSSVMLPL        +   VE+MICGGAS GAY +A++G F+    +CGRM ++    
Sbjct  289   TGSSVMLPLRLTTGDSAQNPVVEMMICGGASGGAYIKAQKGVFMRASSTCGRMRLTDPDP  348

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKR  1449
             KW ME MP  RVM DM++LPTG ++I+NG  +G AGW N   P L P +YSP +    KR
Sbjct  349   KWVMEAMPMGRVMPDMLLLPTGDVIILNGASKGTAGWENAFDPVLNPVLYSPNEPDPSKR  408

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             FSVL  + I RMYHSSA LLPDGR+L+ GSNP+  Y FT V +PTEL L+AF P Y+  +
Sbjct  409   FSVLNPSTIPRMYHSSATLLPDGRILVGGSNPHVRYNFTGVRYPTELSLEAFSPPYLAPQ  468

Query  1630  FDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQ  1809
                 RP  ++  VEG  +  + YG++F + F L    P E+L  S  +P FTTHS  MNQ
Sbjct  469   NSYLRPSILA--VEGQISGFLSYGQQFSITFTLGFYQPEEELMVSMIAPSFTTHSFGMNQ  526

Query  1810  RMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             R+L L    +E+         V APPS   APPGYYM+ VV++ +P    WV+
Sbjct  527   RLLVLDILEIEQLSMFAYKVTVVAPPSRNIAPPGYYMIFVVHQNVPGQCVWVR  579



>ref|XP_009782130.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=588

 Score =   447 bits (1150),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 252/533 (47%), Positives = 333/533 (62%), Gaps = 18/533 (3%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W TL E+ GV AMHM L + N VV FD+   G S   L       +C+ + E L D  
Sbjct  65    GEWVTLQESIGVSAMHMQLLYNNKVVIFDRTDFGPSNLSLP----DGKCRYNDEAL-DVD  119

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD-K  747
             C AHS+ YDV +NT RPL   +D WCSSG + S+GT++QTGGY  G  +I+ F+PC D  
Sbjct  120   CTAHSLLYDVSSNTFRPLMVQTDVWCSSGAVNSDGTLIQTGGYHAGDHKIRLFSPCDDVD  179

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST-DLPFL  924
              C+W    ++L  +RWYAS+ ILP  + RVIIVGGRRA +YEF P+  N       L FL
Sbjct  180   DCDWTELPQNLTVQRWYASDHILP--DGRVIIVGGRRAFSYEFFPKNVNNNDGVFYLQFL  237

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              +T +     NNLYPFL++  DG L++FAN+ S++ +Y  NR+ K+FP +PGE  RSYP+
Sbjct  238   KETTDFKEE-NNLYPFLYILPDGNLYMFANQRSVVLDYVNNRIVKEFPVIPGE-KRSYPA  295

Query  1105  TGSSVMLPL----DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             TGSSVMLPL        +   VEVMICGGAS GAY +A++G F+    +CGRM ++    
Sbjct  296   TGSSVMLPLRLSAGDSAQNPVVEVMICGGASGGAYIKAQKGVFVRASSTCGRMRLTDPDP  355

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKR  1449
             KW ME+MP  RVM DM++LPTG ++I+NG  +G AGW N   P L P +YSP +    KR
Sbjct  356   KWVMEDMPMGRVMPDMLLLPTGDVIILNGASKGTAGWENAFDPVLNPVLYSPNEPDPSKR  415

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             FSVL  + I RMYHSS  LLPDGR+L+ GSNP+  Y FT V +PTEL L+AF P Y+  +
Sbjct  416   FSVLNPSTIPRMYHSSVTLLPDGRILVGGSNPHVRYNFTGVRYPTELSLEAFSPPYLAPQ  475

Query  1630  FDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQ  1809
               + RP  ++  VEG  +  + YG++F + F L    P E+L  S  +P FTTHS  MNQ
Sbjct  476   NSHLRPSILA--VEGQISGFLSYGQQFSITFTLGFYQPEEELMVSMIAPSFTTHSFGMNQ  533

Query  1810  RMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             R+L L    +E+         V APPS   APPGYYM+ VV++ +P    WV+
Sbjct  534   RLLVLDILEIEQLSMFAYKVTVVAPPSRNIAPPGYYMIFVVHQNVPGQCVWVR  586



>ref|XP_009337669.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   445 bits (1145),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 237/528 (45%), Positives = 323/528 (61%), Gaps = 21/528 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+WQ L ++ G+ AMHM L   + VV FD+   G+S   L    NG  C   R D     
Sbjct  25    GKWQLLQQSVGISAMHMQLLRNDRVVMFDRTDFGKSNLPLP---NG-EC--VRND-----  73

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS EYDV  NT+RPL  ++D WCSSG +  NG ++QTGG  DG + ++ F PC    
Sbjct  74    CTAHSAEYDVKTNTVRPLTLLTDVWCSSGAVAPNGRLIQTGGNGDGERNVRVFEPCTG--  131

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+WK  +  L   RWYA++ ILP  N R II+GGRR   YEF P+  +  K   LPFL Q
Sbjct  132   CDWKEFENGLGARRWYATDHILP--NGRQIIIGGRREFNYEFYPKTGSSSKVYSLPFLVQ  189

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T +     NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K +P++PG   R YPSTG
Sbjct  190   T-DDAGEENNLYPFVFLNVDGNLFIFANNRAILFDYAKNNVVKTYPQIPGGDPRCYPSTG  248

Query  1111  SSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNME  1287
             S+V+LPL +      + EV++CGGA  G++ +A QG F+E L +C R+ I+  K +W ME
Sbjct  249   SAVLLPLKNLAAPAVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARININNPKPQWVME  308

Query  1288  NMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRA  1467
              MP  RVM DM++LP G +L+ING   G AGW  G +P L P +Y P   +G RF     
Sbjct  309   TMPQARVMGDMLLLPDGTVLLINGASSGTAGWEIGRNPVLNPVVYRPDNAIGSRFEQQNP  368

Query  1468  TKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRP  1647
             T I RMYHS+A LL DGRVL+ GSNP++ Y FTNV  PTELRL+AF PDY+  +++N RP
Sbjct  369   TTIPRMYHSTAILLRDGRVLVGGSNPHEKYEFTNVLFPTELRLEAFSPDYLGAKYNNLRP  428

Query  1648  KNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLR  1827
             + V+   +    A ++YGK+  ++F +     ++ +  S  +P F THS +MNQR+L L 
Sbjct  429   QIVAPISQ----AKINYGKKLSIQFSVKGNLATKSVSVSMVAPSFNTHSFSMNQRLLVLE  484

Query  1828  CTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
               ++++         V  P S   AP GYY++ VV++ IPS + WV+ 
Sbjct  485   AENVKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_006438575.1| hypothetical protein CICLE_v10031195mg [Citrus clementina]
 gb|ESR51815.1| hypothetical protein CICLE_v10031195mg [Citrus clementina]
Length=535

 Score =   445 bits (1145),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 338/537 (63%), Gaps = 23/537 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+W  L  + G+ AMHM + + + V+ FD+   G S   L    +  R +G   D+    
Sbjct  7     GQWVLLQSSIGISAMHMQVLNNDKVIIFDRTDMGPSNLSLP--IDKCRKEG---DVGQLD  61

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHSV YD+ +NT RPL   +DTWCSSG +LS+GT++QTGGY  G + I+ F PC ++ 
Sbjct  62    CTAHSVLYDIASNTFRPLLLQTDTWCSSGAVLSDGTLVQTGGYNVGDRVIRLFTPCNNEG  121

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W    K+L+D RWYASNQILP  ++R+I+VGGRR  TYEF P+  ++  S  L FL +
Sbjct  122   CDWVELSKNLWDRRWYASNQILP--DNRIIVVGGRRVFTYEFYPKIDSLSSSLYLRFLIE  179

Query  931   TYERNAG-GNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             T  R+ G  NNLYPFLHL  DG LFIFANR SILF+Y  N++ K+FP +PG   R+YPST
Sbjct  180   T--RDPGEENNLYPFLHLLPDGNLFIFANRRSILFDYINNKLVKEFPVIPGNDKRNYPST  237

Query  1108  GSSVMLPL--------DHKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVIS  1260
             GSS++LP+        +        EVM+CGGA AGA+ ++ K+  ++E  ++CGR+ ++
Sbjct  238   GSSILLPVKLSAGSDGNGTAVLPDAEVMVCGGAPAGAFIKSDKESVYVEASRTCGRLKVT  297

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
                  W+ME MP PRVM+DM++LP+G ++IING   G AGW +   P L P +YSP +  
Sbjct  298   DKYPVWSMEFMPMPRVMSDMLLLPSGDVIIINGASNGTAGWEDAVGPNLNPVLYSPDEEE  357

Query  1441  -GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
               +RF VL  +KI RMYHSSA +LPDGR+L+ GSNP+  Y FT  P+PT+L L+AF P Y
Sbjct  358   PDRRFVVLNPSKIPRMYHSSAVVLPDGRILVGGSNPHRRYNFTAYPYPTDLSLEAFHPHY  417

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
             +D      RP  +S+   G     V Y + F V F L    PS ++  S  +P FTTHS 
Sbjct  418   LDPENAYMRPSILSLESIGR---TVSYNEVFSVTFELSSYSPSGEISVSLMTPSFTTHSF  474

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             AMNQR++ L   S+ +        VV  PP+   APPGYYM+ VV+ GIPS + WVK
Sbjct  475   AMNQRLVVLNVVSVSQLSVYAYKVVVNGPPTATVAPPGYYMMFVVHAGIPSHAVWVK  531



>ref|XP_006838081.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
 gb|ERN00650.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
Length=546

 Score =   445 bits (1145),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 236/547 (43%), Positives = 334/547 (61%), Gaps = 16/547 (3%)
 Frame = +1

Query  343   NALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRF  522
             N L   V +  A +  G W+ L EN G+ AMHMAL     VV FD+   G+S   L    
Sbjct  12    NLLPLLVCMFGAIAQLGSWELLQENAGISAMHMALLSNGKVVMFDRTDFGKSNLSLP---  68

Query  523   NGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGY  699
                RC+    +L+    C AHS EYD + N++RPL   +D WCSSG I  +G ++QTGG+
Sbjct  69    -AGRCRSDPNELALTLDCTAHSAEYDPVANSVRPLFVQTDVWCSSGAIAPDGRLIQTGGF  127

Query  700   RDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFV  879
              DG   ++ F PC    C+W+     L   RWYA+NQILP  + R+I++GGRR   YEF 
Sbjct  128   NDGDHVVRVFQPC--DNCDWEEFPSGLAARRWYATNQILP--DGRIIVIGGRRQYNYEFY  183

Query  880   PRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEK  1059
             P+      +    FL +T  ++A  NNLYPF+HLS+DG LF+FAN  S+L +Y  NR+ K
Sbjct  184   PKSEMTAATFLFRFLAET--KDANENNLYPFVHLSTDGNLFVFANNRSVLLDYGGNRIVK  241

Query  1060  KFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQK--VEVMICGGASAGAYTEAKQGRFIEGL  1233
              FP MPG   R+YPS+GSS +LPL          VEV++CGGA  G+Y +A++G+F++ L
Sbjct  242   VFPTMPGGDPRNYPSSGSSTLLPLRISPELSAIPVEVLVCGGAPTGSYDQAREGQFVQAL  301

Query  1234  KSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEP  1413
              +CGR+ I+    +W +E MP  RVM DMV+LPTG +LIING   G AGW  G +P L P
Sbjct  302   DTCGRIRITDPSPQWQIETMPVARVMGDMVLLPTGDVLIINGASAGTAGWEFGRNPVLSP  361

Query  1414  YIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELR  1593
              +Y+P      RF  L +T++ R+YHS+A LLPDGR+L+ GSNP+  Y F+ V  PTELR
Sbjct  362   VLYNPVAPSSARFRTLASTQVPRVYHSTAILLPDGRILVGGSNPHVYYNFSGVLFPTELR  421

Query  1594  LQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYS  1773
             L++F P Y+  +F   RP   ++    S  A + +G++F VRF ++    +E +  +  +
Sbjct  422   LESFSPPYLSPQFSRLRP---NIIFPASNPATIRFGQQFQVRFSVESMVGAEGITVTMVA  478

Query  1774  PPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSI  1953
             P FTTHS +MNQR+L L+ T +      +  A   AP SP+ APPGYY++ VV++G+PS 
Sbjct  479   PSFTTHSFSMNQRLLVLQNTMLTVLSPNVYQANTVAPQSPLLAPPGYYLIFVVHQGVPSS  538

Query  1954  SRWVKFA  1974
             + W + +
Sbjct  539   AIWSRIS  545



>ref|XP_010271447.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=553

 Score =   445 bits (1145),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 245/537 (46%), Positives = 323/537 (60%), Gaps = 17/537 (3%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             L   A  G G+W  L  + G+ AMHM L H + VV FD+   GRS   L       +C+ 
Sbjct  28    LAHAAGVGGGKWDLLKHSIGISAMHMQLLHNDRVVIFDRTDFGRSMLALPH----GKCRH  83

Query  544   SREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
               +D      C AHS EYDV +N+IRPL   +D WCSSG++  +G ++QTGG  DG + +
Sbjct  84    DPKDFVLQVDCTAHSAEYDVSSNSIRPLMVQTDVWCSSGSVSPDGRLIQTGGSNDGERSV  143

Query  721   QFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
             + FAPC    C+W+     L   RWYA+NQILP  + R II+GGR    YEF P+  +  
Sbjct  144   RIFAPC--NGCDWEENSSGLLVPRWYATNQILP--DGRSIIIGGRNQFNYEFYPKSSSTD  199

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
                DLPFL QT + N   NNLYPF+HL+ DG LFIFAN  +IL +Y +N V K+FP+MP 
Sbjct  200   TLFDLPFLSQTNDPNVE-NNLYPFVHLNVDGNLFIFANNRAILLDYTRNVVVKRFPKMPD  258

Query  1081  EGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
               +R YPSTGSSV+LPL    R   + EV+ICGGA  G+Y +A +G F+  L +CGR+ I
Sbjct  259   GHARCYPSTGSSVLLPLKKLKRPSVEAEVLICGGAPKGSYFQAIRGSFVGALSTCGRIKI  318

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +     W+ME MP  RVM DM++LP GQ+L+ING K G AGW  G +P L P IY P   
Sbjct  319   TDESPAWSMETMPLARVMGDMILLPDGQVLMINGAKSGVAGWELGRNPELYPVIYRPNSP  378

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
              G RF V   T I RMYHSSA LL DGRVL+ GSNP++ Y FT V +PTEL L+AF P Y
Sbjct  379   SGSRFHVQNPTTIPRMYHSSALLLRDGRVLVGGSNPHEFYNFTGVLYPTELSLEAFSPGY  438

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAV-VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHS  1794
             +D    + RP+ +S      P+   + YG+   VRF L  +  S+ +  +  +P FTTHS
Sbjct  439   LDPGVSHLRPEIIS-----PPSQTKLKYGQSITVRFSLSGELSSKGVSVTMVAPSFTTHS  493

Query  1795  VAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
              AMNQR+L+L    ++     + +  V  P S   AP GYY++ VV+  +PS   WV
Sbjct  494   FAMNQRLLELDGRQVKPVSKSVYDVQVTIPESGFLAPSGYYLLFVVHTEVPSEGIWV  550



>ref|XP_004237211.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=572

 Score =   446 bits (1146),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 255/531 (48%), Positives = 334/531 (63%), Gaps = 21/531 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W  L E+ GV AMHM L + N V+ FD+   G S   L +     +C+   E L D  
Sbjct  56    GEWVLLHESIGVSAMHMQLLYNNKVIIFDRTDFGASNLSLPQ----GKCRFDDEVL-DVD  110

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHSV YD+L+NT RPL   +D WCSSG + S+GT++QTGGY  G ++I+ F+PC D  
Sbjct  111   CSAHSVLYDILSNTYRPLMVQTDVWCSSGALNSDGTLIQTGGYHTGDRKIRLFSPC-DGD  169

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS---TDLPF  921
             C+W    ++L  +RWYAS+ ILP  + RVIIVGGR+A +YEF P+   M ++     LPF
Sbjct  170   CDWTELPQNLTVQRWYASDHILP--DGRVIIVGGRKAFSYEFFPK--TMDENGGGFQLPF  225

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T +     NNLYPFL++  +G L+IF+N+ SI  +Y  + V ++FP +PGE  RSYP
Sbjct  226   LVETTDP-IEENNLYPFLYILPNGNLYIFSNQRSIELDYVNHNVLREFPMIPGE-KRSYP  283

Query  1102  STGSSVMLPLD-HKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             +TGSSVMLPL   + +   VEVMICGGA  GAY +A +G F  G  SCGRM I+    KW
Sbjct  284   ATGSSVMLPLRLRQGQEPVVEVMICGGAWGGAYVKALEGEFWRGSSSCGRMRITDPDPKW  343

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFS  1455
              ME MP  RVM DM++LPTG +LI+NG   G AGW N   P L P +Y P +    +RF+
Sbjct  344   VMEEMPLGRVMPDMLLLPTGNVLILNGAANGAAGWENAIDPVLNPVLYRPDEPDPRRRFT  403

Query  1456  VLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFD  1635
             VL  TKIARMYHSSA LLPDGR+L+ GSNP+  Y FT V +PTEL L+AF P Y+  ++ 
Sbjct  404   VLTPTKIARMYHSSAILLPDGRILVGGSNPHATYNFTGVKYPTELSLEAFSPPYLATQYA  463

Query  1636  NQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRM  1815
             + RP N ++ V      V+ Y ++F + F L    P  +   S   P FTTHS  MNQR+
Sbjct  464   HLRPLNQAIDV----GQVISYDQQFSITFTLPFPQPDAEFMVSMIPPSFTTHSFGMNQRL  519

Query  1816  LKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             L L    +ER        +V APP+   APPGYYMV VV++G+PS S WVK
Sbjct  520   LFLEIVRVERFFMFGYRVIVFAPPTRNVAPPGYYMVFVVHQGVPSHSVWVK  570



>ref|XP_007030653.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY11155.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=558

 Score =   445 bits (1144),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 248/555 (45%), Positives = 328/555 (59%), Gaps = 29/555 (5%)
 Frame = +1

Query  349   LNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNG  528
             + + VL    A  QG WQ L  + G+ AMHM L H N V+ FD+   G S   L      
Sbjct  18    VTSQVLPLNPAGRQGAWQLLHASVGISAMHMQLLHNNKVIIFDRTDFGPSNLSLPSGL--  75

Query  529   TRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRD  705
               C+    D+     C AHS+ YD+  N  RPL   +DTWCSSG +L NGT++QTGGY D
Sbjct  76    --CRIDPSDIVLQTDCTAHSILYDISTNAFRPLMVQTDTWCSSGAVLPNGTLVQTGGYND  133

Query  706   GSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR  885
             G + I+ F PC D+ C+W    + L   RWYASNQILP  + R+IIVGGRR   YEF P+
Sbjct  134   GDRNIRTFTPCTDEYCDWIEFPQSLLQRRWYASNQILP--DGRIIIVGGRRQFNYEFYPQ  191

Query  886   FPNMQ-----KSTD----LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNY  1038
               N++      STD    L FL +T +     NNLYPFLHL  DG LFIFAN  SIL +Y
Sbjct  192   --NIEGKSSSSSTDHIFGLNFLRETNDYQME-NNLYPFLHLLPDGNLFIFANTRSILLDY  248

Query  1039  RKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGR  1218
              +NRV K+FP++PG   R+YPS+GSSV+LPLD +N   + E+M+CGGA  G++T+A QG 
Sbjct  249   NQNRVVKEFPQIPGGDPRNYPSSGSSVLLPLDDQNEAIEPEIMVCGGAPKGSFTQATQGN  308

Query  1219  FIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGAS  1398
             FI    +CGR+ +S     W ME+MP PRVM DM++LP+G +LIING + G AGW  G  
Sbjct  309   FIRATSTCGRLKVSHANPSWVMEDMPVPRVMGDMILLPSGDVLIINGAEMGTAGWELGRG  368

Query  1399  PALEPYIY-SPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVP  1575
             P   P IY +       RFSV+  +   R+YHSSA LL DGR+L+ GSNP+  Y FTNV 
Sbjct  369   PVTRPIIYRTSDDRPDWRFSVMSPSPRPRLYHSSATLLTDGRILVGGSNPHVFYNFTNVE  428

Query  1576  HPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDL  1755
              PT+L L++F P Y+   +D  RP+ +S+         + YGK F + F +     +  L
Sbjct  429   FPTDLSLESFSPPYLSPEYDPIRPQILSL------DEKIRYGKSFWLSFSVKDYLTASVL  482

Query  1756  EFSAYSPPFTTHSVAMNQRMLKLR---CTSMERGDNGMVNavvaappspvaappGYYMVT  1926
                  +P FTTHS AMNQRM+ L+    T++           +  P +   APPGYY++ 
Sbjct  483   SVRIVAPSFTTHSFAMNQRMVVLKIVGVTTLLPPAPYAYGLSMVGPSTAAIAPPGYYLLF  542

Query  1927  VVNEGIPSISRWVKF  1971
             V++ GIPS   WVK 
Sbjct  543   VLHAGIPSSGMWVKI  557



>ref|XP_007136064.1| hypothetical protein PHAVU_009G014800g [Phaseolus vulgaris]
 gb|ESW08058.1| hypothetical protein PHAVU_009G014800g [Phaseolus vulgaris]
Length=568

 Score =   445 bits (1145),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 253/571 (44%), Positives = 341/571 (60%), Gaps = 25/571 (4%)
 Frame = +1

Query  283   TLPCAITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNT  462
             +L   I  LL+  ++ L P          S A +G G+W  L E+ G+V MHM L H + 
Sbjct  4     SLSLHIIPLLIFHILLLAPP---------SPAEAGNGQWHLLQESIGIVGMHMQLLHNDR  54

Query  463   VVFFDQRGSGRSGYQLRRRFNGTRCKGS-REDLSDPSCYAHSVEYDVLNNTIRPLRFISD  639
             VV  D+   G S   L    NG RC+ +  E +    C AHS+EYDV  N  R L   ++
Sbjct  55    VVILDRTDFGFSNLSLP---NG-RCRNNPNEMVVKTDCTAHSIEYDVAVNKFRSLFVQTN  110

Query  640   TWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILP  819
              WCSSG++  +GT++QTGG+ DG + ++   PC  +TC+W+     L   RWYA+N ILP
Sbjct  111   VWCSSGSVSPDGTLVQTGGFNDGDRAVRALTPC--RTCDWREVDNGLSARRWYATNHILP  168

Query  820   GKNDRVIIVGGRRASTYEFVPRFPNMQKST-DLPFLHQTYERNAGGNNLYPFLHLSSDGY  996
               + R II+GGRR   YEF P+  +  K+T  LPFL QT + +A  NNLYPF+ L+ DG 
Sbjct  169   --DGRQIIIGGRRQFNYEFYPKTQSTAKNTYSLPFLVQTNDASAE-NNLYPFVFLNVDGN  225

Query  997   LFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMIC  1173
             LFIFAN  +ILF+Y KN V   +P++PG   R YPSTGS+V+LPL +    + + EV+IC
Sbjct  226   LFIFANNRAILFDYNKNSVVTTYPQIPGGDPRCYPSTGSAVLLPLKNLRESKVEAEVLIC  285

Query  1174  GGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILII  1353
             GGA  GA+T++  GRF   LK+C R+ I+  K  W ME MPG RVM+DMV+LP G +LI+
Sbjct  286   GGAPRGAFTDSLSGRFTGALKTCARIKITDPKPSWVMETMPGGRVMSDMVLLPNGDVLIV  345

Query  1354  NGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIA  1533
             NG   G AGW  G +P L P++Y P   +G RF +   + I RMYHSSA LL DGRVL+A
Sbjct  346   NGASVGTAGWELGRNPVLNPFLYKPSNRIGSRFELQNPSSIPRMYHSSAVLLRDGRVLVA  405

Query  1534  GSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFH  1713
             GSNP+  Y FTNV  PTELRL+AF P Y++  F N RP  VS     S    V YG+   
Sbjct  406   GSNPHTYYNFTNVMFPTELRLEAFSPAYLEPGFSNVRPTIVS----PSSQTKVKYGETLK  461

Query  1714  VRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappsp  1893
             V F +     ++ +  +  +PPF THS +MNQR+L L   ++ +         V AP S 
Sbjct  462   VGFEVIASLNNDSVSVTMLAPPFATHSFSMNQRLLVLEPQNLSKVGESTYEVEVTAPGSS  521

Query  1894  vaappGYYMVTVVNEGIPSISRWVKFANA*F  1986
             V APPG+Y++ VV+  IPS   WV+   + F
Sbjct  522   VLAPPGFYLLFVVHREIPSHGIWVRMGKSRF  552



>ref|XP_007147126.1| hypothetical protein PHAVU_006G098100g [Phaseolus vulgaris]
 gb|ESW19120.1| hypothetical protein PHAVU_006G098100g [Phaseolus vulgaris]
Length=552

 Score =   444 bits (1143),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 252/561 (45%), Positives = 337/561 (60%), Gaps = 20/561 (4%)
 Frame = +1

Query  298   ITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFD  477
             I  ++   L SL PC    A  L S  A+ QG+WQ L  + G+  MHM L H + V+ FD
Sbjct  6     ILIVIPFVLASLFPC--FQAQTLPSRFAN-QGQWQLLHPSIGISPMHMQLLHNDKVIMFD  62

Query  478   QRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSS  654
             +   G S   L    NG RC+    D++    C AHS  YDV  NT+RPL   +DTWCSS
Sbjct  63    RTDFGHSYLPLS---NG-RCRMDPFDIALKLDCSAHSALYDVATNTLRPLMIQTDTWCSS  118

Query  655   GTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDR  834
             G +L NGT++QTGGY DG + I+ F PC D+TC+W    + L   RWYA+NQILP  + R
Sbjct  119   GAVLPNGTLIQTGGYNDGERNIRMFTPCFDETCDWVEFPRLLSQRRWYATNQILP--DAR  176

Query  835   VIIVGGRRASTYEFVPRFPN---MQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFI  1005
             VI+VGGRR   YEF+P+  N      S  L FL +T + +   NNLYPF+HL  DG LFI
Sbjct  177   VIVVGGRRQFNYEFLPKTANPNSYPSSVPLNFLQRTSDTSE--NNLYPFVHLLPDGNLFI  234

Query  1006  FANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGAS  1185
             FAN  S+LF+Y+ N V K+FP +PGE  R+YPS+GSSV+LPLD      + EV++CGGA 
Sbjct  235   FANTKSVLFDYKLNSVIKEFPPIPGEDPRNYPSSGSSVLLPLDENLVPLQAEVVVCGGAP  294

Query  1186  AGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVK  1365
              G++  A +G F++ L SCGR+ ++     W MENMP PR M DM++LP G ++IINGV 
Sbjct  295   RGSFESALRGSFMQALASCGRLRLTHPNPNWVMENMPMPRAMGDMLLLPNGDVVIINGVG  354

Query  1366  RGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNP  1545
              G AGW +G  P L P I+ P +TV  RFS++      R+YHSSA LL DGRVL+ GSNP
Sbjct  355   AGTAGWEHGREPVLTPLIFRPSETV-NRFSIMAPASRPRLYHSSAVLLKDGRVLVGGSNP  413

Query  1546  NDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFW  1725
             +  Y FT V +PT+L L+AF P Y+   F+  RP     YV  +   V+ +    +V F 
Sbjct  414   HVFYNFTGVEYPTDLSLEAFSPPYLAPEFNPVRPT--IRYVTNN--NVLGFRTFCYVTFS  469

Query  1726  LDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaap  1905
             +     + D+     +P FTTHS   NQRM+ L+   +         A V  P +   AP
Sbjct  470   VSDFGSASDVSIRILAPSFTTHSFGQNQRMVVLKLRGVTYLGGEAYYATVVGPSTAEIAP  529

Query  1906  pGYYMVTVVNEGIPSISRWVK  1968
             PGYY++ VV++G+PS   WV+
Sbjct  530   PGYYILFVVHKGVPSSGWWVQ  550



>ref|XP_004239377.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=567

 Score =   445 bits (1144),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 243/530 (46%), Positives = 335/530 (63%), Gaps = 19/530 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+W  L ++ G+ AMHM L H N VV FD+   G S   L       +C+ + E +    
Sbjct  51    GKWILLHKSIGISAMHMQLLHNNKVVIFDRTDFGSSNLSLPHD----KCRYNDEAIKV-D  105

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK-  747
             C AHS+ Y+V  NT RPL   +D WCSSG +  NGT++QTGGY  G ++I+ F+PC D+ 
Sbjct  106   CTAHSILYNVATNTYRPLTVQTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCFDEE  165

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             TC+W   +++L  +RWY+++ ILP  + R++I+GGR A +YEF P+         LPFL 
Sbjct  166   TCDWTELQQNLTVKRWYSTDHILP--DGRIMIIGGRNAYSYEFFPQSSETDVVFHLPFLK  223

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             +T +     NNLYPFL+L  DG ++IFAN+ SI  +Y KN+V ++FP +PGE  RSYP+T
Sbjct  224   ETTDPKEE-NNLYPFLYLLPDGNVYIFANQRSISLDYAKNKVVREFPVIPGE-KRSYPAT  281

Query  1108  GSSVMLP--LDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWN  1281
             GSSVMLP  L   +    VEVM+CGGA+ GA+  A  G F+   ++CGR+ I+    KW 
Sbjct  282   GSSVMLPMKLVAGDFSPAVEVMVCGGANGGAFLHAAVGGFMPASRTCGRIKITDPDPKWV  341

Query  1282  MENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFSV  1458
             ME+MP  RVM DM++LPTG ++++NG  +G AGW +   P L P++Y PG+    +RFSV
Sbjct  342   MEDMPSGRVMLDMLLLPTGDVILLNGASKGTAGWESAIDPVLNPFLYEPGQPDPNERFSV  401

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             L  T I RMYHSSA L+PDGR+L+ GSNP+  Y FT V +PTEL L+AF+P Y+     N
Sbjct  402   LDPTSIPRMYHSSATLMPDGRILVGGSNPHIRYNFTGVKYPTELSLEAFLPPYLSPHHSN  461

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP N +  VEG     V YG+EF + F L     + ++  +  +P FTTHS AMNQR+L
Sbjct  462   LRPSNTT--VEGP----VSYGQEFSITFTLGVSQDTNEVMVTMVAPSFTTHSFAMNQRLL  515

Query  1819  KLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              L    +++  +      V APPS   APPGYYMV VV++G+P  S WVK
Sbjct  516   ILDIVKIQQVSSFDQKITVYAPPSRNIAPPGYYMVFVVHQGVPGHSIWVK  565



>ref|XP_006344285.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=574

 Score =   445 bits (1145),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 253/530 (48%), Positives = 332/530 (63%), Gaps = 17/530 (3%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W  L E+ GV AMHM L + N V+ FD+   G S   L +     +C+   E L D  
Sbjct  56    GEWVLLHESIGVSAMHMQLLYNNKVIIFDRTDFGASNLSLPQ----GKCRFDDEVL-DVD  110

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV-DK  747
             C AHSV YD+L+NT RPL   +D WCSSG + S+GT++QTGGY  G ++I+ F+PC  D 
Sbjct  111   CSAHSVLYDILSNTYRPLMVQTDVWCSSGALNSDGTLIQTGGYHAGDRKIRLFSPCDGDV  170

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST-DLPFL  924
              C+W    ++L  +RWYAS+ ILP  + RVIIVGGR+A +YEF P+  +       LPFL
Sbjct  171   DCDWTELPQNLTVQRWYASDHILP--DGRVIIVGGRKAFSYEFFPKTMDDNGGVFHLPFL  228

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              +T +     NNLYPFL++  +G L+IF+N+ SI+ +Y  + V ++FP +PGE  RSYP+
Sbjct  229   VETTDPMEE-NNLYPFLYILPNGNLYIFSNQRSIVLDYVNHNVLREFPMIPGE-KRSYPA  286

Query  1105  TGSSVMLPLD-HKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWN  1281
             TGSSVMLPL   + +   VEVMICGGA  GAY +A +G F  G  SCGRM ++    KW 
Sbjct  287   TGSSVMLPLRLRQGQELVVEVMICGGAWGGAYVKALEGEFWRGSSSCGRMTLTDPDPKWV  346

Query  1282  MENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFSV  1458
             ME MP  RVM DM++LPTG +LI+NG   G AGW N   P L P +Y P +    +RF+V
Sbjct  347   MEEMPSGRVMPDMLLLPTGDVLILNGAANGAAGWENAIDPVLNPVLYRPDEPDPRRRFTV  406

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             L  T IARMYHSSA LLPDGR+L+ GSNP+  Y FT V +PTEL L+AF P Y+  ++ +
Sbjct  407   LTPTTIARMYHSSAILLPDGRILVGGSNPHATYNFTGVKYPTELSLEAFSPPYLATQYAH  466

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP N +V V      V+ YG++F + F L    P  +   S   P FTTHS  MNQR+L
Sbjct  467   LRPLNQAVDV----GQVLSYGQQFSITFTLPFPQPDAEFMVSMIPPSFTTHSFGMNQRLL  522

Query  1819  KLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              L    +ER        +V APP+   APPGYYMV VV++G+P  S WVK
Sbjct  523   FLEIVGVERLFMFGYRVIVFAPPTRNIAPPGYYMVFVVHQGVPGHSVWVK  572



>ref|XP_010111102.1| hypothetical protein L484_008478 [Morus notabilis]
 gb|EXC30148.1| hypothetical protein L484_008478 [Morus notabilis]
Length=544

 Score =   444 bits (1142),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 236/533 (44%), Positives = 324/533 (61%), Gaps = 14/533 (3%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDL  558
             A+  GRWQ L ++ G+ AMHM L + + VV FD+   GRS   L       +C+  R D 
Sbjct  23    AAAGGRWQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGRSQLSLP----DGKCRNDRFDT  78

Query  559   S-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +    C AHS EYDV +NT R L   +D WCSSG ++++GT++QTGGY DG +R++ F P
Sbjct  79    ALKVDCTAHSAEYDVTSNTFRALTVQTDVWCSSGAVIADGTLIQTGGYNDGERRVRVFKP  138

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
             C  +TC+W+     L  +RWYA+N ILP  + R II+GGRR   YE+ P+  + +   +L
Sbjct  139   CDGRTCDWQEIDLGLSAKRWYATNHILP--DGRQIIIGGRRQFNYEYYPKDTD-KNVHNL  195

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             PFL +T ++    NNLYPF+ L++DG LF+FAN  +IL+NY  N+V K +P++PG   RS
Sbjct  196   PFLSETNDKRIE-NNLYPFVFLNTDGNLFVFANNRAILWNYASNQVVKTYPQIPGGDPRS  254

Query  1096  YPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             YPSTGS+V+LPL + + R  K EV++CGGA  GAY +A + +F+E LK+C R+ I+    
Sbjct  255   YPSTGSAVLLPLKNIQARNVKAEVLVCGGAPKGAYVQAARKKFVEALKTCARIKITDPNP  314

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
              W +ENMP  RVM DM +LP G +LIING   G AGW N   P L P +Y P    G RF
Sbjct  315   NWVVENMPRARVMGDMALLPNGHVLIINGAGSGTAGWENAIDPVLNPVLYRPDNKAGSRF  374

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
              V   TK  RMYHS+A LL DGR+L+ GSNP+ GY FT V  PT L L+AF P+Y+   F
Sbjct  375   EVENPTKTPRMYHSAAMLLRDGRILVGGSNPHAGYNFTGVTFPTTLSLEAFSPNYLGEEF  434

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
              N RP+     +  +    V Y ++  VRF +        +  +  SP FTTHS +MNQR
Sbjct  435   SNVRPR----ILLPTSHTKVKYAQKLFVRFRIGGNVAQNLVSVTLVSPSFTTHSFSMNQR  490

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             +L L    +        +  VA P S + AP GYY++ V ++ IPS   WV+ 
Sbjct  491   LLVLPSGQIRSLGKKTYDVEVAMPRSAILAPAGYYLLFVNHQEIPSEGVWVQL  543



>ref|XP_009335425.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=547

 Score =   444 bits (1142),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 241/542 (44%), Positives = 326/542 (60%), Gaps = 21/542 (4%)
 Frame = +1

Query  361   VLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK  540
             ++     +  G+W  L +N G+ AMHM L H + VV +D+   G S   L       +C 
Sbjct  21    IISKSTHAATGKWVLLQQNIGITAMHMQLLHNDRVVIYDRTDFGMSNLSLP----DGKC-  75

Query  541   GSREDLSDPS----CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDG  708
               RED +D +    C AHSVEYDV  N+ RPL   +D WCSSG+I  +G ++QTGG+ DG
Sbjct  76    --REDPNDTALKIDCTAHSVEYDVPTNSFRPLMVQTDVWCSSGSISPDGRLIQTGGFNDG  133

Query  709   SKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF  888
              ++++ + PC    C+WK         RWYA+N ILP  + R II+GGRR   YEF P+ 
Sbjct  134   ERKVRIYQPCTG--CDWKEYDNGXXXRRWYATNHILP--DGRQIIIGGRRQFNYEFYPKS  189

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
              +      LPFL QT +     NNLYPF+ L+ DG LFIFAN  +ILFNY KN + K +P
Sbjct  190   ASSSNVYSLPFLVQTNDAKIE-NNLYPFVFLNVDGNLFIFANNRAILFNYVKNIIVKTYP  248

Query  1069  RMPGEGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCG  1245
             ++PG   RSYPSTGS+V+LPL + + +  + EV+ICGGA  G+Y +A +G F+E LK+CG
Sbjct  249   KIPGGDPRSYPSTGSAVLLPLKNLQAQLVEAEVLICGGAPKGSYEKAVKGTFVEALKTCG  308

Query  1246  RMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYS  1425
             R+ I+    +W +E MP  RVM DM +LP G +LIING   G AGW  G +P L P +Y 
Sbjct  309   RIKITDPNPQWVVETMPQARVMGDMTLLPDGTVLIINGAALGTAGWEFGRNPVLNPALYQ  368

Query  1426  PGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAF  1605
             P   VG RF     T I RMYHS+A LL DGRVL+ GSNP+  Y F NV  PTELRL+AF
Sbjct  369   PNNAVGSRFVQQNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYEFKNVLFPTELRLEAF  428

Query  1606  VPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFT  1785
              PDY+D ++ N RPK V+   +G+    + Y ++  VRF +     +  +  +  +P FT
Sbjct  429   NPDYLDAKYANLRPKIVAPKSQGT----ITYAQKLAVRFSVTGTVATNLVSVTMVAPSFT  484

Query  1786  THSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
             THS +MNQR+L L   S+         A+V  P S   AP GYY++ VV++ IPS   WV
Sbjct  485   THSFSMNQRVLVLAAESVTNVALSTYQALVTTPGSGHLAPSGYYLLYVVHQSIPSEGIWV  544

Query  1966  KF  1971
             + 
Sbjct  545   QI  546



>gb|EYU22441.1| hypothetical protein MIMGU_mgv1a024085mg [Erythranthe guttata]
Length=596

 Score =   446 bits (1146),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 249/541 (46%), Positives = 338/541 (62%), Gaps = 24/541 (4%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQL---RRRFNGTRCK  540
             S A  G G W  L E+ GV AMHM L H N +V FD+   G S   L   + RF+    +
Sbjct  71    SAATPGVGEWSLLQESVGVSAMHMQLLHNNKIVIFDRADFGSSNLSLPAGKCRFDP---R  127

Query  541   GSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
              ++ D     C AHS+ YDV +NT RPL   +D WCSSG + S GT++QTGGY DG K+I
Sbjct  128   AAKHD-----CTAHSLLYDVDSNTYRPLMVQTDVWCSSGAVNSLGTLVQTGGYHDGYKKI  182

Query  721   QFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
             + F PC D TC+W     +L  +RWY S+ ILP  +DRVI+VGGRRA +YEF P   N  
Sbjct  183   RTFTPCNDDTCDWVELPLNLTVQRWYGSDHILP--DDRVIVVGGRRAYSYEFFPN--NDN  238

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
             +    P L +T +     NNLYPFLHL  DG LF+FANR S+L +Y+ +R+ +++P +PG
Sbjct  239   RVFPFPLLKETTDPKEE-NNLYPFLHLLPDGNLFVFANRRSLLLDYKNDRIVREYPEIPG  297

Query  1081  EGSRSYPSTGSSVMLPLDHKNR-FQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
             E  R+YP+TGSSVMLPL   N  +  VE++ICGGA  GAY +A +GRF+   KSCGR+ +
Sbjct  298   E-KRNYPATGSSVMLPLKLGNSSYPTVEILICGGARGGAYLKALRGRFMAASKSCGRIRV  356

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-  1434
             +  +  W ME+MP  RVM DM++LPTG ++I+NG  RG AGW  G  P L P +Y P + 
Sbjct  357   TDPEPVWVMEDMPLRRVMPDMLLLPTGDVIIVNGAARGSAGWECGDEPVLSPVMYYPDEP  416

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
                KRFS L  +   RMYHS+A LLPDGR+L+ GSNP+  Y FT   +PT+L L+A+ P 
Sbjct  417   DPAKRFSALSPSTKPRMYHSAAILLPDGRILVGGSNPHVKYNFTAEKYPTDLSLEAYSPP  476

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLD--KKWPSEDLEFSAYSPPFTT  1788
             Y+   + + RP  +S  ++G+    V YG++F + F L   +  P E L  +  +P FTT
Sbjct  477   YLGTEYAHLRPSILS--IDGTEDNAVAYGQQFTISFSLGGFQLVPGEYL-VTMVAPSFTT  533

Query  1789  HSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             HS AMNQR+L L  ++ ++         V APP+   APPGYYM+ VV++G+P  S W+K
Sbjct  534   HSFAMNQRLLVLYVSAEQQIAPFAYKVTVNAPPTANIAPPGYYMLFVVHQGVPCHSVWIK  593

Query  1969  F  1971
              
Sbjct  594   L  594



>ref|XP_002975736.1| hypothetical protein SELMODRAFT_232564 [Selaginella moellendorffii]
 gb|EFJ23365.1| hypothetical protein SELMODRAFT_232564 [Selaginella moellendorffii]
Length=495

 Score =   442 bits (1136),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 243/514 (47%), Positives = 327/514 (64%), Gaps = 23/514 (4%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNN  609
             MHM ++H N V+ FD+   G S  +L       RC+    DL+    C+AHSVE  +   
Sbjct  1     MHMLVSHTNKVLIFDRTDYGPSAIRLPH----GRCRNDSSDLALKIDCWAHSVELQIPTR  56

Query  610   TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDE  789
              IRPL  ++DTWCSSG   ++GT  QTGG+ DG++ ++ +  C D  C+W      L   
Sbjct  57    NIRPLEVLTDTWCSSGAFRADGTFTQTGGWNDGARVVRHYNFCED--CDWTEQPGGLQRP  114

Query  790   RWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYP  969
             RWYASNQILP  ++RVI+VGGR A +YEFVP   ++     LPFL  T +  +  NNLYP
Sbjct  115   RWYASNQILP--DNRVIVVGGRVAFSYEFVPGDGHLYS---LPFLRSTSDGRSE-NNLYP  168

Query  970   FLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRF  1149
             FLHL  DG +F+FAN +SIL +Y+ N+V + +P +PG G+R+YP++GSSVMLPL    RF
Sbjct  169   FLHLLPDGNMFVFANSESILLDYKNNKVVRSYPSLPG-GARNYPASGSSVMLPLLASQRF  227

Query  1150  QKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVIL  1329
             Q+VEV+ICGGAS  AY +A  G F   LK+CGRMV++ N   W +E MP PRVM DM+ L
Sbjct  228   QRVEVLICGGASKTAYKQASSGSFETALKTCGRMVVTDNNPSWILEEMPLPRVMGDMLNL  287

Query  1330  PTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALL  1509
             PTG++LIING ++G AGW    +PAL P +YSP  T   +F+ L +  I RMYHS+A LL
Sbjct  288   PTGEVLIINGAQQGTAGWRFARNPALTPLLYSPSSTSSSKFTTLASASIPRMYHSTAILL  347

Query  1510  PDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAV  1689
             PD RVL+AGSNPN GY F+ V  PTELR++AF P Y+D  FD  R +     +      V
Sbjct  348   PDTRVLVAGSNPNVGYDFSEVLFPTELRIEAFSPPYLDSYFDGVRAE-----ISSMSKVV  402

Query  1690  VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDN-GMVN  1866
             + Y  +  + F +       D E + Y+P F TH+ +MNQR+LKL  ++    +N G   
Sbjct  403   IGYNSQITIEFSVSVL---GDTEATLYAPAFATHAYSMNQRLLKLESSTPVLDENSGYYT  459

Query  1867  avvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              VV APP+   APPGYYM+ VVN G+PSI +W++
Sbjct  460   FVVRAPPTKTIAPPGYYMLFVVNSGVPSIGKWIQ  493



>ref|XP_003523554.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=530

 Score =   443 bits (1139),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 243/535 (45%), Positives = 329/535 (61%), Gaps = 21/535 (4%)
 Frame = +1

Query  373   EAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRE  552
              AA  +G+WQ L +N G+VAMHM L H + V+ FD+   G S   L       RC+ +  
Sbjct  12    HAAEAKGQWQLLHKNIGIVAMHMQLLHNDRVIIFDRTDFGLSNLTLP----DGRCRNNPN  67

Query  553   DLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFF  729
             +L     C AHS+EYDV  NT R L   ++ WCSSG++  +GT++QTGG+ DG + ++ F
Sbjct  68    ELVVKRDCTAHSIEYDVAANTFRALFVQTNVWCSSGSVSPDGTLVQTGGFNDGYRAVRTF  127

Query  730   APCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST  909
              PC  ++C+W   +  L  +RWYA+N ILP  + R II+GGRR   YEF P+    + + 
Sbjct  128   TPC--RSCDWAEVQHGLAAQRWYATNHILP--DGRQIIIGGRRQFNYEFYPK-TQAKNTY  182

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
              LPFL QT + NA  NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V + +P++PG   
Sbjct  183   SLPFLAQTNDANAE-NNLYPFVFLNVDGNLFIFANNRAILFDYNKNSVVRTYPQIPGGDP  241

Query  1090  RSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNK  1269
             R YPSTGS+V+LPL   N   + EV+ICGGA  GA+     G+F+  L++C R+ I+  K
Sbjct  242   RCYPSTGSAVLLPLREPN--VEAEVLICGGAPRGAFRNTLSGKFVGALRTCARIKITDPK  299

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
               W ME MPG RVM+DMV+LP G +LI+NG   G AGW  G +P L P++Y P K VG R
Sbjct  300   ANWVMETMPGARVMSDMVLLPNGDVLIVNGAAVGTAGWELGRNPVLNPFLYKPNKRVGMR  359

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             F V   + I RMYHS A LL DGRVL+AGSNP+  Y FT V  PTELRL+AF P Y++  
Sbjct  360   FEVQNPSHIPRMYHSGAVLLRDGRVLLAGSNPHTYYNFTKVLFPTELRLEAFSPWYLEPG  419

Query  1630  FDNQRPKNVSVYVEGSPAAV--VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
             F N RP  V      SPA+   + YG+   +RF +      + +  +  +PPF THS +M
Sbjct  420   FSNVRPAIV------SPASQTKLKYGQTLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSM  473

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             NQR+L L+   +           V AP S V APPG+Y++ VV++ +PS   WV+
Sbjct  474   NQRLLVLKPHHLSGVGESTHEVEVTAPASAVLAPPGFYLLFVVHQEVPSHGIWVQ  528



>ref|XP_010916153.1| PREDICTED: galactose oxidase-like [Elaeis guineensis]
Length=541

 Score =   443 bits (1140),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 237/525 (45%), Positives = 319/525 (61%), Gaps = 17/525 (3%)
 Frame = +1

Query  397   WQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCY  576
             W  L  + GV AMHM L H + V+ FD+   GRS   L    +G       E +    C 
Sbjct  29    WDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGRSNLSLP---DGKCRNDPNEKVLKIDCT  85

Query  577   AHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCN  756
             AHS EYD+  NT RPL  ++D+WCSSGT+  +G ++QTGG+ DG + ++ F PC D +C+
Sbjct  86    AHSAEYDLATNTFRPLMILTDSWCSSGTVAPDGRLIQTGGWNDGDRAVRTFVPCNDGSCD  145

Query  757   WKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD--LPFLHQ  930
             W    + L   RWYA+NQILP  + R IIVGGR+   +EF P+ PN    T   LPFL  
Sbjct  146   WSEDPQGLAARRWYATNQILP--DGRAIIVGGRKQFNFEFHPK-PNPSDLTTFPLPFLQA  202

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T  ++   +NLYPF+HL+ DG LFIFAN  +IL +Y KN V + +P MPG   R+YPS+G
Sbjct  203   T--KDDVEDNLYPFVHLNIDGNLFIFANNRAILLDYTKNAVVRTYPEMPGGDPRNYPSSG  260

Query  1111  SSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMEN  1290
             SSV+LPL  K    + EV++CGGA  G+YT A++  +++ LK+CGR+ I+     W+ME 
Sbjct  261   SSVLLPL--KPSATEAEVLVCGGAPMGSYTSAREDNYMQALKTCGRIKITDQSPSWSMET  318

Query  1291  MPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRAT  1470
             MP PRVM DM++LP+G++L++NG   G AGW  G  P L P +Y P    G RF V    
Sbjct  319   MPTPRVMGDMILLPSGEVLLLNGAAAGTAGWELGHEPVLTPVLYRPESMAGSRFQVQNPA  378

Query  1471  KIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPK  1650
              I R+YHSSA L+ DGRVL+ GSNP+  Y FT V  PTEL L+AF P+Y+     N RPK
Sbjct  379   TIPRLYHSSAILIRDGRVLVGGSNPHVYYNFTGVDFPTELSLEAFSPEYLSSENSNSRPK  438

Query  1651  NVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRC  1830
                + +  SP + ++YGK+F +RF +        +  +  +P F+THS +MNQR+L L  
Sbjct  439   ---IDISASPIS-LNYGKQFSMRFAV-GAISGGGVTVTMAAPAFSTHSFSMNQRLLILET  493

Query  1831  TSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
              +   GDN        AP S V AP GYY+V VVN GIPS   W 
Sbjct  494   GTALSGDNSSYEVTAVAPASGVLAPSGYYLVFVVNGGIPSEGVWA  538



>ref|XP_006392509.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
 gb|ESQ29795.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
Length=548

 Score =   443 bits (1140),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 236/533 (44%), Positives = 330/533 (62%), Gaps = 27/533 (5%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RW+ L+ N G+ AMHM L H   V+ FD+   G S   L     G  C+    D +    
Sbjct  33    RWELLVPNIGISAMHMQLLHNGMVIMFDRTDFGVSNLSLP----GGICRFDPSDTAVKFD  88

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDK  747
             C AHSV YDV++NT R L+  +DTWCSSG++L NGT++QTGGY DG +  + F+PC   +
Sbjct  89    CSAHSVLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERATRMFSPCGYGE  148

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQK--STDLPF  921
             TC+W    ++L   RWYA+NQILP  + R+I+VGGRR   +EF PR P+  +   +   F
Sbjct  149   TCDWIEFPQYLAQRRWYATNQILP--DGRIIVVGGRRQFNFEFFPR-PDHHRYRGSRFDF  205

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T +  +  NNLYPFLHL  DG LF+FAN  SI+F+Y+ NR+ ++FP +PG   R+YP
Sbjct  206   LRETTD-GSNENNLYPFLHLLPDGNLFVFANTRSIVFDYKSNRIVREFPEIPGGDPRNYP  264

Query  1102  STGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAK-QGRFIEGLKSCGRMVISGNKHKW  1278
             S+GSS++ P+D      +VE+M+CGGA  GA++ AK Q  F   + +CGR+ ++     W
Sbjct  265   SSGSSILFPIDETKNTMEVEIMVCGGAPKGAFSRAKSQHGFTRAISTCGRLKLTDQNPSW  324

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              ME MP PRVM DM++LPTG ++I+NG   G AGW N   P   P IY P     +RFS+
Sbjct  325   EMETMPLPRVMGDMLLLPTGNVIIVNGAGAGTAGWENACDPVTRPVIYHP---FDRRFSI  381

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             +  +   RMYHSSA LLPDGRVL+ GSNP+  Y FTNV +PTEL L+A+ P Y+    D+
Sbjct  382   MSTSSRPRMYHSSAVLLPDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPYLSFTSDS  441

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RPK +      +   VV Y + F+V F + +   ++ L     +P FTTHS+AMNQRM+
Sbjct  442   IRPKIL------TNDKVVSYKRLFNVDFSIPQFLTTDLLSVRIVAPSFTTHSLAMNQRMV  495

Query  1819  KLRCTSMERGDNGMVNavvaap---pspvaappGYYMVTVVNEGIPSISRWVK  1968
              L+  S+ R   G+ N+         +   APPGYYM+ +V+ G+PS+  WV+
Sbjct  496   ILKLLSVTR--EGLTNSYRINALGPSTAEIAPPGYYMMFLVHAGVPSVGAWVQ  546



>ref|XP_011071032.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=607

 Score =   445 bits (1145),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 248/541 (46%), Positives = 328/541 (61%), Gaps = 19/541 (4%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSR  549
             S+   G G W  L E  GV AMHM L + N V+ FD+   G S   L       +C+ S 
Sbjct  76    SDTMVGGGEWSLLQETIGVSAMHMQLLYNNKVLIFDRTDFGPSNLTLP----SGKCRHSD  131

Query  550   EDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFF  729
             E +S   C AHS+ YDV +NT RPL   +D WCSSG + S GT++QTGGY  G  +I+ F
Sbjct  132   EAVSQ-DCTAHSLLYDVASNTYRPLLVKTDVWCSSGAVNSEGTLIQTGGYHGGGHKIRLF  190

Query  730   APCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST  909
              PC D  C+W    ++L   RWY+S+ ILP  + RVIIVGGR + +YEF P+        
Sbjct  191   RPCDDDQCDWIELHQNLTVHRWYSSDHILP--DGRVIIVGGRSSFSYEFFPKNTFENSFY  248

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
               PFL +T +     NNLYPFL+L  DG LF+FAN+ S+L NY+KN++ K+FP +PGE  
Sbjct  249   YFPFLKETTDMKEE-NNLYPFLYLLPDGNLFVFANQRSVLLNYKKNKIVKEFPVIPGE-K  306

Query  1090  RSYPSTGSSVMLPL-------DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGR  1248
             R+YP+TGSSVMLPL       D      +VEVM+CGGA  GAY +A +G ++    SCGR
Sbjct  307   RTYPATGSSVMLPLKLTAGEWDDSPSHPEVEVMVCGGARGGAYMKAVEGLYVAASSSCGR  366

Query  1249  MVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSP  1428
             + ++  + KW ME+MP  RVM DM++LPTG ++I+NG   G AGW    +P L P IY P
Sbjct  367   IRVTDQEPKWEMEDMPMGRVMPDMLLLPTGDVIIVNGAANGTAGWECAINPVLNPVIYKP  426

Query  1429  GK-TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAF  1605
              +    KRFSVL  TKIARMYHS+A LLPDGRVL+ GSNP+  Y FT V +PTEL L+AF
Sbjct  427   YEPDPTKRFSVLNPTKIARMYHSAATLLPDGRVLVGGSNPHVRYNFTGVRYPTELSLEAF  486

Query  1606  VPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFT  1785
              P Y+     + RP  +S   EG    V+ YG++F + F L       +   +  +P FT
Sbjct  487   SPPYLASEHAHLRPSILS--TEGPSNNVISYGQQFAITFTLGMYQHVGEYMVAMAAPSFT  544

Query  1786  THSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
             THS AMNQR+L L   +  +         V APP+   APPGYYM+ VV++G+P    W+
Sbjct  545   THSFAMNQRLLVLYVVNAHQLSAFDHKVTVYAPPTANIAPPGYYMLFVVHQGVPGHCVWI  604

Query  1966  K  1968
             +
Sbjct  605   R  605



>ref|XP_007160695.1| hypothetical protein PHAVU_001G009200g [Phaseolus vulgaris]
 gb|ESW32689.1| hypothetical protein PHAVU_001G009200g [Phaseolus vulgaris]
Length=552

 Score =   443 bits (1140),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 249/541 (46%), Positives = 330/541 (61%), Gaps = 21/541 (4%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK-GS  546
             S  AS  G+WQ L +  G+VAMHM L H +TVV FD+   G S   L     G RC+   
Sbjct  23    SVVASAAGQWQLLHKTIGIVAMHMQLLHTDTVVIFDRTDFGLSNLSLA----GGRCRHDP  78

Query  547   REDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQF  726
              E +    C AHSVEYDV +NT RPL   ++ WCSS  + ++GT++QTGG+ DG + ++ 
Sbjct  79    DEKVVKTDCTAHSVEYDVASNTFRPLFLQTNIWCSSAAVAADGTLVQTGGFNDGERTVRT  138

Query  727   FAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS  906
             F PC   TC+W+     L   RWYA+NQ LP  + R II+GGRR   YEF P+     K+
Sbjct  139   FLPC--ATCDWREFPDGLAVRRWYATNQKLP--DGRQIIIGGRRQFNYEFYPKSDATAKN  194

Query  907   T-DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
             T  LPFL QT + +   NNLYPF+ L+ DG LFIFAN  +IL +Y KN V K FP +PG 
Sbjct  195   TYSLPFLVQTNDPSEE-NNLYPFVFLNVDGTLFIFANNRAILLDYTKNAVVKTFPNIPGN  253

Query  1084  GSRSYPSTGSSVMLPLDHKNR---FQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
               R YPSTGS+V+LPL  KN      + EV+ICGGA  GAYT+AK+G FI  L++C R+ 
Sbjct  254   DPRCYPSTGSAVLLPLRSKNPNFFSPEAEVLICGGAPRGAYTQAKKGTFIGALRTCARIK  313

Query  1255  ISGNKHKWNMENMPGP--RVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSP  1428
             I+     W ME MPG   R+M+DM++LP G +LI+NG   G AGW  G  P L P++Y+P
Sbjct  314   ITDPNPTWVMETMPGGKGRLMSDMILLPNGNVLIVNGAGSGSAGWEFGRDPVLAPFVYNP  373

Query  1429  GKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFV  1608
              K  G RF +L AT   RMYHSSA L+ DGRVL+AGSNP+ GY F++V  PT+L ++AF 
Sbjct  374   DKEFGSRFEILNATNTPRMYHSSAVLVRDGRVLVAGSNPHVGYNFSHVTFPTDLSVEAFS  433

Query  1609  PDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             P Y++  F N RP+     V       V YG++  VR  +        +  +  +PPF T
Sbjct  434   PPYLEAAFRNVRPR----IVGPESGTRVAYGQKVKVRVDVAAALVRSLVRVTVLAPPFAT  489

Query  1789  HSVAMNQRMLKLRCTSMERGDNGMV-NavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
             HS +MNQRML L  + +   D        V AP SP+ APPG+Y++ VV++ IPS   W+
Sbjct  490   HSFSMNQRMLVLEPSHVTNVDGPTTFELEVTAPGSPILAPPGFYLLFVVHQEIPSEGIWI  549

Query  1966  K  1968
             +
Sbjct  550   Q  550



>ref|XP_009335433.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   442 bits (1138),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 241/537 (45%), Positives = 324/537 (60%), Gaps = 23/537 (4%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             VS   +  G+WQ L ++ G+ AMHM L H + V+ FD+   G S   L    NG  C  +
Sbjct  17    VSLTHAAGGKWQLLQQSVGISAMHMQLLHNDRVIMFDRTDFGPSNLSLP---NGA-CVNN  72

Query  547   REDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQF  726
                     C AHS EYDV  NT+RPL  +SD WCSSG +  +G ++QTGG   G +R++ 
Sbjct  73    -------DCTAHSAEYDVKTNTVRPLTVLSDVWCSSGAVAPDGRLIQTGGNGAGERRVRI  125

Query  727   FAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS  906
             F PC    C+WK  +  L   RWYA++ ILP  N R II+GGR    YEF P+  +    
Sbjct  126   FEPCTG--CDWKEIENALNARRWYATDHILP--NGRQIIIGGRGQFNYEFYPKTKSSSNL  181

Query  907   TDLPFLHQTYERNAGG-NNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
               LPFL QT   +AG  NNLYPF+ L+ DG LFIFAN  +ILFNY K +V + +P++PG 
Sbjct  182   YSLPFLTQT--NDAGEENNLYPFVFLNMDGNLFIFANNRAILFNYAKKQVVQTYPQIPGG  239

Query  1084  GSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
               R YPSTGS+V+LPL + K    + EV++CGGA  G++ +  QG F+E LK+C R+ I+
Sbjct  240   DPRCYPSTGSAVLLPLKNLKAPSVEAEVLVCGGAPKGSFAKVNQGTFVEALKTCARIEIN  299

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
                 +W +E MP  RVM DM++LP G +L+ING   G AGW NG +P L P +Y P   +
Sbjct  300   NPNAQWVVETMPQARVMGDMLLLPDGTVLLINGASSGTAGWENGRNPVLNPIVYRPDNAI  359

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF     T I RMYHS+A LL DGRVLI GSNP+D Y FTNV  PTELRL+AF PDY+
Sbjct  360   GSRFEQQNPTTIPRMYHSTAILLRDGRVLIGGSNPHDKYEFTNVLFPTELRLEAFSPDYL  419

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             D  ++N RP      V  +  A ++YGK+  ++F +     S+ +  S  +P F THS +
Sbjct  420   DATYNNLRP----TIVAPNSQAKINYGKKLSIQFSVKGNLVSKSVSVSMVAPSFNTHSFS  475

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             MNQR+L L   ++ +G        V  P S   AP GYY++ VV++ IPS + WV+ 
Sbjct  476   MNQRLLVLGAENIIKGGTTTYEVQVTTPASRNLAPSGYYLLYVVHQQIPSAAIWVQI  532



>ref|XP_007225625.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
 gb|EMJ26824.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
Length=546

 Score =   443 bits (1139),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 240/537 (45%), Positives = 320/537 (60%), Gaps = 15/537 (3%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             +S   +  G+W  L +N G+ AMHM L H + VV FD+   G+S   L       +C+  
Sbjct  22    ISLTHAAGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPE----GQCRND  77

Query  547   RED-LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
               D +    C AHS EYD   N+ RPL   +D WCSSG++  +G+++QTGG+ DG +R++
Sbjct  78    PNDTVLKVDCTAHSAEYDAPTNSFRPLMVQTDVWCSSGSVAQDGSLIQTGGFNDGERRVR  137

Query  724   FFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQK  903
              F  C    C+WK     L   RWYA+N ILP  + R II+GGRR   YEF P+  +   
Sbjct  138   IFQSCTG--CDWKEYDNGLAARRWYATNHILP--DGRQIIIGGRRQFNYEFYPKSESSSN  193

Query  904   STDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
                LPFL QT +     NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K +P++PG 
Sbjct  194   VHSLPFLVQTNDPKVE-NNLYPFVFLNVDGNLFIFANNRAILFDYVKNVVVKTYPQIPGG  252

Query  1084  GSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
               RSYPSTGS+V+LPL + + +F + EV++CGGA  G+Y +A  G F+E LK+CGR+ I+
Sbjct  253   EPRSYPSTGSAVLLPLKNLQAQFVEAEVLVCGGAPKGSYAKAVNGTFVEALKTCGRIKIT  312

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
                 +W +E MP  RVM DM +LP G +LIING   G AGW  G +P L P IY P   V
Sbjct  313   DPNPQWVVETMPQARVMGDMTLLPDGTVLIINGAAVGTAGWEFGRNPVLNPVIYRPDNAV  372

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF     T I RMYHS+A LL DGRVL+ GSNP+  Y FTNV  PTELRL++F PDY+
Sbjct  373   GSRFEQQNPTTIPRMYHSTAVLLRDGRVLVGGSNPHIYYEFTNVLFPTELRLESFNPDYL  432

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             D +  N RPK V+   +    A ++YG++  VRF +        +  +  +P FTTHS +
Sbjct  433   DAKSVNLRPKIVAPQSQ----AKINYGQKLAVRFSVAGTVAPNLVLVTMVAPSFTTHSFS  488

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             MNQR+L L   S            V  P S   AP GYY++ VV++ IPS   WV+ 
Sbjct  489   MNQRLLVLAAESATNVAKSTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQI  545



>ref|XP_004291826.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score =   443 bits (1139),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 240/541 (44%), Positives = 321/541 (59%), Gaps = 14/541 (3%)
 Frame = +1

Query  355   ASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTR  534
             ++ L S   +  G+WQ L+ N G+ AMHM L   + VV FD+   G+S   L    NG  
Sbjct  25    STSLFSLTHAAGGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLSLP---NGV-  80

Query  535   CKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGS  711
             C+ +  D +    C AHS EYDV  N IRPL   SD WCSSG++  +GT++QTGG+ DG 
Sbjct  81    CRNNPNDTALKVDCTAHSAEYDVAGNKIRPLFVYSDVWCSSGSVNPSGTLVQTGGFNDGE  140

Query  712   KRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP  891
             KR++ + PC   TC+WK  +  L + RWYA+N ILP  + R II+GGRR   YEF P+  
Sbjct  141   KRVRTYDPCA--TCDWKEIENALTNRRWYATNHILP--DGRQIIIGGRRQFNYEFYPKSE  196

Query  892   NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPR  1071
                 +  LPFL +T +  A  NNLYPF+ L+ DG LFIFAN  +ILF+Y   ++ K +P 
Sbjct  197   GSMNAHSLPFLVETSDGTAIENNLYPFVFLNVDGNLFIFANNRAILFDYAAGKIVKTYPT  256

Query  1072  MPGEGSRSYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGR  1248
             +PG   RSYPSTGS+V+LPL   K +    EV++CGGA  G+Y  A+ G F+E LK+C R
Sbjct  257   IPGGDPRSYPSTGSAVLLPLKSSKGQVVAAEVLVCGGAPKGSYVNAESGTFVEALKTCAR  316

Query  1249  MVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSP  1428
             + I+    +W ME MP  RVM DM +L  G +LIING  +G AGW  G +P L P +Y  
Sbjct  317   IKITDPNPQWVMETMPLARVMGDMTLLANGDVLIINGAGQGTAGWELGRNPVLNPVVYKS  376

Query  1429  GKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFV  1608
                VG RF     + I RMYHS+A LL DGRVL+ GSNP+  Y F+NV  PTEL L+AF 
Sbjct  377   DNAVGSRFEQQNPSTIPRMYHSTAILLRDGRVLVGGSNPHIRYEFSNVMFPTELALEAFS  436

Query  1609  PDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             P Y++ +F + RP   S   +      V YG++  VRF +  K     +  +  SP FTT
Sbjct  437   PSYLESQFASIRPSIFSPLSQ----VTVGYGQKLAVRFSITGKIALNSVSVTMVSPSFTT  492

Query  1789  HSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             HS +MNQR+L L   ++    N      V  P +   AP GYY++ VV++ IPS   WVK
Sbjct  493   HSFSMNQRLLVLASENVIAVGNLKFEVQVTTPATGNLAPSGYYLLYVVHQQIPSEGIWVK  552

Query  1969  F  1971
              
Sbjct  553   I  553



>ref|XP_003527766.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=558

 Score =   442 bits (1138),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 246/534 (46%), Positives = 330/534 (62%), Gaps = 19/534 (4%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS-RED  555
             A+ +G+WQ L +N G+VAMHM L H + V+ FD+   G S   L       RC+ +  E 
Sbjct  38    AAAKGQWQLLHKNIGIVAMHMQLLHNDRVIIFDRTDFGLSNLTLP----DGRCRNNPNEM  93

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +    C AHSVEYDV+ NT R L   ++ WCSS +   +GT++QTGG+ DG + ++ F P
Sbjct  94    VVKTDCTAHSVEYDVVANTFRALFVQTNVWCSSASASPDGTLVQTGGFNDGDRAVRTFTP  153

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
             C  +TC+WK     L   RWYA+N ILP  + R II+GGRR   YEF P+    + +  L
Sbjct  154   C--RTCDWKEIDDGLAARRWYATNHILP--DGRQIIIGGRRQFNYEFYPK-TQAKNTYSL  208

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             PFL QT + NA  NNLYPF+ L+ DG LFIF+N  +ILF+Y KN V + +P++PG   R 
Sbjct  209   PFLVQTNDANAE-NNLYPFVFLNVDGNLFIFSNNRAILFDYNKNSVVRTYPQIPGGDPRC  267

Query  1096  YPSTGSSVMLPLDHKNRFQKVE--VMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNK  1269
             YPSTGS+V+LPL +  R  KVE  V+ICGGA  GAY  A  G+F+  L++C R+ I+   
Sbjct  268   YPSTGSAVLLPLKNL-RAPKVEAEVLICGGAPRGAYQNALSGKFVPALETCARIKITDPN  326

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
              KW+ME MPG RVM+DMV+LP G +LI+NG   G AGW  G +P L P++Y P   VG R
Sbjct  327   PKWDMETMPGARVMSDMVLLPNGDVLIVNGAAVGTAGWELGRNPLLSPFLYKPNNRVGSR  386

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             F V  ++ I RMYHSSA LL DGRVL+AGSNP+  Y FTNV  PTELRL+AF P Y++  
Sbjct  387   FEVQTSSDIPRMYHSSAVLLRDGRVLVAGSNPHIYYKFTNVLFPTELRLEAFSPWYLEPG  446

Query  1630  FDNQRPKNVSVYVEGSPAAVVDYGKEFHVRF-WLDKKWPSEDLEFSAYSPPFTTHSVAMN  1806
             F + RP      V  +    + YG+   +RF  +      + +  +  SPPF THS +MN
Sbjct  447   FSSVRP----TIVFPASQTKLKYGQTLRLRFEVMSATLVGDSVSVTMLSPPFNTHSFSMN  502

Query  1807  QRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             QRML L    + +         V AP S V APPG+Y++ +V++ IPS   WV+
Sbjct  503   QRMLVLEPHDLSKVGESTYEVEVTAPVSAVLAPPGFYLLFLVHQEIPSQGIWVQ  556



>ref|XP_008387971.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   442 bits (1136),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 235/530 (44%), Positives = 322/530 (61%), Gaps = 25/530 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+WQ L ++ G+ AMHM L H + VV FD+   G S   L    NG  C  +        
Sbjct  25    GKWQLLQQSVGISAMHMQLLHNDRVVMFDRTDFGPSNLSLP---NGA-CVNN-------D  73

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS EYDV  NT+RPL  +SD WCSSG +  +G ++QTGG   G +R++ F PC    
Sbjct  74    CTAHSAEYDVKTNTVRPLTVLSDVWCSSGAVAPDGRLIQTGGNGAGERRVRIFEPCTG--  131

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+WK  +  L   RWYA++ ILP  N R II+GGR    YEF P+  +      LPFL Q
Sbjct  132   CDWKEIENALNARRWYATDHILP--NGRQIIIGGRGQFNYEFYPKTKSSSNLYSLPFLTQ  189

Query  931   TYERNAGG--NNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
             T   N  G  NNLYPF+ L+ DG LFIFAN  +ILFNY K +V + +P++ G   R YPS
Sbjct  190   T---NGAGEENNLYPFVFLNVDGNLFIFANNRAILFNYAKKQVVQTYPQISGGDPRCYPS  246

Query  1105  TGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWN  1281
             +GS+V+LPL + K    + EV++CGGA  G++ +  QG F+E LK+C R+ I+    +W 
Sbjct  247   SGSAVLLPLKNLKAPSVEAEVLVCGGAPKGSFAKVNQGTFVEALKTCARIEINNPNPQWV  306

Query  1282  MENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVL  1461
             +E MP  +VM DM++LP G +L+ING   G AGW NG +P L P +Y P  ++G RF   
Sbjct  307   VETMPQAKVMGDMLLLPDGTVLLINGASSGTAGWENGRNPVLNPVVYRPDNSIGSRFEQQ  366

Query  1462  RATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQ  1641
               T I RMYHS+A LL DGRVL+ GSNP+D Y FTNV  PTELRL+AF PDY+D +++N 
Sbjct  367   NPTTIPRMYHSTAILLRDGRVLVGGSNPHDKYEFTNVLFPTELRLEAFSPDYLDAKYNNL  426

Query  1642  RPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLK  1821
             RPK  +   +    A ++YGK+  ++F +     ++ +  S  +P F THS +MNQR+L 
Sbjct  427   RPKINAPKSQ----AKINYGKKLSIQFSVKGNLVTKSVSVSMAAPSFNTHSFSMNQRLLV  482

Query  1822  LRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             L   ++ +G        V  P S   AP GYY++ VV++ IPS + WV+ 
Sbjct  483   LEAENIIKGGTTTYEVQVTTPASRNLAPSGYYLLYVVHQEIPSAAIWVQI  532



>ref|XP_010105252.1| hypothetical protein L484_019394 [Morus notabilis]
 gb|EXC04187.1| hypothetical protein L484_019394 [Morus notabilis]
Length=544

 Score =   442 bits (1136),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 235/533 (44%), Positives = 327/533 (61%), Gaps = 14/533 (3%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDL  558
             A+  GRWQ L ++ G+ AMHM L + + VV FD+   GRS   L       +C+  R D 
Sbjct  23    AAAGGRWQLLQKSIGIPAMHMQLLNNDRVVIFDRTDFGRSQLSLP----DGKCRNDRFDT  78

Query  559   S-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +    C AHS EYDV +NT R L   +D WCSSG ++++GT++QTGGY DG +R++ F P
Sbjct  79    ALKVDCTAHSAEYDVTSNTFRALTVQTDVWCSSGAVMADGTLIQTGGYNDGERRVRVFKP  138

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
             C  +TC+W+     L  +RWYA+N ILPG   R II+GGRR   YE+ P+  + +   +L
Sbjct  139   CDGRTCDWQEIDLGLSAKRWYATNHILPG--GRQIIIGGRRQFNYEYYPKDTD-KNVHNL  195

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             PFL +T ++    NNLYPF+ L++DG LF+FAN  +IL+NY +N+V K++P++PG   RS
Sbjct  196   PFLSETNDKGIE-NNLYPFVFLNTDGNLFVFANNRAILWNYARNQVVKRYPQIPGGDPRS  254

Query  1096  YPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             YPSTGS+V+LPL + + R  + EV++CGGA  GAY +A + +F+E LK+C R+ I+  K 
Sbjct  255   YPSTGSAVLLPLKNIQARNVEAEVLVCGGAPKGAYVQAARKKFVEALKTCARIKITDPKP  314

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
              W +ENMP  RVM DM +LP G +LIING   G AGW N   P L P +Y P    G RF
Sbjct  315   NWVVENMPRARVMGDMALLPNGHVLIINGAGSGTAGWENAIDPVLNPVLYRPDNKAGSRF  374

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
                  T   RMYHS+A LL DGR+L+ GSNP+ GY FT V  PT L L+AF P+Y++ +F
Sbjct  375   EDENPTTTPRMYHSTAVLLRDGRILVGGSNPHVGYNFTGVTFPTTLSLEAFSPNYLEAKF  434

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
              N RP+     +  +    V Y ++  VRF +        +  +  SP FTTHS +MNQR
Sbjct  435   SNVRPR----ILLPTSHTKVKYAQKLFVRFRIGGNVAQNLVSVTLVSPSFTTHSFSMNQR  490

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             +L L    +        +  VA P S + AP GYY++ V ++ IPS   WV+ 
Sbjct  491   LLVLPRGQIRSLGKKTYHVEVAMPRSAILAPAGYYLLFVNHQEIPSEGVWVQL  543



>ref|XP_008347351.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   441 bits (1135),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 238/540 (44%), Positives = 326/540 (60%), Gaps = 23/540 (4%)
 Frame = +1

Query  358   SVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRC  537
             S+  S   +  G+WQ L ++ G+ AMHM L   + V+ FD+   G+S   L    NG  C
Sbjct  14    SIHFSLTHAAGGKWQLLQQSVGISAMHMQLLRNDRVIMFDRTDFGKSNLALP---NG-EC  69

Query  538   KGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKR  717
                R D     C AHS EYDV  NT+R L  +SD WCSSG +  NG ++QTGG   G +R
Sbjct  70    --VRND-----CTAHSAEYDVKTNTVRALTLLSDVWCSSGAVAPNGRLIQTGGNGAGDRR  122

Query  718   IQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM  897
             ++ F PC    C+WK     L   RWYA++ ILP  N + II+GGRR   YEF P+  + 
Sbjct  123   VRVFEPCTG--CDWKEFANALGARRWYATDHILP--NGQQIIIGGRRQFNYEFYPKTGSS  178

Query  898   QKSTDLPFLHQTYERNAGG-NNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRM  1074
              K   LPFL QT   +AG  NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K +P++
Sbjct  179   SKVYSLPFLVQT--BDAGEENNLYPFVFLNVDGNLFIFANNRAILFDYAKNXVVKTYPQI  236

Query  1075  PGEGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRM  1251
             PG   R  PSTGS+V+LPL +      + EV++CGGA  G++ +A QG F+E L +C R+
Sbjct  237   PGGDPRCXPSTGSAVLLPLKNLAAPSVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARI  296

Query  1252  VISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG  1431
              I+  K +W ME MP  RVM DM++LP G +L+ING   G AGW  G +P L P +Y P 
Sbjct  297   KINNPKPQWVMETMPQARVMGDMLLLPDGTVLLINGASSGAAGWEIGRNPVLNPVVYRPD  356

Query  1432  KTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVP  1611
               +G RF     T I RMYHS+A LL DGRVL+ GSNP+  Y FT+V  PTELRL+AF P
Sbjct  357   NAIGSRFEQQNPTTIPRMYHSTAILLRDGRVLVGGSNPHXKYEFTBVLFPTELRLEAFSP  416

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTH  1791
             DY+D +++N RP+ V+   +    A ++YGK+  ++F +     ++ +  S  +P F TH
Sbjct  417   DYLDAKYNNLRPQIVAPISQ----AKINYGKKLSIQFSVKGNLATQSVSVSMVAPSFNTH  472

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             S +MNQR+L L   ++++         V  P S   AP GYY++ VV++ IPS + WV+ 
Sbjct  473   SFSMNQRLLVLEAENVKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_006483245.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=575

 Score =   442 bits (1138),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 247/537 (46%), Positives = 337/537 (63%), Gaps = 23/537 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+W  L  + G+ AMHM + + + V+ FD+   G S   L    +  R +G   D+    
Sbjct  47    GQWVLLQSSIGISAMHMQVLNNDKVIIFDRTDMGPSNLSLP--IDKCRKEG---DVGQLD  101

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHSV YD+ +NT RPL   +DTWCSSG +LS+GT++QTGGY  G + I+ F PC ++ 
Sbjct  102   CTAHSVLYDIASNTFRPLLLQTDTWCSSGAVLSDGTLVQTGGYNVGDRVIRLFTPCNNEG  161

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W    K+L+D RWYASNQILP  ++R+I+VGGRR  TYEF P+  ++  S  L FL +
Sbjct  162   CDWVELSKNLWDRRWYASNQILP--DNRIIVVGGRRVFTYEFYPKIDSLSSSLYLRFLIE  219

Query  931   TYERNAG-GNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             T  R+ G  NNLYPFLHL  DG LFIFANR SILF+Y  N++ K+FP +PG   R+YPST
Sbjct  220   T--RDPGEENNLYPFLHLLPDGNLFIFANRRSILFDYINNKLVKEFPVIPGNDKRNYPST  277

Query  1108  GSSVMLPL--------DHKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVIS  1260
             GSS++LP+        +        EVM+CGGA AGA+ ++ K+  ++E  ++CGR+ ++
Sbjct  278   GSSILLPVKLSAGSDGNGTAVLPDAEVMVCGGAPAGAFIKSDKESVYVEASRTCGRLKVT  337

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
                  W+ME MP PRVM+DM++LP+G ++IING   G AGW +   P L P +YSP +  
Sbjct  338   DKYPVWSMEFMPMPRVMSDMLLLPSGDVIIINGASNGTAGWEDAVGPNLNPVLYSPDEEE  397

Query  1441  -GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
               +RF VL  +KI RMYHSSA +LPDGR+L+ GSNP+  Y FT  P+PT+L L+AF P Y
Sbjct  398   PDRRFVVLNPSKIPRMYHSSAVVLPDGRILVGGSNPHRRYNFTAYPYPTDLSLEAFHPHY  457

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
             +D      RP  +S+   G     V Y +   V F L    PS ++  S  +P FTTHS 
Sbjct  458   LDPENAYMRPSILSLESIGR---TVSYNEVLSVTFELSSYSPSGEISVSLMTPSFTTHSF  514

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             AMNQR++ L   S+ +        VV  PP+   APPGYYM+ VV+ GIPS + WVK
Sbjct  515   AMNQRLVVLNVVSVSQLSVYAYKVVVNGPPTATVAPPGYYMMFVVHAGIPSHAVWVK  571



>ref|XP_008466509.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=555

 Score =   442 bits (1136),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 251/558 (45%), Positives = 328/558 (59%), Gaps = 26/558 (5%)
 Frame = +1

Query  319   FLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRS  498
              ++SL   N L  S L   AA+G G W+ L  N G+ AMHM L   + VV +D+   G S
Sbjct  18    IILSLIFANLLLFSGLPPTAAAG-GSWRLLQRNVGISAMHMQLLQNDRVVMYDRTDFGPS  76

Query  499   GYQLRRRFNGTRCKGSREDLSDPS------CYAHSVEYDVLNNTIRPLRFISDTWCSSGT  660
                L     G +C      L DP+      C AHS+EY+V+ NT RPL  +SD WCSSG+
Sbjct  77    NLSLP----GGKC------LRDPTAKIKVDCTAHSIEYNVITNTFRPLMVLSDVWCSSGS  126

Query  661   ILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVI  840
             +  +GT++QTGG+  G +R++ F PC   TC+WK     L   RWYA+N ILP  + R I
Sbjct  127   VSPDGTLVQTGGFNSGERRVRTFKPC--STCDWKEIPLALSARRWYATNHILP--DGRQI  182

Query  841   IVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRD  1020
             I+GGRR   YEF P+    Q   DL FL +T +     NNLYPF+ L  DG LFIFAN  
Sbjct  183   IIGGRRQFNYEFYPKDRATQNVFDLRFLAETNDIGIE-NNLYPFVFLQPDGNLFIFANNR  241

Query  1021  SILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYT  1200
             +ILF+Y KN V +KFP +P    R+YPSTGS+VMLPL    +F +VEV++CGGA  G+Y 
Sbjct  242   AILFDYTKNGVVRKFPAIPDGQHRNYPSTGSAVMLPLKVDAKFIEVEVLVCGGAPIGSYD  301

Query  1201  EAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAG  1380
              A  G F++ L++C R+ I+    +W ME MP PRVM DM++LP G +L+ING   G AG
Sbjct  302   RANHGIFVDALRTCARIKITDRNPQWVMETMPQPRVMVDMLLLPNGNVLLINGGSAGAAG  361

Query  1381  WGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYV  1560
             W  G  P L P IY     VGKRF +   T I RMYHS+A LL DGRVL+ GSNP+ GY 
Sbjct  362   WEIGRKPVLNPVIYHTNNPVGKRFELQNPTTIPRMYHSTAILLRDGRVLVGGSNPHAGYN  421

Query  1561  FTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKW  1740
             FT V +PTELRL+AF P Y+D  F   RP   ++    S +A + +G+   V F +  K 
Sbjct  422   FTGVLYPTELRLEAFSPSYLDPEFAYLRP---AIQFPAS-SAKLRHGQALKVGFTVPGKV  477

Query  1741  PSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYM  1920
              S  L  +  SP F THS +MNQR+L L         N      V  P S   AP GYY+
Sbjct  478   DSTKLSVTILSPSFNTHSFSMNQRLLILSTGKYRLRGNKKYEVEVTIPGSGNVAPSGYYI  537

Query  1921  VTVVNEGIPSISRWVKFA  1974
             + +V++ IPS+  WV+  
Sbjct  538   LYLVHKEIPSVGIWVQIG  555



>ref|XP_003519774.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=560

 Score =   442 bits (1137),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 248/543 (46%), Positives = 335/543 (62%), Gaps = 24/543 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             + S  G W  L  + G+ AMHM + + N VV FD+   G S   L    +G RC+ +  D
Sbjct  28    STSTGGHWVQLQRSIGISAMHMQVMYDNKVVIFDRTDFGPSNISL----SGHRCRFNPRD  83

Query  556   LS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
             L+    C AHSV YD+  +T RPL   SD WCSSG + ++GT++QTGG+ DG  +++ F 
Sbjct  84    LALKLDCTAHSVLYDLATDTFRPLTLRSDAWCSSGALTASGTLLQTGGFNDGYTKLRSFT  143

Query  733   PCVD-KTCNWKPGKKH-LYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS  906
             PC    TC+W     H L   RWYASNQILP  N +VI+VGGR + TYEFVP+  N   S
Sbjct  144   PCPSHNTCDWLEHNNHNLSTSRWYASNQILP--NGKVIVVGGRNSFTYEFVPKNQNDASS  201

Query  907   T-DLPFLHQTYERNAGG-NNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
                LPFL  T + N G  NNLYPFLHL  DG LFIFANR+SILF+Y KN++ + FP +PG
Sbjct  202   FWFLPFLKLTRDPNRGEENNLYPFLHLLPDGNLFIFANRNSILFDYTKNKILRNFPLIPG  261

Query  1081  EGSRSYPSTGSSVMLPL------DHKNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKS  1239
             +  R+YPST SSV+LPL      + + R  + EVMICGGA  GAY+ A + R F+E  ++
Sbjct  262   QEKRNYPSTASSVLLPLNLTGLTNGQTRLPEAEVMICGGAYPGAYSLANKLRIFLEASRT  321

Query  1240  CGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYI  1419
             CGR+ ++    +W ME MP PRVM DM++LPTG ++I+NG   G AGW N  +P L P +
Sbjct  322   CGRLKVTDENPEWVMEVMPMPRVMPDMILLPTGDLIILNGAMNGSAGWENAVNPVLHPVM  381

Query  1420  YSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQ  1599
             Y PG      F +L      R+YHSSA L+PDGRVL+ GSNP+  Y F   P+PTEL + 
Sbjct  382   YKPGS--ADPFKLLAPASTGRLYHSSAVLVPDGRVLVGGSNPHRVYDFRANPYPTELSMD  439

Query  1600  AFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPP  1779
             A+ P+Y+   F+N +P  ++V  E + A+   YG+ F V F L K++    +  +  +P 
Sbjct  440   AYYPEYLGVEFENLKPSILTVEAENNTAS---YGRLFAVTFEL-KEYREGGVGVTLVAPS  495

Query  1780  FTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISR  1959
             FTTHS AMNQR+L L   +++         V   PPS   APPGYYM+ +V+ G+PS + 
Sbjct  496   FTTHSFAMNQRVLVLDVVAVQEVAKFGYKVVARGPPSLAVAPPGYYMLFIVHAGVPSAAV  555

Query  1960  WVK  1968
             WV+
Sbjct  556   WVQ  558



>gb|KHN45905.1| Galactose oxidase [Glycine soja]
Length=530

 Score =   441 bits (1133),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 242/535 (45%), Positives = 328/535 (61%), Gaps = 21/535 (4%)
 Frame = +1

Query  373   EAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRE  552
              AA  +G+WQ L +N G+VAMHM L H + V+ FD+   G S   L       RC+ +  
Sbjct  12    HAAEAKGQWQLLHKNIGIVAMHMQLLHNDRVIIFDRTDFGLSNLTLP----DGRCRNNPN  67

Query  553   DLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFF  729
             +L     C AHS+EYDV  NT R L   ++ WCSSG++  +GT++QTGG+ DG + ++ F
Sbjct  68    ELVVKRDCTAHSIEYDVAANTFRALFVQTNVWCSSGSVSPDGTLVQTGGFNDGYRAVRTF  127

Query  730   APCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST  909
              PC  ++C+W   +  L  +RWYA+N ILP  + R II+GGRR   YEF P+    + + 
Sbjct  128   TPC--RSCDWAEVQHGLAAQRWYATNHILP--DGRQIIIGGRRQFNYEFYPK-TQAKNTY  182

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
              LPFL QT + NA  NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V + +P++PG   
Sbjct  183   SLPFLAQTNDANAE-NNLYPFVFLNVDGNLFIFANNRAILFDYNKNSVVRTYPQIPGGDP  241

Query  1090  RSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNK  1269
             R YPSTGS+V+LPL   N   + EV+ICGGA  GA+     G+F+  L++C R+ I+  K
Sbjct  242   RCYPSTGSAVLLPLREPN--VEAEVLICGGAPRGAFRNTLSGKFVGALRTCARIKITDPK  299

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
               W ME MP  RVM+DMV+LP G +LI+NG   G AGW  G +P L P++Y P K VG R
Sbjct  300   ANWVMETMPSARVMSDMVLLPNGDVLIVNGAAVGTAGWELGRNPVLNPFLYKPNKRVGMR  359

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             F V   + I RMYHS A LL DGRVL+AGSNP+  Y FT V  PTELRL+AF P Y++  
Sbjct  360   FEVQNPSHIPRMYHSGAVLLRDGRVLLAGSNPHTYYNFTKVLFPTELRLEAFSPWYLEPG  419

Query  1630  FDNQRPKNVSVYVEGSPAAV--VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
             F N RP  V      SPA+   + YG+   +RF +      + +  +  +PPF THS +M
Sbjct  420   FSNVRPAIV------SPASQTKLKYGQTLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSM  473

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             NQR+L L+   +           V AP S V APPG+Y++ VV++ +PS   WV+
Sbjct  474   NQRLLVLKPHHLSGVGESTHEVEVTAPASAVLAPPGFYLLFVVHQEVPSHGIWVQ  528



>ref|XP_010263908.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=550

 Score =   441 bits (1134),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 245/551 (44%), Positives = 327/551 (59%), Gaps = 29/551 (5%)
 Frame = +1

Query  337   PCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRR  516
             PC +L      + AA G G+W  L ++ G+ AMHM L + + VV FD+   G S   L  
Sbjct  22    PCRSL------THAAGGGGKWDLLQQSIGISAMHMQLLNNDRVVIFDRTDFGESKLPLPD  75

Query  517   RFNGTRCKGSRED-LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTG  693
                  +C+    D +    C AHS EYDVL+ +IRPL  ++D WCSSG +  +G ++QTG
Sbjct  76    ----GKCRNDPNDTVLTVDCTAHSAEYDVLSKSIRPLMVLTDVWCSSGAVSPDGRLIQTG  131

Query  694   GYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYE  873
             G+ DG   ++ F PC    C+W+     L   RWYA+N ILP  + R II+GGRR   YE
Sbjct  132   GFNDGDHAVRIFTPC--NGCDWQENSSGLLARRWYATNHILP--DGRSIIIGGRRQFNYE  187

Query  874   FVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRV  1053
             F P+  +      LPFL QT +     NNLYPF+HL+ DG LFIFAN  +IL +Y KN V
Sbjct  188   FYPKSSSTNILFSLPFLSQTNDPKIE-NNLYPFVHLNVDGNLFIFANNRAILLDYTKNAV  246

Query  1054  EKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEG  1230
              K FP+MPG   RSYPSTGSSV+LPL +  +   + EV++CGGA   +Y +AK+G+F+  
Sbjct  247   VKTFPQMPGGDPRSYPSTGSSVLLPLKNLQQSSVEAEVLVCGGAPKDSYVQAKKGKFVRA  306

Query  1231  LKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALE  1410
             L +CGR+ I+     W+ME MP  RVM DM++LP G +LIING   G AGW  G  P L+
Sbjct  307   LDTCGRIKITDASPDWSMETMPLARVMGDMLLLPNGHVLIINGASSGTAGWELGREPELK  366

Query  1411  PYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTEL  1590
             P IY P    G RF V   +   R+YHS+A LL DGRVL+ G+NP+  Y FT V +PT+L
Sbjct  367   PVIYRPDNPSGSRFEVQNPSSTPRLYHSTAILLRDGRVLVGGNNPHRYYNFTGVLYPTDL  426

Query  1591  RLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRF----WLDKKWPSEDLE  1758
              L+AF PDY+D +F   RPK +S    GS A  + YG+   VRF     L+ KW    + 
Sbjct  427   SLEAFSPDYLDSKFSTLRPKILS---PGSQAQ-LSYGQRLSVRFSVSGALNDKW----VS  478

Query  1759  FSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNE  1938
              +  SP FTTHS +MNQR+L L    +    + + +  V AP S   AP GYY++ VV++
Sbjct  479   VTMVSPSFTTHSFSMNQRLLVLDGGKVTPVSSSVYDVEVTAPNSGFLAPSGYYLLFVVHQ  538

Query  1939  GIPSISRWVKF  1971
              IPS   WV  
Sbjct  539   EIPSEGIWVNI  549



>ref|XP_009619752.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=598

 Score =   442 bits (1137),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 244/530 (46%), Positives = 337/530 (64%), Gaps = 19/530 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+W  L ++ GV AMHM L H N VV FD+   G S   L +     +C+ + E +    
Sbjct  82    GKWILLQKSIGVSAMHMQLLHNNKVVIFDRTDFGASNLSLPQ----GQCRYNDEAIRV-D  136

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV-DK  747
             C AHS+ YDV  NT RPL   +D WCSSG +  NGT++QTGGY  G ++I+ F+PC+ D+
Sbjct  137   CTAHSILYDVATNTYRPLMVHTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCINDE  196

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
              C+W    ++L  +RWYAS+ ILP  + RVIIVGGRRA +YEF P+         LPFL 
Sbjct  197   HCDWTELPQNLTVKRWYASDHILP--DGRVIIVGGRRAFSYEFFPQNSQNNGIFYLPFLK  254

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             +T +     NNLYPFL+L  DG ++IFAN+ S++ +Y  N++ ++FP +PGE  R+YP+T
Sbjct  255   ETTDPKEE-NNLYPFLYLLPDGNIYIFANQRSVVLDYVNNKIIREFPLIPGE-KRTYPAT  312

Query  1108  GSSVMLPLDHKNRFQK--VEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWN  1281
             GSSVMLP+          VEVM+CGGA+ GA+T+A++G F+   ++CGRM I+     W 
Sbjct  313   GSSVMLPMKLVASASSPVVEVMVCGGANGGAFTQAEKGVFLPASRTCGRMRITDLDPVWI  372

Query  1282  MENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFSV  1458
             ME+MP  RVM DM++LPTG ++I+NG  +G AGW +   P L P +Y P +    KRF+V
Sbjct  373   MEDMPMGRVMPDMLLLPTGDVIILNGASKGTAGWESAIDPVLNPVLYKPNEPDPSKRFTV  432

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             L+ + I RMYHS+A LLPDGR+L+ GSNP+  Y FT V +PTEL L+AF P Y+     +
Sbjct  433   LKPSNIPRMYHSAATLLPDGRILVGGSNPHIRYNFTGVQYPTELSLEAFRPPYLAPEHSH  492

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP  ++  VEG     V YG++F + F L    P+++L  S  +P FTTHS AMNQR+L
Sbjct  493   LRPSILT--VEGP----VSYGQKFSITFTLGFFQPAKELMVSMIAPSFTTHSFAMNQRLL  546

Query  1819  KLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              L    ++R         V APPS   APPGYYMV VV++G+P  S W++
Sbjct  547   ILDVVEVQRLSLFAQKITVCAPPSRNIAPPGYYMVFVVHKGVPGHSSWIR  596



>gb|KFK35620.1| hypothetical protein AALP_AA4G014800 [Arabis alpina]
Length=549

 Score =   440 bits (1132),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 238/535 (44%), Positives = 325/535 (61%), Gaps = 31/535 (6%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS-  570
             RW+ L  + G+ AMHM L H   V+ FD+   G S   L     G  C   R D SD + 
Sbjct  34    RWEVLQPSIGISAMHMQLLHNGMVIMFDRTDFGNSNISLA----GGMC---RYDPSDTAV  86

Query  571   ---CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-  738
                C AHSV YDV +NT RPL+  +DTWCSSG++L NGT++QTGGY DG +  + F PC 
Sbjct  87    KFDCSAHSVLYDVASNTYRPLKVQTDTWCSSGSVLPNGTLVQTGGYNDGDRAARMFTPCG  146

Query  739   VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLP  918
               +TC+W    ++L   RWYA+NQILP  + R+I+VGGRR   +E  PR       +   
Sbjct  147   FSETCDWIEFPQYLTQRRWYATNQILP--DGRIIVVGGRRQFNFEIFPRADYRSIESRFE  204

Query  919   FLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSY  1098
             FL +T +  +  NNLYPFLHL  DG LF+FAN  SI+F+Y++NR+ ++FP +PG   R+Y
Sbjct  205   FLRETTD-GSNENNLYPFLHLLPDGNLFVFANTRSIVFDYKRNRIVREFPEIPGGDPRNY  263

Query  1099  PSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGR-FIEGLKSCGRMVISGNKH  1272
             PS+GSS++LPLD  N    + E+M+CGGA  GA++  K GR F     +CGR+ ++G   
Sbjct  264   PSSGSSILLPLDETNNVDLEAEIMVCGGAPKGAFSGVKNGRGFARATSTCGRLKLTGANP  323

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
              W ME MP PRVM DM++LPTG ++I+NG   G AGW N   P   P IY P +   +RF
Sbjct  324   SWEMETMPLPRVMGDMLLLPTGDVIIVNGAGTGTAGWENARDPLTRPVIYYPFE---RRF  380

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
             SV+      RMYHSSA LL DGR+L+ GSNP+  Y FTNV +PTEL L+A+ P Y+    
Sbjct  381   SVMSTASRPRMYHSSAVLLADGRILVGGSNPHVYYNFTNVEYPTELSLEAYSPPYLSFTS  440

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
             D+ RPK +      +   VV+Y   F++ F + +    + L     +P FTTHS AMNQR
Sbjct  441   DSIRPKIL------TSGKVVNYKTLFNLSFSIAQFLTIDLLSVRIVAPSFTTHSFAMNQR  494

Query  1813  MLKLRCTSMERGDNGMVNavvaap---pspvaappGYYMVTVVNEGIPSISRWVK  1968
             M+ L+  S+ R  +G+ N+         +   APPGYYM+ +V+ G+PS   WV+
Sbjct  495   MVILKLISVAR--DGLTNSYRINVLGPSTAEIAPPGYYMMFLVHSGVPSSGTWVQ  547



>ref|XP_004147869.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 ref|XP_004170844.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=548

 Score =   439 bits (1130),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 247/554 (45%), Positives = 327/554 (59%), Gaps = 15/554 (3%)
 Frame = +1

Query  319   FLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRS  498
              ++SL   N L  S L    A+G G W  L  + G+ AMHM L   + VV +D+   G S
Sbjct  7     IVLSLIFTNLLLFSSLSPTTAAG-GSWMLLQRSVGISAMHMQLLQNDRVVMYDRTDFGPS  65

Query  499   GYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGT  678
                L     G +C    +      C AHS+EY+V+ NT RPL  +SD WCSSG++L +GT
Sbjct  66    NLSLP----GGKCLRDPKAKIKVDCTAHSIEYNVITNTFRPLMVLSDVWCSSGSVLPDGT  121

Query  679   IMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRR  858
             ++QTGG+  G +R++ F PC   TC+W+     L   RWYA+N ILP  + R II GGRR
Sbjct  122   LVQTGGFNSGERRVRKFRPC--STCDWEEIPLALSARRWYATNHILP--DGRQIIFGGRR  177

Query  859   ASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNY  1038
                YEF P+    Q   DL FL +T + N   NNLYP++ L  DG LFIFAN  +ILF+Y
Sbjct  178   QYNYEFYPKDEATQNVFDLRFLAETND-NGIENNLYPYVFLQPDGNLFIFANNRAILFDY  236

Query  1039  RKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEA-KQG  1215
              KN+V K FP +P    R+YPSTGS+VMLPL+   +F +VEV++CGGA  G+Y +A   G
Sbjct  237   TKNKVVKTFPAIPDGEPRNYPSTGSAVMLPLNVDAKFIEVEVLVCGGAPKGSYDKANSHG  296

Query  1216  RFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGA  1395
              F+E L++C R+ I+    +W ME MP PRVM DM++LP G +L+ING   G AGW  G 
Sbjct  297   IFVEALRTCARIKITDQNPQWVMETMPQPRVMVDMLLLPNGNVLLINGGSAGAAGWEIGR  356

Query  1396  SPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVP  1575
              PAL P +Y     VGKRF +   T I RMYHS+A LL DGRVL+ GSNP+  Y FT V 
Sbjct  357   KPALNPVLYHTNNPVGKRFELQNPTTIPRMYHSTAILLRDGRVLVGGSNPHSSYNFTGVL  416

Query  1576  HPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDL  1755
              PTELRL+AF P Y+D  F   RP   ++    S +  + +G+   V F +  K  S  L
Sbjct  417   FPTELRLEAFSPSYLDPEFAYLRP---AIQFPAS-SVKLRHGQALKVGFTVPGKVDSTRL  472

Query  1756  EFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVN  1935
               +  SP F THS +MNQR+L L  T      N      V  P S   AP GYY++ +V+
Sbjct  473   SVTILSPSFNTHSFSMNQRLLILSTTKYRLRGNKKYEVEVTIPGSGNVAPSGYYILYLVH  532

Query  1936  EGIPSISRWVKFAN  1977
             + IPSI  WV+ ++
Sbjct  533   KEIPSIGIWVQLSD  546



>ref|XP_008387970.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=547

 Score =   439 bits (1129),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 240/538 (45%), Positives = 327/538 (61%), Gaps = 22/538 (4%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSR  549
             S  A+G G+W  L +N G+ AMH+ L H + VV +D+   G S   L       +C   R
Sbjct  25    STHAAG-GKWVLLQQNIGITAMHLQLLHNDRVVIYDRTDFGMSNLSLP----DGKC---R  76

Query  550   EDLSDPS----CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKR  717
             ED +D +    C AHSVEYDV  N+ RPL   +D WCSSG+I  +G ++QTGG+ DG ++
Sbjct  77    EDPNDTALKIDCTAHSVEYDVPTNSFRPLMVQTDVWCSSGSISPDGRLIQTGGFNDGERK  136

Query  718   IQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM  897
             ++ + PC    C+WK     L   RWYA+N ILP  + R II+GGRR   YEF P+  + 
Sbjct  137   VRIYEPC--NGCDWKEYDNGLAARRWYATNHILP--DGRQIIIGGRRQFNYEFYPKSASS  192

Query  898   QKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMP  1077
                  LPFL QT +     NNLYPF+ L+ DG LFIFAN  +ILF+Y KN + K +P++P
Sbjct  193   SNVYSLPFLVQTNDAKIE-NNLYPFVFLNVDGNLFIFANNRAILFDYVKNIIVKTYPQIP  251

Query  1078  GEGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
             G   RSYPSTGS+V+LPL + + +  + EV++CGGA  G++ +A +G F+E LK+CGR+ 
Sbjct  252   GGDPRSYPSTGSAVLLPLKNLQAQLVEAEVLLCGGAPKGSHEKAVKGTFVEALKTCGRIK  311

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+    +W +E MP  RVM DM +LP G +LIING   G AGW  G +P L P +Y P  
Sbjct  312   ITDPNPQWVVETMPQARVMGDMTLLPDGTVLIINGAALGTAGWEFGRNPVLNPVLYQPNN  371

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
              VG RF     T I RMYHS+A LL DGRVL+ GSNP+  Y F NV  PTELRL+AF PD
Sbjct  372   AVGSRFMQQNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYEFKNVLFPTELRLEAFNPD  431

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHS  1794
             Y+D ++ N RPK V+   +G+    + Y ++  VRF +     +  +  +  +P FTTHS
Sbjct  432   YLDAKYANLRPKIVAPNSQGT----ITYAQKLAVRFSVTGTLATNLVSVTMVAPSFTTHS  487

Query  1795  VAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              +MNQR+L L   S+          +V  P S   AP GYY++ VV++ IPS   WV+
Sbjct  488   FSMNQRVLVLAAESVTNVALSTYQVLVTTPGSGNLAPSGYYLLYVVHQSIPSEGIWVQ  545



>ref|XP_011083592.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=550

 Score =   439 bits (1129),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 238/532 (45%), Positives = 315/532 (59%), Gaps = 16/532 (3%)
 Frame = +1

Query  382   SGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS  561
             +  GRW  L+ N G+ AMHM L H + VV FD+   G S   L       +C+    D  
Sbjct  32    AADGRWDLLLSNIGISAMHMQLLHTDRVVMFDRTDFGPSNISLP----DGKCRRDPNDTV  87

Query  562   DP-SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC  738
              P  C AHSVEYDV +N+IRPL  ++D WCSSG ++ +GT++QTGG+ DG   I+ + PC
Sbjct  88    LPVDCTAHSVEYDVASNSIRPLMVLTDVWCSSGAVMPDGTLVQTGGFNDGDHAIRIYEPC  147

Query  739   VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLP  918
              + TC+W+   + L   RWYA+N ILP  + R I+VGGRR   YEF P+  +   S +LP
Sbjct  148   RNSTCDWREISRGLTQRRWYATNHILP--DGRQIVVGGRRQFNYEFYPKTSSADGSYNLP  205

Query  919   FLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSY  1098
             FL QT +     NNLYPF+ L+ DG LFIFAN  +ILFNY    V + +P MPG   RSY
Sbjct  206   FLVQTNDPRIE-NNLYPFVFLNGDGNLFIFANNRAILFNYLNGSVVRTYPTMPGGDPRSY  264

Query  1099  PSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             PSTGS+V+LPL +     + EV++CGGA  GAY  A  G F+  L +CGR+ I+    +W
Sbjct  265   PSTGSAVLLPLKNN---AETEVLVCGGAPKGAYVRANNGDFVGALNTCGRIRINDLNPQW  321

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              ME MP  RVM+DM++LP G++LIING   G AGW  G SP L P IY P   +G RF V
Sbjct  322   VMETMPMGRVMSDMLLLPNGEVLIINGAGSGTAGWELGRSPVLAPVIYRPDNPIGSRFEV  381

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
                +   RMYHS+A LL DGRVL+ GSNP+  Y FT V  PT+L LQAF P Y+D +   
Sbjct  382   QNPSSTPRMYHSTAVLLRDGRVLVGGSNPHTYYNFTGVLFPTDLTLQAFSPRYLDPKLSY  441

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDK-KWPSEDLEFSAYSPPFTTHSVAMNQRM  1815
              RPK +S   +      + YG++  +RF +   +  S  +  +  +P F THS +MNQR+
Sbjct  442   LRPKIISPVSQSE----IRYGQQLPIRFTIPPGRLNSTSVMVTMVAPSFNTHSFSMNQRL  497

Query  1816  LKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             L L    +           V  P S   AP GYY+V VV++ IPS   WV+ 
Sbjct  498   LVLSHGDVTAVGKSTYQVRVGTPGSGNLAPAGYYLVFVVHQDIPSEGIWVQI  549



>gb|KGN60011.1| hypothetical protein Csa_3G866440 [Cucumis sativus]
Length=560

 Score =   439 bits (1129),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 247/554 (45%), Positives = 327/554 (59%), Gaps = 15/554 (3%)
 Frame = +1

Query  319   FLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRS  498
              ++SL   N L  S L    A+G G W  L  + G+ AMHM L   + VV +D+   G S
Sbjct  19    IVLSLIFTNLLLFSSLSPTTAAG-GSWMLLQRSVGISAMHMQLLQNDRVVMYDRTDFGPS  77

Query  499   GYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGT  678
                L     G +C    +      C AHS+EY+V+ NT RPL  +SD WCSSG++L +GT
Sbjct  78    NLSLP----GGKCLRDPKAKIKVDCTAHSIEYNVITNTFRPLMVLSDVWCSSGSVLPDGT  133

Query  679   IMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRR  858
             ++QTGG+  G +R++ F PC   TC+W+     L   RWYA+N ILP  + R II GGRR
Sbjct  134   LVQTGGFNSGERRVRKFRPC--STCDWEEIPLALSARRWYATNHILP--DGRQIIFGGRR  189

Query  859   ASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNY  1038
                YEF P+    Q   DL FL +T + N   NNLYP++ L  DG LFIFAN  +ILF+Y
Sbjct  190   QYNYEFYPKDEATQNVFDLRFLAETND-NGIENNLYPYVFLQPDGNLFIFANNRAILFDY  248

Query  1039  RKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEA-KQG  1215
              KN+V K FP +P    R+YPSTGS+VMLPL+   +F +VEV++CGGA  G+Y +A   G
Sbjct  249   TKNKVVKTFPAIPDGEPRNYPSTGSAVMLPLNVDAKFIEVEVLVCGGAPKGSYDKANSHG  308

Query  1216  RFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGA  1395
              F+E L++C R+ I+    +W ME MP PRVM DM++LP G +L+ING   G AGW  G 
Sbjct  309   IFVEALRTCARIKITDQNPQWVMETMPQPRVMVDMLLLPNGNVLLINGGSAGAAGWEIGR  368

Query  1396  SPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVP  1575
              PAL P +Y     VGKRF +   T I RMYHS+A LL DGRVL+ GSNP+  Y FT V 
Sbjct  369   KPALNPVLYHTNNPVGKRFELQNPTTIPRMYHSTAILLRDGRVLVGGSNPHSSYNFTGVL  428

Query  1576  HPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDL  1755
              PTELRL+AF P Y+D  F   RP   ++    S +  + +G+   V F +  K  S  L
Sbjct  429   FPTELRLEAFSPSYLDPEFAYLRP---AIQFPAS-SVKLRHGQALKVGFTVPGKVDSTRL  484

Query  1756  EFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVN  1935
               +  SP F THS +MNQR+L L  T      N      V  P S   AP GYY++ +V+
Sbjct  485   SVTILSPSFNTHSFSMNQRLLILSTTKYRLRGNKKYEVEVTIPGSGNVAPSGYYILYLVH  544

Query  1936  EGIPSISRWVKFAN  1977
             + IPSI  WV+ ++
Sbjct  545   KEIPSIGIWVQLSD  558



>ref|XP_010271448.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=549

 Score =   439 bits (1128),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 231/535 (43%), Positives = 320/535 (60%), Gaps = 19/535 (4%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED-  555
             A+G+G W+ L ++ G+ AMHM L + + VV FD+   G+S   L +     +C+    D 
Sbjct  29    AAGRGSWELLQKSIGISAMHMQLLYNDRVVIFDRTDFGKSELALPQ----GKCRTDPSDT  84

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +    C AHS EYDV  N+ RPL   +D WCSSG +  +G ++QTGG+ DG + ++ F P
Sbjct  85    VLTVDCTAHSAEYDVSTNSFRPLMVQTDVWCSSGVVAPDGRLIQTGGFNDGERSVRMFTP  144

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
             C    C+W+  +  L   RWYA+N ILP  + R I++GGRR   YEF P+ P+  K   L
Sbjct  145   C--NGCDWEENRSGLLARRWYATNHILP--DGRSIVIGGRREFNYEFYPKSPSTNKLFSL  200

Query  916   PFLHQTYERNAGG--NNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
             PFL   +E N  G  NNLYPF+HL+ DG LFIF+N  +IL +Y +N+V K FP++PG   
Sbjct  201   PFL---WETNDPGIENNLYPFVHLNVDGNLFIFSNNRAILLDYNRNKVVKTFPQIPGGDP  257

Query  1090  RSYPSTGSSVMLPLDHKNR-FQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGN  1266
             R YPSTGSSV+LPL H  R + + EV++CGGA  G+Y +AK+G F++ L +CGR+ I+  
Sbjct  258   RCYPSTGSSVLLPLKHTQRPYIEAEVLVCGGALKGSYAQAKRGNFVKALNTCGRIKITDP  317

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK  1446
             K  W ME MP PRVM DM ILP G ILIING   G  GW  G  P   P +Y P    G 
Sbjct  318   KPAWFMETMPLPRVMGDMTILPNGHILIINGAASGTGGWEMGRDPVYSPVLYKPDYPSGS  377

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF V   TKI RMYHS+A LL DGRVL+ G+NP+  Y FT V +PT+L L+AF P Y+D 
Sbjct  378   RFEVQNPTKIPRMYHSTAILLRDGRVLVGGNNPHVFYNFTGVLYPTDLSLEAFSPGYLDP  437

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMN  1806
                N RP+ +    +      + YG+   VR  +   + S  +  +  +P FTTHS +MN
Sbjct  438   GLLNVRPRIIYPLSQ----VKLKYGQRLRVRISVPGAFDSSRVSITMVAPSFTTHSFSMN  493

Query  1807  QRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             QR+L L    +      + +     P S + +P GYY++ VV++ +PS   W++ 
Sbjct  494   QRLLVLDAARVTPVSGPVYDVETLMPKSGLLSPSGYYLLFVVHQEVPSKGIWIQI  548



>ref|XP_006857804.1| hypothetical protein AMTR_s00061p00216590 [Amborella trichopoda]
 gb|ERN19271.1| hypothetical protein AMTR_s00061p00216590 [Amborella trichopoda]
Length=528

 Score =   437 bits (1125),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 256/541 (47%), Positives = 338/541 (62%), Gaps = 25/541 (5%)
 Frame = +1

Query  385   GQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSD  564
             G G W  L+ + GV AMHM  T   TVV FD    G S   L      +RC     D++ 
Sbjct  2     GDGHWDLLVSDAGVSAMHMTTTRLGTVVMFDGTYFGTSKLPLGH----SRCHDRATDVAL  57

Query  565   P-SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV  741
             P  C+AHS+EYD   N++RPL  ++DT CSSG  L NGT++QTGG++DG K ++ F PC+
Sbjct  58    PRDCWAHSIEYDPAANSVRPLTILTDTLCSSGAFLPNGTLIQTGGFQDGEKGLRLFHPCL  117

Query  742   DKTCNW---KPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
                C+W         L ++RWY++NQ+LP  + RVI+VGG  A TYEFVP+    + S  
Sbjct  118   GSACDWNEVSSPPSQLSEKRWYSTNQVLP--DHRVIVVGGTTAFTYEFVPKPSGSEGSFR  175

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPFL +T +     NNLYPFLHL  DG L++FAN+DSILF+Y +  V +KFP +P EG R
Sbjct  176   LPFLIETNDPIV-ENNLYPFLHLCPDGSLYVFANKDSILFDYNRGTVIRKFPPIP-EGPR  233

Query  1093  SYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFI-EGLKSCGRMVISGNK  1269
             +YPS+G+SVMLPL   N F ++EV+ICGGA  GA   A+  + +   L SCGRM I+   
Sbjct  234   NYPSSGASVMLPLSAANGFTRMEVLICGGARDGAAKAARGAKDLWLALNSCGRMEITSPN  293

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK-  1446
               W +E MP PRVM DM++LP G +LIING + G AGW  G+ P   P +Y P +++ K 
Sbjct  294   PHWIVEKMPIPRVMGDMILLPDGNVLIINGAQNGVAGWELGSDPCPFPLLYQP-ESIDKA  352

Query  1447  -RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFT--NVPHPTELRLQAFVPDY  1617
              RF  L A+K  RMYHS+A L+ D RVLI GSNP++ Y F   NV  PTEL L+AF P Y
Sbjct  353   SRFLKLAASKTLRMYHSTANLMTDARVLIGGSNPHEKYTFEGPNVKFPTELSLEAFSPPY  412

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
             +D      RP  +SV     P   + YG  F V F L  K   + +EF+ Y+P FTTHS 
Sbjct  413   LDPSNAFLRPDIMSV-----PTEPISYGASFTVEFRLPGK-SGKLVEFNLYAPSFTTHSN  466

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFAN  1977
             +MNQR++KL  +S+     G   ++V APP P  APPGYYM+ VVN G+PS++RWV+F N
Sbjct  467   SMNQRLVKL-TSSVPVEVGGGYKSIVVAPPRPAIAPPGYYMLFVVNGGVPSVARWVRFLN  525

Query  1978  A  1980
              
Sbjct  526   G  526



>ref|XP_009614398.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=553

 Score =   439 bits (1128),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 245/571 (43%), Positives = 338/571 (59%), Gaps = 24/571 (4%)
 Frame = +1

Query  274   LRTTLPCAITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTH  453
             ++ T   +I   ++L L  L  C+  N       A++  G+W  LM N G+ AMHM L +
Sbjct  1     MKFTTSTSILFFILLHLFVLLSCHRPNF------ASAAGGKWNILMSNIGISAMHMQLLN  54

Query  454   RNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRF  630
              + VV FD+   G S   L       +C+    D +    C AHSVEY+++ N+IRPL  
Sbjct  55    NDKVVIFDRTDFGHSNISLP----DGKCRNDPNDTTLQIDCTAHSVEYNIVTNSIRPLMV  110

Query  631   ISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV-DKTCNWKPGKKHLYDERWYASN  807
              +D WCSSG++  +G+++QTGG+ DG K ++ F PC  + TC+W+  +  L   RWYA+N
Sbjct  111   QTDVWCSSGSVFPDGSLVQTGGFNDGEKVVRVFKPCNGNNTCDWQEIQGGLAQRRWYATN  170

Query  808   QILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSS  987
              ILP  + R II+GGRRA  YEF P+  +  K+  LPFL QT +     NNLYPF+ L+ 
Sbjct  171   HILP--DGRQIIIGGRRAFNYEFYPKPASAYKAYSLPFLVQTNDPKIE-NNLYPFVFLNM  227

Query  988   DGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEV  1164
             DG LFIFAN  +ILF+Y KN V K +P++PG   RSYPSTGS+V+LPL +    Q + EV
Sbjct  228   DGNLFIFANNRAILFDYTKNVVVKSYPQIPGGDPRSYPSTGSAVLLPLKNLQTQQIQAEV  287

Query  1165  MICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQI  1344
             ++CGGA  G+Y  A+ G+F+  L +CGR+ I+    +W +ENMP  R M DMVILP G +
Sbjct  288   LVCGGAPKGSYISAQNGKFLGALSTCGRIRITDPNPQWTIENMPLARTMGDMVILPNGNV  347

Query  1345  LIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRV  1524
             LIING   G AGW  G  P L+P IY P    G RF +   + I RMYHS+A LL +GRV
Sbjct  348   LIINGAATGTAGWELGRDPVLKPVIYRPDNPFGSRFEIQNPSTIPRMYHSTATLLRNGRV  407

Query  1525  LIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAA--VVDY  1698
             LIAGSNP+  Y FT V  PTEL L+AF P Y+D   +  RP+ +      SPA+  ++ Y
Sbjct  408   LIAGSNPHIYYNFTGVLFPTELSLEAFSPSYLDPESEYLRPQII------SPASQYIIGY  461

Query  1699  GKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavva  1878
             G+   +RF +  +     +  +  +P F THS   NQR+L L   +++          V 
Sbjct  462   GQRVPIRFKVSGRVNRNLVTVTMVAPGFNTHSFTQNQRLLVLANENVKLVGEKAYQVNVV  521

Query  1879  appspvaappGYYMVTVVNEGIPSISRWVKF  1971
              P S   APPGYY++ VV++ IPS   WVK 
Sbjct  522   TPNSATLAPPGYYLLFVVHQDIPSEGIWVKI  552



>gb|KEH36231.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=555

 Score =   438 bits (1127),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 244/541 (45%), Positives = 331/541 (61%), Gaps = 19/541 (4%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK-GS  546
             S A +  G+WQ L  N G+VAMHM L H + V+ FD+   G S   L    NG RC+   
Sbjct  26    SPAIAAGGQWQLLQNNIGIVAMHMQLLHNDRVIIFDRTDFGFSNLSLP---NG-RCRVNP  81

Query  547   REDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQF  726
             +E      C AHS+EYDV +NT RPL   ++ WCSSG++  NGT++QTGG+ DG + ++ 
Sbjct  82    QEQAVKNDCTAHSLEYDVFSNTFRPLFIQTNIWCSSGSVNPNGTLIQTGGFNDGDRSVRT  141

Query  727   FAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS  906
             F PC    C+W+     L   RWYA+N  LP  + R II+GGRR   YEF P+     K+
Sbjct  142   FNPC--PNCDWQEFNASLSARRWYATNHKLP--DGRQIIIGGRRQFNYEFYPKKDATAKN  197

Query  907   T-DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
             T  LPFL QT + +A  NNLYPF+ L+ DG LFIFAN  +ILF+Y  N+V K +P +PG 
Sbjct  198   TYSLPFLVQTNDASAE-NNLYPFVFLNVDGNLFIFANNRAILFDYNSNKVVKTYPTIPGG  256

Query  1084  GSRSYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
               RSYPS+GS+ +LPL + +N   + EVMICGGA  G+Y +  QG FI  L +CGR+ I+
Sbjct  257   DPRSYPSSGSAALLPLRNLQNPLVEAEVMICGGAPKGSYEKTLQGSFIGALNTCGRLKIT  316

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
                  W ME MPG RVM+DM++LP G +L+ING   G AGW +G +P L P++Y P   V
Sbjct  317   DPNPSWVMETMPGGRVMSDMILLPNGDVLLINGAAVGSAGWESGRNPVLNPFLYKPNSLV  376

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF + + + I RMYHS+A LL DGRVL+AGSNP+  Y FT +  PTELRL+AF P Y+
Sbjct  377   GSRFQLQKPSDIPRMYHSTAVLLRDGRVLVAGSNPHVNYNFTRL-FPTELRLEAFSPSYL  435

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             +  F++ RP  + V+        + Y ++  VRF +        +  + Y+P F THS +
Sbjct  436   ELGFNDVRP--IMVFPAPQSQTKLKYAQKLKVRFQVKATLMKNMVSVTMYAPSFNTHSFS  493

Query  1801  MNQRMLKLRCTSMERGDNG----MVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             MNQR+L L   S  +   G         VA P SP+ APPGYY++ VV++ +PS   WV+
Sbjct  494   MNQRLLVLDELSSSKNVVGESTSTYQVEVAIPNSPILAPPGYYLLFVVHQEVPSQGVWVQ  553

Query  1969  F  1971
              
Sbjct  554   L  554



>ref|XP_006471853.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
 gb|KDO53324.1| hypothetical protein CISIN_1g041651mg [Citrus sinensis]
Length=557

 Score =   438 bits (1127),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 238/539 (44%), Positives = 319/539 (59%), Gaps = 26/539 (5%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED-  555
             A  QG W  L E+ G+ AMHM L H N V+ FD+   G+S   L    +  RC+    D 
Sbjct  34    AGSQGEWNLLHESIGISAMHMQLLHDNRVIMFDRTDFGQSNLSL----SSGRCRFDPYDT  89

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +    C AHS+ YDV  N  RPL   +DTWCSSG++L NGT++Q+GGY DG   ++ F P
Sbjct  90    VLHTDCTAHSILYDVATNAYRPLMVQTDTWCSSGSVLPNGTLVQSGGYNDGDHVVRTFTP  149

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR------FPNM  897
             C D  C+W    +HL + RWYA+NQILP     +I    +    YEF P+      FP  
Sbjct  150   CDDDQCDWIELPQHLSERRWYATNQILPDGRIIIIGGRRQF--NYEFYPKSDEDLSFP--  205

Query  898   QKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMP  1077
              ++  L FL +T  R+   NNLYPF+HL  DG LFIFAN  SILF+Y++N+V K++P +P
Sbjct  206   -QTFMLHFLLET--RDYAENNLYPFVHLLPDGNLFIFANTRSILFDYKQNKVLKEYPEIP  262

Query  1078  GEGSRSYPSTGSSVMLPLDHKNRFQKV--EVMICGGASAGAYTEAKQGRFIEGLKSCGRM  1251
             G   R+YPSTGSSV+LPLD +N    V  E+MICGGA   ++  A QG FI  + +CGR+
Sbjct  263   GADPRNYPSTGSSVLLPLDERNGSTSVQAEIMICGGAQNASFALATQGVFIRAISTCGRL  322

Query  1252  VISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG  1431
             V+S     W ME MP PRVM DM++LP G ++IING + G AGW     P   P IY P 
Sbjct  323   VVSHANPSWVMEEMPLPRVMGDMILLPNGDVIIINGAQLGTAGWELARGPMTRPIIYRPS  382

Query  1432  KTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVP  1611
             +   +RFSV+  +   RMYHSSA LL DGRVLI GSNP+  Y FTNV +PT+L L+A+ P
Sbjct  383   EQTSRRFSVMEPSTRPRMYHSSAILLTDGRVLIGGSNPHIYYNFTNVVYPTDLSLEAYSP  442

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTH  1791
              Y+   +   RPK +S+         + Y   F VRF +++   +  +     +P FTTH
Sbjct  443   PYLSAEYATVRPKILSL------NETIGYKATFQVRFSVEEYLSAGVVSVRLIAPSFTTH  496

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             S  MNQRM+ L+   +    + + +    AP +   APPGYY++ VV+  IPS   WVK
Sbjct  497   SFGMNQRMVVLKILEVSHVTSYVYHLAAVAPSTAEIAPPGYYLLFVVHAEIPSSGMWVK  555



>ref|XP_009364601.1| PREDICTED: galactose oxidase [Pyrus x bretschneideri]
Length=556

 Score =   437 bits (1125),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 234/537 (44%), Positives = 324/537 (60%), Gaps = 21/537 (4%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED-  555
             +S QG+W+ L  + G+ AMHM L   N V+ FD+   G S   L R     +C+    D 
Sbjct  32    SSNQGQWRLLHSSVGISAMHMQLLRTNKVIMFDRTDYGPSNISLPR----GQCRRDPNDT  87

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +    C AHS+ YD+ +NT RPL   +DTWCSSG++L +GT++QTGGY DG + ++ F+P
Sbjct  88    VLKVDCTAHSILYDLGSNTFRPLTVHTDTWCSSGSVLPDGTLVQTGGYNDGDRVVRTFSP  147

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ---KS  906
             C +  C+W     +L   RWYA+NQILP  + RVIIVGGR+   YEF PR    Q   ++
Sbjct  148   CNNDNCDWLELPNYLIQRRWYATNQILP--DGRVIIVGGRQQFNYEFYPRSSQNQGGPRT  205

Query  907   TDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEG  1086
               L FL QT +++   NNLYPFLHL  DG LFIFAN  SI+F+Y +N + ++ P +PG  
Sbjct  206   IWLEFLRQTTDQDE--NNLYPFLHLLPDGNLFIFANTKSIIFDYSQNAIVRELPNIPGGD  263

Query  1087  SRSYPSTGSSVMLPLDH---KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
              R+YPSTGSSV+LPLD     N   +VE+M+CGGA   +Y  A  G FI  L +CGR+ +
Sbjct  264   PRNYPSTGSSVLLPLDENTPSNGSIEVEIMVCGGAPRKSYVLALHGEFINALGTCGRLNV  323

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
                  +W +E MP PRVM DM++LPTG ++IING  +G AGW NG  P   P IY P + 
Sbjct  324   YDPNPRWVVELMPVPRVMADMLLLPTGDVVIINGAAQGAAGWENGRDPVTTPVIYRPSEV  383

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
             +  RFSV+  +  AR+YHS+A L+PDGR+L+ GSNP+  Y FT V + T+L L+AF P Y
Sbjct  384   LNHRFSVMIGSPRARLYHSTAVLVPDGRILVGGSNPHAYYNFTGVEYQTDLSLEAFSPPY  443

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
             +   +D  RP+  ++ V      V+ Y +   V   + +      L     +P FTTHS 
Sbjct  444   LSEEYDPVRPRIAAIDV------VIGYRQLISVEILVPESQSVRVLSARLVAPSFTTHSF  497

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             AMNQRM+ L+   +     G     +  P +   APPGYY++ VV+  IPS + WV+
Sbjct  498   AMNQRMVILKLIGVTHVAAGTYRVSLVGPSTAEIAPPGYYLLFVVHADIPSSAAWVR  554



>ref|XP_010532190.1| PREDICTED: galactose oxidase [Tarenaya hassleriana]
Length=555

 Score =   437 bits (1124),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 236/532 (44%), Positives = 327/532 (61%), Gaps = 22/532 (4%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RWQ L  N G+ AMHM L H + V+ FD+   G S   L     G  C+    D +    
Sbjct  39    RWQLLQSNIGISAMHMQLLHNDMVIMFDRTDFGTSNISLP----GGLCRYDPYDTAVKFD  94

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDK  747
             C AHSV YDV++NT RPL+  +DTWCSSG++L NGT++QTGGY DG + ++ F PC   +
Sbjct  95    CTAHSVIYDVVSNTYRPLKVQTDTWCSSGSVLPNGTLVQTGGYNDGERVMRMFTPCGYGE  154

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             TC+W    ++L + RWYA+NQILP  + R+I+VGGRR   +EF PR  +  +     FL 
Sbjct  155   TCDWIEFPRYLANRRWYATNQILP--DGRIIVVGGRRQFNFEFFPRVQSNIRGFRFDFLR  212

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             +T +  +  NNLYPF+HL  DG LF+FAN  SILF+YR+N++ K++P +PG   R+YPS+
Sbjct  213   ETSD-GSNENNLYPFVHLLPDGNLFVFANTRSILFDYRRNKITKEYPEIPGGDPRNYPSS  271

Query  1108  GSSVMLPLD---HKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISGNKHK  1275
             GSS++LPL    + N+  +VEVM+CGGA  G++T+A KQ  F   + +CGRM ++     
Sbjct  272   GSSILLPLQETYNPNKSIEVEVMVCGGAPKGSFTKANKQQTFARAVSTCGRMRLTDENPS  331

Query  1276  WNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFS  1455
             W ME MP PRVM+DM++LPTG ++I+NG   G AGW N   P   P IY P      RFS
Sbjct  332   WQMETMPLPRVMSDMLLLPTGDVIIVNGAASGTAGWENAHDPVTRPIIYRP---YDHRFS  388

Query  1456  VLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFD  1635
             V+  +   RMYHSSA LL DGR+L+ GSNP+  Y FTNV +PT+L L+ + P Y+   +D
Sbjct  389   VMSTSARPRMYHSSAILLSDGRILVGGSNPHIYYNFTNVEYPTDLSLEVYSPPYISSIYD  448

Query  1636  NQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRM  1815
               RPK ++         +++Y +   + F + +    + L     SP FTTHS AMNQRM
Sbjct  449   PFRPKILNY------DKILNYERLNILCFSIQEFISLDRLSVRIISPSFTTHSFAMNQRM  502

Query  1816  LKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             + LR   +   ++G        P +   APPGYYM+ VV+ G+PS   WVK 
Sbjct  503   VVLRLHEVAHHESGPYWITAFGPSTAEIAPPGYYMMFVVHAGVPSSGVWVKL  554



>ref|XP_006343542.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   437 bits (1123),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 239/559 (43%), Positives = 331/559 (59%), Gaps = 18/559 (3%)
 Frame = +1

Query  307   LLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRG  486
             LLVL + +L+   A  + +LVS      G W+ L ++ G+ AMHM L H N VV FD+  
Sbjct  11    LLVLTVFTLQTSTA--SQMLVSRRHL-VGEWRLLHKSIGITAMHMQLLHNNKVVIFDRTD  67

Query  487   SGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTI  663
              GRS   L R     RC+ +  DL     C AHSV YD+ +NT RPL   +DTWCSSG +
Sbjct  68    FGRSNLSLPR----GRCRYNSHDLVLHKDCSAHSVLYDIASNTFRPLMVQTDTWCSSGAV  123

Query  664   LSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVII  843
             L NGT++QTGGY DG   I+  APC  + C+W    + L   RWY+++ ILP  + R+I+
Sbjct  124   LPNGTLVQTGGYNDGDHIIRTIAPCTGENCDWFELPRTLIQRRWYSTDHILP--DARIIV  181

Query  844   VGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDS  1023
             +GGR+   YEF P+      +  L FL  T +R    NNLYPF+ L  DG L IF+N  +
Sbjct  182   IGGRKQYNYEFYPKNSRGNSAFRLQFLKSTQDRK-DENNLYPFVFLLPDGNLLIFSNTRA  240

Query  1024  ILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTE  1203
             I+ NY+KN+V ++ P +PG+  R+YPSTGS+V+LPLD +NR  + E+M+CGGA   AY  
Sbjct  241   IILNYKKNQVVRELPSIPGDEPRNYPSTGSAVLLPLD-ENRPMEAEIMVCGGAPRRAYGL  299

Query  1204  AKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGW  1383
                  +++ L SCGR+ +  +  +W ME MP PRVM+DM+ILP G ILIING  RG AGW
Sbjct  300   TANMVYMKALSSCGRINVRDDHGRWKMETMPTPRVMSDMLILPNGDILIINGASRGTAGW  359

Query  1384  GNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVF  1563
              N  SP   P IY P      RFS+++A+   R+YHSSA L+ DGRVL+ GSNP + Y F
Sbjct  360   DNARSPVTRPVIYRPNMRRHNRFSIMKASSRPRLYHSSAILMTDGRVLVGGSNPQENYNF  419

Query  1564  TNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWP  1743
             T V  PT+L L+AF P ++ R+  + +P  +S+       A++ Y K F   F + +   
Sbjct  420   TGVEFPTDLSLEAFYPPFLARKHKHLKPTVLSI------DAILIYKKSFSATFTVPRFLR  473

Query  1744  SEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMV  1923
                +     +P FTTHS +MNQRM+ L+   +              P +   APPGYY++
Sbjct  474   MGTVSIRIIAPSFTTHSFSMNQRMVVLKGVVVVAVSANTYRFTAFGPSTKEIAPPGYYLL  533

Query  1924  TVVNEGIPSISRWVKFANA  1980
              VV+ GIPS   WVK  ++
Sbjct  534   FVVHAGIPSSGMWVKIQDS  552



>ref|XP_003553749.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=552

 Score =   436 bits (1122),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 250/561 (45%), Positives = 339/561 (60%), Gaps = 20/561 (4%)
 Frame = +1

Query  298   ITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFD  477
             I  L+   L SL P     A  L S  A+ QG+W  +  + G+ AMHM L H + ++ FD
Sbjct  6     IMILIPFILASLFP--YFEAQTLSSTFAN-QGQWNLVQPSVGISAMHMQLLHNDKIIMFD  62

Query  478   QRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSS  654
             +   G S   L    NG RC+    D++    C AHSV YDV  NT+RPL   +DTWCSS
Sbjct  63    RTDFGHSYLPLS---NG-RCRMDPNDIALKVDCSAHSVLYDVPTNTLRPLMIQTDTWCSS  118

Query  655   GTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDR  834
             G++L NGT++QTGGY DG + I+ F PC D+TC+W      L   RWYA+NQILP  + R
Sbjct  119   GSVLPNGTLIQTGGYNDGERSIRMFTPCFDETCDWVEFPGLLSQRRWYATNQILP--DAR  176

Query  835   VIIVGGRRASTYEFVPRFPNMQKSTD---LPFLHQTYERNAGGNNLYPFLHLSSDGYLFI  1005
             VI+VGGRR   YEF+P+ P+   S     L FL QT +R+   NNLYPF+HL  DG LFI
Sbjct  177   VIVVGGRRQFNYEFLPKTPSPNSSPSSIPLNFLQQTSDRSE--NNLYPFVHLLPDGNLFI  234

Query  1006  FANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGAS  1185
             FAN  S+LF+Y++N V K+FP +PG   R+YPS+GSSV+LPLD      + EV++CGGA 
Sbjct  235   FANTKSVLFDYKQNSVIKEFPPIPGGDPRNYPSSGSSVLLPLDENLASLEAEVVVCGGAP  294

Query  1186  AGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVK  1365
              G++  A +G F++ L +CGR+ ++     W MENMP PR M DM++LP G ++I NGV 
Sbjct  295   RGSFESAARGNFVQALGTCGRIKVTDPNPNWVMENMPMPRAMGDMLLLPNGDVVITNGVG  354

Query  1366  RGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNP  1545
              G AGW +G  P L P ++ P +TV  RFSV+      R+YHSSA LL DGRVL+ GSNP
Sbjct  355   AGTAGWEHGHDPVLTPVLFRPSETV-NRFSVMAPASRPRLYHSSAVLLRDGRVLVGGSNP  413

Query  1546  NDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFW  1725
             +  Y FT V +PT+L L+AF P Y+   FD  RP     Y+  +   V+ Y    +V F 
Sbjct  414   HVFYNFTGVEYPTDLSLEAFSPPYLALDFDPVRPT--IRYITNN--NVLGYRVFCYVTFT  469

Query  1726  LDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaap  1905
             +     + ++     +P FTTHS   NQRM+ L+ + +         A V  P +   AP
Sbjct  470   VPNFASASEVSVKIVAPSFTTHSFGQNQRMVVLKLSGVTYLAGEAYYATVVGPSTAEIAP  529

Query  1906  pGYYMVTVVNEGIPSISRWVK  1968
             PGYY++ VV++G+PS   WV+
Sbjct  530   PGYYLLFVVHKGVPSSGSWVQ  550



>ref|XP_003527665.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=541

 Score =   436 bits (1121),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 238/539 (44%), Positives = 337/539 (63%), Gaps = 16/539 (3%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGT-RCKG  543
             V+EA++  G+WQ L ++ G+VAMH+ L + + ++ +D+   G S   L    NGT R   
Sbjct  14    VTEASNSNGQWQLLQKSIGIVAMHVQLLNNDRLIIYDRTDFGFSNLTLP---NGTCRHDP  70

Query  544   SREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
             S + L+   C AHS+EYDV ++T RPL   +D WCSSGT ++NGT++QTGGY DG ++I+
Sbjct  71    SEKVLNQTDCTAHSLEYDVASDTFRPLFVQTDIWCSSGTTVANGTLIQTGGYNDGERKIR  130

Query  724   FFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ-  900
              F PC  +TC+W+     L  +RWY+++  LP  + R II+GGRR   YEF P+  + + 
Sbjct  131   SFTPC--ETCDWQETDNALLVKRWYSTDHYLP--DGRQIIIGGRRQFNYEFYPKINSAEY  186

Query  901   -KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMP  1077
              K   LPFL +TY++    NNLYPF+ L+ DG LFIFAN  +ILF+Y+ + V + +P +P
Sbjct  187   DKPYVLPFLFETYDKGVE-NNLYPFVFLNVDGNLFIFANSRAILFDYQNDIVVRTYPEIP  245

Query  1078  GEGSRSYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
             G   RSYPSTGS+V+LPL + +    + EV+ICGGA  GA+    QG F++ L SC R++
Sbjct  246   GGDPRSYPSTGSAVLLPLRNLEAPSVEAEVLICGGAPRGAFQLVPQGVFLQALDSCARIM  305

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+     W +E+MP  RVM+DMV+LP G ILIING + G AGW     P LEP IY    
Sbjct  306   ITDPNATWTVESMPMGRVMSDMVMLPNGDILIINGAQLGTAGWDKAMEPVLEPVIYKTNG  365

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
              VG RF +  A+ I RMYHS+A L+ DGRVL+ GSNP++ Y F+NV +PT+L L+AF P 
Sbjct  366   WVGSRFVLQSASSIPRMYHSTAILVRDGRVLVGGSNPHEKYDFSNVSYPTDLSLEAFSPY  425

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHS  1794
             Y+D +F   RP    + VE    A V YG++F +   ++     E +  +  +PPF THS
Sbjct  426   YLDPQFSPLRP----MIVEPCSHANVTYGEKFKMGIEVNGTLVPELVSVTMLAPPFNTHS  481

Query  1795  VAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              +MNQR+L L    +    N      V  P S V APP +Y++ VV++ IPS   W+K 
Sbjct  482   FSMNQRLLVLSIGQVNVTGNWTCEFEVTPPGSAVLAPPTFYLLFVVHQDIPSEGIWIKI  540



>gb|AET97563.1| galactose oxidase [Ziziphus jujuba]
Length=545

 Score =   436 bits (1122),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 239/539 (44%), Positives = 321/539 (60%), Gaps = 17/539 (3%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             L ++AA GQ  WQ L ++ G+ AMHM L + + VV FD+   G S   L       +C+ 
Sbjct  22    LFADAAGGQ--WQLLQKSIGISAMHMQLLNNDRVVIFDRTDFGPSNLSLP----AGKCRN  75

Query  544   SRED-LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
                D +    C AHS EYDV  NT RPL   +D WCSSG +  +G ++QTGGY DG +R+
Sbjct  76    DPNDTVLTVDCTAHSAEYDVATNTFRPLTVQTDVWCSSGCVTPDGRLIQTGGYNDGERRV  135

Query  721   QFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
             + + PC    C+W+  +  L   RWYA+N ILP  + R II+GGRR   YEF P+  +  
Sbjct  136   RIYKPCTG--CDWQEIELGLAARRWYATNHILP--DGRQIIIGGRRQFNYEFYPKTASAS  191

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
                 LPFL QT +     NNLYPF+ L++DG LF+FAN  +IL +Y KN+V K +P +PG
Sbjct  192   NVYSLPFLVQTNDPKIE-NNLYPFVFLNTDGNLFVFANNRAILLDYVKNKVLKTYPEIPG  250

Query  1081  EGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
                RSYPSTGS+V+LPL++ K  F + EV++CGGA  G+YTEA +  FI  LK+C R+ I
Sbjct  251   GDPRSYPSTGSAVLLPLENLKANFIEAEVLVCGGAPKGSYTEAIKRNFIGALKTCARIKI  310

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +    +W +E MP  RVM DM +LP G +LIING   G AGW  G +P L P IY P   
Sbjct  311   TDPNPQWVVETMPTARVMGDMTLLPNGNVLIINGGAAGTAGWELGRNPVLNPVIYKPNNA  370

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
             VG RF     + I RMYHS+A LL DGRVL+ GSNP+  Y FT V  PT+L L+AF P Y
Sbjct  371   VGSRFESQNPSSIPRMYHSTAILLRDGRVLVGGSNPHVYYNFTGVIFPTDLSLEAFSPSY  430

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
             ++ +F N RP+ VS   +   A    Y ++  VRF +     ++ +  +  SP FTTHS 
Sbjct  431   LEAQFSNLRPRIVSPTSQTKLA----YAQKLAVRFTVTGTVATKLVSVTMVSPSFTTHSF  486

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFA  1974
             +MNQR+L L   S+           V  P S   AP GYY++ VV++ IPS+  WV+  
Sbjct  487   SMNQRLLVLGAESVRNLGKTTYEVQVTTPSSGNLAPSGYYLLFVVHQEIPSLGIWVQIV  545



>ref|XP_009779182.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=596

 Score =   437 bits (1125),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 242/530 (46%), Positives = 335/530 (63%), Gaps = 19/530 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+W  L ++ GV AMHM L H N VV FD+   G S   L +     +C+ + E +    
Sbjct  80    GKWILLQKSIGVSAMHMQLLHNNKVVIFDRTDFGASNLSLPQ----GQCRYNDEAIRV-D  134

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV-DK  747
             C AHS+ YDV  NT RPL   +D WCSSG +  NGT++QTGGY  G ++I+ F+PC  D+
Sbjct  135   CTAHSILYDVATNTYRPLMVTTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCNNDE  194

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
              C+W    ++L  +RWY+S+ ILP  + RVIIVGGRRA +YEF P+         LPFL 
Sbjct  195   HCDWTELPQNLTVKRWYSSDHILP--DGRVIIVGGRRAFSYEFFPQNSQNNGIFYLPFLK  252

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             +T +     NNLYPFL+L  DG ++IFAN+ SI+ +Y  N++ ++FP +PGE  R+YP+T
Sbjct  253   ETTDPKEE-NNLYPFLYLLPDGNIYIFANQRSIVLDYVNNKIIREFPPIPGE-KRTYPAT  310

Query  1108  GSSVMLPLDHKNRFQK--VEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWN  1281
             GSSVMLP+          VEVM+CGGA+ GA+++A++G F+   ++CGRM I+     W 
Sbjct  311   GSSVMLPMKLVASASSPVVEVMVCGGANGGAFSQAEKGVFLPASRTCGRMRITDPDPVWV  370

Query  1282  MENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFSV  1458
             ME+MP  RVM DM++LPTG ++I+NG  +G AGW +   P L P +Y P +  + KRF+V
Sbjct  371   MEDMPMGRVMPDMLLLPTGDVIILNGASKGTAGWESAIDPVLNPVLYKPNELDLSKRFTV  430

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             L+ + I RMYHS+A LLPDGR+++ GSNP+  Y FT V +PTEL L+AF P Y+     +
Sbjct  431   LKPSNIPRMYHSAATLLPDGRIVVGGSNPHIRYNFTGVQYPTELSLEAFRPPYLAPEHSH  490

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP  ++  VEG     V YG++F + F L    P+++L  S   P FTTHS AMNQR+L
Sbjct  491   LRPSILT--VEGP----VSYGQKFSITFTLGFYQPAKELMVSMIPPSFTTHSFAMNQRLL  544

Query  1819  KLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              L    ++R         V APPS   APPGYYMV VV+ G+P  S W++
Sbjct  545   ILDVVGVQRLSLFAQKITVCAPPSRNIAPPGYYMVFVVHRGVPGHSSWIR  594



>ref|XP_008775019.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=544

 Score =   436 bits (1121),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 244/539 (45%), Positives = 329/539 (61%), Gaps = 21/539 (4%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSR  549
             + AA+G GRW  L  + GV AMHM L H + VV FD+   G S   L    NG       
Sbjct  21    NSAAAGGGRWDLLHRSIGVSAMHMQLLHNDRVVIFDRTDFGLSNLSLP---NGKCRNDPN  77

Query  550   EDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFF  729
             E +    C AHS EYDV  NT RPL  ++D+WCSSG +  +G ++QTGG+ DG + ++ F
Sbjct  78    EKVIKIDCTAHSAEYDVATNTFRPLMILTDSWCSSGAVAPDGRLIQTGGWNDGDRAVRTF  137

Query  730   APCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST  909
              PC D +C+W    + L   RWYA+NQILP  + R IIVGGRR   YEF P+ PN    T
Sbjct  138   VPCDDGSCDWSEVPQGLAARRWYATNQILP--DGRAIIVGGRRQFNYEFHPK-PNPSDLT  194

Query  910   D--LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
                LPFL  T  ++   +NLYPF+HL+ DG LFIFAN  +IL +Y +N + + +P MPG 
Sbjct  195   TFPLPFLQNT--KDDVEDNLYPFVHLNVDGNLFIFANNRAILLDYTRNAIVRTYPEMPGG  252

Query  1084  GSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKSCGRMVIS  1260
               R+YPS+GSSV+LPL  K    + EV++CGGA  G+YT A+  + +++ LK+CGR+ I+
Sbjct  253   DPRNYPSSGSSVLLPL--KPSATEAEVLVCGGAPVGSYTSARDVKNYMQALKTCGRIKIT  310

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
                  W++E M  PRVM DM++LPTG++L+ING   G AGW  G  P L P +YSP    
Sbjct  311   DQSPSWSVETMSTPRVMGDMILLPTGEVLLINGAAAGAAGWELGHEPVLTPVVYSPESPA  370

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF V   +KI R+YHSSA LL DGRVL+ GSNP+  Y FT V  PTEL L+AF P+Y+
Sbjct  371   GARFQVQNPSKIPRLYHSSAILLRDGRVLVGGSNPHVYYNFTGVEFPTELSLEAFSPEYL  430

Query  1621  DRRFDNQRPKNVSVYVEGSPAAV-VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
                  N RPK     ++ S + + ++YGK+F +RF +        +  +  +P F+TH+ 
Sbjct  431   TSGSSNSRPK-----IDNSSSPISLNYGKQFTLRFAV-AAISGGGVSVTMAAPAFSTHAF  484

Query  1798  AMNQRMLKLRC-TSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             +MNQR+L L    ++  G+NG       AP S + AP GYYMV VVN GIPS   W + 
Sbjct  485   SMNQRLLILETGKALAAGNNGSYEVTAVAPASGILAPSGYYMVFVVNGGIPSEGVWAQI  543



>ref|XP_010105253.1| hypothetical protein L484_019396 [Morus notabilis]
 gb|EXC04188.1| hypothetical protein L484_019396 [Morus notabilis]
Length=548

 Score =   436 bits (1120),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 241/531 (45%), Positives = 318/531 (60%), Gaps = 15/531 (3%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             GRWQTL  + GV AMHM L + + VV FD+   G+S   L       +C+    D +   
Sbjct  28    GRWQTLQTSIGVSAMHMQLLNTDRVVIFDRTDFGKSNLSLPD----GKCRNDPNDTALKI  83

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              C AHSVEYDV++NT RPL   +D WCSSG +  +GT++QTGG+ DG +R++ F PC   
Sbjct  84    DCTAHSVEYDVVSNTFRPLMVQTDVWCSSGALTPDGTLVQTGGFNDGERRVRIFKPCSTG  143

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST-DLPFL  924
              C+W   +  L   RWYA++ ILP  + +VI++GGRR   YEF P+  +  K+   LPFL
Sbjct  144   GCDWLEIEFGLAARRWYATDHILP--DGQVIVIGGRRQFNYEFYPKTTSSAKNPYSLPFL  201

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              QT +     NNLYPF+ L+ DG LFIFAN  +IL +Y KN+V K +P++PG   RSYPS
Sbjct  202   VQTNDAKIE-NNLYPFVFLNVDGNLFIFANNRAILLDYTKNQVLKTYPQIPGGDPRSYPS  260

Query  1105  TGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWN  1281
             TGS+V+LPL + + +  + EV++CGGA  GAY +A  G F+  LKSC RM I+     W 
Sbjct  261   TGSAVLLPLKNLQAQLIEAEVLVCGGAPKGAYVQAVNGNFVGALKSCARMKITDPNPTWV  320

Query  1282  MENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVL  1461
             ME+MP  RVM DM +LP G +LIING   G AGW  G  P L P +Y P K +G RF V 
Sbjct  321   MEDMPLARVMGDMTLLPNGNVLIINGGAAGTAGWEYGRDPVLSPILYRPDKLIGSRFEVQ  380

Query  1462  RATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQ  1641
               + I RMYHS+A LL DGRVL+ GSNP+  Y FT V  PT+L L++F P Y+D +F N 
Sbjct  381   NPSSIPRMYHSTAILLRDGRVLVGGSNPHIYYNFTGVLFPTDLSLESFSPQYLDAQFSNL  440

Query  1642  RPKNVSVYVEGSPAAVVDYGKEFHVRFWLD-KKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
             RPK VS   +      V Y  +  VRF +         +  +  +P FTTHS +MNQR+L
Sbjct  441   RPKIVSPPSQSK----VSYLNKLAVRFTVSGATLLPGSVAVTMVAPSFTTHSFSMNQRLL  496

Query  1819  KLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              L   SM           V  P S + AP GYY+  VV++ IPS   WV+ 
Sbjct  497   VLSAESMTSLGKSTYEVRVTTPGSGILAPSGYYLWFVVHQEIPSDGIWVQI  547



>ref|XP_002272723.2| PREDICTED: uncharacterized protein LOC100259927 [Vitis vinifera]
Length=549

 Score =   435 bits (1119),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 243/541 (45%), Positives = 324/541 (60%), Gaps = 23/541 (4%)
 Frame = +1

Query  358   SVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRC  537
             S LV  A S  G W+ L ++ G+ +MH+ L     ++ FD+  +G S   L +     + 
Sbjct  24    SNLVLGAHSNGGSWELLKKSIGISSMHIQLLQNERIITFDRTDAGPSNLTLPKGRKCPKI  83

Query  538   KGSREDLSDPSCYAHSVEYDVLNN-TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSK  714
              G R+      CY H+VE D++NN  +RPL  +SDTWCSSG++L +G ++Q+GGY +G K
Sbjct  84    SGRRD------CYVHAVELDMMNNLNVRPLTVLSDTWCSSGSLLPDGKLVQSGGYGNGEK  137

Query  715   RIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF--  888
              ++   PC   TC+WK   K L   RWYASNQ+LPG N  +I+VGGR   +YEF+P+   
Sbjct  138   VVRTLEPC--PTCDWKEDYKGLISPRWYASNQVLPGGN--IIVVGGRFQFSYEFIPKSSK  193

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
             P   +   LPFL +T   +   NNLYPF HLS+DG LFIFAN   IL +Y KN+V K +P
Sbjct  194   PEDHRLYTLPFLKETRYSSQIPNNLYPFTHLSTDGNLFIFANNRGILLDYVKNKVVKTYP  253

Query  1069  RMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCG  1245
              MPGE +R+YPSTGSSV+LPLD   +   + EV ICGG    ++ +AK G F+E  K+CG
Sbjct  254   TMPGEVARNYPSTGSSVLLPLDLSTKTTPEAEVFICGGTHPESFNKAKAGIFLEATKTCG  313

Query  1246  RMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYS  1425
             R+ I+    KW ME MP  RV+ DM++LPTG +LIING   G AGW     P   P IY 
Sbjct  314   RLRITAANPKWEMEEMPISRVLGDMIMLPTGDVLIINGAANGSAGWWYARVPVYNPVIYR  373

Query  1426  PGKTV-GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQA  1602
             P +     RF VL+A  I R+YHS+A LL DGRVL+AGSNPN  Y FT VP PTEL ++A
Sbjct  374   PAEAATANRFEVLKAATIPRLYHSTAHLLSDGRVLVAGSNPNHNYNFT-VPFPTELSVEA  432

Query  1603  FVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPF  1782
             F P Y+       RP   SV     P   + Y ++F V F +  +   +    +  +P F
Sbjct  433   FSPPYLTS--GKPRPSISSV----KPGMNLAYKQKFSVEFQVKVRQLGK-FYLTMVAPSF  485

Query  1783  TTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRW  1962
             TTHS +MNQR+L L    + R  +G       AP S   APPGYY + VV EG+PS+ +W
Sbjct  486   TTHSFSMNQRLLLLAVNRVRRMSSGSYAVEGDAPASAAVAPPGYYQLFVVYEGVPSVGKW  545

Query  1963  V  1965
             V
Sbjct  546   V  546



>ref|XP_006383733.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
 gb|ERP61530.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
Length=557

 Score =   436 bits (1120),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 243/555 (44%), Positives = 336/555 (61%), Gaps = 24/555 (4%)
 Frame = +1

Query  328   SLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQ  507
             +++PC+       V  +A+G+GRWQ L +N G+VAMHM L + + VV +D+   G+S   
Sbjct  18    AVQPCHR------VVTSAAGRGRWQLLQKNIGIVAMHMQLLNNDRVVIYDRTDYGKSNIS  71

Query  508   LRRRFNGTRCKG-SREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIM  684
             L       +C+  S E +    C AHSVEYDVL N  RPL   ++ WCSSG ++ +G+++
Sbjct  72    LPH----GKCRNDSWELVIKYDCTAHSVEYDVLANKFRPLMVQTNVWCSSGAVVPDGSLI  127

Query  685   QTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRAS  864
             QTGG+ DG ++++ F PC +  C+W      L   RWYA+N ILP  + + II+GGRR  
Sbjct  128   QTGGFNDGQRKVRTFYPC-NGDCDWVETGDGLKARRWYATNHILP--DGKQIIIGGRRQF  184

Query  865   TYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRK  1044
              YEF P+  +      LPFL QT +R +  NNLYPF+ L+SDG LFIFAN  +ILF+Y+ 
Sbjct  185   NYEFYPK-TSSPDVYSLPFLLQTNDRGSE-NNLYPFVFLNSDGNLFIFANNRAILFDYKT  242

Query  1045  NRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEA-----  1206
              +V K +P +PG   RSYPSTGS+V+LPL + +    + EV++CGGA  G++  A     
Sbjct  243   GKVVKTYPAIPGGDPRSYPSTGSAVLLPLKNLDAATIEAEVLVCGGAPKGSFEMATKRKS  302

Query  1207  KQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWG  1386
              + +F++ L +CGR+ I+    +W ME MP  RVM DM +LP G +LIING   G AGW 
Sbjct  303   AERKFLKALDTCGRIKINEPSPQWVMETMPCARVMGDMTLLPNGVVLIINGAGDGTAGWE  362

Query  1387  NGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFT  1566
             NG SPAL P +Y P    G RF  L  + I RMYHS+A LL DGRVL+ GSNP+ GY FT
Sbjct  363   NGRSPALNPVLYWPDGAAGSRFEPLNPSTIPRMYHSAAILLRDGRVLVGGSNPHSGYEFT  422

Query  1567  NVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPS  1746
              V  PTEL L+AF P Y+D +    RPK VS     S    + YG++  VRF +  K  +
Sbjct  423   RVLFPTELSLEAFSPPYLDSKNKYLRPKIVS--STASKGKYIGYGQKLWVRFKVIGKLKA  480

Query  1747  EDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVT  1926
             + +  +  +P F THS +MN R+L LR   +      + +  V  P S   AP GYY++ 
Sbjct  481   DMVSVTMVAPAFNTHSFSMNHRLLALRNEKVTYVRTSIYDIQVTTPSSGYLAPSGYYILY  540

Query  1927  VVNEGIPSISRWVKF  1971
             VV++ IPSI  WVK 
Sbjct  541   VVHQYIPSIGIWVKL  555



>ref|XP_010242442.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=573

 Score =   436 bits (1121),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 245/544 (45%), Positives = 339/544 (62%), Gaps = 27/544 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             G+W  L  + G+ AMHM L H + V+ FD+   G S   L    +  RC+    D++ + 
Sbjct  41    GKWVLLHTSIGLSAMHMQLLHNDKVLMFDRTDFGPSNLSL----SFGRCRFDPNDVALNI  96

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              C AHS+ YD+  NT RPL   +DTWCSSG++L NGT++QTGGY DG + I+ F+PC+D 
Sbjct  97    DCTAHSLIYDIPTNTFRPLMVQTDTWCSSGSVLPNGTLVQTGGYNDGDRVIRTFSPCIDD  156

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVP-RFPNMQKSTD--LP  918
              C+W    ++L   RWYASNQILP  + R+IIVGGR+   YEF P    N    ++  L 
Sbjct  157   LCDWTELPEYLSSRRWYASNQILP--DGRIIIVGGRKVFNYEFYPTNLVNESAPSNYYLS  214

Query  919   FLHQT---YERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
             FL +T   YE     NNLYPFLHL  DG LFIFAN  SILF++ +NRV ++FP +PG   
Sbjct  215   FLEETRDPYEE----NNLYPFLHLLPDGNLFIFANTRSILFSHTRNRVLREFPAIPGGHK  270

Query  1090  RSYPSTGSSVMLPLD----HKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
             R+YPS+GSSV+LP++    +  +  + EVM+CGGA  GA+ +A+ G ++    SCGR+ +
Sbjct  271   RNYPSSGSSVLLPINLAGGNATQSPEAEVMVCGGAPPGAFDQAEVGIYVGASNSCGRLKV  330

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIY-SPGK  1434
             +  K KW ME MP  RVM+DM++LPTG++LIING   G AGW N  +P L P +Y +  +
Sbjct  331   TDPKPKWVMEEMPMGRVMSDMLLLPTGEVLIINGAANGTAGWENAINPVLNPVLYLTYEQ  390

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFT-NVPHPTELRLQAFVP  1611
                +RF VL  + I R+YHS+A LLPDGR+L+ GSNP+  Y FT +V +PTEL L+AF+P
Sbjct  391   DPSRRFKVLNGSPIPRLYHSAAVLLPDGRILVGGSNPHRLYNFTDDVRYPTELSLEAFLP  450

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE-DLEFSA--YSPPF  1782
              Y+  ++   RP  VSV   G+ ++ + YG++F V F L   +  E D+  S    +P F
Sbjct  451   HYLAAQYALLRPLIVSVGPNGT-SSSISYGQKFSVTFALSVAYRIEQDISVSVTLIAPSF  509

Query  1783  TTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRW  1962
             TTH+  MNQR++ L   S+ +       A +  P +   APPGYYM+ VV  GIPS   W
Sbjct  510   TTHAFGMNQRLVVLNVISLLQVFTSAYQADLDGPTTSSVAPPGYYMLFVVYAGIPSHGFW  569

Query  1963  VKFA  1974
             VK  
Sbjct  570   VKIG  573



>emb|CBI34589.3| unnamed protein product [Vitis vinifera]
Length=544

 Score =   435 bits (1118),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 243/541 (45%), Positives = 324/541 (60%), Gaps = 23/541 (4%)
 Frame = +1

Query  358   SVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRC  537
             S LV  A S  G W+ L ++ G+ +MH+ L     ++ FD+  +G S   L +     + 
Sbjct  19    SNLVLGAHSNGGSWELLKKSIGISSMHIQLLQNERIITFDRTDAGPSNLTLPKGRKCPKI  78

Query  538   KGSREDLSDPSCYAHSVEYDVLNN-TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSK  714
              G R+      CY H+VE D++NN  +RPL  +SDTWCSSG++L +G ++Q+GGY +G K
Sbjct  79    SGRRD------CYVHAVELDMMNNLNVRPLTVLSDTWCSSGSLLPDGKLVQSGGYGNGEK  132

Query  715   RIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF--  888
              ++   PC   TC+WK   K L   RWYASNQ+LPG N  +I+VGGR   +YEF+P+   
Sbjct  133   VVRTLEPC--PTCDWKEDYKGLISPRWYASNQVLPGGN--IIVVGGRFQFSYEFIPKSSK  188

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
             P   +   LPFL +T   +   NNLYPF HLS+DG LFIFAN   IL +Y KN+V K +P
Sbjct  189   PEDHRLYTLPFLKETRYSSQIPNNLYPFTHLSTDGNLFIFANNRGILLDYVKNKVVKTYP  248

Query  1069  RMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCG  1245
              MPGE +R+YPSTGSSV+LPLD   +   + EV ICGG    ++ +AK G F+E  K+CG
Sbjct  249   TMPGEVARNYPSTGSSVLLPLDLSTKTTPEAEVFICGGTHPESFNKAKAGIFLEATKTCG  308

Query  1246  RMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYS  1425
             R+ I+    KW ME MP  RV+ DM++LPTG +LIING   G AGW     P   P IY 
Sbjct  309   RLRITAANPKWEMEEMPISRVLGDMIMLPTGDVLIINGAANGSAGWWYARVPVYNPVIYR  368

Query  1426  PGKTV-GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQA  1602
             P +     RF VL+A  I R+YHS+A LL DGRVL+AGSNPN  Y FT VP PTEL ++A
Sbjct  369   PAEAATANRFEVLKAATIPRLYHSTAHLLSDGRVLVAGSNPNHNYNFT-VPFPTELSVEA  427

Query  1603  FVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPF  1782
             F P Y+       RP   SV     P   + Y ++F V F +  +   +    +  +P F
Sbjct  428   FSPPYLTS--GKPRPSISSV----KPGMNLAYKQKFSVEFQVKVRQLGK-FYLTMVAPSF  480

Query  1783  TTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRW  1962
             TTHS +MNQR+L L    + R  +G       AP S   APPGYY + VV EG+PS+ +W
Sbjct  481   TTHSFSMNQRLLLLAVNRVRRMSSGSYAVEGDAPASAAVAPPGYYQLFVVYEGVPSVGKW  540

Query  1963  V  1965
             V
Sbjct  541   V  541



>ref|XP_009606830.1| PREDICTED: galactose oxidase [Nicotiana tomentosiformis]
Length=556

 Score =   435 bits (1119),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 242/565 (43%), Positives = 329/565 (58%), Gaps = 21/565 (4%)
 Frame = +1

Query  295   AITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFF  474
              I  LL+L  +SL+P   L AS ++   +  +G W+ L E+ GV AMHM L   N VV F
Sbjct  5     TIIFLLLLTFISLQP---LVASQMLVSRSGIEGEWRLLHESIGVSAMHMQLLRNNKVVIF  61

Query  475   DQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCS  651
             D+   GRS   L     G RC+    DL     C AHSV YDV +NT RPL   +DTWCS
Sbjct  62    DRTDFGRSNLSLP----GGRCRYDSHDLVIREDCSAHSVLYDVGSNTFRPLMVQTDTWCS  117

Query  652   SGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKND  831
             SG +L +GT++QTGGY DG   I+  APC  + C+W    + L   RWY+++ ILP  + 
Sbjct  118   SGAVLPDGTLVQTGGYNDGDHIIRTLAPCTGENCDWVEFPRTLIQRRWYSTDHILP--DA  175

Query  832   RVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFA  1011
             R+I++GGR    YEF P+ P+   +  L FL  T + +   NNLYPF+ L  DG LFIFA
Sbjct  176   RIIVIGGRNQHNYEFYPKNPSSFSAFWLQFLSDTRDGD-NENNLYPFVFLLPDGNLFIFA  234

Query  1012  NRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAG  1191
             N  +I+ +Y+KN V ++ P +PG   R+YPSTGS+V+LPLD  +  Q  E+M+CGGA   
Sbjct  235   NTRAIILDYKKNEVVRELPSIPGNEPRNYPSTGSAVLLPLDENSPMQA-EIMVCGGAPRR  293

Query  1192  AYTEAKQGRFIEGLKSCGRMVISG---NKHKWNMENMPGPRVMNDMVILPTGQILIINGV  1362
             A+     G ++  L SCGR+ IS    N   W ME MP PRVM+DM+ILP G I++ING 
Sbjct  294   AFGLTDYGVYMTALSSCGRITISDDHVNDGSWKMEQMPTPRVMSDMLILPNGDIILINGA  353

Query  1363  KRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSN  1542
              RG AGW N  +P   P IY P +    RFSV+ A+   R+YHS+A LL DGRVL+ GSN
Sbjct  354   ARGTAGWENARNPVTRPVIYRPNRAENNRFSVMEASLKPRLYHSTAILLTDGRVLVGGSN  413

Query  1543  PNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRF  1722
             P+  Y FT V  PT+L L+AF P Y+   +   +P  +S+        ++ Y + F V F
Sbjct  414   PHKFYNFTGVEFPTDLSLEAFSPPYLAPEYAPLKPTVLSI------DEILIYKQPFSVTF  467

Query  1723  WLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaa  1902
              + K      +     +P FTTHS +MNQRM+ L+  ++    +         P +   A
Sbjct  468   TVPKFLKMGIVLVRIVAPSFTTHSFSMNQRMVVLKSIAVSTVTDNTYRFTAFGPSTKEIA  527

Query  1903  ppGYYMVTVVNEGIPSISRWVKFAN  1977
             PPGYYM+ VV+ GIPS   WV+  +
Sbjct  528   PPGYYMLFVVHAGIPSSGVWVQIQD  552



>ref|XP_008389005.1| PREDICTED: galactose oxidase [Malus domestica]
Length=556

 Score =   435 bits (1118),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 234/538 (43%), Positives = 320/538 (59%), Gaps = 21/538 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             ++  QG+W  L  + G+ AMHM L   N V+ FD+   G S   L R     +C+    D
Sbjct  31    SSGNQGQWHLLHSSVGISAMHMQLLRTNKVIMFDRTDYGPSNISLPR----GQCRRDPND  86

Query  556   -LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
              +    C AHS+ YD+ +NT RPL   +DTWCSSG+IL +GT++QTGGY DG + ++ F+
Sbjct  87    TVLKVDCTAHSILYDLGSNTFRPLTVHTDTWCSSGSILPDGTLVQTGGYNDGDRVVRTFS  146

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ---K  903
             PC +  C+W     +L   RWYA+NQILP  + RVIIVGGRR   YEF PR    Q    
Sbjct  147   PCNNDNCDWLELPNYLIQRRWYATNQILP--DGRVIIVGGRRQFNYEFYPRSSQNQGGPH  204

Query  904   STDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
             +  L FL QT +++   NNLYPFLHL  DG LFIFAN  SI+F+Y +N V ++ P +PG 
Sbjct  205   TIWLEFLRQTTDQDE--NNLYPFLHLLPDGNLFIFANAKSIIFDYSQNAVVRELPDIPGG  262

Query  1084  GSRSYPSTGSSVMLPLDH---KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
               R+YPSTGSSV+LPLD     N   +VE+M+CGG    ++  A  G FI  L +CGR+ 
Sbjct  263   DPRNYPSTGSSVLLPLDENTPSNGNMEVEIMVCGGTPRNSHVLALHGEFISALGTCGRLN  322

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             +     +W +E MP PRVM DM++LPTG ++IING   G AGW NG  P   P IY P +
Sbjct  323   VYDPNPRWVVEFMPVPRVMADMLLLPTGDVIIINGAALGAAGWENGRDPVTTPVIYRPSE  382

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
              + +RFSV+  +  AR+YHS+A L+PDGR+L+ GSNP+  Y FT V +PT+L L+AF P 
Sbjct  383   VLNRRFSVMTGSSRARLYHSAAVLVPDGRILVGGSNPHIYYNFTGVEYPTDLSLEAFSPP  442

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHS  1794
             Y+   +D  RP+  ++        V  Y +   V   + +      L     +P FTTHS
Sbjct  443   YLSDEYDPVRPRIAAI------EDVFGYRQLISVEILVPEFLSVRVLSARLVAPSFTTHS  496

Query  1795  VAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              AMNQRM+ L+   +     G     +  P +   APPGYY++ VV+  IPS + WV+
Sbjct  497   FAMNQRMVVLKLIGVTHVAAGTYRVSLVGPSTAEIAPPGYYLLFVVHSDIPSSAAWVR  554



>ref|XP_008338258.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score =   434 bits (1116),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 234/537 (44%), Positives = 321/537 (60%), Gaps = 22/537 (4%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             L +  A+G G+WQ L +N G+ AMHM L + + V+ FD+   G+S   L    NGT  + 
Sbjct  24    LTTTHAAG-GKWQLLQQNVGISAMHMQLLYNDRVIMFDRTDFGKSNLSLP---NGTCVRN  79

Query  544   SREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
                      C AHS EYDV  NT+RPL   SD WCSSG++  NG ++QTGGY  G +R++
Sbjct  80    D--------CTAHSAEYDVTTNTVRPLTVQSDIWCSSGSVAPNGNLIQTGGYDIGERRVR  131

Query  724   FFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQK  903
              F PC    C+WK  +  L   RWYA++ ILP  + R II+GGR    YEF P+  +   
Sbjct  132   VFKPCTG--CDWKEYENTLGVSRWYATDHILP--DGRQIIIGGRXQFNYEFYPKTESSSN  187

Query  904   STDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
                LPFL QT + N   NNLYP++ L+ DG LFIFAN  +IL +Y  N+V K +P++PG 
Sbjct  188   VYSLPFLVQTNDPNEE-NNLYPYVFLNVDGNLFIFANNRAILLDYVMNKVVKXYPQIPGG  246

Query  1084  GSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
               RSYPSTGS+V+LPL +      + EV++CGGA  G+Y +A +G F+E L +CGR+ I+
Sbjct  247   DPRSYPSTGSAVLLPLRNLTAPSIEAEVLVCGGAPKGSYXQAIKGTFVEALNTCGRIKIN  306

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
               K +W +E MP  RVM+DM++LP G ++IING   G AGW  G +P LEP +Y P   V
Sbjct  307   DPKPQWVVETMPQARVMSDMLLLPDGTVVIINGASFGTAGWELGQNPVLEPLVYRPDNAV  366

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF       I RMYHS+A LL DGRVL+ GSNP+D Y   +   PTELRL+AF  DY+
Sbjct  367   GSRFEKQNPAPIPRMYHSTAVLLRDGRVLVGGSNPHDKYELADELFPTELRLEAFSXDYL  426

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             D ++   RP+     V+    A + YGK+  +RF L     +  +  +  +P F THS +
Sbjct  427   DAKYSKLRPR----IVDPKSQAKISYGKKLFIRFSLXGSIATNLVMVTIVAPSFNTHSFS  482

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             MNQR+L L   ++++         V  P S   AP GYY++ VV++ IPS   WV+ 
Sbjct  483   MNQRLLVLAAETVKKVGTMTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQI  539



>ref|XP_009791893.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=545

 Score =   434 bits (1116),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 235/536 (44%), Positives = 324/536 (60%), Gaps = 19/536 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A +  G+WQ L  N G+ AMHM L + + V+ +D+   G S   L    NG RC+ +  D
Sbjct  24    ADAAGGKWQLLKSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLP---NG-RCRNNPND  79

Query  556   LS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
             L+    C AHSVEYDV  N++RPL   +D WCSSG++ ++G+++QTGG+ DG + ++   
Sbjct  80    LALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNADGSLVQTGGFNDGERMVRVVK  139

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC   TC+W+    +L   RWY++N ILP  + R II+GGR+A  YEF P+  +      
Sbjct  140   PC--NTCDWQEMGSNLIQSRWYSTNHILP--DGRQIIIGGRKAFNYEFYPKTASTNNVFS  195

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPFL QT       NNL+PF+ L+ DG LFIFAN  +ILF+Y+ N+V K +P++PG   R
Sbjct  196   LPFLQQTNNPREE-NNLFPFVFLNVDGNLFIFANDRAILFDYKVNKVVKTYPQIPGGDPR  254

Query  1093  SYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNK  1269
             +YPS+GS+V+LPL + + +  + EV++CGGA  G+Y +A +G FI  L +CGR+ I+   
Sbjct  255   NYPSSGSAVLLPLKNLRAQTVQAEVLVCGGAPRGSYPKADKGEFIGALNTCGRITITDPN  314

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
              +W +E MP  R M DMVILP G +LIING   G AGW     P L P IY P   +G R
Sbjct  315   PQWTVETMPLARTMGDMVILPDGNVLIINGAAAGTAGWQIARKPVLSPVIYRPDNPLGSR  374

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             F V  +  I RMYHS+A LL DGRVL+ GSNPN+ Y FT V  PTEL L+AF P Y+D  
Sbjct  375   FEVQNSNTIPRMYHSTAVLLRDGRVLVGGSNPNEFYNFTGVLFPTELSLEAFSPSYLDPE  434

Query  1630  FDNQRPKNVSVYVEGSPAA--VVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
               N RP+ +      SPA+     YGK  ++RF +     ++ ++ +  +P F THS  M
Sbjct  435   SSNLRPQII------SPASRHKTKYGKSVNIRFTVSGLLNTDLVKVTMVAPGFNTHSNTM  488

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             NQRML L    + R         +  P S   APPGYYM+ VV++ IPS   W+K 
Sbjct  489   NQRMLVLSSGKVRRIGKSSYQINLIFPNSGKLAPPGYYMLFVVHQEIPSEGIWIKI  544



>ref|XP_010660091.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=544

 Score =   434 bits (1116),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 242/533 (45%), Positives = 316/533 (59%), Gaps = 16/533 (3%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK-GSRE  552
             A   QG W  L  + G+ AMHM L   N VV FD+   G S   L        C+   R+
Sbjct  26    ATVNQGEWHLLHASIGISAMHMQLLWNNKVVIFDRTDFGPSNLSLPPHL----CRHDPRD  81

Query  553   DLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
                   C AHS+ Y V  NT RPL+  +DTWCSSG++L NGT+ QTGG+ DG   ++ F 
Sbjct  82    HALQTDCTAHSLLYCVDTNTFRPLKVQTDTWCSSGSVLPNGTLTQTGGFNDGDHVLRMFT  141

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC D +C+W     +L   RWYASNQILP  + R+IIVGGRR   YEF PR         
Sbjct  142   PCDDYSCDWVEFPGYLSQRRWYASNQILP--DGRIIIVGGRRQFNYEFYPRSSRGSNLYT  199

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             L FL +T  R+A  NNLYPFLHL  DG LFIFAN  SI  +Y++NRV ++FP + G   R
Sbjct  200   LDFLRET--RDAHENNLYPFLHLLPDGNLFIFANTRSISLDYKRNRVVQEFPPITGGEPR  257

Query  1093  SYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             +YPS+GSSVMLP++     +  EV++CGGA  GA ++A +G F+    +CGR+ ++    
Sbjct  258   NYPSSGSSVMLPINETQAIEA-EVLVCGGAPPGAVSQALRGNFVSASLTCGRLKVTDENP  316

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
              W ME MP  RVM DM++LPTG ++IING + G AGW  G SP   P IY P   V +RF
Sbjct  317   NWVMEEMPVARVMGDMLLLPTGDVIIINGARLGAAGWEYGRSPVTNPVIYLPFGDVNRRF  376

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
              V+  +   RMYHSSA LLPDGR+L+ GSNP+  Y FTNV +PT+L L+A+ P Y    F
Sbjct  377   LVMSGSIRPRMYHSSAVLLPDGRILVGGSNPHVYYNFTNVLYPTDLSLEAYSPPYTSPAF  436

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
              + RP  +S+         + YG+ F + F + +      L  +  +P FTTH+VAMNQR
Sbjct  437   SSLRPHILSL------DENLLYGQSFSIVFNVCEYTNDRVLSANIVAPSFTTHTVAMNQR  490

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             M+ LR  S+ +         V  P +P  APPGYYM+ VV+ GIPS   WVK 
Sbjct  491   MVVLRVESVMQEVGNTYRLSVVGPSTPEIAPPGYYMLFVVHSGIPSHGSWVKI  543



>ref|XP_008367966.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score =   434 bits (1115),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 234/537 (44%), Positives = 321/537 (60%), Gaps = 22/537 (4%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             L +  A+G G+WQ L +N G+ AMHM L + + V+ FD+   G+S   L    NGT  + 
Sbjct  24    LTTTHAAG-GKWQLLQQNVGISAMHMQLLYNDRVIMFDRTDFGKSNLSLP---NGTCVRN  79

Query  544   SREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
                      C AHS EYDV  NT+RPL   SD WCSSG++  NG ++QTGGY  G +R++
Sbjct  80    D--------CTAHSAEYDVTTNTVRPLTVQSDIWCSSGSVAPNGNLIQTGGYDIGERRVR  131

Query  724   FFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQK  903
              F PC    C+WK  +  L   RWYA++ ILP  + R II+GGR    YEF P+  +   
Sbjct  132   VFKPCTG--CDWKEYENTLGVSRWYATDHILP--DGRQIIIGGRGQFNYEFYPKTESSSN  187

Query  904   STDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
                LPFL QT + N   NNLYP++ L+ DG LFIFAN  +IL +Y  N+V K +P++PG 
Sbjct  188   VYSLPFLVQTNDPNEE-NNLYPYVFLNVDGNLFIFANNRAILLDYVMNKVVKIYPQIPGG  246

Query  1084  GSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
               RSYPSTGS+V+LPL +      + EV++CGGA  G+Y +A +G F+E L +CGR+ I+
Sbjct  247   DPRSYPSTGSAVLLPLRNLTAPSIEAEVLVCGGAPKGSYVQAIKGTFVEALNTCGRIKIN  306

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
               K +W +E MP  RVM+DM++LP G ++IING   G AGW  G +P LEP +Y P   V
Sbjct  307   DPKPQWVVETMPQARVMSDMLLLPDGTVVIINGASFGTAGWELGQNPVLEPLVYRPDNAV  366

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF       I RMYHS+A LL DGRVL+ GSNP+D Y   +   PTELRL+AF  DY+
Sbjct  367   GSRFEKQNPAPIPRMYHSTAVLLRDGRVLVGGSNPHDKYELADELFPTELRLEAFSXDYL  426

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             D ++   RP+     V+    A + YGK+  +RF L     +  +  +  +P F THS +
Sbjct  427   DAKYSKLRPR----IVDPKSQAKISYGKKLFIRFSLXGSIATNLVMVTIVAPSFNTHSFS  482

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             MNQR+L L   ++++         V  P S   AP GYY++ VV++ IPS   WV+ 
Sbjct  483   MNQRLLVLAAETVKKVGTMTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQI  539



>ref|XP_004499224.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=549

 Score =   434 bits (1115),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 241/554 (44%), Positives = 331/554 (60%), Gaps = 16/554 (3%)
 Frame = +1

Query  313   VLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSG  492
             +LFL+ +    A+   V     A+G G+WQ L +N G+VAMHM L H + +V FD+   G
Sbjct  8     LLFLLPILITTAMTWRV----TAAGNGQWQQLQKNIGIVAMHMQLLHNDRIVIFDRTDFG  63

Query  493   RSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSN  672
              S   L    NG      +E      C AHSVEYDV +NT R L   +D WCSSGT+  N
Sbjct  64    LSNLSLP---NGKCRHDPKETTVKTDCTAHSVEYDVKSNTFRALFVQTDVWCSSGTVNPN  120

Query  673   GTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGG  852
             G ++QTGG+ DG + ++ + PC D  C+W+     L   RWYA++ ILP  + R II+GG
Sbjct  121   GILIQTGGFNDGDRAVRIYNPCDD--CDWQEFDGGLTARRWYATDHILP--DGRQIIIGG  176

Query  853   RRASTYEFVPRFPNMQKST-DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSIL  1029
             R+   YEF P+   + K   +LPFL +T +R    NNLYPF+ L+ DG LF+FAN  +IL
Sbjct  177   RKQFNYEFYPKNHEVDKKVYNLPFLDETNDRGEE-NNLYPFVFLNVDGNLFVFANNRAIL  235

Query  1030  FNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEA  1206
              +Y KN V + FP++PG   RSYPSTGS V+LPL + +++  + EV+ICGGA  G++  A
Sbjct  236   LDYTKNAVVRTFPQVPGGEPRSYPSTGSGVLLPLKNLQSKAVEAEVLICGGAPKGSFQLA  295

Query  1207  KQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWG  1386
              + +F++ L +C R+ I+    KW ME MPG RVM+DMV+LP G +LIING   G AGW 
Sbjct  296   TKNKFLKALNTCVRIKITDPNPKWVMETMPGSRVMSDMVMLPNGNVLIINGAGSGTAGWE  355

Query  1387  NGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFT  1566
              G  P L P +Y     +G RF +   ++  RMYHSSA L+ DGRVL+ GSNP  GY F 
Sbjct  356   FGRDPVLNPVLYKTDNPIGSRFELQNPSETPRMYHSSAVLVRDGRVLVGGSNPYIGYNFI  415

Query  1567  NVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPS  1746
             NV  PTEL ++AF P Y++ RF N RPK +S   E      + YG++  +RF +      
Sbjct  416   NVLFPTELSIEAFSPSYLEPRFANVRPKIMSHISESQTK--LRYGQKLVLRFQVKTTLDR  473

Query  1747  EDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVT  1926
               L  +  +PPF THS +MNQR+L L    +          VV  P S + APPG+YM+ 
Sbjct  474   NLLYVTLLAPPFNTHSFSMNQRLLVLEPNKVNNVAGTTYEIVVTIPGSTILAPPGFYMLF  533

Query  1927  VVNEGIPSISRWVK  1968
             VV++ IPS   W++
Sbjct  534   VVHKEIPSEGIWIQ  547



>ref|XP_007222145.1| hypothetical protein PRUPE_ppa004709mg [Prunus persica]
 gb|EMJ23344.1| hypothetical protein PRUPE_ppa004709mg [Prunus persica]
Length=495

 Score =   431 bits (1109),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 230/514 (45%), Positives = 310/514 (60%), Gaps = 21/514 (4%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNT  612
             MHM L H + VV FD+   G+S   L       +C G+        C AHS EYDV  NT
Sbjct  1     MHMQLLHNDRVVLFDRTDFGKSNLSLP----DGKCVGN-------DCTAHSAEYDVTTNT  49

Query  613   IRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDER  792
              RPL  +SD WCSSG++  +G ++QTGG+ +G +R++ F PC    C+WK  +  L   R
Sbjct  50    FRPLTVLSDVWCSSGSVAPDGRLIQTGGFTNGERRVRIFEPCTG--CDWKEIENGLAARR  107

Query  793   WYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPF  972
             WYA++ ILP  + R II+GGRR   YEF P+  +  K   LPFL QT + +A  NNLYPF
Sbjct  108   WYATDHILP--DGRQIIIGGRRQFNYEFYPKSASTNKVFSLPFLVQTNDPDAE-NNLYPF  164

Query  973   LHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDH-KNRF  1149
             + L+ DG LFIFAN  +ILF+Y KN V K +P++PG   RSYPSTGS+V+LPL + K R 
Sbjct  165   VFLNVDGNLFIFANNRAILFDYVKNNVVKTYPQIPGGDPRSYPSTGSAVLLPLKNLKARS  224

Query  1150  QKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVIL  1329
              + EV++CGGA  G+Y +A +G F   L +C R+ I+    +W +E MP  RVM DM +L
Sbjct  225   IEAEVLVCGGAPTGSYIKATKGTFTGALNTCARIKITDPNPQWVLETMPQARVMGDMTLL  284

Query  1330  PTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALL  1509
             P G +L+ING   G AGW  G +P L P +Y P    G RF     T I RMYHS+A LL
Sbjct  285   PDGTVLLINGASNGAAGWELGRNPVLNPVVYRPDNAAGSRFEQQNPTTIPRMYHSTAVLL  344

Query  1510  PDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAV  1689
              DGRVL+ GSNP+  Y FTNV  PTELR++AF PDY+D ++ N RPK V+   +    A 
Sbjct  345   RDGRVLVGGSNPHPNYEFTNVLFPTELRVEAFNPDYLDAKYGNLRPKIVTPKSQ----AK  400

Query  1690  VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNa  1869
             ++YGK+  +RF +     +  +  +  +P FTTHS +MN R L L   +++         
Sbjct  401   INYGKKLTIRFSVTGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLASENVKSVGKSAYEV  460

Query  1870  vvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              V  P S   AP GYY++ VV++ IPS   WV+ 
Sbjct  461   EVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQI  494



>ref|XP_007017717.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14942.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   433 bits (1113),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 244/562 (43%), Positives = 332/562 (59%), Gaps = 27/562 (5%)
 Frame = +1

Query  298   ITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFD  477
              + LL   L + +PC+     VL + A    GRWQ L ++ GV AMHM L   + VV FD
Sbjct  7     FSILLFQLLFASQPCH----RVLTTAA---DGRWQLLQKSIGVSAMHMQLLRNDRVVMFD  59

Query  478   QRGSGRSGYQLRRRFNGTRCKGSREDLSDPS-CYAHSVEYDVLNNTIRPLRFISDTWCSS  654
             +   G+S   L    NG +C  +  + + P+ C AHSVEY+VL N  R L   +D WCSS
Sbjct  60    RTDFGKSNLSLP---NG-KCLTNSSNTALPADCTAHSVEYNVLTNEFRALMVQTDVWCSS  115

Query  655   GTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDR  834
             G I+ +G ++QTGG+ +G +R++ F+PC   TC+W+     L  +RWYASN ILP  + R
Sbjct  116   GAIMPDGNLVQTGGFNNGERRVRVFSPC--STCDWQEIPNRLAAKRWYASNHILP--DGR  171

Query  835   VIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFAN  1014
              IIVGGR    YEF+P+      + +LPFL +T +R    NNLYPF+ L+ DG LFIFAN
Sbjct  172   QIIVGGRGQFNYEFIPK-TFAANTFNLPFLSETNDRGVE-NNLYPFVFLNVDGNLFIFAN  229

Query  1015  RDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAG  1191
               +IL +Y  N+V K +P +PG   RSYPSTGS+V+LPL + K    + EV +CGGA  G
Sbjct  230   NRAILLDYVNNKVVKTYPTIPGGNPRSYPSTGSAVLLPLKNLKASAIQAEVFVCGGAPKG  289

Query  1192  AYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRG  1371
             +Y +A +G FI  L +C RM I+    +W ME MP  RVM+DM++LP G++LIING   G
Sbjct  290   SYVQALKGNFIGALNTCARMTITDPNPQWVMETMPMARVMSDMILLPNGKVLIINGAGSG  349

Query  1372  CAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPND  1551
              AGW  G  P L P +Y P   +G RF     T I RMYHS+  LL DGRVL+ GSNP+ 
Sbjct  350   SAGWELGRDPVLSPVMYLPDNEIGSRFETQTPTTIPRMYHSAVVLLRDGRVLVGGSNPHA  409

Query  1552  GYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAV--VDYGKEFHVRFW  1725
              Y FT V  PTEL L+AF P YMD  F++ RP  V      +P ++  +   K+  V+  
Sbjct  410   FYNFTGVLFPTELSLEAFSPAYMDSEFNDLRPTIV------APKSMFGIQIRKKLSVQVQ  463

Query  1726  LDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaap  1905
             +  K     +  +  +P FTTHS +MNQR+L L   ++    N   N     P S   AP
Sbjct  464   ITGKVDPNLVSVTMVAPSFTTHSFSMNQRVLDLGNDNVTASGNSTYNIEYTTPRSYNLAP  523

Query  1906  pGYYMVTVVNEGIPSISRWVKF  1971
              G+Y++ VV++ IPS + WVK 
Sbjct  524   AGFYLLFVVHQDIPSQAIWVKL  545



>ref|XP_010061250.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
 gb|KCW68173.1| hypothetical protein EUGRSUZ_F01844 [Eucalyptus grandis]
Length=551

 Score =   433 bits (1113),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 233/530 (44%), Positives = 318/530 (60%), Gaps = 15/530 (3%)
 Frame = +1

Query  385   GQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSD  564
             G GRWQ L  + GV AMHM L H + VV FD+   G+S   L    NG      R+    
Sbjct  33    GGGRWQLLQRSIGVSAMHMQLLHNDVVVIFDRTDFGKSNLSLP---NGKCRNDPRDTALK  89

Query  565   PSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD  744
               C AHS+EYDV +N+ RPL   +D WCSSG+++ +G ++QTGG+ DG +RI+ F PC  
Sbjct  90    IDCTAHSIEYDVASNSFRPLMVQTDVWCSSGSVMPDGRLIQTGGFNDGERRIRIFNPC--  147

Query  745   KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFL  924
               C+W+  +  L   RWYA+N ILP  N   IIVGGR    YEF P+     K  +LPFL
Sbjct  148   SGCDWQEVENGLSARRWYATNHILP--NGLQIIVGGRGQFNYEFYPK-TGAPKVYNLPFL  204

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              QT + N   NNLYPF+HL+ DG LFIFAN  +ILF+Y   +V K +P MPG   R+YPS
Sbjct  205   AQTNDANIE-NNLYPFVHLNVDGNLFIFANNRAILFDYAHGKVVKTYPAMPGGDPRNYPS  263

Query  1105  TGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWN  1281
             TGSSV+LPL + +   ++ EV++CGGA  G+Y +A +G F+  L +CGR+ I+    +W 
Sbjct  264   TGSSVLLPLKNLQAPVKEAEVLVCGGAPRGSYIKATKGNFVGALTTCGRIKITDPAPQWV  323

Query  1282  MENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVL  1461
             ME MP PRVM DM +LP G +LIING   G AGW  G +P   P +Y P    G RF + 
Sbjct  324   METMPKPRVMGDMTLLPNGNVLIINGAAVGTAGWEIGRNPVFNPVLYRPDNPTGNRFELQ  383

Query  1462  RATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQ  1641
               + I RMYHS+A LL DGRVL+ GSNP+  Y FT+V  PTEL L+AF P Y+D +++N 
Sbjct  384   NPSSIPRMYHSTAILLRDGRVLVGGSNPHVTYAFTSVLFPTELSLEAFSPPYLDAQYNNL  443

Query  1642  RPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLK  1821
             RP+ +S     +  A + YG +  VRF +     +  +  +  +P FTTHS +MNQR+L 
Sbjct  444   RPRIIS----PASQAGIGYGMKLLVRFSVVGAVSASRVTVTMVAPSFTTHSFSMNQRLLV  499

Query  1822  L-RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             +     +      +       P +   AP GYY++ VV++ +PS   W++
Sbjct  500   IGDGRGVTAVGKSVYEVEAVTPGTRTLAPAGYYLLFVVHQDVPSEGIWIR  549



>ref|XP_011069750.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   433 bits (1113),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 243/549 (44%), Positives = 328/549 (60%), Gaps = 29/549 (5%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             +++ AA G G+W  L+ N GV AMHM L + + V+ FD+   G S   L       +C+ 
Sbjct  29    VLTLAAPGGGKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPN----NQCRN  84

Query  544   SREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
                DL+    C AHSVEYDV +N+IRPL  ++D WCSSG+ + +G++MQTGG+ DG + +
Sbjct  85    DPNDLTLKVDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDRNV  144

Query  721   QFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
             + + PC D +C+W+     L   RWYA+N ILP  + R IIVGGR   +YEF P+     
Sbjct  145   RVYKPCSDDSCDWQEFDVALRQRRWYATNHILP--DGRQIIVGGRGQFSYEFYPKKAGAD  202

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
             +S +LPFL QT +     NNLYPF+ L++DG LFIFAN  +ILF+Y    V + +P +PG
Sbjct  203   QSYNLPFLSQTNDPRIE-NNLYPFVFLNTDGNLFIFANNRAILFDYVNGLVVRNYPTIPG  261

Query  1081  EGSRSYPSTGSSVMLPLDHKNRFQKV--EVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
                RSYPS+GS+V+LPL        V  EV++CGGA  G++T A  G F+  L +CGR+ 
Sbjct  262   GDPRSYPSSGSAVLLPLRDLQGGANVTAEVLVCGGAPKGSFTSANNGNFVGALNTCGRIR  321

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             IS    +W ME MP  RVM DMV+LP G ILIING   G AGW  G +P L P IY P  
Sbjct  322   ISDPNPQWAMETMPLARVMGDMVLLPNGNILIINGASSGTAGWDFGRNPVLTPVIYRPNN  381

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
              VG RF    ++ I RMYHS+A LL DGR+L++GSNP+  Y FT V  PT+L ++AF PD
Sbjct  382   PVGLRFEAQNSSSIPRMYHSTAILLRDGRILVSGSNPHAYYNFTGVVFPTDLTIEAFSPD  441

Query  1615  YMDRRFDNQRPKNVSVYVEGSPA--AVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             Y+D R    RP  V      SPA  + + YG++  + F    +     +  +  +PPFTT
Sbjct  442   YLDSRLIRVRPMIV------SPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTT  495

Query  1789  HSVAMNQRMLKL--------RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGI  1944
             HS +MNQR+L L          TS+  G N  V   V  P S + APPGYY++ VV   +
Sbjct  496   HSFSMNQRLLVLTNSTGISASVTSLG-GSNYQV--RVRTPSSNILAPPGYYLLFVVYREV  552

Query  1945  PSISRWVKF  1971
             PS   WV+ 
Sbjct  553   PSQGIWVQI  561



>ref|XP_007017718.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14943.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   432 bits (1111),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 245/564 (43%), Positives = 333/564 (59%), Gaps = 24/564 (4%)
 Frame = +1

Query  289   PCAITALLVL-FLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTV  465
             P  I ++LV   L + +PC+     +L S A    GRWQ L ++ GV AMHM L   + V
Sbjct  3     PTFIFSILVFQLLFASQPCH----RILTSAA---DGRWQLLQKSIGVSAMHMQLLRNDRV  55

Query  466   VFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-SCYAHSVEYDVLNNTIRPLRFISDT  642
             V FD+   G+S   L    NG +C  +  + + P  C AHSVEY+VL N  R L   +D 
Sbjct  56    VMFDRTDFGKSNLSLP---NG-KCLSNPTNTALPVDCTAHSVEYNVLTNEFRALTVQTDV  111

Query  643   WCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPG  822
             WCSSG I+ +G ++QTGG+ +G++R++ F+PC   TC+W+     L  +RWYA+N ILP 
Sbjct  112   WCSSGAIMPDGNLVQTGGFNNGTRRVRVFSPC--STCDWQEIPNGLAAKRWYATNHILP-  168

Query  823   KNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLF  1002
              + R IIVGGRR   YEF+P+      + +LPFL +T +R    NNLYPF+ L+ DG LF
Sbjct  169   -DGRQIIVGGRRQFNYEFIPK-TVAANTFNLPFLSETNDRGVE-NNLYPFVFLNVDGNLF  225

Query  1003  IFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGG  1179
             IFAN  +IL +Y  N+V K +P +PG   RSYPSTGS+V+LPL + K    + EV++CGG
Sbjct  226   IFANNRAILLDYVNNKVVKTYPTIPGGDPRSYPSTGSAVLLPLKNLKAPAIQAEVLVCGG  285

Query  1180  ASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIING  1359
             A  G+Y +A +G FI  L +C RM I+    +W ME MP  RVM+DM++LP G++LIING
Sbjct  286   APKGSYLQALKGNFIGALNTCARMTITDPNPQWVMETMPMARVMSDMILLPNGKVLIING  345

Query  1360  VKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGS  1539
                G AGW  G  P L P +Y P   +G RF     T I RMYHS+  LL DGRVL+ GS
Sbjct  346   AGSGSAGWELGRDPVLSPVMYLPDHEIGSRFETQTPTTIPRMYHSAVVLLRDGRVLVGGS  405

Query  1540  NPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVR  1719
             NP+  Y FT V  PTEL L+AF P YMD  F++ RP      V     + +   K+  V+
Sbjct  406   NPHAFYNFTGVLFPTELSLEAFSPVYMDAEFNDLRP----TIVAPKSMSGIQIRKKLSVQ  461

Query  1720  FWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspva  1899
               +  K     +  +  +P FTTHS +MNQR+L L   ++    N   N     P S   
Sbjct  462   VVITGKVDPNLVSVTMVAPSFTTHSFSMNQRVLDLGNNNVTALGNSTYNIEYTTPRSYNL  521

Query  1900  appGYYMVTVVNEGIPSISRWVKF  1971
             AP G+Y++ VV++ IPS   WVK 
Sbjct  522   APAGFYLLFVVHQDIPSQGIWVKL  545



>gb|KDO82728.1| hypothetical protein CISIN_1g048017mg [Citrus sinensis]
Length=566

 Score =   432 bits (1112),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 244/536 (46%), Positives = 331/536 (62%), Gaps = 35/536 (7%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+W  L  + G+ AMHM + + + V+ FD+   G S   L    +  R +G   D+    
Sbjct  52    GQWVLLQSSIGISAMHMQVLNNDKVIIFDRTDMGPSNLSLP--IDKCRKEG---DVGQLD  106

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHSV YD+ +NT RPL   +DTWCSSG +LS+GT++QTGGY  G + I+ F PC D+ 
Sbjct  107   CTAHSVLYDIASNTFRPLLLQTDTWCSSGAVLSDGTLVQTGGYNVGDRVIRLFTPCNDEG  166

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W    K+L+D RWYASNQILP  ++R+I+VGGRR  TYEF P+  ++  S  L FL +
Sbjct  167   CDWVELSKNLWDRRWYASNQILP--DNRIIVVGGRRVFTYEFYPKIDSLSSSLYLRFLIE  224

Query  931   TYERNAG-GNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             T  R+ G  NNLYPFLHL  DG LFIFANR SILF+Y  N++ K+FP +PG   R+YPST
Sbjct  225   T--RDPGEENNLYPFLHLLPDGNLFIFANRRSILFDYINNKLVKEFPVIPGNDKRNYPST  282

Query  1108  GSSVMLPL--------DHKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVIS  1260
             GSS++LP+        +        EVM+CGGA AGA+ ++ K+  ++E  ++CGR+ ++
Sbjct  283   GSSILLPVKLSAGSDGNGTAALPDAEVMVCGGAPAGAFIKSDKESVYVEASRTCGRLKVT  342

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
                  W+ME MP PRVM+DM++LP+G ++IING   G AGW +   P             
Sbjct  343   DKYPVWSMEFMPMPRVMSDMLLLPSGDVIIINGASNGTAGWEDAEEP-------------  389

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
              +RF VL  +KI RMYHSSA +LPDGR+L+ GSNP+  Y FT  P+PT+L L+AF P Y+
Sbjct  390   DRRFVVLNPSKIPRMYHSSAVVLPDGRILVGGSNPHRRYNFTAYPYPTDLSLEAFHPHYL  449

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             D      RP  +S+    S    V Y + F V F L    PS ++  S  +P FTTHS A
Sbjct  450   DPENAYMRPSILSL---ESIDRTVSYNEVFAVTFELSSYSPSGEISVSLMTPSFTTHSFA  506

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             MNQR++ L   S+ +        VV  PP+   APPGYYM+ VV+ GIPS + WVK
Sbjct  507   MNQRLVVLNVVSVSQLSVYAYKVVVNGPPTATVAPPGYYMMFVVHAGIPSHAVWVK  562



>ref|XP_010256224.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=554

 Score =   432 bits (1110),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 239/532 (45%), Positives = 321/532 (60%), Gaps = 21/532 (4%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPS  570
             +W+ L  N G+ AMHM L H N VV FD+   G S   L       RC+    D +    
Sbjct  37    QWRLLHTNIGLSAMHMQLLHNNKVVMFDRTDFGPSNLSL----PPGRCRFDPNDTALKID  92

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS+ YDV  NTIRPL   +DTWCSSG +L +GT++QTGGY DG + I+   PC +  
Sbjct  93    CTAHSLLYDVATNTIRPLMVQTDTWCSSGALLPDGTLLQTGGYNDGDRAIRQLTPCNNDE  152

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W     +L  +RWYA+NQILP  + RVII+GGRR  +YEF PR  +   S  L FL +
Sbjct  153   CDWIESPGYLSAKRWYATNQILP--DGRVIILGGRREFSYEFYPR-GSSSNSFWLNFLRE  209

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T  R+   NNLYPFLHL  DG LFIFAN  SI F+Y  NRV ++FP + G   R+YPS+G
Sbjct  210   T--RDNDENNLYPFLHLLPDGNLFIFANTRSISFDYVHNRVVREFPPITGGEPRNYPSSG  267

Query  1111  SSVMLPL----DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             SSV+LPL    +++      EV+ICGGA AG++++A +GRFI    +CGR+ ++ +  KW
Sbjct  268   SSVLLPLQLFDENRGTGTPAEVLICGGAPAGSFSQAGRGRFIRACSTCGRLKVTDHDPKW  327

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV-GKRFS  1455
              ME MP  RVM DM++LPTG ++IING   G AGW N   P  +P IY   ++   +RFS
Sbjct  328   IMEEMPMARVMGDMLLLPTGDVIIINGACYGTAGWENARDPVTKPVIYRTYESANNQRFS  387

Query  1456  VLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFD  1635
             V++ +   R+YHS+A LLPDGR+L+ GSNP+  Y FT   +PT+L L++F P Y+ R   
Sbjct  388   VMQPSPTPRLYHSTAVLLPDGRILVGGSNPHPIYRFTGAEYPTDLSLESFSPPYLAREHA  447

Query  1636  NQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRM  1815
               RP  V+         V+ YG+   V F + +   +  L  +  +P FTTHSVAMNQR+
Sbjct  448   ETRPTIVAT------GEVLKYGELLTVDFTVQEYQSATALSVTIVAPSFTTHSVAMNQRL  501

Query  1816  LKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             + LR   +              PPS   AP GYY++ VV+ GIPS + WVK 
Sbjct  502   VVLRVADVSHISAHRYQLKAHGPPSATIAPSGYYLLFVVHAGIPSSAVWVKI  553



>ref|XP_006649773.1| PREDICTED: galactose oxidase-like [Oryza brachyantha]
Length=559

 Score =   432 bits (1111),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 245/538 (46%), Positives = 324/538 (60%), Gaps = 25/538 (5%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK-GSREDLSDPS  570
             RW  L  + GV AMHM L H + V+ FD+   G+S   L       RC+   RE +    
Sbjct  34    RWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGQSNLSLP----DGRCRRNPRERVVPVD  89

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV--D  744
             C AHS EYDV +NT RPL   +DTWCSSGT+  +GT++QTGG+ DG + ++  A C   D
Sbjct  90    CTAHSAEYDVASNTFRPLYVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNVRTMAACEADD  149

Query  745   KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF-PNMQKSTDLPF  921
              +C+W   +  L   RWYA+NQILP  + R  IVGGRR  +YEF P+  P+    T +PF
Sbjct  150   DSCDWDETQDALAVSRWYATNQILP--DGRAFIVGGRRQFSYEFYPKADPSDTSVTLMPF  207

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L QT  ++   NNLYPF+HL+ DG LFIFA   +IL +Y+KN++ + +P + G   R+YP
Sbjct  208   LVQT--KDPEENNLYPFVHLNIDGNLFIFAKNRAILLDYKKNKIVRTYPELAGGDPRNYP  265

Query  1102  STGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWN  1281
             S+GSSV+LPL  K    + EV++CGGA AG+Y   K G F   L +CGR+ I+     W 
Sbjct  266   SSGSSVLLPL--KPSPTEAEVLVCGGAPAGSYNSTKDGTFPSALVTCGRIKITDMAPSWV  323

Query  1282  MENMPGPRVMNDMVILPTG-QILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
             +E MP PRVM DM++LP G +++IING   G AGW +  +PAL P IY P  + G RF  
Sbjct  324   IETMPSPRVMGDMILLPNGAEVVIINGAMDGTAGWESAKTPALAPLIYRPDHSPGDRFEE  383

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
               +T IAR+YHSSA LL DGR+L+ GSNP+  Y F+NV +PTEL L+A+ P+Y+D   D 
Sbjct  384   QSSTDIARLYHSSAVLLRDGRLLVGGSNPHIYYNFSNVQYPTELSLEAYSPEYLDPSNDM  443

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE----DLEFSAYSPPFTTHSVAMN  1806
              RP  V     G+PA+V  YG    +RF +     S      L  +  +P FTTHS AMN
Sbjct  444   LRPTIVDPSPTGAPASVT-YGASLTLRFTVPASKRSRGGIGPLSATMVAPSFTTHSFAMN  502

Query  1807  QRMLKL---RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             QR+L L   +  ++ R   G     V  P + V APPGYYMV VVN  IPS   WV  
Sbjct  503   QRLLFLDVVKTAALARA--GSYQTSVVMPATAVLAPPGYYMVFVVNGHIPSEGIWVHI  558



>ref|XP_009408991.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=540

 Score =   431 bits (1108),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 243/536 (45%), Positives = 320/536 (60%), Gaps = 26/536 (5%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             AA+G G W+ L  + GV AMHM L H + VV FD+   G S   L       RC+    D
Sbjct  26    AAAGGGEWKLLQHSIGVSAMHMQLLHNDRVVVFDRTDFGPSNLSLPD----GRCRNDPND  81

Query  556   LSDP-SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
              + P  C AHS EYDV+ N  RPL  ++DTWCSSG++  +GT++QTGG+ DG +  + F 
Sbjct  82    KALPVDCTAHSAEYDVVANAFRPLMVLTDTWCSSGSVAPDGTLVQTGGFNDGERAARTFR  141

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR-FPNMQKST  909
             PC D +C+W    + L   RWYA+NQ+LP  + R ++VGGRR   YEF P+  P+   + 
Sbjct  142   PCDDGSCDWVETAQALAVRRWYATNQVLP--DGRAVVVGGRRQFNYEFYPKPDPSDMSTI  199

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
              L FL  T  R+   +NLYPF+HLS DG LFIFAN  +IL +Y KN V + +P+MP    
Sbjct  200   ALRFLQDT--RDDVEDNLYPFVHLSIDGNLFIFANNRAILLDYSKNTVVRTYPKMPSGEP  257

Query  1090  RSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQG-RFIEGLKSCGRMVISGN  1266
             R+YPS+GSSV+LPL  K    + EV+ICGGA AG+Y++A Q  RF+  L SCGR+ I+  
Sbjct  258   RNYPSSGSSVLLPL--KPSPTEAEVLICGGAPAGSYSQALQKKRFLRALDSCGRIKITDA  315

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK  1446
                WNME MP PRVM DMV+LP G +L+ING   G AGW  G  P L P +Y P    G 
Sbjct  316   APSWNMEAMPVPRVMGDMVLLPDGDVLLINGAAAGTAGWELGHDPVLTPVVYRPDGAAGA  375

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF V   +   R+YHS+A LL DGRVL+ GSNP+  Y F+ V +PTEL ++AF P Y++ 
Sbjct  376   RFDVQSGSTTPRLYHSTAVLLRDGRVLVGGSNPHVKYNFSGVEYPTELSMEAFSPSYLNS  435

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE-DLEFSAYSPPFTTHSVAM  1803
                  RP+   +    SP  +  YG  F ++F +     SE  +  +  +P F THS +M
Sbjct  436   ENSRLRPQ---ILTPPSPIQLT-YGGRFSLQFSVGVV--SEGGIRVTMVAPSFATHSFSM  489

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             NQR+L L        + GM   V  AP S + APPGYYMV VVN G+PS   W   
Sbjct  490   NQRLLVLET------EGGMSEVVAVAPASAILAPPGYYMVYVVNGGVPSEGIWAHI  539



>gb|EYU36763.1| hypothetical protein MIMGU_mgv1a004035mg [Erythranthe guttata]
Length=548

 Score =   431 bits (1109),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 237/540 (44%), Positives = 325/540 (60%), Gaps = 18/540 (3%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
              +  A++  G+W  L+ N GV AMH+ L + + VV FD+   G S   L       +C+ 
Sbjct  22    FLPRASAAGGKWDVLLSNIGVSAMHIQLLNNDRVVIFDRTDFGSSNISLP----AGKCRN  77

Query  544   SRED-LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
                D  S   C AHSVEYDV++NT+RPL   +DTWCSSG +  +G+++QTGGY DG   +
Sbjct  78    DPNDTYSTVDCTAHSVEYDVVSNTVRPLTVQTDTWCSSGAVAPDGSLVQTGGYNDGDHAV  137

Query  721   QFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF-PNM  897
             + F PC D +C+W+     L   RWYA+N ILP  + + II+GGRR   +EF P+  P  
Sbjct  138   RTFRPCNDSSCDWQEINPGLIKRRWYATNHILP--DGKQIIIGGRRQFGFEFYPKTSPAD  195

Query  898   QKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMP  1077
              KS +L FL QTY+     NNLYPF+ L++DG LFIFAN  +ILFNY    V K +P +P
Sbjct  196   YKSYNLSFLVQTYDPLIE-NNLYPFVFLNTDGNLFIFANNRAILFNYSNRVVVKTYPIIP  254

Query  1078  GEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
             G   RSYPS+GS+V+LPL + +     EV++CGGA   +Y  A  G F+  L +CGR+ I
Sbjct  255   GGDPRSYPSSGSAVLLPLKNNS---GAEVLVCGGAPKDSYVNATNGIFLPALDTCGRIRI  311

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +    +W +E MPGPRVM DMV+LP G +LIING + G AGW  G  P L P IY P K+
Sbjct  312   NDPNPQWVVETMPGPRVMGDMVLLPNGNVLIINGARSGTAGWEYGRDPVLSPVIYRPDKS  371

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
             +  RF V  ++   RMYHS+A LL DGRVL+ G+NP+  Y FT V  PT+L L+AF P Y
Sbjct  372   IWSRFEVQNSSTTPRMYHSTAVLLRDGRVLVGGNNPHAYYNFTGVLFPTDLTLEAFSPSY  431

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDK-KWPSEDLEFSAYSPPFTTHS  1794
             +D +F + RP    V V     +V+ YG+E  + F +   +     ++ +  +P FTTHS
Sbjct  432   LDSKFASSRP----VIVTPVSPSVIGYGQELTIGFAVASGRIIGSLVKVTMVAPSFTTHS  487

Query  1795  VAMNQRMLKLRCTSMERG-DNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              +MNQR+L L   ++    DN      V  P S + AP GYY++ VV + IPS   WV+ 
Sbjct  488   FSMNQRLLVLSGGNVTTSFDNTTYQIRVITPGSGILAPSGYYLLFVVYQEIPSEGIWVQI  547



>ref|XP_004500954.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=555

 Score =   431 bits (1108),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 238/544 (44%), Positives = 331/544 (61%), Gaps = 23/544 (4%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK-GS  546
             S A SG G+WQ L +N G+V MHM L H + VV FD+   G S   L    NG RC+   
Sbjct  26    SPAESGSGQWQLLQKNIGIVGMHMQLLHNDRVVIFDRTDFGLSNLSLP---NG-RCRINP  81

Query  547   REDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQF  726
             +E +    C AHS+EYDV++N+ RPL   ++ WCSSG++  +G ++QTGG+ DG + ++ 
Sbjct  82    QEQVVKTDCTAHSLEYDVVSNSFRPLFVQTNVWCSSGSVSPDGKLIQTGGFNDGDRTVRI  141

Query  727   FAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS  906
             F PC   +C+W+     L   RWY++N  LP  + R II+GGRR   YEF P+  +  K+
Sbjct  142   FNPC--SSCDWQEFNASLAARRWYSTNHNLP--DGRQIIIGGRRQFNYEFYPKKESTAKN  197

Query  907   T-DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
             T  LPFL QT +  A  NNLYPF+ L+ DG LFIFAN  +ILF+Y  N V K +P +PG 
Sbjct  198   TYSLPFLVQTNDAGAE-NNLYPFVFLNVDGNLFIFANNRAILFDYNSNNVVKTYPVIPGG  256

Query  1084  GSRSYPSTGSSVMLPLDHKNRFQKVE--VMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
               RSYPSTGS+V+LPL +  ++  VE  VMICGGA  G++ +   G FI  L +C R+ I
Sbjct  257   DPRSYPSTGSAVLLPLSNLQKYPSVEAEVMICGGAPRGSFQKTLNGTFIGALNTCARIKI  316

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +     W +E MPG RVM+DM++LP G +L+ING   G AGW +G +P L P++Y P + 
Sbjct  317   TDPNPNWVIETMPGGRVMSDMLLLPNGNVLLINGAAMGSAGWESGRNPVLNPFLYKPNER  376

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVF-TNVPHPTELRLQAFVPD  1614
             VG RF + + + I RMYHS+A L+ DGRVL+ GSNP+  Y F  NV  PTELRL+AF P 
Sbjct  377   VGSRFQLQKPSGIPRMYHSTAVLVRDGRVLVGGSNPHIDYKFNNNVLFPTELRLEAFSPS  436

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHS  1794
             Y++   D+ RPK   V+        + YG++  VRF +        +  +  +PPF THS
Sbjct  437   YLEAGLDDVRPK--MVFPAPQSQTKLKYGQKLKVRFQVKATLVRNSVSVTMIAPPFNTHS  494

Query  1795  VAMNQRMLKLRCTSMERGDNGM----VNavvaappspvaappGYYMVTVVNEGIPSISRW  1962
              +MNQR+L L    M+  +N +        V  P S + APP YY++ VV++ +PS   W
Sbjct  495   FSMNQRLLVLE---MKLQNNTVGESTYEIEVTTPGSAILAPPAYYLLFVVHQEVPSQGVW  551

Query  1963  VKFA  1974
             V+  
Sbjct  552   VQLV  555



>ref|XP_011069718.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   431 bits (1108),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 243/549 (44%), Positives = 327/549 (60%), Gaps = 29/549 (5%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             +++ AA G G+W  L+ N GV AMHM L + + V+ FD+   G S   L       +C+ 
Sbjct  29    VLTLAAPGGGKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPNN----QCRN  84

Query  544   SREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
                DL+    C AHSVEYDV +N+IRPL  ++D WCSSG+ + +G++MQTGG+ DG + +
Sbjct  85    DPNDLTLKVDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDRNV  144

Query  721   QFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
             + + PC D +C+W+     L   RWYA+N ILP  + R IIVGGR   +YEF P+     
Sbjct  145   RVYKPCSDDSCDWQEFDVALRQRRWYATNHILP--DGRQIIVGGRGQFSYEFYPKKAGAD  202

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
             +S +LPFL QT +     NNLYPF+ L++DG LFIFAN  +ILF+Y    V + +P +PG
Sbjct  203   QSYNLPFLSQTNDPRIE-NNLYPFVFLNTDGNLFIFANNRAILFDYVNGLVVRNYPTIPG  261

Query  1081  EGSRSYPSTGSSVMLPLDHKNRFQKV--EVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
                RSYPS+GS+V+LPL        V  EV++CGGA  G++T A  G F+  L SCGR+ 
Sbjct  262   GDPRSYPSSGSAVLLPLRDLQGGANVTAEVLVCGGAPKGSFTSANNGNFVGALNSCGRIR  321

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             IS    +W ME MP  RVM DMV+LP G ILIING   G AGW  G +P   P IY P  
Sbjct  322   ISDPNPQWVMETMPLARVMGDMVLLPNGNILIINGASSGTAGWDLGRNPVFTPVIYRPNN  381

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
              VG RF    ++ I RMYHS+A LL DGR+L++GSNP+  Y FT V  PT+L ++AF PD
Sbjct  382   PVGLRFEAQNSSSIPRMYHSTAILLRDGRILVSGSNPHAYYNFTGVVFPTDLTMEAFSPD  441

Query  1615  YMDRRFDNQRPKNVSVYVEGSPA--AVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             Y+D R    RP  V      SPA  + + YG++  + F    +     +  +  +PPFTT
Sbjct  442   YLDPRLIRVRPMIV------SPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTT  495

Query  1789  HSVAMNQRMLKL--------RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGI  1944
             HS +MNQR+L L          TS+  G N  V   V  P S + APPGYY++ VV   +
Sbjct  496   HSFSMNQRLLVLTNSTGISASVTSLG-GSNYQV--RVMTPGSNILAPPGYYLLFVVYREV  552

Query  1945  PSISRWVKF  1971
             PS   WV+ 
Sbjct  553   PSQGIWVQI  561



>gb|EYU23055.1| hypothetical protein MIMGU_mgv1a021812mg, partial [Erythranthe 
guttata]
Length=517

 Score =   429 bits (1103),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 233/531 (44%), Positives = 310/531 (58%), Gaps = 16/531 (3%)
 Frame = +1

Query  382   SGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED-L  558
             S QG W+ L E+ G+ AMHM L   N +V FD+   G S   L       RC+    D +
Sbjct  1     SLQGEWRLLHESIGISAMHMQLLKNNKLVIFDRTDFGPSNLSL----PDGRCRSDPNDEV  56

Query  559   SDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC  738
                 C AHS+ YD+ +N+ RPL  ++DTWCSSGT+L +GT++QTGG+ DG    +  APC
Sbjct  57    LVRDCTAHSIMYDIGSNSFRPLTILTDTWCSSGTVLPDGTLVQTGGFNDGDHVTRTLAPC  116

Query  739   VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLP  918
               K C+W      L   RWYA+NQILP  + R+IIVGGR    YEF PR      S  L 
Sbjct  117   ARKNCDWNEFPDSLSRRRWYATNQILP--DGRIIIVGGRAQFNYEFYPRNYG-DGSIRLR  173

Query  919   FLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSY  1098
             FL +   R+   NNLYPFLHL  DG LF+FAN  SI+ +Y+++RV ++FP + G  SR+Y
Sbjct  174   FLKEA--RDGSENNLYPFLHLLPDGNLFVFANTRSIVLDYKRHRVVREFPAIHGGDSRNY  231

Query  1099  PSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             PS+GSSV+LP+D      +VEV+ICGGA   AY +A QG F+    +CGR+ IS     W
Sbjct  232   PSSGSSVLLPIDENVTPVRVEVLICGGAKNNAYEQADQGTFLRASSTCGRLRISDRHPAW  291

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              ME MP PRVM DMV+LP G ++IING   G AGW  G +P   P IY P    G RFSV
Sbjct  292   KMEAMPMPRVMGDMVLLPNGDVIIINGAGSGAAGWEAGRNPVTRPVIYRPDGGSGNRFSV  351

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             + A+   RMYHS+A L+PDGRV + G NP+  Y F+ V  PT+L L++F P Y+   +D 
Sbjct  352   MAASGRPRMYHSTAVLIPDGRVFVGGGNPHIYYNFSGVDFPTDLSLESFSPPYLSPHYDR  411

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP+ V +         + Y   F VRF + +     ++     +PPF THS +MNQRM+
Sbjct  412   LRPRIVEI------EETLGYTAPFLVRFRVPEFRRMSEVSVRIVAPPFNTHSFSMNQRMV  465

Query  1819  KLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              LR          +       P +   APPGYY++ +V+ GIPS   W+K 
Sbjct  466   VLRWDEAAYIGGDVYEVAAFGPSTAEIAPPGYYLLFLVHSGIPSSGAWIKI  516



>emb|CAN83495.1| hypothetical protein VITISV_026965 [Vitis vinifera]
Length=549

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 242/541 (45%), Positives = 321/541 (59%), Gaps = 23/541 (4%)
 Frame = +1

Query  358   SVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRC  537
             S LV  A S  G W+ L ++ G+ +MH+ L     ++ FD+  +G S   L +     + 
Sbjct  24    SNLVLGAHSNGGSWELLKKSIGISSMHIQLLQNERIITFDRTDAGPSNLTLPKGRKCPKI  83

Query  538   KGSREDLSDPSCYAHSVEYDVLNN-TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSK  714
              G R+      CY H+VE D++NN  +RPL  +SDTWCSSG+ L +G + Q+GGY +G K
Sbjct  84    SGRRD------CYVHAVELDMMNNLNVRPLTVLSDTWCSSGSXLPDGKLXQSGGYGNGEK  137

Query  715   RIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF--  888
              ++   PC   TC+WK   K L   RWYASNQ+LPG N  +I+VGGR   +YEF+P+   
Sbjct  138   VVRTLEPC--PTCDWKEDYKGLISPRWYASNQVLPGGN--IIVVGGRFQFSYEFIPKSSK  193

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
             P   +   LPFL +T   +   NNLYPF HLS+DG LFIFAN    L +Y KN+V K +P
Sbjct  194   PEDHRLYTLPFLKETRYSSQIPNNLYPFTHLSTDGNLFIFANNRGXLLDYVKNKVVKTYP  253

Query  1069  RMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCG  1245
              MPGE +R+YPSTGSSV+LPLD   +   + EV ICGG    ++ +AK G F+E  K+CG
Sbjct  254   TMPGEVARNYPSTGSSVLLPLDLSTKTTPEAEVFICGGTHPESFNKAKAGIFLEATKTCG  313

Query  1246  RMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYS  1425
             R+ I+    KW ME MP  RV+ DM++LPTG +LIING   G AGW     P   P IY 
Sbjct  314   RLRITAANPKWEMEEMPISRVLGDMIMLPTGDVLIINGAANGSAGWWYARVPVHNPVIYR  373

Query  1426  PGKTV-GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQA  1602
             P +     RF VL+A  I R+YHS+A LL DGRVL+AGSNPN  Y FT VP PTEL ++A
Sbjct  374   PAEAATANRFEVLKAATIPRLYHSTAHLLSDGRVLVAGSNPNHNYNFT-VPFPTELSVEA  432

Query  1603  FVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPF  1782
             F P Y+       RP   SV     P   + Y ++F V F +  +   +    +  +P F
Sbjct  433   FSPPYLTS--GKPRPSISSV----KPGMNLAYKQKFSVEFQVKVRQLGK-FYLTMVAPSF  485

Query  1783  TTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRW  1962
             TTHS +MNQR+L L    + R  +G       AP S   APPGYY + VV EG+PS+ +W
Sbjct  486   TTHSFSMNQRLLLLAVNRVRRMSSGSYAVEGDAPASAAXAPPGYYQLFVVYEGVPSVGKW  545

Query  1963  V  1965
             V
Sbjct  546   V  546



>ref|XP_003626387.1| Galactose oxidase [Medicago truncatula]
 gb|AES82605.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=570

 Score =   431 bits (1107),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 229/533 (43%), Positives = 321/533 (60%), Gaps = 16/533 (3%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-D  564
             QG W+ +    G+ AMHM L+H N ++ FD+   G S   L    NG RC+    D +  
Sbjct  48    QGEWELIQPTIGISAMHMQLSHNNKIIIFDRTDFGPSNLPLS---NG-RCRMDPFDTALK  103

Query  565   PSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD  744
               C AHSV YD+  NT R L   +DTWCSSG++LSNGT++QTGG+ DG +RI+ F PC +
Sbjct  104   IDCTAHSVLYDIATNTFRSLTVQTDTWCSSGSVLSNGTLVQTGGFNDGERRIRMFTPCFN  163

Query  745   KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFL  924
             + C+W     +L + RWYA+NQILP  ++R+II+GGRR   YEF+P+      S+    +
Sbjct  164   ENCDWIEFPSYLSERRWYATNQILP--DNRIIIIGGRRQFNYEFIPKTTTSSSSSSSSSI  221

Query  925   HQTYER---NAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             H ++ +   +   NNLYPF+HL  +G LFIFAN  SILF+Y++N V K+FP +PG    +
Sbjct  222   HLSFLQETNDPSENNLYPFVHLLPNGNLFIFANTRSILFDYKQNVVVKEFPEIPGGDPHN  281

Query  1096  YPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHK  1275
             YPS+GSSV+LPLD      +  +MICGGA  G++  AK   F+  LK+CG + ++ +   
Sbjct  282   YPSSGSSVLLPLDENQISMEATIMICGGAPRGSFEAAKGKNFMPALKTCGFLKVTDSNPS  341

Query  1276  WNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVG-KRF  1452
             W +ENMP  RVM DM+ILP G ++IING   G AGW NG  P L P I+   +T   KRF
Sbjct  342   WIIENMPMARVMGDMLILPNGDVIIINGAGSGTAGWENGRQPVLTPVIFRSSETKSDKRF  401

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
             SV+      R+YHSSA +L DGRVL+ GSNP+  Y FT V  PT+L L+AF P Y+   F
Sbjct  402   SVMSPASRPRLYHSSAIVLRDGRVLVGGSNPHVNYNFTGVEFPTDLSLEAFSPPYLSLEF  461

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
             D  RP      +      ++ Y   ++V F + K   + ++     +P FTTHS  MNQR
Sbjct  462   DLVRPT-----IWHVTNKILGYRVFYYVTFTVAKFASASEVSVRLLAPSFTTHSFGMNQR  516

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             M+ L+   +   +  +  A V  P +   APPGYY++ +V+ G+PS   WV+ 
Sbjct  517   MVVLKLIGVTMVNLDIYYATVVGPSTQEIAPPGYYLLFLVHAGVPSSGEWVQL  569



>gb|EAY89314.1| hypothetical protein OsI_10817 [Oryza sativa Indica Group]
Length=563

 Score =   431 bits (1107),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 251/569 (44%), Positives = 329/569 (58%), Gaps = 36/569 (6%)
 Frame = +1

Query  313   VLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSG  492
             VL LV L       A   ++ A+   GRW  L  + GV AMHM L H + V+ FD+   G
Sbjct  14    VLLLVIL-------ACAGIAPASGAGGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFG  66

Query  493   RSGYQLRRRFNGTRCK-GSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILS  669
              S   L       RC+   RE +    C AHS EYDV +NT RPL   +DTWCSSGT+  
Sbjct  67    LSNLSLPD----GRCRRNPRERVVPMDCTAHSAEYDVASNTFRPLFVFTDTWCSSGTVAP  122

Query  670   NGTIMQTGGYRDGSKRIQFFAPCV--DKTCNWKPGKKHLYDERWYASNQILPGKNDRVII  843
             +GT++QTGG+ DG + ++  A C   D TC+W   +  L   RWYA+NQILP  + R  I
Sbjct  123   DGTLVQTGGWNDGYRNVRTMAACEAGDDTCDWDETQDALAANRWYATNQILP--DGRAFI  180

Query  844   VGGRRASTYEFVPRFPNMQKST-DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRD  1020
             VGGRR  TYEF P   +   S   LPFL QT  ++   NNLYPF+HL+ DG LFIFA   
Sbjct  181   VGGRRQFTYEFYPTADSSGASAISLPFLVQT--KDPEENNLYPFVHLNIDGNLFIFAKNR  238

Query  1021  SILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYT  1200
             +ILF+Y+KN+V + +P + G   R+YPS+GSSV+LPL  K    + EV++CGGA AG+YT
Sbjct  239   AILFDYKKNKVVRTYPELAGGDPRNYPSSGSSVLLPL--KPSPTEAEVLVCGGAPAGSYT  296

Query  1201  EAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTG-QILIINGVKRGCA  1377
               K G F   L +CGR+ I+     W +E MP PRVM DM++LP G +++IING   G A
Sbjct  297   STKDGTFSSALVTCGRIKITDTAPAWVIETMPSPRVMGDMILLPNGAEVVIINGAMDGTA  356

Query  1378  GWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGY  1557
             GW +  +PA  P IY P  + G RF    +T IAR+YHSSA LL DGR+L+ GSNP+  Y
Sbjct  357   GWESAKTPAYAPVIYRPDHSPGDRFEEQSSTDIARLYHSSAVLLRDGRLLVGGSNPHIYY  416

Query  1558  VFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKK  1737
              F+NV +PTEL L+A+ P+Y+D   D  RP  V     G+ A  V YG    ++F +   
Sbjct  417   NFSNVQYPTELSLEAYSPEYLDPSNDALRPTIVDPSPNGA-AVSVTYGASLTLQFAVPAA  475

Query  1738  WPSED--------LEFSAYSPPFTTHSVAMNQRMLKL---RCTSMERGDNGMVNavvaap  1884
               +          +  +  +P FTTHS AMNQR+L L   +  ++ R         V  P
Sbjct  476   RRARGGGGGGIGLVSVTMVAPSFTTHSFAMNQRLLLLDAVKTAALARAST--YQTSVVMP  533

Query  1885  pspvaappGYYMVTVVNEGIPSISRWVKF  1971
              +   APPGYYMV VVN  IPS   WV  
Sbjct  534   ATAALAPPGYYMVFVVNGHIPSEGIWVHI  562



>ref|XP_009801814.1| PREDICTED: galactose oxidase [Nicotiana sylvestris]
Length=560

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 240/568 (42%), Positives = 329/568 (58%), Gaps = 23/568 (4%)
 Frame = +1

Query  295   AITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFF  474
              I  LL++  +SL+   +L AS ++   +  QG W+ L E+ GV AMHM L   N VV F
Sbjct  5     TIIFLLLVMFISLQ---SLVASQMLVSRSGIQGEWRLLHESIGVSAMHMQLLRNNKVVIF  61

Query  475   DQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCS  651
             D+   GRS   L     G RC+    DL     C AHSV YDV +NT RPL   +DTWCS
Sbjct  62    DRTDFGRSNLSLP----GGRCRYDSHDLVISEDCSAHSVLYDVGSNTFRPLMVQTDTWCS  117

Query  652   SGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKND  831
             SG +L +GT++QTGGY DG   I+  APC  K C+W    + L   RWY+++ ILP  + 
Sbjct  118   SGAVLPDGTLVQTGGYNDGDHIIRTLAPCTGKNCDWVELPRTLIQRRWYSTDHILP--DA  175

Query  832   RVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGG---NNLYPFLHLSSDGYLF  1002
             R+I++GGR    YEF P+      S+   F  Q       G   NNLYPF+ L  DG LF
Sbjct  176   RIIVIGGRNQHNYEFYPKNSRDDPSSFSAFWLQFLSDTRDGDNENNLYPFVFLLPDGNLF  235

Query  1003  IFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGA  1182
             IFAN  +I+ +Y+K+ V ++ P +PG   R+YPSTGS+V+LPLD +NR  + E+M+CGGA
Sbjct  236   IFANTRTIILDYKKHEVVRELPSIPGNEPRNYPSTGSAVLLPLD-ENRPMQAEIMVCGGA  294

Query  1183  SAGAYTEAKQGRFIEGLKSCGRMVISGN---KHKWNMENMPGPRVMNDMVILPTGQILII  1353
                A+     G ++  L SCGR+ IS +      W ME MP PRVM+DM+ILP+G I++I
Sbjct  295   PRRAFGLTDYGVYMTALSSCGRITISDDHVSDSSWKMEQMPTPRVMSDMLILPSGDIILI  354

Query  1354  NGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIA  1533
             NG  RG AGW N  +P   P IY P +    RFSV+ A+   R+YHS+A LL DGRVL+ 
Sbjct  355   NGAARGTAGWENARNPVTRPMIYRPNRAENNRFSVMEASTRPRLYHSTAILLTDGRVLVG  414

Query  1534  GSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFH  1713
             GSNP+  Y FT V  PT+L L++F P Y+   +   +P  +S+        ++ Y + F 
Sbjct  415   GSNPHKFYNFTGVDFPTDLSLESFSPPYLAPEYAPLKPTVLSI------DDILMYKQPFS  468

Query  1714  VRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappsp  1893
             V F + K      +     +P FTTHS +MNQRM+ L+  ++    +     +   P + 
Sbjct  469   VTFTVPKFLKMGIVSVRIVAPSFTTHSFSMNQRMVVLKRVAISTVSDNTYRFIAFGPSTK  528

Query  1894  vaappGYYMVTVVNEGIPSISRWVKFAN  1977
               APPGYYM+ VV+ GIPS   WVK  +
Sbjct  529   EIAPPGYYMLFVVHAGIPSSGVWVKIHD  556



>ref|XP_004243010.2| PREDICTED: galactose oxidase [Solanum lycopersicum]
Length=527

 Score =   429 bits (1103),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 231/532 (43%), Positives = 317/532 (60%), Gaps = 17/532 (3%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             G W+ L E+ G+ AMHM L H N VV FD+   G S   L R     RC+ +  DL+   
Sbjct  10    GEWRLLHESIGITAMHMQLLHNNKVVIFDRTDFGHSNLSLPR----GRCRYNSHDLALQK  65

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              C AHSV YD+++NT RPL   +DTWCSSG +L NGT++QTGG+ DG   ++  APC D+
Sbjct  66    DCSAHSVLYDIVSNTFRPLMVQTDTWCSSGAVLPNGTLVQTGGFNDGDHIVRSLAPCTDE  125

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
              C+W    + L   RWY+++ ILP  + R+I++GGR+   YEF P+      +  L FL 
Sbjct  126   NCDWFELPRTLVQRRWYSTDHILP--DARIIVIGGRKQYNYEFYPKNSRGDSAFSLQFLK  183

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
              T ER    NNLYPF+ L  DG L IFAN  +I+ NY++N+V ++ P +PG+  R+YPST
Sbjct  184   STLERYE--NNLYPFVFLLPDGNLVIFANTRAIILNYKENQVVRELPSIPGDEPRNYPST  241

Query  1108  GSSVMLPLDHKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISGNKHKWNM  1284
             GS+V+LPLD +NR  + E+M+CGGA   AY  A K   +++ L SCGR+ +  +   W M
Sbjct  242   GSAVLLPLD-ENRPMEAEIMVCGGAPRRAYRYADKYKMYMKALSSCGRINVIDDHGIWEM  300

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MP  RVM+DM+ILP G I+IING  RG AGW N  SP   P IY P      RFS+++
Sbjct  301   ETMPTRRVMSDMLILPDGDIIIINGASRGTAGWNNAISPVTTPVIYRPNVRRDNRFSIMK  360

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
             A    R+YHSSA L+ DGRVL+ GSNP + Y FT V  PT+L L+AF P Y+ R+  + +
Sbjct  361   AASRPRLYHSSAILMTDGRVLVGGSNPQEYYNFTGVEFPTDLSLEAFSPPYLARKHSHLK  420

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKL  1824
             P  +S+        ++ Y   F   F +        +     +P FTTHS +MNQRM+ L
Sbjct  421   PTVLSI------DEILTYKSSFSATFTVPTFLRIGTVSIRIIAPSFTTHSFSMNQRMVVL  474

Query  1825  RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFANA  1980
             +   +    +        AP +   APPGYYM+ VV+ GIPS   WVK  ++
Sbjct  475   KGVVVVAISDNSYKFTAFAPSTKEIAPPGYYMLFVVHAGIPSSGVWVKIQDS  526



>ref|XP_009794042.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=553

 Score =   430 bits (1105),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 237/537 (44%), Positives = 319/537 (59%), Gaps = 18/537 (3%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A++  G+W  LM N G+ AMHM L + + VV FD+   G S   L       +C+    D
Sbjct  29    ASAAGGKWNLLMPNIGISAMHMQLLNNDKVVIFDRTDFGHSNISLPY----GKCRNDPND  84

Query  556   LS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
              +    C AHSVEY+ + N+IRPL   +D WCSSG +  +G+++QTGG+ DG K ++ F 
Sbjct  85    TTLQIDCTAHSVEYNTVTNSIRPLMVQTDVWCSSGAVFPDGSLVQTGGFNDGEKVVRVFK  144

Query  733   PCV-DKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST  909
             PC  + TC+W+  +  L   RWYA+N ILP  + R I++GGRRA  YEF P+  +  K+ 
Sbjct  145   PCNGNNTCDWQEIQGGLAQRRWYATNHILP--DGRQIVIGGRRAFNYEFYPKPASAYKAY  202

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
              LPFL QT +     NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K FP++PG   
Sbjct  203   SLPFLVQTNDLKIE-NNLYPFVFLNVDGNLFIFANNRAILFDYTKNVVVKNFPQIPGGDP  261

Query  1090  RSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGN  1266
             RSYPSTGS+V+LPL +    Q + EV++CGGA  G+Y  A+ G F+  L +CGR+ I+  
Sbjct  262   RSYPSTGSAVLLPLKNLQTQQIQAEVLVCGGAPKGSYISAQNGNFLAALTTCGRIGITDP  321

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK  1446
               +W MENMP  R M DM+ILP G +LII+G   G AGW  G  P L+P IY P      
Sbjct  322   NPQWTMENMPLARTMGDMLILPNGNVLIISGAATGTAGWELGRDPVLKPVIYRPDNPFSS  381

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF +   + I RMYHS+A LL DGRVLI GSNP+  Y FT V  PTEL L+AF P Y+D 
Sbjct  382   RFEIQNPSTIPRMYHSTATLLRDGRVLIGGSNPHIYYNFTGVLFPTELSLEAFSPSYLDP  441

Query  1627  RFDNQRPKNVSVYVEGSPAA--VVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
               +  RP+ +      SPA+   + YG+   VRF +  +     +  +  +P F THS  
Sbjct  442   ESEYLRPQII------SPASQYTIGYGQRVPVRFKVSGRVNRNLVTVTMVAPGFNTHSFT  495

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              NQR+L L   +++          V  P S   APPGYY++ VV++ IPS   WVK 
Sbjct  496   QNQRLLVLASENVKLLGEKAYQINVVTPNSATLAPPGYYLLFVVHQDIPSEGIWVKI  552



>ref|XP_008377171.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   429 bits (1103),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 316/529 (60%), Gaps = 23/529 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G+WQ L +  G+ AMHM L   + V  FD+   G+S   L    NG  C   R D     
Sbjct  25    GKWQLLQQXVGISAMHMQLLRNDRVXMFDRTDFGKSNLXLP---NG-EC--VRND-----  73

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS EYDV  NT+R L  +SD WCSSG +  NG ++QTGG   G +R++ F PC    
Sbjct  74    CTAHSAEYDVKTNTVRALTLLSDVWCSSGAVAPNGRLIQTGGNGAGDRRVRVFEPCTG--  131

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+WK     L   RWYA++ ILP  N + II+GGR    YE  P+  +  K   LPFL Q
Sbjct  132   CDWKEFANALGARRWYATDHILP--NGQQIIIGGRXQFNYEXYPKTGSSSKVYSLPFLVQ  189

Query  931   TYERNAGG-NNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             T   +AG  NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K +P++PG   R  PST
Sbjct  190   T--BDAGEENNLYPFVFLNVDGNLFIFANNRAILFDYAKNXVVKTYPQIPGGDPRCXPST  247

Query  1108  GSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             GS+V+LPL +      + EV++CGGA  G++ +A QG F+E L +C R+ I+  K +W M
Sbjct  248   GSAVLLPLKNLAAPSVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARIKINNPKPQWVM  307

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MP  RVM DM++LP G +L+ING   G AGW  G +P L P +Y P   +G RF    
Sbjct  308   ETMPQARVMGDMLLLPDGTVLLINGASSGAAGWEIGRNPVLNPVVYRPDNAIGSRFEQQN  367

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
              T I RMYHS+A LL DGRVL+ GSNP+  Y FT+V  PTELRL+AF PDY+D +++N R
Sbjct  368   PTTIPRMYHSTAILLRDGRVLVGGSNPHXKYEFTBVLFPTELRLEAFSPDYLDAKYNNLR  427

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKL  1824
             P+ V+   +    A ++YGK+  ++F +     +  +  S  +P F  HS +MNQR+L L
Sbjct  428   PQIVAPISQ----AKINYGKKLSIQFSVKGNLATXSVSVSMVAPSFNXHSFSMNQRLLVL  483

Query  1825  RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
                ++++         V  P S   AP GYY++ VV++ IPS + WV+ 
Sbjct  484   XAENVKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_011069751.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=560

 Score =   430 bits (1105),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 238/548 (43%), Positives = 324/548 (59%), Gaps = 29/548 (5%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             ++ AA G G+W  L+ + GV AMHM L + + VV FD+   G S   L        C+  
Sbjct  28    LTLAAPGGGKWNLLLSDIGVSAMHMQLLNTDRVVIFDRTDFGPSNISLPN----NHCRND  83

Query  547   REDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
               DL     C AHSVEYDV +N+IRPL  ++D WCSSG+++ +G++MQTGG+ DG + ++
Sbjct  84    PNDLMLKVDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSVMPDGSLMQTGGFNDGDRNVR  143

Query  724   FFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQK  903
              + PC D +C+W+     L   RWYA+N ILP  + R IIVGGR   +YEF P+     +
Sbjct  144   VYKPCGDNSCDWQEFDAVLRQRRWYATNHILP--DGRQIIVGGRGQFSYEFYPKKAGADQ  201

Query  904   STDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGE  1083
             S +LPFL QT +     NNLYPF+ L+ DG LFIFAN  +ILF+Y    V + +P +PG 
Sbjct  202   SYNLPFLSQTNDPRIE-NNLYPFVFLNVDGNLFIFANNRAILFDYTNGVVVRNYPTIPGG  260

Query  1084  GSRSYPSTGSSVMLPLDHKNRFQKV--EVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
               RSYPS+GS+V+LPL        V  EV++CGGA  G++T A  G+F+  L SCGR+ I
Sbjct  261   DPRSYPSSGSAVLLPLRDLQAGSNVTAEVLVCGGAPKGSFTSANNGKFVGALNSCGRIRI  320

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +    +W ME MP  RVM DMV+LP G +LIING   G AGW  G  P L P IY P   
Sbjct  321   TDPNPQWVMETMPLARVMGDMVLLPNGNVLIINGASTGTAGWDLGRDPVLTPLIYRPNNP  380

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
             VG RF    +T I RMYHS+A LL DGR+L++GSNP+  Y FT V  PT+L ++ F PDY
Sbjct  381   VGLRFEAQNSTSIPRMYHSTAILLRDGRILVSGSNPHAYYNFTGVLFPTDLTMETFSPDY  440

Query  1618  MDRRFDNQRPKNVSVYVEGSPA--AVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTH  1791
             +D R    RP+ V      SPA  + ++YG++  + F    +     +  +  +PPFTTH
Sbjct  441   LDPRLVRVRPRIV------SPASHSQIEYGQQLVINFTAQGRINRGFITVTMVAPPFTTH  494

Query  1792  SVAMNQRMLKL--------RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIP  1947
             S +MNQR+L L          T + R +       V  P S + APPGYY++ VV   +P
Sbjct  495   SFSMNQRLLVLTNRTGISASVTPLGRSN---YQVRVMTPGSNILAPPGYYLLFVVYREVP  551

Query  1948  SISRWVKF  1971
             S   W++ 
Sbjct  552   SQGIWIQI  559



>ref|XP_011010793.1| PREDICTED: galactose oxidase [Populus euphratica]
Length=544

 Score =   429 bits (1104),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 238/537 (44%), Positives = 322/537 (60%), Gaps = 25/537 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W  L E+ G+ AMHM +   N V+ FD+   GRS   L        C+   E +    
Sbjct  20    GNWVVLQESIGISAMHMQVLRNNKVIMFDRTDFGRSNLSLP----DGECRYKDEVVKPKD  75

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AH+V YD+ +NT RPL   ++TWCSSG++ S+G ++QTGGY+ G   I+ F PC D +
Sbjct  76    CTAHAVLYDIASNTFRPLMVQTNTWCSSGSLDSSGNLIQTGGYKAGEAVIRSFTPCGDDS  135

Query  751   CNW-KPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             C+W +   + L++ RWYASNQ+LP  + R+IIVGGRRA TYEF P+ P  + +  LPFL 
Sbjct  136   CDWVELTNQVLWNRRWYASNQLLP--DGRIIIVGGRRAFTYEFYPKNPQERDNFTLPFLI  193

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
              T +      NLYPFLHL  DG LFIFAN  SI  +Y++N+V K++P MP    R+YP T
Sbjct  194   HTRDPQEE-INLYPFLHLLPDGNLFIFANNRSISLDYKRNKVIKEYPVMPVGDRRNYPCT  252

Query  1108  GSSVMLPL---------DHKNRFQKVEVMICGGASAGAYTEAKQGRFIE-GLKSCGRMVI  1257
             GSSV+LPL         DH     + EVMICGGA  GAY ++      E    +CGR+ +
Sbjct  253   GSSVLLPLRLTGITNVTDHP----EAEVMICGGAQKGAYIKSNYLHIYEQASTTCGRLKV  308

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +  K +W ME MP PR+MNDM++LPTG ++IING   G AGW +  +P   P +Y P + 
Sbjct  309   TDTKPEWVMELMPIPRIMNDMLLLPTGDLIIINGATNGSAGWNDAMNPVYNPVLYQPDED  368

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
               +RF VL ++KIAR+YHS+AALLPDGR+L+ GSNP+  Y  T  P+PTEL L+AF   Y
Sbjct  369   PTRRFVVLSSSKIARLYHSTAALLPDGRILVGGSNPHQRYNMTGKPYPTELSLEAFYLHY  428

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
             +D ++   RP  ++V +       V YG+ F V F          +  +  +P FTTHS 
Sbjct  429   LDPQYSYLRPSILTVELSDR---AVSYGEMFSVTFVCSSYRLDLGVSVTVIAPSFTTHSF  485

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              MNQRM+ L   S+ +       A V  P +   APPGYYM+ VV+ GIPS + WV 
Sbjct  486   GMNQRMVVLNVLSVVQLSMFAYKANVIGPINVNVAPPGYYMMFVVHAGIPSNAVWVN  542



>gb|KEH24796.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=516

 Score =   428 bits (1101),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 324/522 (62%), Gaps = 12/522 (2%)
 Frame = +1

Query  406   LMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHS  585
             L ++ GVVAMHM L H + +V FD+   G S   L    NG       E +    C AHS
Sbjct  2     LQKSIGVVAMHMQLLHNDRIVIFDRTDFGYSNLSLP---NGQCRHDPAELVVKDDCTAHS  58

Query  586   VEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKP  765
             +EYDVL+NT RPL   ++ WCSSG++  NG+++QTGGY DG++ I+ ++PC   TC+W  
Sbjct  59    LEYDVLSNTFRPLFVKTNIWCSSGSVRPNGSLVQTGGYNDGNRNIRIYSPC--PTCDWSE  116

Query  766   GKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERN  945
                 L  ERWYA++ ILP  N   I+VGGR    YEF P+  ++  +  L FL +T +  
Sbjct  117   IDGGLSAERWYATSHILP--NGSQIVVGGRGQFNYEFYPKSNDINANYSLSFLAETNDPE  174

Query  946   AGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVML  1125
                NNLYPF+ L+ DG LFI AN  SILF+Y K  V K FP +PG   R+YPSTGS+V+L
Sbjct  175   QE-NNLYPFVFLNVDGNLFIMANNKSILFDYTKGMVVKTFPEVPGGDPRNYPSTGSAVLL  233

Query  1126  PLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGP  1302
             PL + + +  + EV++CGGAS G+Y ++K+  F++ L +C R+ I+    +W+ME MP P
Sbjct  234   PLKNLEAKNLEAEVLVCGGASRGSYLQSKKEVFLKALNTCARIKITDPNPQWDMETMPSP  293

Query  1303  RVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIAR  1482
             RVM+DMV+LP G ILIING   G +GW  G  PAL P++Y     +G RF + R+++  R
Sbjct  294   RVMSDMVMLPNGNILIINGASSGTSGWEQGRDPALTPFLYRTNNPIGSRFKLQRSSETPR  353

Query  1483  MYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSV  1662
             MYHS+A L+ DGRVL+ GSNP+ GY FTNV  PTEL ++A+ P Y+  R  N RPK +S 
Sbjct  354   MYHSTAVLVRDGRVLVGGSNPHSGYSFTNVLFPTELSIEAYSPSYLSDRLSNYRPKIMS-  412

Query  1663  YVEGSPAAVVDYGKEFHVRFWLDKKWPSEDL-EFSAYSPPFTTHSVAMNQRMLKLRCTSM  1839
              ++      + YG++  ++F +++     +L   +   PPF THS +MNQR+L L    +
Sbjct  413   -LDSKTQMELKYGQKLELQFQVNRTLKYLNLVHVTMLLPPFNTHSFSMNQRLLVLEQNKV  471

Query  1840  ERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
              R +       V  P SP+ APPG+Y++ VVN  IPS   WV
Sbjct  472   NRVNGTTYEIEVTVPNSPILAPPGFYLLFVVNAQIPSEGIWV  513



>ref|XP_011045139.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=549

 Score =   429 bits (1103),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 236/552 (43%), Positives = 330/552 (60%), Gaps = 23/552 (4%)
 Frame = +1

Query  328   SLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQ  507
             +++PC+       V  +A+G GRWQ L ++ G+VAMHM L + + VV +D+   GRS   
Sbjct  16    AIQPCHR------VVTSAAGGGRWQLLQKSIGIVAMHMQLLNNDHVVIYDRTDFGRSNLS  69

Query  508   LRRRFNGTRCKG-SREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIM  684
             L     G +C+  S E +    C AHSV+YDVL N  RPL   +D WCSSG +  +G+++
Sbjct  70    LP----GGKCRDDSSEIVVKHDCTAHSVDYDVLANKFRPLMVQTDVWCSSGAVFPDGSLI  125

Query  685   QTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRAS  864
             QTGG+ DG ++++ F PC    C+W      L  +RWYA+N ILP  + + II+GGRR  
Sbjct  126   QTGGFSDGERKVRTFYPC-KGDCDWVETGNGLKAKRWYATNHILP--DGKQIIIGGRRQF  182

Query  865   TYEFVPRF--PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNY  1038
              YEF P+   PN+     LPFL QT +R    NNLYPF+ L+SDG LFIFAN  +ILF+Y
Sbjct  183   NYEFYPKTSSPNVYS---LPFLLQTNDRGIE-NNLYPFVFLNSDGNLFIFANNRAILFDY  238

Query  1039  RKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQG  1215
             +  +V K +P +PG   RSYPSTGS+V+LPL + +      EV++CGGA  G++ +  +G
Sbjct  239   KTGKVVKTYPAIPGGDPRSYPSTGSAVLLPLKNLDAATIAAEVLVCGGAPKGSFEKVAKG  298

Query  1216  RFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGA  1395
              F++ L +CGR+ I+    +W ME MP  RVM DM +LP G +LIING   G AGW +G 
Sbjct  299   NFVKALDTCGRIKINDPNPQWVMETMPHARVMGDMTLLPNGVVLIINGAGAGTAGWESGR  358

Query  1396  SPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVP  1575
             +P L P +Y P    G RF  L    I R+YHS+A LL DGRVL+ GSNP+ GY F  V 
Sbjct  359   NPVLNPILYWPNGAAGSRFESLNPNTIPRVYHSTAILLRDGRVLVGGSNPHIGYEFKGVL  418

Query  1576  HPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDL  1755
              P+EL L+AF P Y+D + +  RP  +S     S    + YG++  VRF +  K  ++ +
Sbjct  419   FPSELSLEAFSPPYLDAQHNYVRPTILS--STASKGKYIGYGQKLLVRFKVTGKLMADKI  476

Query  1756  EFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVN  1935
               +  +P F THS +MN R+L L  T +        +  V  P S   AP G+Y++ VV+
Sbjct  477   SVTMVAPAFNTHSFSMNHRLLVLGNTKVTSVGTSTYDVQVTTPRSGYLAPSGHYILYVVH  536

Query  1936  EGIPSISRWVKF  1971
             + IPS   WVK 
Sbjct  537   QYIPSTGIWVKI  548



>ref|XP_010096335.1| hypothetical protein L484_021082 [Morus notabilis]
 gb|EXB63810.1| hypothetical protein L484_021082 [Morus notabilis]
Length=588

 Score =   430 bits (1106),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 247/545 (45%), Positives = 326/545 (60%), Gaps = 30/545 (6%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W  L  + GV AMHM L     VV FD    G S   L            R+ ++D  
Sbjct  53    GNWILLHSSIGVSAMHMQLLRNGKVVIFDGIEVGPSNLTLPNNQCLRITNNRRQVVTD--  110

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP-CVD-  744
             C AHSV YDV++NT RPL   ++TWCSSG++ S+GT++QTGGY DG ++I+ F+P C+  
Sbjct  111   CTAHSVLYDVISNTFRPLTLRTNTWCSSGSVASDGTLVQTGGYGDGIRKIRTFSPFCIQY  170

Query  745   ----------KTCNWKP-GKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP  891
                        +C+W       L D RWY+S+Q+LP  + R+IIVGGR+A +YEF P+ P
Sbjct  171   QNDVVVSDGSSSCDWTEFAGISLADRRWYSSSQVLP--DGRLIIVGGRQAFSYEFFPKNP  228

Query  892   NMQKSTDLPFLHQT---YERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKK  1062
                +S  L FL +T   YE N    NLYPFLHL  DG LFIFAN  SI  +Y +NR+ K+
Sbjct  229   QNDRSFYLRFLFETMDPYEEN----NLYPFLHLLPDGNLFIFANNRSISLDYNRNRIVKE  284

Query  1063  FPRMPGEGSRSYPSTGSSVMLPLD-HKN-RFQKVEVMICGGASAGAYTEAKQGR-FIEGL  1233
             FP +PG   RSYPSTGSSV+LPL  H +    + EV+ICGG+ +GA+T + + R F+   
Sbjct  285   FPIIPGGYKRSYPSTGSSVLLPLRLHADVAIPEAEVIICGGSQSGAFTMSNKARVFLPAA  344

Query  1234  KSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEP  1413
             +SCGR+ ++ +  KW ME MP PRVM DM+ILPTG ++IING   G AGW +  +P L P
Sbjct  345   RSCGRIKVTDSDPKWVMEYMPMPRVMPDMLILPTGDVIIINGAGNGTAGWNDAVNPVLNP  404

Query  1414  YIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELR  1593
              +Y  GK  G+RFSVL  T I RMYHSSA LLP G +L+ GSNP+  Y FT    PTEL 
Sbjct  405   VLYRTGKRYGRRFSVLNPTAIPRMYHSSAVLLPSGGILVGGSNPHRKYNFTADLFPTELS  464

Query  1594  LQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYS  1773
             L+ + P Y+D ++ + RP  +++        VV YG+ F V F L    P   +  +  +
Sbjct  465   LEVYQPYYLDTQYASMRPSILTIETN---MQVVSYGQMFSVTFVLPMYRPIPGVSVALVT  521

Query  1774  PPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSI  1953
             P F+THS AMNQRML L     ER            PP+   APPGYYM+ +V+ G+PS 
Sbjct  522   PSFSTHSFAMNQRMLVLDVAGFERLSIVAYKITAHGPPTSAVAPPGYYMLFLVHSGVPSE  581

Query  1954  SRWVK  1968
               WVK
Sbjct  582   GVWVK  586



>ref|XP_002512263.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF49715.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=533

 Score =   428 bits (1101),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 230/531 (43%), Positives = 320/531 (60%), Gaps = 34/531 (6%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK-GSREDLSD  564
             QG W  L  N G+ AMHM L H N V+ +D+   GRS   L  R    RC+  SR+   +
Sbjct  33    QGEWNQLQSNIGITAMHMQLLHDNKVIIYDRTDFGRSNVSLPHR----RCRHDSRDQALE  88

Query  565   PSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD  744
               C AH++ YD+  N+ RPL   +D WCSS +++ NGT++QTGGY DG   ++ F  C++
Sbjct  89    VDCTAHTILYDLDTNSFRPLTIQTDVWCSSASVIPNGTLIQTGGYNDGDHVMRSFTSCLN  148

Query  745   KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFL  924
               C+W   + +L + RWYASNQILP  + R+IIVGGRRA TYEF   +P++ ++  L FL
Sbjct  149   DDCDWIEFRDYLRERRWYASNQILP--DGRIIIVGGRRAYTYEF---YPSVSRTFWLSFL  203

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              +T + N+  NNLYPFLHL  DG LFIFAN  SIL +Y +N V ++FPR+P    R+YPS
Sbjct  204   RETRDGNSE-NNLYPFLHLLPDGNLFIFANTRSILLDYNRNHVIREFPRIPNHDPRNYPS  262

Query  1105  TGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             TGSSV+LPLD  +   + E++ICGGA  G++    +  F   + SCGR+V++ +   W+M
Sbjct  263   TGSSVLLPLDENSDSIRAEILICGGAPRGSFERNARRVFEGAISSCGRLVVTRHNPSWDM  322

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MP PRVM+DM++LPTG I+IING + G AG+    +P   P+IY P ++  +RFSV+ 
Sbjct  323   ETMPTPRVMSDMLLLPTGDIIIINGAQSGTAGYDAARNPITNPFIYRPHQSSNRRFSVMT  382

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
              ++  RMYHSSA LLPDGRVL+ G+                L L+ F P Y+   +   R
Sbjct  383   PSQKPRMYHSSAILLPDGRVLVGGN----------------LSLETFSPPYLSDEYTQIR  426

Query  1645  PKNVSVYVEGSPAAVVDYG--KEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
             P  +S+       + + YG    F VRF +++      L     +P FTTHS AMNQRM+
Sbjct  427   PSVLSL-----DKSTLGYGNASAFRVRFHVEEYISDNVLSVRIVAPSFTTHSFAMNQRMV  481

Query  1819  KLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              L+  S+E   +      VA P +   APPGYY++ VV+ G PS   WVK 
Sbjct  482   VLKMNSIEAETSNTYALHVAGPSTVQIAPPGYYLLFVVHAGTPSNGSWVKI  532



>ref|XP_003613586.1| hypothetical protein MTR_5g038410 [Medicago truncatula]
 gb|AES96544.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=536

 Score =   428 bits (1101),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 247/543 (45%), Positives = 324/543 (60%), Gaps = 42/543 (8%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNN  609
             MHM +   N V+ FD+   G S   L    +  RC+ +  D++    C AHS+ YD+  N
Sbjct  1     MHMQVMKDNKVIIFDRTDFGPSNISL----SNNRCRYNPHDMALKLDCTAHSILYDITTN  56

Query  610   TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV-DKTCNWKPGKKHLYD  786
             T+RPL   +D WCSSG +   GT++QTGG+ DG  +++ F PC  + TC+W+  +++L  
Sbjct  57    TLRPLTLQTDAWCSSGAVSPTGTLIQTGGFNDGYTKLRTFTPCPHNNTCDWEELQQNLSS  116

Query  787   ERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGG-NNL  963
              RWYASNQILP  N R+I+VGGR + +YEFVP+  N      L FL  T + N G  NNL
Sbjct  117   SRWYASNQILP--NGRIIVVGGRSSFSYEFVPKRLNDASFYHLRFLQLTRDSNPGEENNL  174

Query  964   YPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLD---  1134
             YPFLHL   G LFIFANR SILF+Y +NRV ++FP +PGE  R+YPSTGSSVMLPL+   
Sbjct  175   YPFLHLLPTGNLFIFANRRSILFDYERNRVIREFPIIPGEEKRNYPSTGSSVMLPLNLTG  234

Query  1135  -HKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRV  1308
              +   F +VE+MICGGA  GA+  A K+  F+E   SCGR+ +S  + +W ME MP PRV
Sbjct  235   KNGTEFIEVEIMICGGAFPGAFDYASKKKVFLEASSSCGRLKVSDVEPEWVMEVMPVPRV  294

Query  1309  MNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG-KTVGKRFSVLRATKIARM  1485
             M DM++LPTG ++I+NG   G AGW N A+P L P +Y PG      +F +L      RM
Sbjct  295   MPDMLLLPTGNVIILNGAANGTAGWENAANPVLYPVLYKPGLDNPFMKFELLAPASTPRM  354

Query  1486  YHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVY  1665
             YHSSA LLPDGR+L+ GSNP+  Y F    +PTEL L A+ PDY+    D  RP  V+V 
Sbjct  355   YHSSAVLLPDGRILVGGSNPHRLYDF-QAKYPTELSLDAYYPDYLRPELDTLRPVIVAVE  413

Query  1666  VEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMER  1845
             V  S    + Y   F V F L +      +  S  +P FTTHS AMNQR+L L  T++E 
Sbjct  414   VVNS---TLSYESLFSVSFLLREVKDVNRIRVSMVAPSFTTHSFAMNQRLLFLEVTALEE  470

Query  1846  GDNGMVN-----------------------avvaappspvaappGYYMVTVVNEGIPSIS  1956
               N M +                       A V  PPS   APPGYYM+ V++ GIPS++
Sbjct  471   VVNSMQDQNFGEFGFGSSLGPGKIANSVYKATVRGPPSLNVAPPGYYMLFVIHVGIPSVA  530

Query  1957  RWV  1965
              WV
Sbjct  531   TWV  533



>ref|NP_191321.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 emb|CAB41193.1| putative protein [Arabidopsis thaliana]
 gb|AEE79679.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score =   429 bits (1102),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 318/529 (60%), Gaps = 23/529 (4%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RW+ L+ + G+ AMHM L H   V+ FD+   G S   L     G  C+    D ++   
Sbjct  36    RWEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGTSNVSLP----GGICRYDPTDTAEKFD  91

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDK  747
             C AHSV YDV++NT RPL   +DTWCSSG +L NGT++QTGGY DG +  + F+PC    
Sbjct  92    CSAHSVLYDVVSNTYRPLNVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFSPCGYSD  151

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             TC+W    ++L   RWYA+NQILP  + R+I+VGGRR   YE  PR  +  +S+ L FL 
Sbjct  152   TCDWIEFPQYLSQRRWYATNQILP--DGRIIVVGGRRQFNYELFPRHDSRSRSSRLEFLR  209

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             +T +  +  NNLYPF+HL  DG LF+FAN  SI+F+Y+KNR+ K+FP +PG   R+YPS+
Sbjct  210   ETSD-GSNENNLYPFIHLLPDGNLFVFANTRSIVFDYKKNRIVKEFPEIPGGDPRNYPSS  268

Query  1108  GSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             GSS++ PLD  N    +VE+M+CGG+  G ++      F     +CGR+ +S     W M
Sbjct  269   GSSILFPLDDTNDANVEVEIMVCGGSPKGGFSRG----FTRATSTCGRLKLSDQSPSWEM  324

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MP PRVM DM++LPTG ++I+NG   G AGW     P ++P IY P       F+V+ 
Sbjct  325   ETMPLPRVMGDMLLLPTGDVIIVNGAGAGTAGWEKARDPIIQPVIYQP---FDHLFTVMS  381

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
                  RMYHSSA LLPDGRVL+ GSNP+  Y FTNV +PT+L L+A+ P Y+    D  R
Sbjct  382   TPSRPRMYHSSAILLPDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLFFTSDPIR  441

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKL  1824
             PK     +  +   V+ Y + F+V F + +    + L     +P FTTHS AMNQRM+ L
Sbjct  442   PK-----ILLTSDKVLSYKRLFNVDFSIAQFLTVDLLSVRIVAPSFTTHSFAMNQRMVIL  496

Query  1825  RCTSMERGD-NGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             +  S+ R             P +   APPGYYM+ +V+ GIPS + WV+
Sbjct  497   KLLSVTRDQLTNSYRVSALGPSTAEIAPPGYYMIFLVHAGIPSSAAWVQ  545



>ref|NP_001049609.1| Os03g0258900 [Oryza sativa Japonica Group]
 gb|ABF95066.1| glyoxal oxidase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11523.1| Os03g0258900 [Oryza sativa Japonica Group]
 gb|EAZ26322.1| hypothetical protein OsJ_10202 [Oryza sativa Japonica Group]
 dbj|BAH00424.1| unnamed protein product [Oryza sativa Japonica Group]
Length=564

 Score =   429 bits (1103),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 251/570 (44%), Positives = 329/570 (58%), Gaps = 37/570 (6%)
 Frame = +1

Query  313   VLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSG  492
             VL LV L       A   ++ A+   GRW  L  + GV AMHM L H + V+ FD+   G
Sbjct  14    VLLLVIL-------ACAGIAPASGAGGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFG  66

Query  493   RSGYQLRRRFNGTRCK-GSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILS  669
              S   L       RC+   RE +    C AHS EYDV +NT RPL   +DTWCSSGT+  
Sbjct  67    LSNLSLPD----GRCRRNPRERVVPMDCTAHSAEYDVASNTFRPLFVFTDTWCSSGTVAP  122

Query  670   NGTIMQTGGYRDGSKRIQFFAPCV--DKTCNWKPGKKHLYDERWYASNQILPGKNDRVII  843
             +GT++QTGG+ DG + ++  A C   D TC+W   +  L   RWYA+NQILP  + R  I
Sbjct  123   DGTLVQTGGWNDGYRNVRTMAACEAGDDTCDWDETQDALAANRWYATNQILP--DGRAFI  180

Query  844   VGGRRASTYEFVPRFPNMQKST-DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRD  1020
             VGGRR  TYEF P   +   S   LPFL QT  ++   NNLYPF+HL+ DG LFIFA   
Sbjct  181   VGGRRQFTYEFYPTADSSGGSAISLPFLVQT--KDPEENNLYPFVHLNIDGNLFIFAKNR  238

Query  1021  SILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYT  1200
             +ILF+Y+KN+V + +P + G   R+YPS+GSSV+LPL  K    + EV++CGGA AG+YT
Sbjct  239   AILFDYKKNKVVRTYPELAGGDPRNYPSSGSSVLLPL--KPSPTEAEVLVCGGAPAGSYT  296

Query  1201  EAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTG-QILIINGVKRGCA  1377
               K G F   L +CGR+ I+     W +E MP PRVM DM++LP G +++IING   G A
Sbjct  297   STKDGTFSSALVTCGRIKITDTAPAWVIETMPSPRVMGDMILLPNGAEVVIINGAMDGTA  356

Query  1378  GWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGY  1557
             GW +  +PA  P IY P  + G RF    +T IAR+YHSSA LL DGR+L+ GSNP+  Y
Sbjct  357   GWESAKTPAYAPVIYRPDHSPGDRFEEQSSTDIARLYHSSAVLLRDGRLLVGGSNPHIYY  416

Query  1558  VFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKK  1737
              F+NV +PTEL L+A+ P+Y+D   D  RP  V     G+ A  V YG    ++F +   
Sbjct  417   NFSNVQYPTELSLEAYSPEYLDPSNDALRPTIVDPSPNGA-AVSVTYGASLTLQFAVPAA  475

Query  1738  WPSED---------LEFSAYSPPFTTHSVAMNQRMLKL---RCTSMERGDNGMVNavvaa  1881
               +           +  +  +P FTTHS AMNQR+L L   +  ++ R         V  
Sbjct  476   RRARGGGGGGGIGLVSVTMVAPSFTTHSFAMNQRLLLLDAVKTAALARAST--YQTSVVM  533

Query  1882  ppspvaappGYYMVTVVNEGIPSISRWVKF  1971
             P +   APPGYYMV VVN  IPS   WV  
Sbjct  534   PATAALAPPGYYMVFVVNGHIPSEGIWVHI  563



>ref|XP_006378160.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP55957.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=544

 Score =   428 bits (1101),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 239/536 (45%), Positives = 325/536 (61%), Gaps = 25/536 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W  L E+ G+ AMHM +   N V+ FD+   GRS   L       +C+   E +    
Sbjct  20    GNWVVLQESIGISAMHMQVLRNNKVIMFDRTDFGRSNLSLP----DGKCRYKDEAVKPKD  75

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AH+V YD+ +NT RPL   +DTWCSSG++ S+G ++QTGGY+ G   I+ F PC D +
Sbjct  76    CTAHAVLYDIASNTFRPLMVQTDTWCSSGSLDSSGNLIQTGGYKAGEAVIRSFTPCDDDS  135

Query  751   CNW-KPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             C+W +   + L++ RWYASNQ+LP  + R+IIVGGRRA TYEF P+ P  + +  LPFL 
Sbjct  136   CDWVELSNQVLWNRRWYASNQLLP--DGRIIIVGGRRAFTYEFYPKNPQERDNFTLPFLI  193

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
              T +      NLYPFLHL  DG LFIFAN  SI  +Y++N+V K++P MP    R+YP T
Sbjct  194   HTRDPQEE-INLYPFLHLLPDGNLFIFANNRSISLDYKRNKVIKEYPVMPVGDRRNYPCT  252

Query  1108  GSSVMLPL---------DHKNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKSCGRMVI  1257
             GSSV+LPL         DH     + EVMICGGA  GAY ++     + +   +CGR+ +
Sbjct  253   GSSVLLPLRLTGITNVTDHP----EAEVMICGGAQKGAYIKSNYLHIYGQASTTCGRLKV  308

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +  K +W ME MP PR+MNDM++LPTG ++IING   G AGW +  +P   P +Y P + 
Sbjct  309   TDPKPEWVMELMPIPRIMNDMLLLPTGDLIIINGATNGSAGWNDAMNPVYNPVLYQPDED  368

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
               +RF VL ++KIAR+YHS+AALLPDGR+L+ GSNP+ GY  T  P+PTEL L+AF   Y
Sbjct  369   PTRRFVVLSSSKIARLYHSTAALLPDGRILVGGSNPHQGYNMTGKPYPTELSLEAFYLHY  428

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
             +D ++   RP  ++V +       V YG+ F V F          +  +  +P FTTHS 
Sbjct  429   LDPQYAYLRPSILTVELSDR---AVSYGELFSVTFVCSSYRLDLGVSVTVIAPSFTTHSF  485

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
              MNQRM+ L   S+ +       A V  P +   APPGYYM+ VV+ GIPS + WV
Sbjct  486   GMNQRMVVLNVVSVVQLSMFAYKANVIGPINVNVAPPGYYMMFVVHAGIPSNAVWV  541



>ref|XP_006342233.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   428 bits (1101),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 233/538 (43%), Positives = 323/538 (60%), Gaps = 15/538 (3%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSR  549
             S  A+G GRW  LM N G+ +MHM L + + VV +D+   G S   L    NG +C+ + 
Sbjct  27    SAYAAGGGRWDLLMSNIGISSMHMQLLNNDRVVMYDRTDFGASNISLP---NG-KCRNNT  82

Query  550   EDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQF  726
              DL+    C AHSVEYDV  N++RPL   +D WCSSG+  S+GT++QTGG+ DG   ++ 
Sbjct  83    NDLTLKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGENVVRV  142

Query  727   FAPCV--DKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
               PC     TC+WK  +  L   RWYA+N +LP  + R II+GGR A  YEF P+  +  
Sbjct  143   LKPCNGNKSTCDWKEIEGALIQSRWYATNHVLP--DGRQIIIGGREAFNYEFYPKTLSTN  200

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
                +L FL QT +     NNLYPF+ L+ DG LFIFAN  +ILF+Y ++ + K +P++PG
Sbjct  201   NIFNLTFLQQTNDLREE-NNLYPFVFLNVDGNLFIFANNRAILFDYTRDIIVKTYPQIPG  259

Query  1081  EGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
                R+YPSTGS+V+LPL + + +  + EV++CGG   G++  A++G F+  L +CGR+ I
Sbjct  260   GDPRNYPSTGSAVLLPLKNLEAQIIQAEVLVCGGTKNGSFLRAQRGNFLGALNTCGRITI  319

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +    +W ME MP  R+M DMVILP G +LIING   G AGW  G +P L P IY P   
Sbjct  320   TDPNPQWIMETMPLARIMGDMVILPNGNVLIINGATAGTAGWELGRNPVLSPVIYRPDNP  379

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
             V  RF V  ++ I RMYHS+  LL DGRVL++GSNP+  Y FT V +PTEL L+AF P Y
Sbjct  380   VNSRFDVQNSSTIPRMYHSTTVLLRDGRVLVSGSNPHGLYNFTGVLYPTELSLEAFSPSY  439

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
             +D    N RP+ VS     S    V YG + ++RF +        ++ +  +P F THS 
Sbjct  440   LDSESVNLRPRVVS----PSSRRKVKYGGQVNIRFIIPGPINRNLVKVTMVAPGFNTHSF  495

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              MNQR+L+L   ++ +            P S   APPGYYM+ VV++ IPS   W++ 
Sbjct  496   TMNQRILELSSGNVTQVGTSTFKINSIFPNSSKLAPPGYYMLFVVHQDIPSEGIWIRI  553



>ref|XP_006342711.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=568

 Score =   428 bits (1101),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 231/535 (43%), Positives = 318/535 (59%), Gaps = 20/535 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             G W  L+ N G+ AMHM L + + VV FD+   G S   L       +C+  + D +   
Sbjct  45    GSWNLLLSNIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPD----GKCRYDQNDTTLKV  100

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC---  738
              C AHS+EYD+ +N+IRPL   +D WCSSG++  +G+++QTGG+ DG K ++ F PC   
Sbjct  101   DCTAHSIEYDIASNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGEKVVRVFKPCSNA  160

Query  739   -VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
               + TC+W+  +  L   RWY++N ILP  + R II+GGRRA  YEF P+  +   S  L
Sbjct  161   TTNGTCDWEEIQGGLVQRRWYSTNHILP--DGRQIIIGGRRAFNYEFYPKSASANNSYSL  218

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             PFL +T + N   NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V   +P +PG   R+
Sbjct  219   PFLVKTNDPNKIENNLYPFVFLNVDGNLFIFANNRAILFDYTKNVVLTNYPEIPGGDPRN  278

Query  1096  YPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             YPSTGS+V+LPL +    + + EV++CGGA  G+YT A  G F   L +CGR++I+    
Sbjct  279   YPSTGSAVLLPLKNLQAQEIQAEVLVCGGAPKGSYTSALNGNFSGALSTCGRIIITDPNP  338

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
             +W ME MP  R M DMVILP G +LIING   G AGW  G  P L+P IY P      RF
Sbjct  339   QWTMETMPLARTMGDMVILPNGNVLIINGATTGTAGWECGRDPVLKPVIYRPDNPFDSRF  398

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
              +  ++ I RMYHS+A LL DGRVL+ GSNP+  Y FT V  PTEL L+AF P Y+D   
Sbjct  399   EIQNSSTIPRMYHSTAVLLRDGRVLVGGSNPHIYYNFTGVLFPTELSLEAFSPSYLDSIS  458

Query  1633  DNQRPKNVSVYVEGSPAA--VVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMN  1806
             +  RP+ +      SPA+   ++YG+   +RF +  +     +  +  +P F THS  MN
Sbjct  459   EYLRPQII------SPASQYAIEYGQRMPIRFKVAGRVDINLVTITMVAPGFNTHSFTMN  512

Query  1807  QRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             QR+L L   +++          V  P +   APPGYY++ VV++ IPS   WVK 
Sbjct  513   QRLLVLVSENVKLIGENAYQINVVTPNNAKLAPPGYYLLFVVHQDIPSEGIWVKI  567



>ref|XP_002876427.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52686.1| hypothetical protein ARALYDRAFT_907231 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   427 bits (1098),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 317/529 (60%), Gaps = 23/529 (4%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RW+ L+ + G+ AMHM L H   VV FD+   G S   L     G  C+    D +    
Sbjct  36    RWEMLLPSIGISAMHMQLLHNGMVVMFDRTDFGTSNVSLP----GGICRYDPTDTAVKFD  91

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDK  747
             C AHSV YDV++NT RPL   +DTWCSSG +L NGT++QTGGY DG +  + F PC   +
Sbjct  92    CSAHSVLYDVVSNTYRPLNVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFTPCGYSE  151

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             TC+W    ++L   RWYA+NQI+P  + R+I+VGGRR   YE  PR  +  +S+   FL 
Sbjct  152   TCDWIEFPQYLSQRRWYATNQIIP--DGRIIVVGGRRQFNYELFPRHDSRSRSSRFEFLR  209

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             +T +  +  NNLYPFLHL  DG LF+FAN  SI+F+Y+KNR+ K+FP +PG   R+YPS+
Sbjct  210   ETSD-GSNENNLYPFLHLLPDGNLFVFANTRSIVFDYKKNRIVKEFPEIPGGDPRNYPSS  268

Query  1108  GSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             GSS++ PLD  N    +VE+M+CGG+  G ++      F     +CGR+ +S     W M
Sbjct  269   GSSILFPLDETNNTDIEVEIMVCGGSPKGGFSHG----FTRATSTCGRLKLSDQNPIWEM  324

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E+MP PRVM DM++LPTG ++I+NG   G AGW     P ++P IY P       FSV+ 
Sbjct  325   ESMPLPRVMGDMLLLPTGDVIIVNGAGAGTAGWEKARDPVIQPVIYQP---FDHLFSVMS  381

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
                  RMYHSSA LLPDGRVL+ GSNP+  Y FTNV +PT+L L+A+ P Y+    D  R
Sbjct  382   TPSRPRMYHSSAVLLPDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLSFTSDPIR  441

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKL  1824
             PK     +  +   V+ Y + F+V F + +    + L     +P FTTHS AMNQRM+ L
Sbjct  442   PK-----ILLTNDKVLSYKRLFNVDFSIAQFLTVDLLSVRIVAPSFTTHSFAMNQRMVIL  496

Query  1825  RCTSMERGD-NGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             +  S+ R             P +   APPGYYM+ +V+ GIPS + WV+
Sbjct  497   KLLSVTRDQLTNSYRISALGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQ  545



>ref|XP_008813838.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=548

 Score =   427 bits (1098),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 245/564 (43%), Positives = 334/564 (59%), Gaps = 26/564 (5%)
 Frame = +1

Query  289   PCAITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVV  468
             P +   LL LFL  +   ++       +EAASG GRW  L  + GV AMHM L H + V+
Sbjct  3     PTSALPLLFLFLYDITLSHS------AAEAASGGGRWDLLQRSIGVSAMHMQLLHNDRVI  56

Query  469   FFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWC  648
              FD+   G S   L    +G       E +    C AHS EYDV+ NT RPL   +DTWC
Sbjct  57    IFDRTDFGPSNLSLP---DGKCRHDHHERVLKIDCTAHSAEYDVVTNTFRPLTIHTDTWC  113

Query  649   SSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKN  828
             SSG++  +G ++QTGG  DG + I+ F PC D  C+WK  +  L   RWYA+NQILP  +
Sbjct  114   SSGSVDPDGRLIQTGGSFDGERAIRTFFPCTDSRCDWKEVEA-LAVPRWYATNQILP--D  170

Query  829   DRVIIVGGRRASTYEFVPRF-PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFI  1005
              R II+GGR   +YEF P+  P+    T+L FL QT  R+   NNLYPF+HL+ DG LFI
Sbjct  171   GRAIIIGGRLQFSYEFYPKSNPSTAGITNLEFLLQT--RDVEENNLYPFVHLNVDGNLFI  228

Query  1006  FANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGAS  1185
             FAN  +IL +Y KN + + +P +PG   RSYPSTGSSV+LPL+     ++ EV+ICGGA 
Sbjct  229   FANNRAILLDYTKNNIVRTYPPVPGGDPRSYPSTGSSVLLPLESSG--EEAEVLICGGAP  286

Query  1186  AGAYTEA-KQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTG-QILIING  1359
              G++ +A K   F+  L +CGR+ I+     W +E MP PRVM DM++LP+G ++LIING
Sbjct  287   RGSFMKAIKNEAFVGALSTCGRIKITDPSPTWFIETMPTPRVMGDMILLPSGKEVLIING  346

Query  1360  VKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGS  1539
                G AGW  G SP + P +Y PGK VG RF V  ++   R+YHSSA LL DGR+L+ GS
Sbjct  347   AAAGAAGWELGRSPVMTPVVYCPGKPVGARFEVQNSSSTPRLYHSSAILLRDGRILVGGS  406

Query  1540  NPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVR  1719
             NP++ YVF+ V +PTEL L+AF PDY+       RP+     +E     +++YGK+F +R
Sbjct  407   NPHENYVFSGVDYPTELSLEAFSPDYLGAEHSILRPR----IIEPRTPLMLNYGKQFSLR  462

Query  1720  FWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspva  1899
             F   +   +E +  +  +P F+THS +MNQR+L L+ +      +G     + A      
Sbjct  463   F-KARLTSNEGVSVTMVAPSFSTHSFSMNQRLLILKSSKAATIPSGSSTHEIGAVAPKSR  521

Query  1900  app--GYYMVTVVNEGIPSISRWV  1965
                  GYYM  +VN  IP    WV
Sbjct  522   ILAPPGYYMFFIVNGRIPGEGIWV  545



>ref|XP_010100623.1| hypothetical protein L484_011554 [Morus notabilis]
 gb|EXB83260.1| hypothetical protein L484_011554 [Morus notabilis]
Length=505

 Score =   426 bits (1094),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 235/518 (45%), Positives = 314/518 (61%), Gaps = 19/518 (4%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNN  609
             MHM L     VV +D+   G S   L     G RC+    D +    C AHSV YD + N
Sbjct  1     MHMQLLRNTKVVIYDRTDFGPSNLSL----GGGRCRFDPLDTALQNDCTAHSVLYDPVLN  56

Query  610   TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK-TCNWKPGKKHLYD  786
             T RPL   +D+WCSSG++L NGT++QTGG+ DG   I+ F+PC+D+  C+W     +L  
Sbjct  57    TFRPLMLQTDSWCSSGSVLPNGTLVQTGGFNDGDHVIRTFSPCMDEENCDWIETPNYLAQ  116

Query  787   ERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLY  966
              RWY++NQILP  + R+I+VGGRR   YEF PR         L FL +T + +   NNLY
Sbjct  117   RRWYSTNQILP--DGRIIVVGGRRQFNYEFFPRNLGDPSLMWLNFLRETSDSDE--NNLY  172

Query  967   PFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNR  1146
             PFLHL  DG LFIFAN  SI F+Y +NR+ K+FP +PG   R+YPS+GSSV+LPLD    
Sbjct  173   PFLHLLPDGNLFIFANTRSISFDYNQNRIVKEFPPIPGGDPRNYPSSGSSVLLPLDENKE  232

Query  1147  FQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHK---WNMENMPGPRVMND  1317
               + E+MICGGA  GA+  A +G F+E L SCGR+++S N      W ME+MP PR M D
Sbjct  233   CVEAEIMICGGAPRGAHRLALEGTFVEALSSCGRLIVSYNDQNPSNWVMEDMPLPRAMGD  292

Query  1318  MVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSS  1497
             MVILP+G ++IINGV +G AGW  G  P + P IY P    G RF+++ ++   R+YHS+
Sbjct  293   MVILPSGDVIIINGVGQGTAGWELGRDPVMAPLIYCPNAEPGHRFTLMESSSRPRLYHST  352

Query  1498  AALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGS  1677
             A LLPDG+VL+ GSNP+  Y FT V +PTEL L+AF P Y+       RPK ++      
Sbjct  353   AILLPDGQVLVGGSNPHVFYNFTGVEYPTELSLEAFSPPYLSAENGLVRPKILAA-----  407

Query  1678  PAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNG  1857
                V  YG+ F V F +     ++ + F   +P FTTHS  M+QRM+ ++  ++ +    
Sbjct  408   -TGVFGYGQFFSVVFTVPLYNGADAVSFRLIAPSFTTHSFGMSQRMVVMKVGTVSQVARF  466

Query  1858  MVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
               NA V  P +   APPGYYM+ VV+  IPS   WVK 
Sbjct  467   AYNATVIGPWTAEIAPPGYYMLFVVHCEIPSFGAWVKL  504



>emb|CDY62245.1| BnaC01g42480D [Brassica napus]
Length=552

 Score =   426 bits (1096),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 231/531 (44%), Positives = 319/531 (60%), Gaps = 23/531 (4%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RW+ L+ + G+ AMHM L H   V+ FD+   G S   L     G  C+    D +    
Sbjct  37    RWEVLLPSVGISAMHMQLLHNGMVIMFDRTDFGISNLSL----PGGMCRFDPSDTAVKFD  92

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDK  747
             C AHSV YDV++NT R L+  +DTWCSSG++L NGT++QTGGY DG +  + F PC   +
Sbjct  93    CSAHSVLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFTPCGYSE  152

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQK--STDLPF  921
             TC+W    ++L   RWYA+NQILP  + R+I+VGGRR   +E  PR P+  +   +   F
Sbjct  153   TCDWIEFPQYLAQRRWYATNQILP--DGRIIVVGGRRQFNFEIFPR-PDSHRYRGSRFDF  209

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T +  +  NNLYPFL+L  DG LF+FAN  SI+F+Y++NR+ ++FP +PG   R+YP
Sbjct  210   LRETTD-GSSENNLYPFLYLLPDGNLFVFANTRSIVFDYKRNRIVREFPEIPGGDPRNYP  268

Query  1102  STGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAK-QGRFIEGLKSCGRMVISGNKHKW  1278
             S+GSS++ PLD      + E+M+CGGA   A+  AK Q  F     +CGR+ ++     W
Sbjct  269   SSGSSILFPLDESKNIMEAEIMVCGGAPKDAFPRAKSQQGFTCATSTCGRLRLTSPNPIW  328

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              ME MP PRVM DM++LPTG I+I+NG   G AGW N   P   P IY P     +RFS+
Sbjct  329   EMETMPLPRVMGDMLLLPTGDIIIVNGAGAGTAGWENARDPVTRPVIYHP---FDRRFSI  385

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             +  +  +RMYHSSA LLPDGRVL+ GSNP+  Y FTNV +PTEL L+A+ P Y+    D+
Sbjct  386   MSTSSRSRMYHSSAVLLPDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPYLSFTSDS  445

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP  +      +   V+ Y + F+V F + +    + L     +P FTTHS AMNQRM+
Sbjct  446   IRPHIL------TNDKVISYKRLFNVNFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQRMV  499

Query  1819  KLRCTSMERGD-NGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              L+  S+   D           P +   APPGYYM+ +V+ GIPS   WV+
Sbjct  500   ILKLLSVTHEDLTNSYKIDALGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQ  550



>emb|CDP00283.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   425 bits (1092),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 234/523 (45%), Positives = 319/523 (61%), Gaps = 21/523 (4%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNT  612
             MHM L + N VV FD+   GRS   L       RC+ S +      C AHSV YD++ NT
Sbjct  1     MHMQLLYNNKVVIFDRTDFGRSNISLPF----GRCRFSVDGKLRIDCTAHSVIYDIVTNT  56

Query  613   IRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDER  792
              RPL   +D WCSS  +  +G ++QTGGYR G+ +I+ F PC +  C+W    ++L   R
Sbjct  57    FRPLMVQTDVWCSSAAVNPDGVLVQTGGYRGGADKIRLFTPCNNDFCDWIELPQNLTVRR  116

Query  793   WYASNQILPGKNDRVIIVGGRRASTYEFVPR---FPNMQKSTDLPFLHQTYERNAGGNNL  963
             WYAS+QILP  + R+IIVGGRRA +YEF P+   F +  +   L FL +T +     NNL
Sbjct  117   WYASDQILP--DGRIIIVGGRRAFSYEFFPKNSVFFSNAEVYWLQFLKETSDPREE-NNL  173

Query  964   YPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKN  1143
             YPFLHL  DG LF+FAN+ S++ +Y  N++ +KFP +PGE  RSYPSTGSSV+LPL    
Sbjct  174   YPFLHLLPDGNLFVFANQHSVILDYVNNKILRKFPPIPGE-KRSYPSTGSSVLLPLRLTG  232

Query  1144  RFQK-------VEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGP  1302
                +       VEVMICGGA+ G+Y +A+ G ++   KSCGR+ ++    +W ME MP  
Sbjct  233   SGSRLGSPSPEVEVMICGGANGGSYIQARLGVYVAASKSCGRLRVTDPDPEWEMETMPMN  292

Query  1303  RVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT-VGKRFSVLRATKIA  1479
             RVM DM++LPTG +LI+NG  +G AGW     P L P +Y P +    +RF+VL  T   
Sbjct  293   RVMPDMLLLPTGDVLILNGASKGSAGWELADDPVLHPVLYRPSEMDPQQRFTVLNPTVNP  352

Query  1480  RMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVS  1659
             R+YHS+A LLPDGRVL+ GSNP+  Y FT V +PT+L L+AF+P Y+  ++   RP  ++
Sbjct  353   RLYHSAAVLLPDGRVLVGGSNPHALYRFTGVKYPTDLTLEAFLPPYLGPQYSQLRPSILT  412

Query  1660  VYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSM  1839
                EG    ++ YG++F + F L    P +D   +  +P FTTHS AMNQR++ L     
Sbjct  413   --FEGPTDNIISYGQQFSITFTLGLHPPGQDFRVTMIAPSFTTHSFAMNQRLVMLDVVGY  470

Query  1840  ERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             ++         V APP+   APPGYYM  VVN GIPS   W++
Sbjct  471   QQLSAFAFKVTVCAPPTRNIAPPGYYMTFVVNGGIPSTGVWIR  513



>ref|XP_006382737.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP60534.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=550

 Score =   426 bits (1095),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 241/542 (44%), Positives = 322/542 (59%), Gaps = 19/542 (4%)
 Frame = +1

Query  358   SVLVSEAA----SGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFN  525
             SV++S+         GRW  L E+ G+ AMHM L H N VV +D+   G S   L     
Sbjct  21    SVVISQTTPSSDGSHGRWDLLSESVGISAMHMQLMHDNKVVIYDRTDFGPSNISLP----  76

Query  526   GTRCKGS-REDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYR  702
             G  C+    +D     C AHS+ YD + +T RPL   +DTWCSSG +L NGT++QTGG+ 
Sbjct  77    GGLCRADPYDDALKIDCTAHSILYDTITDTYRPLMIQTDTWCSSGAVLPNGTLVQTGGFH  136

Query  703   DGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVP  882
             DG    + F PC + +C+W    K+L   RWYA+NQILP  + R+II+GGRR   YEF P
Sbjct  137   DGDNVTRMFTPCTNDSCDWVEFPKYLSRRRWYATNQILP--DGRIIIIGGRREFNYEFFP  194

Query  883   RFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKK  1062
             R  + +++  L FL +T E +   NNLYPF HL  DG LFIFAN  SILF+Y +NRV ++
Sbjct  195   R-SSPRRTFQLSFLRETREGDVE-NNLYPFAHLLPDGNLFIFANTRSILFDYNQNRVVRE  252

Query  1063  FPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSC  1242
             FP +PG   R+YPSTGSSV+LPLD        EV++CGGA  GA+  A +G F+    +C
Sbjct  253   FPSIPGGDPRNYPSTGSSVLLPLDENEYRIDPEVLVCGGAPNGAFQLAARGTFVRATPTC  312

Query  1243  GRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIY  1422
             GR+ ++     W ME MP PR M DM++LPTG +++INGV+ G AGW  G  PA  P IY
Sbjct  313   GRLRVTDQNASWVMETMPIPRAMGDMLLLPTGDVIVINGVQLGTAGWELGRLPATRPVIY  372

Query  1423  SPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQA  1602
              P     +RFSV+  +   RMYHS+A LL DGRVL+ G NP+  Y FTNV +PT+L L+ 
Sbjct  373   HPSHPSDQRFSVMPPSPRPRMYHSAAILLADGRVLVGGGNPHVYYNFTNVVYPTDLSLET  432

Query  1603  FVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPF  1782
             F P Y+   + + RP  +SV         +  G+ F V F +++      L     +P F
Sbjct  433   FSPPYLSTDYASVRPVILSV------DGTISRGQRFLVSFSVEEYLTQSVLSVRIVAPSF  486

Query  1783  TTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRW  1962
             TTHS +MNQRM+ L+   +   D     + V  P S   APPGYYM+ VV+ GIPS   W
Sbjct  487   TTHSFSMNQRMVVLKIDDIIYDDTSSYTSSVFGPSSSEIAPPGYYMLFVVHSGIPSSGVW  546

Query  1963  VK  1968
             V+
Sbjct  547   VR  548



>ref|XP_011073112.1| PREDICTED: galactose oxidase [Sesamum indicum]
Length=549

 Score =   426 bits (1095),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 230/541 (43%), Positives = 319/541 (59%), Gaps = 17/541 (3%)
 Frame = +1

Query  355   ASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTR  534
             A  ++   A  +G W  L  + G+ AMHM L   N VV FD+   G S   L    +G R
Sbjct  23    ACQMLPAYAHIEGEWHLLHRSIGISAMHMQLLKNNKVVIFDRTDFGPSNISL----SGRR  78

Query  535   CKGSRED-LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGS  711
             C+    D +    C AHS+ YD+  N  R L   +DTWCSSG +L +GT++QTGGY DG 
Sbjct  79    CRFDPNDRVLKKDCTAHSILYDIRTNGFRTLTVQTDTWCSSGALLPDGTLVQTGGYNDGD  138

Query  712   KRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVP-RF  888
               I+   PC    C+W    + L   RWYASNQILP  + RVIIVGGR    YEF P   
Sbjct  139   HVIRILVPCNGGNCDWVEFPRSLSRRRWYASNQILP--DGRVIIVGGRAQFNYEFYPGHS  196

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
             P+  KS  L FL +T  ++   NNLYPFLHL  DG LF+FAN  SI+FNY++N++ ++FP
Sbjct  197   PSSSKSFRLNFLRET--KDGHENNLYPFLHLLPDGNLFVFANTRSIVFNYKRNQIVREFP  254

Query  1069  RMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGR  1248
              +PG   R+YPS+GSSV+LP+D +N     E+MICGGA+  A+  A +G F     +CGR
Sbjct  255   AIPGADPRNYPSSGSSVLLPID-ENAPVVPEIMICGGATRNAFELANRGVFQRACSTCGR  313

Query  1249  MVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSP  1428
             + I+  +  W +ENMP PRVM+DM+ILP G ++IING + G AGW    +P   P IY+P
Sbjct  314   LKITKEEPAWKIENMPMPRVMSDMLILPDGYVIIINGARSGTAGWEYAKNPVTRPLIYNP  373

Query  1429  GKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFV  1608
                 G RFS++ A+   R+YHS+A LL DGR+L+ GSNP+  Y FT V +PT+L L++F 
Sbjct  374   NGKAGVRFSIMAASSRPRLYHSTAVLLTDGRILVGGSNPHKYYNFTGVDYPTDLSLESFS  433

Query  1609  PDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             P Y+   +D  RP+ +  Y       ++ Y   F + F + +   +  +     +P F T
Sbjct  434   PPYLSPVYDRLRPRIIRTY------EIIRYKNAFSLTFTVQRFVKTSAVSVRIVAPSFNT  487

Query  1789  HSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             HS +MNQRM+ L+   + R    +     + P  P  APPGYY++ +++ GIPS   WVK
Sbjct  488   HSFSMNQRMVVLKGARVSRVGPNVYRVAASGPSKPEIAPPGYYLLFLLHAGIPSSGMWVK  547

Query  1969  F  1971
              
Sbjct  548   I  548



>ref|XP_006577272.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=550

 Score =   426 bits (1095),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 246/561 (44%), Positives = 337/561 (60%), Gaps = 20/561 (4%)
 Frame = +1

Query  298   ITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFD  477
             I  L+   L SL P     A  L S A + QG+W  L  + G+  MHM L H + ++ FD
Sbjct  4     IMILIPFILASLFPF--FQAQPL-SSAFANQGQWNLLQPSIGISPMHMQLLHNDKIIMFD  60

Query  478   QRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSS  654
             +   G S   L    NG RC+    +++    C AHSV YDV  NT RPL   +DTWCSS
Sbjct  61    RTDFGHSYLPLS---NG-RCRMDPNEIALKVDCSAHSVLYDVATNTFRPLMIQTDTWCSS  116

Query  655   GTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDR  834
             G++L NGT++QTGGY DG + I+ F PC  +TC+W      L   RWYA+NQILP  + R
Sbjct  117   GSVLPNGTLVQTGGYNDGERSIRMFTPCFGETCDWVEFPGLLSQRRWYATNQILP--DAR  174

Query  835   VIIVGGRRASTYEFVPRFPNMQKSTD---LPFLHQTYERNAGGNNLYPFLHLSSDGYLFI  1005
             VI+VGGRR   YEF+P+ P+   S     L FL QT +R+   NNLYPF+HL  DG LFI
Sbjct  175   VIVVGGRRQFNYEFLPKTPSPNSSPSSIPLNFLQQTSDRSE--NNLYPFVHLLPDGNLFI  232

Query  1006  FANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGAS  1185
             FAN  S+LF+Y++N V ++FP +PG   R+YPS+GSSV+LPLD      + EV++CGGA 
Sbjct  233   FANTKSVLFDYKQNSVIREFPPIPGGDPRNYPSSGSSVLLPLDENLDSLEPEVVVCGGAP  292

Query  1186  AGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVK  1365
              G++  A +G F++ L +CGR+ ++ +   W M+NMP PR M DM++LP G ++IING  
Sbjct  293   RGSFENAARGNFVQALGTCGRIKVTDSNPNWVMQNMPMPRAMGDMLLLPNGDVVIINGAG  352

Query  1366  RGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNP  1545
              G AGW +G  P L P I+ P +TV  +FSV+      R+YHSSA LL DGRVL+ GSNP
Sbjct  353   AGTAGWEHGHDPVLSPVIFRPSETV-NQFSVMAPASRPRLYHSSAVLLRDGRVLVGGSNP  411

Query  1546  NDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFW  1725
             +  Y FT V +PT+L L+AF P Y+   F   RP  V  Y+  +   V+ Y    +V F 
Sbjct  412   HVFYNFTGVEYPTDLSLEAFSPPYLAPDFAPVRP--VIRYITNN--NVLGYRVFCYVTFT  467

Query  1726  LDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaap  1905
             +       ++     +P FTTHS   NQRM+ L+ +++         A V  P +   AP
Sbjct  468   VPNYASVSEVSIRIVAPSFTTHSFGQNQRMVVLKLSAVTYLAGEAYYATVMGPSTAEIAP  527

Query  1906  pGYYMVTVVNEGIPSISRWVK  1968
             PGYY++ VV++G+PS   WV+
Sbjct  528   PGYYLLFVVHKGVPSWGSWVQ  548



>ref|XP_002510488.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF52675.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=547

 Score =   425 bits (1093),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 240/540 (44%), Positives = 328/540 (61%), Gaps = 25/540 (5%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             V+EAA G  RWQ L EN G+ AMHM L + + VV FD+   G S   L    NG   K  
Sbjct  25    VTEAAGG--RWQLLQENIGITAMHMQLLNNDRVVIFDRTDFGLSNLSLP---NGKCRKDP  79

Query  547   REDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQF  726
              E +    C AHSVEYDVL+N IR L   ++ WCSSG ++ +G+++QTGG+ DG ++++ 
Sbjct  80    TELVLKTDCTAHSVEYDVLSNQIRALMVQTNVWCSSGAVMPDGSLIQTGGFNDGERKVRT  139

Query  727   FAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR--FPNMQ  900
             F PC   +C+W      L   RWYA+N ILP  + + II+GGRR   YEF P+   P++ 
Sbjct  140   FDPC--SSCDWVELGDGLKARRWYATNHILP--DGKQIIIGGRRQFNYEFYPKSAAPDVY  195

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
                 L FL +T +RN   NNLYPF+ L+ DG LFIFAN  +I+F+Y+  +V K +P +PG
Sbjct  196   S---LRFLVETNDRNIE-NNLYPFVFLNVDGNLFIFANNRAIMFDYKVAKVVKTYPTIPG  251

Query  1081  EGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
                RSYPSTGS+VMLPL +      + EV++CGGA  G+YTEA +G F++ L +CGRM I
Sbjct  252   GDPRSYPSTGSAVMLPLKNSQAENIEAEVLVCGGAPKGSYTEAMKGNFVKALDTCGRMKI  311

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +    +W +E MP  RVM DM+ LP G ++I+NG   G AGW  G +P L P +Y P   
Sbjct  312   TDANPQWTIETMPEARVMGDMIFLPNGNVIIVNGGGAGTAGWEYGRNPVLNPVLYKPDNA  371

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFT-NVPHPTELRLQAFVPD  1614
             +G RF     + I RMYHS+A LL DGRVL+ GSNP+  Y F+ +V  PTELRL+AF P 
Sbjct  372   IGSRFESQNPSTIPRMYHSTAILLRDGRVLVGGSNPHINYNFSKDVFFPTELRLEAFSPA  431

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAV--VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             Y+D   +N RP  +      SPA+   + Y ++  VRF +  +     +  +  +P FTT
Sbjct  432   YLDTANNNLRPTII------SPASKSRLGYAQKLAVRFKVTGRLTENTVSVTMVAPSFTT  485

Query  1789  HSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             HS +MNQR+L L    +     G  +  V AP S   APPG+Y++ VV+E IPS   WV+
Sbjct  486   HSFSMNQRLLVLDNEKVTDVGTGTYDVQVTAPRSTNLAPPGFYLLFVVHEDIPSEGIWVQ  545



>ref|XP_006290310.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
 gb|EOA23208.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
Length=547

 Score =   425 bits (1093),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 319/529 (60%), Gaps = 24/529 (5%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RW+ L+ + G+ AMHM L H   V+ FD+   G S   L     G  C+    D +    
Sbjct  37    RWEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGTSNVSLP----GGVCRYDPTDTAVKFD  92

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDK  747
             C AHSV YDV++NT RPL+  +DTWCSSG +L NGT++QTGGY DG +  + F PC   +
Sbjct  93    CSAHSVLYDVVSNTFRPLQVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARTFTPCGYSE  152

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             TC+W    ++L   RWYA+NQILP  + R+I+VGGRR   +EF PR  +  +S+   FL 
Sbjct  153   TCDWIEFPQYLSQRRWYATNQILP--DGRIIVVGGRRQFNFEFFPRHSSRSRSSRFEFLR  210

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             +T +  +  NNLYPF+HL  DG LF+FAN  SI+F+Y++NRV K+FP +PG   R+YPS+
Sbjct  211   ETSD-GSNENNLYPFIHLLPDGNLFVFANTRSIVFDYKRNRVVKEFPEIPGGDPRNYPSS  269

Query  1108  GSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             GSS++ PLD  N    +VE+M+CGG+  G ++      F     +CGR+ +S     W M
Sbjct  270   GSSILFPLDETNGTDVQVEIMVCGGSPRGGFSRG----FTRATSTCGRLKLSDQNPSWEM  325

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MP PRVM DM++LPTG ++I+NG   G AGW     P ++P IY P     + FSV+ 
Sbjct  326   ETMPLPRVMGDMLLLPTGDVIIVNGAGTGTAGWEKARDPVIQPLIYHP---FDRLFSVMS  382

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
                  RMYHSSA LLPDGRVL+ GSNP+  Y FTNV +PT+L L+A+ P Y+    D  R
Sbjct  383   TPTRPRMYHSSAVLLPDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLSFTSDPIR  442

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKL  1824
             PK +      +   V+ Y + F++ F + +    + L     +P FTTHS AMNQRM+ L
Sbjct  443   PKIL------TSDKVLGYKRLFNIDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVIL  496

Query  1825  RCTSMERGD-NGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
                S+ R          V  P +   APPGYYM+ +V+ GIPS + WV+
Sbjct  497   NLLSVTRDQLTNSYRVNVLGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQ  545



>ref|XP_011028961.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=598

 Score =   427 bits (1098),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 233/534 (44%), Positives = 319/534 (60%), Gaps = 14/534 (3%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDL  558
             A+G G+WQ L  + G+ AMHM L   + VV +D+   GRS   L    +G     S E +
Sbjct  75    AAGGGQWQLLQNSIGITAMHMQLLSNDRVVIYDRTDFGRSNLSLP---DGKCRNDSSELV  131

Query  559   SDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC  738
                 C AHSVEYDVL N  RPL   SD WCSSG ++ +G+++QTGG+ DG ++++ F+PC
Sbjct  132   IKYDCSAHSVEYDVLANRFRPLMVQSDVWCSSGAVVPDGSLIQTGGFNDGERKVRIFSPC  191

Query  739   VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR--FPNMQKSTD  912
                 C+W+     L  +RWYA++ ILP  + R II+GGRR   YEF P+   PN+     
Sbjct  192   NGADCDWEEVGDGLKAKRWYATSHILP--DGRQIIIGGRRQFNYEFYPKSSAPNVYS---  246

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             L FL +T +R    NNLYP + L+ DG LFIFAN  +ILF+++ N+V K +P +PG   R
Sbjct  247   LRFLMETNDRGIE-NNLYPSVFLNGDGNLFIFANNRAILFDHKTNKVVKTYPAIPGGDPR  305

Query  1093  SYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNK  1269
             SYPSTGS+V+LPL + +    + EV++CGGA  G++   ++G F++ L +C R+ I+   
Sbjct  306   SYPSTGSAVLLPLKNLQASTIEAEVLVCGGAPKGSFARVEKGNFVQALDTCARIKINDPN  365

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
              +W ME MP  RVM DM +LP G +LIING   G AGW NG  P L P +Y P    G R
Sbjct  366   PRWVMETMPTARVMGDMTLLPNGNVLIINGAGAGTAGWENGRDPVLNPVLYRPDDASGSR  425

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             F +   + I RMYHS+A LL DGR L+ GSNP+ GY FT V  PTEL L+AF P Y+D +
Sbjct  426   FELQNPSTIPRMYHSTAILLRDGRGLVGGSNPHIGYEFTGVLFPTELSLEAFSPPYLDPK  485

Query  1630  FDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQ  1809
             FD+ RPK VS     S    + YG++  VRF +  K   + +  +  +P F THS +MN 
Sbjct  486   FDDLRPKIVS--SSASKGKNIGYGQKLLVRFKVTSKIVIDMVSVTMVAPAFNTHSFSMNH  543

Query  1810  RMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             R+L L    +        +  V  PP    AP G+YM+ VV++ IPS   WVK 
Sbjct  544   RLLVLGNEKVTDVGASTYDIQVMTPPPGDLAPSGHYMLYVVHQEIPSEGLWVKI  597



>ref|XP_010516382.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=546

 Score =   425 bits (1093),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 232/529 (44%), Positives = 316/529 (60%), Gaps = 24/529 (5%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RW+ L+ + G+ AMHM L H   V+ FD+   G S   L     G  C+    D +    
Sbjct  36    RWEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNVSLP----GGICRYDPTDTAVKFD  91

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDK  747
             C AHSV YDV++NT RPL+  +DTWCSSG +L NGT++QTGGY DG +  + F PC   +
Sbjct  92    CSAHSVLYDVVSNTYRPLQVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARMFTPCGYSE  151

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             TC+W    ++L   RWYA+NQILP  + R+I+VGGRR   YE  PR  +  +S+   FL 
Sbjct  152   TCDWMEFPQYLSQRRWYATNQILP--DGRIIVVGGRRQFNYEIFPRHSSRSRSSRFEFLR  209

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             +T +  +  NNLYPF+HL  DG LF+FAN  SI+F+Y+ NRV K+FP +PG   R+YPS+
Sbjct  210   ETSD-GSDENNLYPFIHLLPDGNLFVFANTRSIVFDYKTNRVVKEFPEIPGGDPRNYPSS  268

Query  1108  GSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             GSSV+ PLD  N    +VE+M+CGG+  G ++      F+    +CGR+ +S     W M
Sbjct  269   GSSVLFPLDETNDTNVQVEIMVCGGSPRGGFSRG----FVRATSTCGRLKLSDQNPSWEM  324

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MP PRVM DM++LPTG ++I+NG   G AGW     P ++P IY P       FSV+ 
Sbjct  325   ETMPLPRVMGDMLLLPTGDVIIVNGAGTGTAGWEKARDPVIQPLIYHP---FDHLFSVMS  381

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
                  RMYHSS  LLPDGRVL+ GSNP+  Y FTNV +PT+L L+A+ P Y+    D  R
Sbjct  382   TPMRPRMYHSSTVLLPDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLSFTSDPIR  441

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKL  1824
             PK +      +   V+ Y + F+V F + +    + L     +P FTTHS AMNQRM+ L
Sbjct  442   PKIL------TSDKVLSYKRLFNVDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVIL  495

Query  1825  RCTSMERGD-NGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             +  S+ R             P +   APPGYYM+ +V+ GIPS + WV+
Sbjct  496   KLLSVTRDQLTNSYRVSALGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQ  544



>ref|XP_009600286.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=554

 Score =   426 bits (1094),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 234/538 (43%), Positives = 313/538 (58%), Gaps = 19/538 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A +  G W  L+ N G+ AMHM L + + V+ +D+   G S   L       +C+ +  D
Sbjct  29    AYAAGGNWDLLISNIGISAMHMQLLNNDRVIIYDRTDFGASNISLPD----GKCRNNSND  84

Query  556   LS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
             L+    C AHSVEYDV  N++RPL   +D WCSSG+  S+G+++QTGG+ DG   ++ F 
Sbjct  85    LALKLDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGENVVRVFR  144

Query  733   PCVDK--TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS  906
             PC     TC+WK     L   RWYA+N ILP  + R II+GGR A  YEF P+  +    
Sbjct  145   PCNGNGSTCDWKEIGGGLIQSRWYATNHILP--DGRQIIIGGREAFNYEFYPKTASTNNV  202

Query  907   TDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEG  1086
               LPFL QT +     NNLYPF+ L+ DG LFIFAN  +ILFNY  N V K +P++PG  
Sbjct  203   FSLPFLQQTNDPREE-NNLYPFVFLNVDGNLFIFANDRAILFNYMANTVVKTYPQIPGGD  261

Query  1087  SRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISG  1263
              R+YPSTGS+++LPL + + +  + EV++CGG + G+Y  A  G F+  L +CGR+ I+ 
Sbjct  262   PRNYPSTGSAILLPLKNLQAQTIQAEVLVCGGTAKGSYLNASSGNFLGALNTCGRITITD  321

Query  1264  NKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVG  1443
                +W ME MP  R M DMVILP G +LIING   G AGW  G SP L P IY P     
Sbjct  322   PNPQWIMETMPLVRTMGDMVILPNGNVLIINGAAAGTAGWELGRSPVLSPVIYRPDNPSH  381

Query  1444  KRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMD  1623
              RF V  +  I RMYHS++ LL DGRVL+ GSNP+  Y FT V +PTEL L+ F P Y+D
Sbjct  382   SRFEVQNSNTIPRMYHSTSILLRDGRVLVGGSNPHALYNFTGVLYPTELSLETFSPSYLD  441

Query  1624  RRFDNQRPKNVSVYVEGSPAAV--VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSV  1797
                 N RP+ +      SPA+   V YG   ++RF +      + ++ +  SP F THS 
Sbjct  442   PESANSRPQII------SPASQRKVKYGGRVNIRFTVPGSVKRDLVKVTMVSPGFNTHSF  495

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              MNQRML L   ++ R            P S   AP GYY++ VV++GIPS   WV+ 
Sbjct  496   TMNQRMLVLFSGNVTRVGKSAYKINSVFPNSSNLAPAGYYLLFVVHQGIPSEGIWVRI  553



>ref|XP_002893079.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69338.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   424 bits (1091),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 244/556 (44%), Positives = 330/556 (59%), Gaps = 23/556 (4%)
 Frame = +1

Query  316   LFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGR  495
             LFL S++    L  +  VS AA  +G W+ +  N G+ AMHM L H + VV +D+   G 
Sbjct  12    LFLTSIQ----LLLTYHVSSAA--RGLWKYIAPNVGISAMHMQLLHNDRVVMYDRTNFGP  65

Query  496   SGYQLRRRFNGTRCKGSREDL-SDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSN  672
             S   L    NG  C+ +  D+ S   C AHS+EYDV  NT+RPL   S+TWCSSG++  +
Sbjct  66    SNISLP---NG-NCRDNPNDIVSKRDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPD  121

Query  673   GTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGG  852
             G ++QTGG RDG  + + F+PC +  C+W      L   RWYASN ILP  + + I++GG
Sbjct  122   GVLVQTGGDRDGELKARTFSPCDNNQCDWVEINNGLTKRRWYASNHILP--DGKQIVIGG  179

Query  853   RRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILF  1032
             +    YEF P+  N      LPFL +T+++    NNLYPF+ +++DG LFIFAN  +IL 
Sbjct  180   QAQFNYEFFPKTTN-PNVVALPFLAETHDQ-GQENNLYPFVFMNTDGNLFIFANNKAILL  237

Query  1033  NYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEA-  1206
             +Y KN V K FP +PG   R+YPSTGS+V+LPL +    Q + EV++CGGA  G+Y  A 
Sbjct  238   DYVKNTVVKTFPAIPGGDPRNYPSTGSAVLLPLKNLEADQIETEVLVCGGAPKGSYNLAF  297

Query  1207  KQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWG  1386
             ++  F+E L +C R+ I+    +W +ENMP  RVM DM++LP G +LIING   G A W 
Sbjct  298   RKKTFVEALDTCARIKINDANPQWTVENMPHARVMGDMILLPNGDVLIINGGSFGTAAWE  357

Query  1387  NGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFT  1566
              G  P L P +Y P   V  RF  LR T I RMYHS+A LL DGRVL+ GSNP+  Y FT
Sbjct  358   LGREPVLAPDLYHPENPVNSRFESLRPTTIPRMYHSAAILLRDGRVLVGGSNPHAFYNFT  417

Query  1567  NVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPS  1746
              V  PTEL L+AF P Y+ R F + RPK +S      P + + YG    ++F +  +  +
Sbjct  418   GVLFPTELSLEAFSPVYLQREFSDLRPKIIS----PKPQSTIKYGMNLKLKFTVTGEV-T  472

Query  1747  EDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMER-GDNGMVNavvaappspvaappGYYMV  1923
               ++ +   P FTTHS AMNQR+L L    + R G +      V  P S   A PGYYM+
Sbjct  473   TPVKVTLVFPTFTTHSFAMNQRVLVLDNVKLTRKGKSPTYEVQVRTPKSANIAWPGYYMI  532

Query  1924  TVVNEGIPSISRWVKF  1971
              VVN+ IPS   WV+ 
Sbjct  533   FVVNQNIPSEGVWVRL  548



>ref|XP_003544396.1| PREDICTED: uncharacterized protein LOC100791340 [Glycine max]
Length=551

 Score =   424 bits (1091),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 237/535 (44%), Positives = 325/535 (61%), Gaps = 18/535 (3%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W+ L ++ G+VAMHM L H +TVV FD+   G S   L    +G     + E      
Sbjct  26    GHWKVLQQSIGIVAMHMQLLHTDTVVIFDRTDFGLSNLSLP---DGLCRHDAAEMAVKTD  82

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC--VD  744
             C AHS+EYDV +NT RPL   ++ WCSS ++ S+GT++QTGG+ DG K+++ F+PC    
Sbjct  83    CTAHSLEYDVSSNTFRPLFLQTNVWCSSASVASDGTLIQTGGFNDGEKKVRTFSPCPTTA  142

Query  745   KTCNW-KPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST-DLP  918
              TC+W +     L   RWY++N +LP  + R II+GGRR   YEF P+     K+   LP
Sbjct  143   ATCDWLELPSDTLSARRWYSTNHLLP--DGRQIIIGGRRQFNYEFFPKTHTRAKNAYSLP  200

Query  919   FLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSY  1098
             FL QT + +   NNLYPF+ L+ D  LFIFAN  +ILF++ KN V + FP +P    R Y
Sbjct  201   FLVQTNDPHEE-NNLYPFVFLNVDSTLFIFANNRAILFDFTKNAVVRTFPTVPHGDPRCY  259

Query  1099  PSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             PSTGS+V+LPL  +N + + EV++CGGA  G+Y EAK+G F+  L +C R+ I+    KW
Sbjct  260   PSTGSAVLLPL--RNPYSEAEVLVCGGAPRGSYNEAKKGNFLGALNTCARIKITDPDPKW  317

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              +E MP  RVM DM++LP G +LIING   G AGW     P L P +Y+P K+ G RF +
Sbjct  318   VIETMPKARVMGDMILLPNGNVLIINGAGSGSAGWEFARDPVLNPVVYNPDKSTGSRFEI  377

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             L  +   RMYHS+A LL DGRVL+AGSNP+ GY F+NV  PTEL ++AF P Y++  +D+
Sbjct  378   LVESNTPRMYHSTAILLRDGRVLVAGSNPHIGYNFSNVMFPTELSVEAFYPPYLESGYDD  437

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDL-EFSAYSPPFTTHSVAMNQRM  1815
              RP+   V+ E      V YG++  VR  +        L   +  +PPF THS +MNQRM
Sbjct  438   VRPR--IVFPESEARTKVTYGEKVKVRVQVAGGSLVRSLVRVTVSAPPFNTHSFSMNQRM  495

Query  1816  LKLR---CTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             L L     T++  G        V  P SPV APPGYY++ VV++ IPS   W++ 
Sbjct  496   LVLEPINVTNIVGGPTPTYEIEVTTPGSPVLAPPGYYLLFVVHQEIPSQGIWIQI  550



>ref|XP_006849170.1| hypothetical protein AMTR_s00027p00175370 [Amborella trichopoda]
 gb|ERN10751.1| hypothetical protein AMTR_s00027p00175370 [Amborella trichopoda]
Length=560

 Score =   425 bits (1092),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 244/543 (45%), Positives = 330/543 (61%), Gaps = 24/543 (4%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             V   ASG G+W+ L  + G+ AMHMAL   N V+ FD+   G S   L    NG RC+  
Sbjct  33    VLALASGGGQWKLLKRSIGISAMHMALLPNNRVIMFDRTDFGPSNVSLP---NG-RCRKD  88

Query  547   REDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
             R D +    C+AHSVE + + + +RPL  ++DTWCSSG +  +G ++QTGG  DG + ++
Sbjct  89    RHDRALQTDCWAHSVELNWVTHGVRPLTILTDTWCSSGALAPDGHLIQTGGSNDGERVVR  148

Query  724   FFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF-PNMQ  900
              F+PC   TC+W      L   RWYASNQILP  + R+I+VGGR    YEFVP+  P+  
Sbjct  149   TFSPCA--TCDWAELPDGLAMPRWYASNQILP--DGRIIVVGGRGQFNYEFVPKTDPSEH  204

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
                 L FL +T  R+   NNLYPFLHL  DG LF+FAN  +I  +Y  +RV + FP +PG
Sbjct  205   SMYPLEFLSET--RDDCENNLYPFLHLLPDGTLFLFANTKAISLDYITHRVVRTFPALPG  262

Query  1081  EGSRSYPSTGSSVMLPLDHK-NRFQKV--EVMICGGASAGAYTEAKQGRFIEGLKSCGRM  1251
             E SR+YPSTGSS MLPL    N  Q V  EV++CGGA + +  +A +G F+   ++CGR+
Sbjct  263   E-SRNYPSTGSSTMLPLILAVNSTQPVDAEVLVCGGAPSHSNFQANKGVFLPASRTCGRI  321

Query  1252  VISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG  1431
               +    +W++E MP  RVM DMV+LPTG+ILIING  +G AGWG G  P L P +Y P 
Sbjct  322   KATDESPEWSIETMPLKRVMGDMVMLPTGEILIINGAGKGTAGWGVGRDPVLCPVLYKPD  381

Query  1432  KTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVP  1611
               +G RF VL  +   R+YHSSA LL DGRVL+ GSNPN GY F+ V  PTEL L+ F P
Sbjct  382   APIGHRFEVLSPSSTPRLYHSSAQLLSDGRVLVGGSNPNRGYNFSGVLFPTELSLEFFSP  441

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPS--EDLEFSAYSPPFT  1785
              Y+  ++   RPK  S+     P   + Y + F++ F+  K+     +++  +  +P FT
Sbjct  442   PYIKLKW--SRPKITSL----KPGRTMSYTQHFYINFYSRKQSTKGVDEILVTMVAPSFT  495

Query  1786  THSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
             THSV+MNQR+L LR   +E G +G        P S V APPGYY++ +V+ G PS   WV
Sbjct  496   THSVSMNQRLLVLRVMGLEGGHDGAYRVECVPPVSAVLAPPGYYLLFLVHGGSPSRGVWV  555

Query  1966  KFA  1974
             +  
Sbjct  556   RLG  558



>ref|XP_009119411.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=552

 Score =   424 bits (1090),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 231/531 (44%), Positives = 317/531 (60%), Gaps = 23/531 (4%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RW+ L+ + G+ AMHM L H   V+ FD+   G S   L     G  C+    D +    
Sbjct  37    RWEVLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNLSLP----GGMCRFDPSDTAVKFD  92

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDK  747
             C AHSV YDV++NT R L+  +DTWCSSG++L NGT++QTGGY DG +  + F PC   +
Sbjct  93    CSAHSVLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFTPCGYSE  152

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ--KSTDLPF  921
             TC+W    ++L   RWYA+NQILP  + R+I+VGGRR   +E  PR P+    + +   F
Sbjct  153   TCDWIEFPQYLAQRRWYATNQILP--DGRIIVVGGRRQFNFEIFPR-PDSHGYRGSRFDF  209

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T +  +  NNLYPFL+L  DG LF+FAN  SI+F+Y++NR+ ++FP +P    R+YP
Sbjct  210   LRETTD-GSSENNLYPFLYLLPDGNLFVFANTRSIVFDYKRNRIVREFPEIPDGDPRNYP  268

Query  1102  STGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAK-QGRFIEGLKSCGRMVISGNKHKW  1278
             S+GSS++ PLD      + E+M+CGGA   A+  AK Q  F     +CGR+ ++     W
Sbjct  269   SSGSSILFPLDESKNIMEAEIMVCGGAPKDAFPRAKSQQGFTRATSTCGRLRLTSPNPIW  328

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              ME MP PRVM DM++LPTG I+I+NG   G AGW N   P   P IY P      RFS+
Sbjct  329   EMETMPLPRVMGDMLLLPTGDIIIVNGAGAGTAGWENARDPVTRPVIYHP---FDHRFSI  385

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             +  +   RMYHSSA LLPDGRVL+ GSNP+  Y FTNV +PTEL L+A+ P Y+    D+
Sbjct  386   MSTSSCPRMYHSSAVLLPDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPYLSFTSDS  445

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP  +      +   V+ Y + F+V F + +    + L     +P FTTHS AMNQRM+
Sbjct  446   IRPHIL------TNDKVISYKRLFNVHFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQRMV  499

Query  1819  KLRCTSMERGD-NGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              L+  S+   D        V  P +   APPGYYM+ +V+ GIPS   WV+
Sbjct  500   ILKLLSVTHEDLTNSYKLDVLGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQ  550



>emb|CDX81637.1| BnaC08g39640D [Brassica napus]
Length=558

 Score =   424 bits (1089),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 241/535 (45%), Positives = 327/535 (61%), Gaps = 25/535 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             GRW  L  + G+ AMHM L H N VV FD+   G S   L  +     C+ +    +   
Sbjct  39    GRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQ----TCRNA----TVFD  90

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS+ YDV +NT RPL   SDTWCSSG++ ++G+++QTGGY  G + ++ F PC   +
Sbjct  91    CSAHSLLYDVASNTFRPLTLRSDTWCSSGSLNASGSLIQTGGYGVGERVVRIFTPCDGVS  150

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W   + +L   RWY++NQILP  + R+IIVGGRRA TYEF P+ P  +    L FL +
Sbjct  151   CDWVENRAYLSSRRWYSTNQILP--DGRIIIVGGRRAFTYEFYPKNPG-KSVFILRFLAE  207

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T + N   NNLYPFLHL  DG LFIFANR SILF++  +R+ K+FP +PG   R+YPSTG
Sbjct  208   TRDPNE-ENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPGGDKRNYPSTG  266

Query  1111  SSVMLPLD---HKNRFQ-KVEVMICGGASAGAYTEAKQ---GRFIEGLKSCGRMVISGNK  1269
             SSV+LPL      NR +   EVM+CGGA  GA+ +A +     F+   ++CGR+ ++   
Sbjct  267   SSVLLPLSLTGENNRSKIAAEVMVCGGAPHGAFLKAARTIPKIFVGASRTCGRLKVTDPN  326

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGK  1446
               W ME MP PRVM DM++LP G +LIING   G AGW +     L P +Y PG+    +
Sbjct  327   PSWVMEQMPAPRVMPDMLLLPNGDVLIINGASNGTAGWEDATKAVLNPILYLPGEPDPTR  386

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF +L  T+I RMYHS++ LL DGRVLI GSNP+  Y FT   +PTEL L+A++P Y+D 
Sbjct  387   RFEILAPTRIPRMYHSASLLLADGRVLIGGSNPHRNYNFTARHYPTELSLEAYLPRYLDP  446

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSED-LEFSAYSPPFTTHSVAM  1803
             ++   RP  V+V + G+    + YGK F V F +      +  +     +P F+THS AM
Sbjct  447   QYSGVRPSIVTVELAGN----MLYGKSFAVTFVIPAFGMFDGRVSVRLVAPSFSTHSTAM  502

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             NQRML LR   + +       A V  P +   APPGYYM+ +V+ G PS++ WVK
Sbjct  503   NQRMLVLRVRRVVQLSVFAYKADVDGPTNSYVAPPGYYMMFMVHRGTPSVAIWVK  557



>ref|XP_011074991.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=544

 Score =   423 bits (1087),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 234/543 (43%), Positives = 316/543 (58%), Gaps = 24/543 (4%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             +++ AASG  RW  L+ N G+ AMHM L + + VV FD+   G S   L           
Sbjct  20    VLTRAASG--RWDFLLSNIGISAMHMQLLYTDRVVIFDRTDFGVSNISLP-------AGN  70

Query  544   SREDLSDPS----CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGS  711
              R D SD +    C AHSVEYDV  N+IRPL  ++DTWCSSG ++ +GT++QTGGY DG 
Sbjct  71    CRNDPSDTALVNDCTAHSVEYDVATNSIRPLMVLTDTWCSSGAVMPDGTLVQTGGYNDGD  130

Query  712   KRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP  891
               ++ + PC + +C+W+     L   RWYA+N ILP  + R I++GGRR   YEF P+  
Sbjct  131   HAVRLYKPCTNNSCDWREINPGLTQRRWYATNHILP--DGRAIVIGGRRQHNYEFYPKTS  188

Query  892   NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPR  1071
                 S  L FL +T +     NNLYPF+ L+ DG LFIFAN  +ILF+Y K  V + +P 
Sbjct  189   PGDTSYKLDFLVETKDPKIE-NNLYPFVFLNVDGNLFIFANNRAILFDYVKGTVVRTYPT  247

Query  1072  MPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRM  1251
             +PG   RSYPSTGS+V+LPL   +     EV++CGGA  GAY  A  G F+  L +C R+
Sbjct  248   IPGGDPRSYPSTGSAVLLPL--TDNAGSAEVLVCGGAPNGAYLSAMNGSFVTALDTCARI  305

Query  1252  VISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG  1431
              I+    +W +E MP PRVM DMV+LP G +LIING   G AGW  G +P L P IY P 
Sbjct  306   RINEPNPEWILETMPMPRVMGDMVLLPNGNVLIINGAGSGAAGWELGRNPVLAPVIYRPN  365

Query  1432  KTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVP  1611
                G RF V  ++ I RMYHS+A LL DGRVL+ GSNP+  Y FT V  PT+L L+AF P
Sbjct  366   NPFGSRFEVQSSSTIPRMYHSTALLLRDGRVLVGGSNPHTHYNFTGVLFPTDLTLEAFCP  425

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRF-WLDKKWPSEDLEFSAYSPPFTT  1788
              Y+D  F N  P+ VS   +      + Y ++  V F + D       +  +  +P FTT
Sbjct  426   SYLDPNFKNLGPRIVSPTAQTK----IGYNQQLTVLFTFPDNLNRDASIMVTMVAPAFTT  481

Query  1789  HSVAMNQRMLKLRCTSMERGDN-GMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
             HS +MNQR++ L   ++   D        V  P S   A PG+Y++ VV++ +PS   WV
Sbjct  482   HSCSMNQRLIVLSGGNVTAADGRSTYQIRVMTPSSGNIAQPGFYLLFVVHQDVPSEGIWV  541

Query  1966  KFA  1974
             + +
Sbjct  542   QIS  544



>ref|XP_011092656.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   423 bits (1088),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 239/548 (44%), Positives = 324/548 (59%), Gaps = 27/548 (5%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             +++ AA G G+W  ++ N GV AMHM L + + VV FD+   G S   L       +C+ 
Sbjct  29    ILTLAAPGGGKWNLVLSNIGVSAMHMQLLNTDRVVIFDRTDFGPSNISLPNN----QCRN  84

Query  544   SREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
                DL+    C AHSVEYDV +N+IRPL  ++D WCSSG+ + +G++MQTGG+ DG + +
Sbjct  85    DPNDLTLKVDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDRNV  144

Query  721   QFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
             + + PC D +C+W+     L   RWYA+N ILP  + R IIVGGR    YEF P+     
Sbjct  145   RVYKPCSDDSCDWQEFDVALRQRRWYATNHILP--DGRQIIVGGRGQFGYEFYPKKTGAD  202

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
             +S +LPFL QT +     NNLYPF+ L++DG LFIFAN  +ILF+Y    V + +P +PG
Sbjct  203   QSYNLPFLSQTNDPRIE-NNLYPFVFLNTDGNLFIFANNRAILFDYVNGLVVRNYPTIPG  261

Query  1081  EGSRSYPSTGSSVMLPLDHKNRFQKV--EVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
                RSYPS+GS+V+LPL        V  EV++CGGA  G++T A  G F+  L +C R+ 
Sbjct  262   GDPRSYPSSGSAVLLPLRDLQGGANVTAEVLVCGGAPKGSFTSANNGNFVGALNTCWRIR  321

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             IS    +W ME MP  RVM DMV+LP G ILIING   G AGW  G +P L P IY P  
Sbjct  322   ISDPNPQWVMETMPLARVMGDMVLLPNGNILIINGASSGTAGWDLGRNPVLTPVIYRPNN  381

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
              VG RF    ++ I RMYHS+A LL DGR+L++GSNP+  Y FT V  PT+L ++AF PD
Sbjct  382   PVGLRFEAQNSSTIPRMYHSTAILLRDGRILVSGSNPHAYYNFTGVVFPTDLTMEAFSPD  441

Query  1615  YMDRRFDNQRPKNVSVYVEGSPA--AVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTT  1788
             Y+D      RP  V      SPA  + + YG++  + F    +     +  +  +PPFTT
Sbjct  442   YLDPHLIRVRPMIV------SPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTT  495

Query  1789  HSVAMNQRMLKLRCTSMER-------GDNGMVNavvaappspvaappGYYMVTVVNEGIP  1947
             HS +MNQR+L L  ++          G N  V   V  P S + APPGYY++ VV   +P
Sbjct  496   HSFSMNQRLLVLTNSTGISASVISLGGSNYQV--RVMTPGSNILAPPGYYLLFVVYREVP  553

Query  1948  SISRWVKF  1971
             S   WV+ 
Sbjct  554   SQGIWVQI  561



>ref|XP_003589379.1| Galactose oxidase [Medicago truncatula]
 gb|AES59630.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=543

 Score =   422 bits (1086),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 232/533 (44%), Positives = 320/533 (60%), Gaps = 16/533 (3%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
              A+G G+WQ L ++ G+VAMHM L H + +V FD+   G S   L    NG      RE 
Sbjct  25    VAAGNGQWQVLQKSIGIVAMHMQLLHNDRIVIFDRTDFGLSKLPLP---NGKCRHDPRET  81

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
                  C AHSVEY++ +NT RPL   +D WCSSG++   GT++QTGGY DG + I+ F  
Sbjct  82    TVKTDCTAHSVEYNIKSNTFRPLFVQTDVWCSSGSVNPKGTLVQTGGYNDGDRTIRMFDT  141

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
             C    C+W+     L   RWYA+N ILP  + R II+GGR+   YEF P+  N      L
Sbjct  142   C--NNCDWQEFDGGLAARRWYATNHILP--DGRQIIIGGRKQFNYEFYPK--NNIGVYRL  195

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             PFL QT +  A  NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V + FP++PG   RS
Sbjct  196   PFLEQTNDAGAE-NNLYPFVILNVDGNLFIFANNRAILFDYTKNVVVRTFPQIPGGDPRS  254

Query  1096  YPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             YPS+GS V+LPL + +++F + EV+ICGGA  G+Y +A +  F+  L +C R+ I+    
Sbjct  255   YPSSGSGVLLPLKNLQSKFIEAEVLICGGAPKGSYQKASKREFLGALNTCARIKITDPNP  314

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
              W +E MP  RVM DMV+LP G +LIING   G AGW  G  P L P +Y     +G RF
Sbjct  315   TWVVETMPRARVMGDMVMLPNGDVLIINGAGSGTAGWEYGRDPVLNPVLYKTNNPIGARF  374

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
              +   +   RMYHS+A L+ DGRVL+ GSNP+ GY F NV  PTEL ++AF P Y++ RF
Sbjct  375   ELQNPSHTPRMYHSTAILVRDGRVLVGGSNPHIGYNFNNVLFPTELSIEAFSPSYLEPRF  434

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
              N RP+ V+     S + +  +G++  +RF +        +  +  +PPF THS +MNQR
Sbjct  435   ANVRPRIVA-----STSELQKHGQKLGLRFQVKAALDKNLVYVTMLAPPFNTHSFSMNQR  489

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             +L L    +   +    +  V  P SP+ APPG+Y++ VV++ IPS   W++ 
Sbjct  490   LLVLESNKVNIVEGTTYDVQVTMPGSPILAPPGFYLLFVVHKEIPSEGIWIQI  542



>ref|NP_173419.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAL24259.1| At1g19900/F6F9_4 [Arabidopsis thaliana]
 gb|AEE29911.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=548

 Score =   422 bits (1086),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 235/535 (44%), Positives = 323/535 (60%), Gaps = 16/535 (3%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             +++ +G W+ +  N G+ AMHM L H + VV +D+   G S   L    NG  C+ + +D
Sbjct  26    SSAARGLWKYIAPNVGISAMHMQLLHNDRVVMYDRTNFGPSNISLP---NGN-CRDNPQD  81

Query  556   -LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
              +S   C AHS+EYDV  NTIRPL   S+TWCSSG++  +G ++QTGG RDG  + + F+
Sbjct  82    AVSKIDCTAHSIEYDVATNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKTRTFS  141

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC +  C+W      L   RWYASN ILP  + + I++GG+    YEF P+  N      
Sbjct  142   PCNNNQCDWVEMNNGLKKRRWYASNHILP--DGKQIVMGGQGQFNYEFFPKTTN-PNVVA  198

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPFL +T+++    NNLYPF+ +++DG LF+FAN  +IL +Y KN V K FP +PG   R
Sbjct  199   LPFLAETHDQ-GQENNLYPFVFMNTDGNLFMFANNRAILLDYVKNTVVKTFPAIPGGDPR  257

Query  1093  SYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNK  1269
             +YPSTGS+V+LPL + +    + EV++CGGA  G+Y  A++  F++ L +C R+ I+  K
Sbjct  258   NYPSTGSAVLLPLKNLEADNVETEVLVCGGAPKGSYNLARKKTFVKALDTCARIKINDAK  317

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
              +W +E MP  RVM DM+ LP G +L+ING   G A W  G +P L P +Y P   VG R
Sbjct  318   PEWAVEKMPHARVMGDMIPLPNGDVLLINGGSFGTAAWELGRTPVLAPDLYHPENPVGSR  377

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             F  LR T I RMYHS+A LL DGRVL+ GSNP+  Y +T V  PTEL L+AF P Y+ R 
Sbjct  378   FESLRPTTIPRMYHSAAILLRDGRVLVGGSNPHAFYNYTGVLFPTELSLEAFSPVYLQRE  437

Query  1630  FDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQ  1809
             F N RPK +S      P +++ YG    ++F +  +  +   + +   P FTTHS AMNQ
Sbjct  438   FSNLRPKIIS----PEPQSMIKYGTNLKLKFSVTGEV-TTPAKVTMVFPTFTTHSFAMNQ  492

Query  1810  RMLKLRCTSMER-GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             R+L L      R G + M    V  P S   A PGYYM+ VVN+ IPS   WVK 
Sbjct  493   RVLVLDNVKFTRKGKSPMYEVQVRTPRSANIAWPGYYMIFVVNQDIPSEGVWVKL  547



>ref|XP_009797022.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score =   422 bits (1086),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 235/559 (42%), Positives = 330/559 (59%), Gaps = 20/559 (4%)
 Frame = +1

Query  310   LVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGS  489
             + LF +  +    L  S   + A +  G+WQ LM N G+ AMH+ L + + V+ +D+   
Sbjct  7     VFLFFILWQLPLFLLLSCQSNLAYAAGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDF  66

Query  490   GRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTIL  666
             G S   L       +C+ +  DL+    C AHSVEYDV  N++RPL   +D WCSSG++ 
Sbjct  67    GPSNISLP----DGKCRNNPNDLALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVN  122

Query  667   SNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIV  846
             S+G+++QTGG+ DG   ++   PC   TC+W+    +L   RWY++N ILP  + R II+
Sbjct  123   SDGSLVQTGGFNDGEHMVRVVKPC--STCDWQEMGNNLIQSRWYSTNHILP--DGRQIII  178

Query  847   GGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSI  1026
             GGR+A  YEF P+  +      LPFL QT       NNL+PF+ L+ DG LFIFAN  +I
Sbjct  179   GGRKAFNYEFYPKTASTSNVFSLPFLQQTNNPREE-NNLFPFVFLNVDGNLFIFANDRAI  237

Query  1027  LFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTE  1203
             L +Y+ N V K FP++PG   R+YPS+GS+V+LPL + +++  + EV++CGGA  G+Y +
Sbjct  238   LLDYKTNTVVKTFPQIPGGDPRNYPSSGSAVLLPLKNLRSQTVQAEVLVCGGAPRGSYPK  297

Query  1204  AKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGW  1383
             A +G F+  L +CGR+ I+    +W ME MP  R M DMVILP G +LIING   G AGW
Sbjct  298   ADKGEFLGALNTCGRITITDPNPQWTMETMPLARTMGDMVILPNGNVLIINGAASGTAGW  357

Query  1384  GNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVF  1563
                 +P L P IY P      RF V     I RMYHS+A LL DGRVL+ GSNPN+ Y F
Sbjct  358   QIARNPVLSPVIYRPDNPSDSRFEVQNPNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNF  417

Query  1564  TNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVD--YGKEFHVRFWLDKK  1737
             T V  PT+L L+AF P Y+D+   N RP+ +      SPA+ +   YG+   +RF     
Sbjct  418   TGVLFPTDLSLEAFSPSYLDQESANLRPRII------SPASHLKYTYGQRVDIRFTASGL  471

Query  1738  WPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMV-NavvaappspvaappGY  1914
               ++ ++ +  +P F THS  MNQRML L  + M R     V       P S + APPGY
Sbjct  472   LNTDLVKVTMVAPGFNTHSFTMNQRMLVLPRSGMVRQVGRFVYQISCVFPKSGIFAPPGY  531

Query  1915  YMVTVVNEGIPSISRWVKF  1971
             Y++ VV++ IPS + WV+ 
Sbjct  532   YLLFVVHQDIPSEAIWVRI  550



>ref|XP_009603236.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=564

 Score =   423 bits (1088),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 231/537 (43%), Positives = 327/537 (61%), Gaps = 20/537 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A +  G+WQ LM N G+ AMH+ L + + V+ +D+   G S   L    NG +C+ +  D
Sbjct  42    AYAAGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGASNISLP---NG-KCRNNPND  97

Query  556   LS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
             L+    C AHSVEYDV  N++RPL   +D WCSSG++ S+G+++QTGG+ DG + ++   
Sbjct  98    LALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGERMVRVVK  157

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC   TC+W+    +L   RWY++N ILP  + R II+GGR+A  YEF P+  +     +
Sbjct  158   PC--STCDWQEMGSNLIQSRWYSTNHILP--DGRQIIIGGRKAFNYEFYPKTASTNNVFN  213

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPFL QT       NNL+PF+ L+ DG LFIFAN  +ILF+Y+ N+V K +P++PG   R
Sbjct  214   LPFLQQTNNPREE-NNLFPFVFLNVDGNLFIFANDRAILFDYKTNKVVKTYPQIPGGDPR  272

Query  1093  SYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNK  1269
             +YPS+GS+V+LPL + +++  + EV++CGGA  G+Y +A +G F+  L +CGR+ I+   
Sbjct  273   NYPSSGSAVLLPLKNLRSQTVQAEVLVCGGAPRGSYPKADKGEFLGALNTCGRITITDPN  332

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
              +W +E MP  R M DMVILP G +LIING   G AGW    +P L P IY P      R
Sbjct  333   PQWTIETMPLARTMGDMVILPNGNVLIINGAASGTAGWQIARNPVLSPVIYRPDNPSDSR  392

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             F V     I RMYHS+A LL DGRVL+ GSNPN+ Y FT V  PT+L L+AF P Y+D  
Sbjct  393   FEVQNPNVIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVLFPTDLSLEAFSPSYLDPE  452

Query  1630  FDNQRPKNVSVYVEGSPAAVVD--YGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
               N RP+ +      SPA+ +   YG+   +RF   +    + ++ +  +P F THS  M
Sbjct  453   SANLRPRII------SPASHLKFTYGQRVDIRFTASRLLNRDLVKVTMVAPGFNTHSFTM  506

Query  1804  NQRMLKLRCTSMERGDNGMV-NavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             NQRML L  + + R     V       P S + APPGYY++ VV++ IPS + WV+ 
Sbjct  507   NQRMLVLPRSGIVRQVGRFVYQISCVFPKSAIFAPPGYYLLFVVHQDIPSEAIWVRI  563



>emb|CDY44816.1| BnaCnng11720D [Brassica napus]
Length=552

 Score =   422 bits (1086),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 230/531 (43%), Positives = 316/531 (60%), Gaps = 23/531 (4%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RW+ L+ + G+ AMHM L H   V+ FD+   G S   L     G  C+    D +    
Sbjct  37    RWEVLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNLSL----PGGMCRFDPSDTAVKFD  92

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC-VDK  747
             C AHSV YD+++NT R L+  +DTWCSSG++L NGT++QTGGY DG +  + F PC   +
Sbjct  93    CSAHSVLYDIVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFTPCGYSE  152

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ--KSTDLPF  921
             TC+W    ++L   RWYA+NQILP  + R+I+VGGRR   +E  PR P+    + +   F
Sbjct  153   TCDWIEFPQYLAQRRWYATNQILP--DGRIIVVGGRRQFNFEIFPR-PDSHGYRGSRFDF  209

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T +  +  NNLYPFL+L  DG LF+FAN  SI+F+Y+ NR+ ++FP +PG   R+YP
Sbjct  210   LRETTD-GSSENNLYPFLYLLPDGNLFVFANTRSIVFDYKMNRIVREFPEIPGGDPRNYP  268

Query  1102  STGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAK-QGRFIEGLKSCGRMVISGNKHKW  1278
             S+GSS++ PLD      + E+M+CGGA   A+  AK Q  F     +CGR+ ++     W
Sbjct  269   SSGSSILFPLDESKNIMEAEIMVCGGAPKDAFPRAKSQQGFRRATSTCGRLRLTSLNPIW  328

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              ME MP PRVM DM++LPTG I+I+NG   G AGW N   P   P IY P     +RFS+
Sbjct  329   EMETMPLPRVMGDMLLLPTGDIIIVNGAGAGTAGWENARDPVTRPVIYHP---FDRRFSI  385

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             +  +   RMYHSSA LLPDGRVL+ GSNP+  Y FTNV +PTEL L+A+ P Y+    D+
Sbjct  386   MSTSSRPRMYHSSAVLLPDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPYLSFTSDS  445

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP  +      +   V+ Y + F+V F +      + L     +P FTTHS AMNQRM+
Sbjct  446   IRPHIL------TNDKVISYKRLFNVHFSIPLFLTIDLLSVRIVAPSFTTHSFAMNQRMV  499

Query  1819  KLRCTSMERGD-NGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              L+  S+   D           P +   APPGYYM+ +V+ GIPS   WV+
Sbjct  500   ILKLLSVTHEDLTNSYKLDALGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQ  550



>ref|XP_006849171.1| hypothetical protein AMTR_s00027p00177380 [Amborella trichopoda]
 gb|ERN10752.1| hypothetical protein AMTR_s00027p00177380 [Amborella trichopoda]
Length=557

 Score =   422 bits (1086),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 240/575 (42%), Positives = 340/575 (59%), Gaps = 31/575 (5%)
 Frame = +1

Query  268   HQLRTTLPCAITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMAL  447
             H  +T L  A  + L L ++    C  L+        ASG G W+ +  + G+ AMHMAL
Sbjct  6     HSKKTRLAMATLSPLALAMLIFAACCVLSL-------ASGGGEWKLMKRSIGISAMHMAL  58

Query  448   THRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPL  624
                + V+ FD+   G S   L +     RC+    D +    C+AHSVE D++ + +R L
Sbjct  59    LPNDRVIIFDRTDFGPSNVSLPK----GRCRKDPHDQALQTDCWAHSVELDLVTHAVRSL  114

Query  625   RFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYAS  804
                +DTWCSSG +  +G ++QTGG+ DG + ++ F+PC D  C+W      L   RWYAS
Sbjct  115   TLQTDTWCSSGALAPDGHLIQTGGFNDGERVVRTFSPCSD--CDWAETPDGLAVRRWYAS  172

Query  805   NQILPGKNDRVIIVGGRRASTYEFVPRF-PNMQKSTDLPFLHQTYERNAGGNNLYPFLHL  981
             NQILP  + R+I+VGGR+  +YEFVP+  P+ Q +  L FL +T  R+   NNLYPF+HL
Sbjct  173   NQILP--DGRIIVVGGRKEFSYEFVPKTDPSEQCTYPLDFLSET--RDECENNLYPFVHL  228

Query  982   SSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHK-NRFQKV  1158
               DG LF+F+N  +I  +Y  +RV + FP + GE SR+YPSTGSS MLPL    N  Q V
Sbjct  229   LPDGTLFLFSNTKAISLDYMTHRVVRTFPALSGE-SRNYPSTGSSAMLPLILAVNSTQPV  287

Query  1159  --EVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILP  1332
               EV++CGGA + +  +A +G F+   ++CGR+  + +  +W++E MP  RVM DM++LP
Sbjct  288   DAEVLVCGGAPSHSNFQANKGLFLPASRTCGRIKATDDSPEWSIEAMPLNRVMGDMIMLP  347

Query  1333  TGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLP  1512
             TG++LIING ++G AGWG G  P L P +Y P + +G RF VL    I R+YHSSA LLP
Sbjct  348   TGEVLIINGARKGTAGWGVGRDPVLSPVLYKPDEPIGHRFEVLSPASIPRLYHSSAHLLP  407

Query  1513  DGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVV  1692
             DGRVL+ GSNPN  Y F+ V  PTEL L  F P YM  +  + RP+  S+     P   +
Sbjct  408   DGRVLVGGSNPNMRYNFSGVLFPTELSLDIFSPPYM--KLKSSRPRITSI----KPGRTL  461

Query  1693  DYGKEFHVRFWLDKKWPS--EDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVN  1866
              Y + F +   + +K     + +  +  +P FTTHSV+MNQR+L L    ++ G +G   
Sbjct  462   SYSQHFFINIEMKEKAIKGVDTILVTMVAPSFTTHSVSMNQRLLVLTVMGLKGGHDGSYR  521

Query  1867  avvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
                  P S V APPGYY++ +V+ G PS   WV+ 
Sbjct  522   VECVPPGSAVLAPPGYYLLYLVHGGSPSRGVWVRL  556



>ref|XP_007209012.1| hypothetical protein PRUPE_ppa023406mg [Prunus persica]
 gb|EMJ10211.1| hypothetical protein PRUPE_ppa023406mg [Prunus persica]
Length=533

 Score =   421 bits (1083),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 235/536 (44%), Positives = 316/536 (59%), Gaps = 22/536 (4%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP  567
             Q +W+ L  + GV AMHMAL   + V+ FD+  +G S   L +         S  + +D 
Sbjct  9     QSKWKLLKRSIGVSAMHMALLPNDKVIIFDRTDAGPSNLSLPQENCARVHHQSAHEATD-  67

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              CYAHSVE++  N   RPL   +DTWCSSG +  +G ++Q+GGY DG K +++F PC+D 
Sbjct  68    -CYAHSVEFNPANRDFRPLTISTDTWCSSGALSQDGVLIQSGGYDDGYKVVRYFKPCLD-  125

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP-NMQKSTDLPFL  924
              C+W   +  L   RWYASNQ+LP  + R+I+VGGR    YEF+P+   N +K   LPFL
Sbjct  126   -CDWIEEQNGLIVPRWYASNQVLP--DGRIIVVGGRFQFNYEFIPKTSTNDKKLYQLPFL  182

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              +T       NNLYPFLHLS+DG LFIFAN  +ILF+Y  N+V  KFP MPG  SR+YPS
Sbjct  183   EETMHLPKVPNNLYPFLHLSTDGNLFIFANDRAILFDYVHNKVVTKFPVMPGGVSRNYPS  242

Query  1105  TGSSVMLPLD--HKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             TGSS +LP+     N    VEV++CGG    +  +A  G ++   KSCGR++I+     W
Sbjct  243   TGSSALLPISLVGNNSSPSVEVLVCGGTFPDSNVKANAGIYMPASKSCGRLIITEKNPNW  302

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              ME MP  RVM DM++LPTG +LIING   G AGW     P L P +Y P      RF +
Sbjct  303   EMEEMPINRVMGDMILLPTGDVLIINGAASGTAGWAVAREPVLNPVLYKPNHEKTGRFEL  362

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             +  T I R+YHS+A LL DGRVL+ GSNPN  Y FT + +PTEL L+AF P Y+      
Sbjct  363   MNPTTIPRLYHSTAHLLSDGRVLVGGSNPNVNYNFTTL-YPTELSLEAFYPPYLSTS-SK  420

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP   S+     P   + Y ++F++ F     +  + +  +  +P FTTHS AMNQR+L
Sbjct  421   SRPSINSI----KPGVDLTYLQKFYLGF--KTNYVPDKIYVTMVAPSFTTHSFAMNQRVL  474

Query  1819  KLRCTSMER-----GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              L  + + +     G  G +N    AP  P  APPGYY++ VV +GIPS   WV+ 
Sbjct  475   VLDFSQVGKNGNLSGSKGYINLEGFAPARPELAPPGYYLLFVVCDGIPSRGMWVRI  530



>ref|XP_004238618.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=553

 Score =   422 bits (1084),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 231/540 (43%), Positives = 322/540 (60%), Gaps = 19/540 (4%)
 Frame = +1

Query  370   SEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSR  549
             S  A+  G+W  LM N G+ +MHM L + + V+ +D+   G S   L    NG +C+ + 
Sbjct  27    SAYAAAGGKWDLLMSNIGISSMHMQLLNNDRVIMYDRTDFGASNISLP---NG-KCRNNT  82

Query  550   EDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQF  726
              DL+    C AHSVEYDV  N+IRPL   +D WCSSG+  S+GT++QTGG+ DG K ++ 
Sbjct  83    NDLALKIDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGEKVVRV  142

Query  727   FAPCVDKT--CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
               PC      C+W+  +  L   RWYA+N +LP  + R II+GGR A  YEF P+  +  
Sbjct  143   LKPCNGNKSRCDWREIESALIQSRWYATNHVLP--DGRQIIIGGREAFNYEFYPKTLSTN  200

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
                +L FL QT +     NNLYPF+ L+ DG LFIFAN  +ILF+Y  + + K +P++PG
Sbjct  201   NIFNLTFLQQTNDPREE-NNLYPFVFLNVDGNLFIFANNRAILFDYTSDTIVKTYPQIPG  259

Query  1081  EGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVI  1257
                R+YPSTGS+V+LPL + + +  + EV++CGG   G++  A++G+F+  L +CGR+ I
Sbjct  260   GDPRNYPSTGSAVLLPLKNLEAQIIQAEVLVCGGTKNGSFLRAQRGKFLGALNTCGRIRI  319

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKT  1437
             +    +W ME MP  R+M+DMVILP G +LIING   G AGW  G SP L P IY P   
Sbjct  320   TDPNPQWVMETMPLARIMSDMVILPNGNVLIINGAAAGTAGWELGRSPVLSPVIYRPDNP  379

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
             V  RF V   + I RMYHS+  LL DGRVL+ GSNP+  Y FT V +PTEL L+AF P Y
Sbjct  380   VNSRFEVQNPSTIPRMYHSTTILLRDGRVLVGGSNPHGLYNFTGVLYPTELSLEAFSPSY  439

Query  1618  MDRRFDNQRPKNVSVYVEGSPAA--VVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTH  1791
             +D    N RP+ +      SPA+   V YG + ++RF +        ++ +  +P F TH
Sbjct  440   LDSDSANLRPQII------SPASRRKVKYGGQVNIRFIVPGPINRNLVKVTMVAPGFNTH  493

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             S  MNQR+L L   ++ +            P S   APPGYYM+ VV++ IPS   W++ 
Sbjct  494   SFTMNQRILVLSSGNVTQVGTSTYKINSIFPNSSKLAPPGYYMLFVVHQDIPSEGIWIRI  553



>ref|XP_009117902.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=559

 Score =   422 bits (1085),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 241/535 (45%), Positives = 327/535 (61%), Gaps = 25/535 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             GRW  L  + G+ AMHM L H N VV FD+   G S   L  +     C+ +    +   
Sbjct  40    GRWDLLQPSIGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQ----TCRNA----TVFD  91

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS+ YDV +NT RPL   SDTWCSSG++ ++G+++QTGGY  G + ++ F PC   +
Sbjct  92    CSAHSLLYDVASNTFRPLTLRSDTWCSSGSLNASGSLIQTGGYGVGERVVRIFTPCDGVS  151

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W   + +L   RWY++NQILP  + R+IIVGGRRA TYEF P+ P  +    L FL +
Sbjct  152   CDWVENRAYLSSRRWYSTNQILP--DGRIIIVGGRRAFTYEFYPKNPG-KSVFILRFLAE  208

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T + N   NNLYPFLHL  DG LFIFANR SILF++  +R+ K+FP +PG   R+YPSTG
Sbjct  209   TRDPNE-ENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPGGDKRNYPSTG  267

Query  1111  SSVMLPLD---HKNRFQ-KVEVMICGGASAGAYTEAKQ---GRFIEGLKSCGRMVISGNK  1269
             SSV+LPL      NR +   EVM+CGGA  GA+ +A +     F+   ++CGR+ ++   
Sbjct  268   SSVLLPLSLTGENNRSKIAAEVMVCGGAPPGAFLKAARTIPKVFVGASRTCGRLKVTDPN  327

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGK  1446
               W ME MP PRVM DM++LP G ILIING   G AGW +  +  L P +Y P +    +
Sbjct  328   PSWVMEQMPAPRVMPDMLLLPNGDILIINGASNGTAGWEDATNAVLNPILYMPDEPDPTR  387

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF +L  T+I RMYHS++ LL DGRVLI GSNP+  Y FT   +PTEL L+A++P Y+D 
Sbjct  388   RFEILAPTRIPRMYHSASLLLADGRVLIGGSNPHRNYNFTARHYPTELSLEAYLPRYLDP  447

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSED-LEFSAYSPPFTTHSVAM  1803
             ++   RP  V+V + G+    + YGK F V F +      +  +     +P F+THS AM
Sbjct  448   QYSGVRPSIVTVELAGN----MLYGKSFAVTFVIPAFGMFDGRVSVRLVAPSFSTHSTAM  503

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             NQRML LR   + +       A V  P +   APPGYYM+ +V+ G PS++ WVK
Sbjct  504   NQRMLVLRVRRVVQLSVFAYKADVDGPTNSYVAPPGYYMMFMVHRGTPSVAIWVK  558



>ref|XP_004486272.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=540

 Score =   421 bits (1083),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 234/544 (43%), Positives = 326/544 (60%), Gaps = 20/544 (4%)
 Frame = +1

Query  355   ASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTR  534
             ASV+   +ASG G W+ L +N G+VAMHM L H + +V FD+   G S   L    NG R
Sbjct  11    ASVVYLVSASG-GEWKVLQKNIGIVAMHMQLLHNDRIVIFDRTDFGLSNISLP---NG-R  65

Query  535   CK-GSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGS  711
             C+    E +    C AHS+EYDV +NT RPL   +D WCSSGT+ S+G ++QTGGY DG 
Sbjct  66    CRYDPSEKVVKVDCTAHSIEYDVTHNTFRPLFVQTDVWCSSGTVRSDGALVQTGGYSDGE  125

Query  712   KRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP  891
             + ++ F PC   TC+W      L   RWYA++ ILP  + R I++GGRR   YEF P+  
Sbjct  126   RNVRIFTPC--HTCDWIELNGGLDTRRWYATSHILP--DSRQIVIGGRRQFNYEFFPKSI  181

Query  892   NMQKST--DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKF  1065
             N + +   +LPFL +T + +   NNLYPF+ L+ DG LFI AN  +IL +Y KN V K F
Sbjct  182   NGRANNVYNLPFLVETNDPHQE-NNLYPFVFLNVDGNLFIMANSKAILLDYTKNMVVKTF  240

Query  1066  PRMPGEGSRSYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSC  1242
             P +PG   R YPSTGS+V+LPL + +  F + EV++CGGA  G++   K+  F + L +C
Sbjct  241   PEVPGGDPRCYPSTGSAVLLPLRNLQAAFLEAEVLVCGGAPRGSFNNTKKHEFRQALNTC  300

Query  1243  GRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIY  1422
              R+ I+    +W ME MPG RVM+DMV+LP G +L+ING   G AGW  G +P L P++Y
Sbjct  301   ARIKITDPNPQWEMETMPGARVMSDMVMLPNGNVLLINGASFGTAGWEQGRNPVLTPFLY  360

Query  1423  SPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQA  1602
                  +G RF     +   RMYHS+A L+ DGRV++ GSNP+ GY F NV  PTEL L+A
Sbjct  361   ETNNPIGSRFKKQSPSTTPRMYHSTAILVRDGRVVVGGSNPHVGYSFENVLFPTELSLEA  420

Query  1603  FVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDL-EFSAYSPP  1779
             F P Y++RR+ + RP+ +S      P   + YG++  ++F ++      +L   +  +P 
Sbjct  421   FSPSYLERRYSHLRPRILS-----EPQIKLSYGQKLELQFQMNVTLNYPNLVHVTMLAPS  475

Query  1780  FTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISR  1959
             FTTHS +MNQR+L L    +    +      V  P S   APPG+Y++ VV   IPS   
Sbjct  476   FTTHSFSMNQRLLVLEPNKVGIVQDKTYGIKVTVPGSSTLAPPGFYLLFVVYGKIPSEGI  535

Query  1960  WVKF  1971
             W + 
Sbjct  536   WAQI  539



>ref|XP_008245383.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=553

 Score =   422 bits (1084),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 235/536 (44%), Positives = 317/536 (59%), Gaps = 22/536 (4%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP  567
             QG+W+ L  + GV AMHMAL   + V+ FD+  +G S   L +         S  + SD 
Sbjct  29    QGKWKLLKRSIGVSAMHMALLPNDKVIIFDRTDAGPSNLTLPQEKCARVHHQSAHEASD-  87

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              CYAHSVE++  N   RPL   +DTWCSSG +  +G ++Q+GGY DG K +++F PC+D 
Sbjct  88    -CYAHSVEFNPANRDFRPLTISTDTWCSSGALSQDGVLIQSGGYDDGYKVVRYFKPCLD-  145

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP-NMQKSTDLPFL  924
              C+W   +  L   RWYASNQ+LP  + R+IIVGGR    YEF+P+   N +K   LPFL
Sbjct  146   -CDWIEEQNGLIVPRWYASNQVLP--DGRIIIVGGRFQFNYEFIPKTSTNDKKLYQLPFL  202

Query  925   HQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPS  1104
              +T       NNLYPFLHLS+DG LFIFAN  ++LF+Y +N+V  KFP MPG  SR+YPS
Sbjct  203   EETMHLPKVPNNLYPFLHLSTDGNLFIFANDRAVLFDYVQNKVVTKFPVMPGGVSRNYPS  262

Query  1105  TGSSVMLPLD--HKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             TGSS +LP+     N    VEV++CGG    +  +A  G ++   KSCGR++I+     W
Sbjct  263   TGSSALLPISLVGNNSSPTVEVLVCGGTFPDSNVKANAGIYMPASKSCGRLIITEKNPNW  322

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              ME MP  RVM DM++LPTG +LIING   G AGW     P L P +Y P      RF +
Sbjct  323   EMEEMPINRVMGDMILLPTGDVLIINGAASGTAGWAVAREPVLNPVLYKPNHEKTGRFEL  382

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             +  T I R+YHS+A LL DGRVL+ GSNPN  Y FT + +PTEL L+AF P Y+      
Sbjct  383   MSPTTIPRLYHSTAHLLSDGRVLVGGSNPNVNYNFTTL-YPTELSLEAFYPPYLSTS-SR  440

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP    +     P   + Y ++F++ F     +  + +  +  +P FTTHS AMNQR+L
Sbjct  441   SRPSIDLI----KPGVDLTYLQKFYLGF--KTNYVPDKIYVTLVAPSFTTHSFAMNQRVL  494

Query  1819  KLRCTSMER-----GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              L  + + +     G  G +N    AP  P  APPGYY++ VV +G+PS   WV+ 
Sbjct  495   VLDFSQVGKNGNISGSKGYINLEGFAPARPELAPPGYYLLFVVCDGVPSRGMWVRI  550



>emb|CDY53551.1| BnaA09g57100D [Brassica napus]
Length=561

 Score =   422 bits (1084),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 241/535 (45%), Positives = 327/535 (61%), Gaps = 25/535 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             GRW  L  + G+ AMHM L H N VV FD+   G S   L  +     C+ +    +   
Sbjct  42    GRWDLLQPSIGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQ----TCRNA----TVFD  93

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS+ YDV +NT RPL   SDTWCSSG++ ++G+++QTGGY  G + ++ F PC   +
Sbjct  94    CSAHSLLYDVASNTFRPLTLRSDTWCSSGSLNASGSLIQTGGYGVGERVVRIFTPCDGVS  153

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W   + +L   RWY++NQILP  + R+IIVGGRRA TYEF P+ P  +    L FL +
Sbjct  154   CDWVENRAYLSSRRWYSTNQILP--DGRIIIVGGRRAFTYEFYPKNPG-KSVFILRFLAE  210

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T + N   NNLYPFLHL  DG LFIFANR SILF++  +R+ K+FP +PG   R+YPSTG
Sbjct  211   TRDPNE-ENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPGGDKRNYPSTG  269

Query  1111  SSVMLPLD---HKNRFQ-KVEVMICGGASAGAYTEAKQ---GRFIEGLKSCGRMVISGNK  1269
             SSV+LPL      NR +   EVM+CGGA  GA+ +A +     F+   ++CGR+ ++   
Sbjct  270   SSVLLPLSLTGENNRSKIAAEVMVCGGAPPGAFLKAARTIPKVFVGASRTCGRLKVTDPN  329

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGK  1446
               W ME MP PRVM DM++LP G ILIING   G AGW +  +  L P +Y P +    +
Sbjct  330   PSWVMEQMPAPRVMPDMLLLPNGDILIINGASNGTAGWEDATNAVLNPILYMPDEPDPTR  389

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF +L  T+I RMYHS++ LL DGRVLI GSNP+  Y FT   +PTEL L+A++P Y+D 
Sbjct  390   RFEILAPTRIPRMYHSASLLLADGRVLIGGSNPHRNYNFTARHYPTELSLEAYLPRYLDP  449

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSED-LEFSAYSPPFTTHSVAM  1803
             ++   RP  V+V + G+    + YGK F V F +      +  +     +P F+THS AM
Sbjct  450   QYSGVRPSIVTVELAGN----MLYGKSFAVTFVIPAFGMFDGRVSVRLVAPSFSTHSTAM  505

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             NQRML LR   + +       A V  P +   APPGYYM+ +V+ G PS++ WVK
Sbjct  506   NQRMLVLRVRRVVQLSVFAYKADVDGPTNSYVAPPGYYMMFMVHRGTPSVAIWVK  560



>ref|XP_010504696.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=547

 Score =   421 bits (1083),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 236/558 (42%), Positives = 328/558 (59%), Gaps = 28/558 (5%)
 Frame = +1

Query  319   FLVSLRPCNALNASVLVSEAAS----GQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRG  486
             F+++L     L+ ++L    A+       RW+ L+ + G+ AMHM L H   V+ FD+  
Sbjct  8     FILTLSILICLSIAILSEGQATPFLLQFDRWEMLLPSIGISAMHMQLLHNGMVIMFDRTD  67

Query  487   SGRSGYQLRRRFNGTRCKGSREDLSDP-SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTI  663
              G S   L     G  C+    D +    C AHSV YDV++N+ RPL+  +DTWCSSG +
Sbjct  68    FGISNVSLP----GGICRYDPTDTAVKFDCTAHSVLYDVVSNSYRPLQVQTDTWCSSGAV  123

Query  664   LSNGTIMQTGGYRDGSKRIQFFAPC-VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVI  840
             L NGT++QTGGY DG +  + F PC   +TC+W    ++L   RWYA+NQILP  + R+I
Sbjct  124   LPNGTLVQTGGYNDGERAARMFTPCGYSETCDWMEFPQYLSQRRWYATNQILP--DGRII  181

Query  841   IVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRD  1020
             +VGGRR   YE  PR  +  +S+   FL +T +  +  NNLYPF+HL  DG LF+FAN  
Sbjct  182   VVGGRRQFNYEIFPRHNSRSRSSRFEFLRETSD-GSNENNLYPFIHLLPDGNLFVFANTR  240

Query  1021  SILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAY  1197
             SI+F+Y+ NRV K+FP +PG   R+YPS+GSSV+ PLD  N    +VE+M+CGG+  G +
Sbjct  241   SIVFDYKTNRVVKEFPEIPGGDPRNYPSSGSSVLFPLDETNDTNVQVEIMVCGGSPRGGF  300

Query  1198  TEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCA  1377
             +      F+    +CGR+ +S     W ME MP PRVM DM++LPTG ++I+NG   G A
Sbjct  301   SRG----FVRATSTCGRLRLSDQNPSWEMETMPLPRVMGDMLLLPTGDVIIVNGAGTGTA  356

Query  1378  GWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGY  1557
             GW       ++P IY P       FSV+      RMYHSSA LLPDGRVL+ GSNP+  Y
Sbjct  357   GWEKARDLVIQPLIYHP---FDHLFSVMSTPTRPRMYHSSAVLLPDGRVLVGGSNPHVYY  413

Query  1558  VFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKK  1737
              FTNV +PT+L L+A+ P Y+    D  RPK +      +   V+ Y + F+V F + + 
Sbjct  414   NFTNVEYPTDLSLEAYSPPYLSFTSDPIRPKIL------TSDKVLGYKRLFNVDFSIPQF  467

Query  1738  WPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGD-NGMVNavvaappspvaappGY  1914
                + L     +P FTTHS AMNQRM+ L+  S+ R             P +   APPGY
Sbjct  468   LTVDLLSVRIVAPSFTTHSFAMNQRMVILKLLSVTRDQLTNSYRVSALGPSTAEIAPPGY  527

Query  1915  YMVTVVNEGIPSISRWVK  1968
             YM+ +V+ GIPS + WV+
Sbjct  528   YMMFLVHAGIPSSAAWVQ  545



>gb|KGN62661.1| hypothetical protein Csa_2G365680 [Cucumis sativus]
Length=561

 Score =   421 bits (1082),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 326/541 (60%), Gaps = 16/541 (3%)
 Frame = +1

Query  364   LVSEAAS-GQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK  540
             LVS++     GRW  L E+ GV+ MHM L H + VV FD+   G S       F   +C+
Sbjct  33    LVSQSQPIDSGRWNLLQEDIGVLPMHMQLLHSDRVVIFDRTDFGASNLP----FPDGKCR  88

Query  541   GSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKR  717
                 D++    C AHS+EYD+ +N+ RPL   +D WCS+G  +S+G ++QTGG+ DG +R
Sbjct  89    MDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMSDGALVQTGGFNDGDRR  148

Query  718   IQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM  897
             ++ F P  + + +W+     L   RWY +NQILP  + R I++GGRR  +YEFVP+    
Sbjct  149   VRIFKPYPNGS-DWEEIPFALAVRRWYPTNQILP--DGRQIVIGGRRQFSYEFVPKTNGA  205

Query  898   QKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMP  1077
              K+   PFL +T +     NNLYPF+ L+ DG LF+FAN  SILF+Y +N+V K FP +P
Sbjct  206   TKAYSFPFLVETNDPLIE-NNLYPFVFLNVDGNLFVFANNRSILFDYARNKVLKIFPAIP  264

Query  1078  GEGSRSYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
             G   R YPSTGS+V+LPL + +    + EV++CGGA  GA+ +A    F+  L +C R+ 
Sbjct  265   GGDPRCYPSTGSAVLLPLRNLQAATIEAEVLVCGGAPKGAFDKAVNRIFVGALNTCARIK  324

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+  K +W ME MP  RVM DMV+LP G +LIING   G AGW N   P L P +Y P  
Sbjct  325   ITDPKPEWVMETMPMGRVMGDMVLLPNGDVLIINGAGSGTAGWDNARDPILNPILYRPND  384

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
             + G RF +L  + I R+YHS+A LL DGRVL+ GSNPN  Y FT VP PTELRL+AF P 
Sbjct  385   SPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNFTGVPFPTELRLEAFSPP  444

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSED-LEFSAYSPPFTTH  1791
             Y+D  F+N RPK +S     S    V + ++  VRF +     S + +E +  +PPF TH
Sbjct  445   YLDPEFENMRPKILS----PSSQTTVRHTQQLAVRFNVTGNNVSLNTVEVTMVAPPFNTH  500

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             S +M+QR+L +   ++    N   +  V+ P S   AP GYY++ VV+  IPS   W++ 
Sbjct  501   SFSMSQRLLVIGGENVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHREIPSNGIWIRI  560

Query  1972  A  1974
              
Sbjct  561   V  561



>ref|XP_008221748.1| PREDICTED: galactose oxidase [Prunus mume]
Length=585

 Score =   421 bits (1083),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 242/568 (43%), Positives = 329/568 (58%), Gaps = 36/568 (6%)
 Frame = +1

Query  319   FLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRS  498
             +L +  P +++NA+   +   S  G+W  L ++ GV AMHM L   + V+ FD+   G S
Sbjct  34    YLTNPTPFSSINAT---TSNVSAGGQWVLLHKSIGVSAMHMQLLKNDKVILFDRTDMGPS  90

Query  499   GYQLR-----RRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTI  663
              +        R++N T  +     ++D  C AHS++YD+++  IRPL   SDTWCSSG +
Sbjct  91    NFSFPSGTGCRKYNDTHHR--NRTITD--CTAHSLQYDIISGNIRPLYVSSDTWCSSGAL  146

Query  664   LSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVII  843
               NGT++QTGGY  G ++I+  APC D  C W     +L D RWYAS QILP  + RVI+
Sbjct  147   DPNGTLIQTGGYGSGIRKIRTVAPCDDGKCEWTELPVNLADGRWYASTQILP--DGRVIV  204

Query  844   VGGRRASTYEFVPRFPNM-QKSTDLPFLHQT---YERNAGGNNLYPFLHLSSDGYLFIFA  1011
             VGGRRA +YEF P+  ++  K   L FL +T   YE     NNLYPFLHL  DG LFIFA
Sbjct  205   VGGRRAFSYEFYPKTDDVSSKRYYLSFLAETTDPYEE----NNLYPFLHLLPDGSLFIFA  260

Query  1012  NRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-----KVEVMICG  1176
             N  SIL +Y++NRV K+ P +P    R+YPSTGSSV+LPL  K         + EV+ICG
Sbjct  261   NNRSILLDYKQNRVVKELPVIPDGIKRTYPSTGSSVLLPLKMKGSLDGSDKPEAEVLICG  320

Query  1177  GASAGAYTEAKQGR-FIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILII  1353
             G+  GA+  +   R F+    SCGR+ ++    KW ME MP PRVM+DM++LPTG ++I+
Sbjct  321   GSPPGAFNMSNLNRVFVSASNSCGRIKLTDPNPKWVMEEMPMPRVMSDMLLLPTGDVIIL  380

Query  1354  NGVKRGCAGWGNGASPALEPYI---YSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRV  1524
             NG   G AGW + A+P   P +   Y P   +  RF VL  +   RMYHSSA LLPDGR+
Sbjct  381   NGASNGTAGWEDAANPVFNPVLYKTYEPDPNL--RFVVLNPSSTPRMYHSSALLLPDGRI  438

Query  1525  LIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGK  1704
             L+ GSNP++ Y FT  P PT+L L+A+ P Y+       RP  +++        +V YG+
Sbjct  439   LVGGSNPHEVYNFTARPFPTDLSLEAYQPPYLGPLLAALRPSILTIEARD---GIVSYGQ  495

Query  1705  EFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaap  1884
              F V F L        +     +P FTTHS +MNQRM+ L    +E             P
Sbjct  496   MFSVTFMLSVYRADPGISVVLITPSFTTHSFSMNQRMVVLDVARLENLSALAYKIAAYGP  555

Query  1885  pspvaappGYYMVTVVNEGIPSISRWVK  1968
             P    APPGYYM+ +V+ G PS + WVK
Sbjct  556   PKTTVAPPGYYMLFLVHAGTPSHAVWVK  583



>ref|XP_004164439.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=561

 Score =   420 bits (1080),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 325/541 (60%), Gaps = 16/541 (3%)
 Frame = +1

Query  364   LVSEAAS-GQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK  540
             LVS++     GRW  L E+ GV+ MHM L H + VV FD+   G S       F   +C+
Sbjct  33    LVSQSQPIDSGRWNLLQEDIGVLPMHMQLLHSDRVVIFDRTDFGASNLP----FPDGKCR  88

Query  541   GSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKR  717
                 D++    C AHS+EYD+ +N+ RPL   +D WCS+G  +S+G ++QTGG+ DG +R
Sbjct  89    MDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMSDGALVQTGGFNDGDRR  148

Query  718   IQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM  897
             ++ F P  + + +W+     L   RWY +NQILP  + R I++GGRR  +YEFVP+    
Sbjct  149   VRIFKPYPNGS-DWEEIPFALAVRRWYPTNQILP--DGRQIVIGGRRQFSYEFVPKTNGA  205

Query  898   QKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMP  1077
              K+   PFL +T +     NNLYPF+ L+ DG LF+FAN  SILF+Y +N+V K FP +P
Sbjct  206   TKAYSFPFLVETNDPLIE-NNLYPFVFLNVDGNLFVFANNRSILFDYARNKVLKIFPAIP  264

Query  1078  GEGSRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
             G   R YPSTGS+V+LPL   +    + EV++CGGA  GA+ +A    F+  L +C R+ 
Sbjct  265   GGDPRCYPSTGSAVLLPLRKLQAATIEAEVLVCGGAPKGAFDKAVNRIFVGALNTCARIK  324

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+  K +W ME MP  RVM DMV+LP G +LIING   G AGW N   P L P +Y P  
Sbjct  325   ITDPKPEWVMETMPMGRVMGDMVLLPNGDVLIINGAGSGTAGWDNARDPILNPILYRPND  384

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
             + G RF +L  + I R+YHS+A LL DGRVL+ GSNPN  Y FT VP PTELRL+AF P 
Sbjct  385   SPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNFTGVPFPTELRLEAFSPP  444

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSED-LEFSAYSPPFTTH  1791
             Y+D  F+N RPK +S     S    V + ++  VRF +     S + +E +  +PPF TH
Sbjct  445   YLDPEFENMRPKILS----PSSQTTVRHTQQLAVRFNVTGNNVSLNTVEVTMVAPPFNTH  500

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             S +M+QR+L +   ++    N   +  V+ P S   AP GYY++ VV+  IPS   W++ 
Sbjct  501   SFSMSQRLLVIGGENVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHREIPSNGIWIRI  560

Query  1972  A  1974
              
Sbjct  561   V  561



>ref|XP_006833409.1| hypothetical protein AMTR_s00109p00131490 [Amborella trichopoda]
 gb|ERM98687.1| hypothetical protein AMTR_s00109p00131490 [Amborella trichopoda]
Length=603

 Score =   421 bits (1083),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 236/531 (44%), Positives = 329/531 (62%), Gaps = 22/531 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED--LSD  564
             G W+    NTG+ AMH+ L     VV FD    G S  +L    +G RC+  + +    +
Sbjct  86    GSWELASANTGISAMHVQLMPSGKVVMFDASVFGPSKIKL----DGGRCRIDKRERRKGN  141

Query  565   PSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD  744
               C+AH+VEYDV    +RPL   ++TWCSSG + ++G ++QTGG+ +G   ++ +  C  
Sbjct  142   NDCWAHAVEYDVDTAAVRPLMVKTNTWCSSGALGADGRLIQTGGFNEGGNVVRLYESC--  199

Query  745   KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ-KSTDLPF  921
             K C+W      L  +RWY+S+ ILP  N  VIIVGGRR  +YEF+P   N + K  DLPF
Sbjct  200   KDCDWVEKPNSLSGQRWYSSDHILPDGN--VIIVGGRRKFSYEFIPAEGNSELKVYDLPF  257

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T +     NNLYPFLHLS+DG LF+FAN  SIL +Y+ NR+ + FP +PG GSR+YP
Sbjct  258   LKETTDDVE--NNLYPFLHLSTDGNLFVFANDRSILLDYKNNRIVRTFPVLPG-GSRNYP  314

Query  1102  STGSSVMLPLDHKNRFQKV--EVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHK  1275
             ++GS+V+LP+  + R   +  EV+ICGGA+  + ++A +G F++ L +CGR+ I+    +
Sbjct  315   ASGSAVLLPIRLRGRENLIPSEVLICGGATPESASQADRGVFVDALDTCGRITITDPNSQ  374

Query  1276  WNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFS  1455
             W +E MP  RVM DM+ILP  Q+LIING K G +GW    +P L P +Y+P     +RF 
Sbjct  375   WKIERMPSRRVMGDMLILPNAQVLIINGAKSGTSGWSFARNPNLSPVLYNPRNPRNQRFQ  434

Query  1456  VLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFD  1635
              L  + I RMYHSS  +LPDG+VLIAGSN N  Y +T++ +PTELR + F P Y+D    
Sbjct  435   TLNPSTIPRMYHSSGVVLPDGKVLIAGSNTNPKYNYTSL-YPTELRAEKFSPPYLDPSLA  493

Query  1636  NQRPKNVSVYVEGSPAAVVDYGKEFHVRFWL-DKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
             + RP   ++  E  P A+  YG  F ++  L D+     DL  + Y+PPFTTHS + NQR
Sbjct  494   SHRP---NILTELMPKALA-YGGGFKIQISLSDQIVADTDLSVTMYAPPFTTHSYSQNQR  549

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
             ML LR   +E+   G     V APPS V APPGYY++ VV+ G+PS   WV
Sbjct  550   MLVLRMNDVEQVAPGTYQISVVAPPSAVVAPPGYYLLFVVHFGVPSEGVWV  600



>ref|XP_002518913.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF43446.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=546

 Score =   419 bits (1078),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 232/540 (43%), Positives = 320/540 (59%), Gaps = 27/540 (5%)
 Frame = +1

Query  373   EAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRE  552
             E    QGRW+ L  + G+ AMHM L   + ++ FD+   G S   L +     +C    +
Sbjct  22    EGQQYQGRWKLLKRSIGISAMHMQLLPNDKIIAFDRTNFGPSNLSLPQ----GKCPTESQ  77

Query  553   DLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
                   C+AHSVE+D  N  IRPL  ++DTWCSSG +  +G ++Q+GGYR G + ++ F 
Sbjct  78    TTD---CFAHSVEFDPFNRNIRPLTILTDTWCSSGGLSQDGVLLQSGGYRFGERVVRTFK  134

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST-  909
             PC  ++C+W    K L   RWYASNQ+LP  + R IIVGGR    YEF+P+  +  ++  
Sbjct  135   PC--ESCDWTEDPKGLISPRWYASNQVLP--DGRFIIVGGRYQYNYEFIPKTSSSDQTLY  190

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
              LPFL +T       NNLYPFLHLS DG LFIFAN  ++L +Y KN+V + +P MPG  S
Sbjct  191   QLPFLKETRYSPLIPNNLYPFLHLSPDGNLFIFANDRAVLLDYAKNKVVRNYPVMPGNVS  250

Query  1090  RSYPSTGSSVMLPLDHKNRFQ---KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
             R+YPSTGSSV+LPL   + +      EV+ICGG S  +  +A  G++++  KSCGR+VI+
Sbjct  251   RNYPSTGSSVLLPLVLVSNYSTNPDAEVLICGGTSPDSNQKADAGQYVDASKSCGRLVIT  310

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG---  1431
                  W ME MP  RVM DM++LPTG++LIING  +G AGW     P L P +Y P    
Sbjct  311   SANPSWEMEEMPKNRVMGDMIMLPTGEVLIINGAAKGTAGWNAAREPVLNPILYRPDVEK  370

Query  1432  KTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVP  1611
              +   RF ++  + I R+YHS+A LL DGRVL+ GSNPN  Y FT V +PTEL L+AF P
Sbjct  371   NSNTSRFEIMSPSPIPRLYHSAAHLLSDGRVLVGGSNPNRNYNFTTV-YPTELSLEAFYP  429

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTH  1791
              Y+       RP   ++     P   +DY ++F + F L  +    ++  +  +P FTTH
Sbjct  430   PYLSSNI--PRPNITAI----KPGGNLDYKQKFSMEFQLKNQEDPRNICITMVAPSFTTH  483

Query  1792  SVAMNQRMLKLRCTS--MERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWV  1965
             S AMNQR+L L   +   ++  +G     V AP +   APPGYY + VV+EG+PS   WV
Sbjct  484   SFAMNQRLLVLGLDNNGTKKVASGKYVVNVNAPGTAALAPPGYYQLFVVHEGVPSRGIWV  543



>ref|XP_010496071.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score =   420 bits (1079),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 240/538 (45%), Positives = 328/538 (61%), Gaps = 28/538 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             GRW  L  + G+ AMHM L H N VV FD+   G S   L        C+ +    +   
Sbjct  42    GRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHL----CQNA----TVFD  93

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV---  741
             C AHS+ YDV +NT RPL    DTWCSSG++ ++G+++QTGGY  G + ++ F PC    
Sbjct  94    CSAHSILYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGSGERTVRVFTPCDGVG  153

Query  742   DKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPF  921
               +C+W   + +L   RWY++NQILP  + R+IIVGGRRA TYEF P+ P  +   +L F
Sbjct  154   SLSCDWVENRAYLSSRRWYSTNQILP--DGRIIIVGGRRAFTYEFYPKNPG-KSVFNLRF  210

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T + N   NNLYPFLHL  DG LFIFANR SILF++  +R+ K+FP +PG   R+YP
Sbjct  211   LAETRDPNEE-NNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGGDKRNYP  269

Query  1102  STGSSVMLPL---DHKNRFQ-KVEVMICGGASAGAYTEAKQ---GRFIEGLKSCGRMVIS  1260
             STGSSV+LPL      NR +   EVM+CGGA  GA+ +A +     F+ G +SCGR+ ++
Sbjct  270   STGSSVLLPLLLTGESNRSKIAAEVMVCGGAPPGAFFKAARTIPKIFVGGSRSCGRLKVT  329

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-T  1437
                 +W ME MP PRVM DM++LP G +LIING   G AGW +  +  L P +Y P +  
Sbjct  330   DPNPRWIMEQMPSPRVMGDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPVLYLPDEPD  389

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
               +RF +L  T+I RMYHS++ LL DGRVL+ GSNP+  Y FT  P+PTEL L+A++P Y
Sbjct  390   PTRRFEILAPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTASPYPTELSLEAYLPRY  449

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE-DLEFSAYSPPFTTHS  1794
             +D ++   RP  ++V + G     +  G+ F V F +      +  +     +P F+THS
Sbjct  450   LDPQYVRVRPTIITVELAGK----MLNGQGFAVTFVIPAFGMFDGGVSVRLVAPSFSTHS  505

Query  1795  VAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              AMNQRML LR   + +       A V  P +   APPGYYM+ VV+ GIPS++ WVK
Sbjct  506   TAMNQRMLVLRVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVWVK  563



>ref|XP_010476497.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score =   419 bits (1078),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 240/539 (45%), Positives = 329/539 (61%), Gaps = 28/539 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             GRW  L  + G+ AMHM L H N VV FD+   G S   L        C+ +    +   
Sbjct  42    GRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHL----CQNA----TVFD  93

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV---  741
             C AHS+ YDV +NT RPL    DTWCSSG++ ++G+++QTGGY  G + ++ F PC    
Sbjct  94    CSAHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGSGERTVRVFTPCDGVG  153

Query  742   DKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPF  921
               +C+W   + +L   RWY++NQILP  + R+IIVGGRRA TYEF P+ P  +   +L F
Sbjct  154   SLSCDWVENRAYLSSRRWYSTNQILP--DGRIIIVGGRRAFTYEFYPKNPG-KSVFNLRF  210

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T + N   NNLYPFLHL  DG LFIFANR SILF++  +R+ K+FP +PG   R+YP
Sbjct  211   LAETRDPNEE-NNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGGDKRNYP  269

Query  1102  STGSSVMLPL---DHKNRFQ-KVEVMICGGASAGAYTEAKQ---GRFIEGLKSCGRMVIS  1260
             STGSSV+LPL      NR +   EVM+CGGA  GA+ +A +     F+ G +SCGR+ ++
Sbjct  270   STGSSVLLPLLLTGESNRSKIAAEVMVCGGAPPGAFFKAARTIPKIFVGGSRSCGRLKVT  329

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-T  1437
                 +W ME MP PRVM DM++LP G +LIING   G AGW +  +  L P +Y P +  
Sbjct  330   DPNPRWIMEQMPSPRVMGDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPILYLPDEPD  389

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
               +RF +L  T+I RMYHS++ LL DGRVL+ GSNP+  Y FT   +PTEL L+A++P Y
Sbjct  390   PTRRFEILAPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTARSYPTELSLEAYLPRY  449

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE-DLEFSAYSPPFTTHS  1794
             +D ++   RP  ++V + G+    + YG+ F V F +      +  +     +P F+THS
Sbjct  450   LDPQYVRVRPTIITVELAGN----MLYGQGFAVTFAIPAFGMFDGGVSVRLVAPSFSTHS  505

Query  1795  VAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              AMNQRML LR   + +       A V  P +   APPGYYM+ VV+ GIPS++ WVK 
Sbjct  506   TAMNQRMLVLRVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  564



>ref|XP_004152661.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=561

 Score =   419 bits (1078),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 233/541 (43%), Positives = 325/541 (60%), Gaps = 16/541 (3%)
 Frame = +1

Query  364   LVSEAAS-GQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK  540
             LVS++     GRW  L E+ GV+ MHM L H + VV FD+   G S       F   +C+
Sbjct  33    LVSQSQPIDSGRWNLLQEDIGVLPMHMQLLHSDRVVIFDRTDFGASNLP----FPDGKCR  88

Query  541   GSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKR  717
                 D++    C AHS+EYD+ +N+ RPL   +D WCS+G  +S+G ++QTGG+ DG +R
Sbjct  89    MDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMSDGALVQTGGFNDGDRR  148

Query  718   IQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM  897
             ++   P  + + +W+     L   RWY +NQILP  + R I++GGRR  +YEFVP+    
Sbjct  149   VRILKPYPNGS-DWEEIPFALAVRRWYPTNQILP--DGRQIVIGGRRQFSYEFVPKTNGA  205

Query  898   QKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMP  1077
              K+   PFL +T +     NNLYPF+ L+ DG LF+FAN  SILF+Y +N+V K FP +P
Sbjct  206   TKAYSFPFLVETNDPLIE-NNLYPFVFLNVDGNLFVFANNRSILFDYARNKVLKIFPAIP  264

Query  1078  GEGSRSYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
             G   R YPSTGS+V+LPL + +    + EV++CGGA  GA+ +A    F+  L +C R+ 
Sbjct  265   GGDPRCYPSTGSAVLLPLRNLQAATIEAEVLVCGGAPKGAFDKAVNRIFVGALNTCARIK  324

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+  K +W ME MP  RVM DMV+LP G +LIING   G AGW N   P L P +Y P  
Sbjct  325   ITDPKPEWVMETMPMGRVMGDMVLLPNGDVLIINGAGSGTAGWDNARDPILNPILYRPND  384

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
             + G RF +L  + I R+YHS+A LL DGRVL+ GSNPN  Y FT VP PTELRL+AF P 
Sbjct  385   SPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNFTGVPFPTELRLEAFSPP  444

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSED-LEFSAYSPPFTTH  1791
             Y+D  F+N RPK +S     S    V + ++  VRF +     S + +E +  +PPF TH
Sbjct  445   YLDPEFENMRPKILS----PSSQTTVRHTQQLAVRFNVTGNNVSLNTVEVTMVAPPFNTH  500

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             S +M+QR+L +   ++    N   +  V+ P S   AP GYY++ VV+  IPS   W++ 
Sbjct  501   SFSMSQRLLVIGGENVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHREIPSNGIWIRI  560

Query  1972  A  1974
              
Sbjct  561   V  561



>ref|XP_009774595.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=554

 Score =   419 bits (1077),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 228/533 (43%), Positives = 310/533 (58%), Gaps = 19/533 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             G W  L+ N G+ AMHM L + + V+ +D+   G S   L       +C+ +  DL+   
Sbjct  34    GNWDLLISNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPD----GKCRNNPNDLALKL  89

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              C AHSVEYDV  N++RPL   +D WCSSG+  S+G+++QTGG+ DG   ++ F PC   
Sbjct  90    DCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGENVVRVFRPCNGN  149

Query  748   --TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPF  921
               TC+WK     L   RWYA+N ILP  + R II+GGR A  YEF P+  +     +LPF
Sbjct  150   GSTCDWKEIGGGLIQSRWYATNHILP--DGRQIIIGGREAFNYEFYPKTASTNSVFNLPF  207

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L QT +     NNLYPF+ L+ DG LFIFAN  +ILFNY  N V K +P++PG   R+YP
Sbjct  208   LQQTNDPREE-NNLYPFVFLNVDGNLFIFANDRAILFNYMANTVVKTYPQIPGGDPRNYP  266

Query  1102  STGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             STGS+V+LPL + + +  + EV++CGG   G+Y  A  G F+  L +CGR+ I+    +W
Sbjct  267   STGSAVLLPLKNLQAQIIQAEVLVCGGTPRGSYLNASSGNFLGALNTCGRITITDPNPQW  326

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              ME MP  R M DMVILP G +LI+NG   G AGW  G SP L P IY P      RF V
Sbjct  327   IMETMPLARTMGDMVILPNGNVLILNGAAAGTAGWELGRSPVLSPVIYRPDNPFDSRFEV  386

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
               +  I RMYHS++ L+ DGRVL+ GSNP+  Y FT V +PTEL L+ F P Y+D    N
Sbjct  387   QNSNTIPRMYHSTSILIRDGRVLVGGSNPHAFYNFTGVLYPTELSLETFSPSYLDPESAN  446

Query  1639  QRPKNVSVYVEGSPAA--VVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
              RP+ +      +PA+   + YG+  ++RF +      + +  +  +P F THS  MNQR
Sbjct  447   SRPRII------APASRHKIKYGQRVNIRFTVPGSVNRDVVNVTMVAPGFNTHSFTMNQR  500

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             ML L   ++ R            P S   AP GYY++ VV++ IPS   WV+ 
Sbjct  501   MLVLFSGNVTRVGKSAYKINSVFPNSSNLAPAGYYLLFVVHQDIPSEGIWVRI  553



>emb|CDP07430.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   419 bits (1077),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 227/540 (42%), Positives = 318/540 (59%), Gaps = 15/540 (3%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK-  540
             L   AA+  G+W  L  + G+ +MHM L + + VV +D+   G S   L       +C+ 
Sbjct  32    LAEAAATTGGQWALLQSSIGIASMHMQLLNNDKVVIYDRTDFGPSNISLA----SGKCRY  87

Query  541   GSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
               +E +    C AHSVEYDV  N+ RPL  ++D WCSSG+++ +GT +QTGG+ DG   +
Sbjct  88    DPQEQVLKVDCTAHSVEYDVATNSFRPLTVLTDVWCSSGSLMPDGTFVQTGGFNDGDHVV  147

Query  721   QFFAPCVDKT-CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM  897
             + + PC   + C+W+     L   RWYA+N ILP  +   II+GGRR   YEF P+    
Sbjct  148   RLYKPCSSGSNCDWQEINNGLIQRRWYATNHILPDSSQ--IIIGGRRQFNYEFYPKTAAT  205

Query  898   QKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMP  1077
              +  +L FL QT +     NNLYPF+ L+ DG LFIFAN  +IL NY+KN V K +P++P
Sbjct  206   NQVFNLRFLVQTNDPVVE-NNLYPFVFLNVDGNLFIFANNRAILLNYKKNIVVKNYPQLP  264

Query  1078  GEGSRSYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
                 R YPSTGS+V+LPL + +    + EV++CGGA  GAY  A++G F+  L +CGR+ 
Sbjct  265   DGNPRCYPSTGSAVLLPLRNLQGPAIQAEVLVCGGAPKGAYASAQKGDFMGALNTCGRIS  324

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+    +W ME MP  RVM DM++LP G +L+ING   G AGW  G +P L P IY P K
Sbjct  325   INDPNPQWVMETMPLARVMGDMLLLPNGHVLMINGASAGTAGWEYGRNPVLSPVIYQPNK  384

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
             T+G RF V   + I RMYHSSA LL DGRVL+ GSNP+  Y FT V +PTEL L+AF P 
Sbjct  385   TIGSRFEVQNPSTIPRMYHSSAILLRDGRVLVGGSNPHMLYNFTGVLYPTELSLEAFSPS  444

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHS  1794
             Y+D      RP+ +S   +      + YG++  +RF +  +     +  +  +P F THS
Sbjct  445   YLDPGVAGLRPRIISPVSQSQ----IGYGRQLVIRFSVSGQLKGNLVTVTMAAPSFNTHS  500

Query  1795  VAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMV-TVVNEGIPSISRWVKF  1971
              +MNQR+L L   +++   N      V  P +   APPG+Y++  VV++ IPS   WV  
Sbjct  501   FSMNQRLLVLGGDNVKIAGNSTYQTAVLTPSTSSLAPPGFYLLFVVVHQDIPSQGIWVHL  560



>ref|XP_006342231.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=556

 Score =   419 bits (1077),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 226/536 (42%), Positives = 314/536 (59%), Gaps = 16/536 (3%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDL  558
             A+  G+W  LM N G+ AMHM L + + VV +D+   G S   L    NG +C+ +  DL
Sbjct  31    AAAGGKWDLLMSNIGISAMHMQLLNDDRVVMYDRTDFGMSNISLP---NG-KCRNNNNDL  86

Query  559   S-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +    C AHS+EYDV  N++RPL   ++ WCSSG+  S+G+++QTGG  DG   I+ + P
Sbjct  87    ALKVDCTAHSIEYDVSTNSVRPLMIQTNVWCSSGSATSDGSLVQTGGSNDGKFVIRVYKP  146

Query  736   CVD---KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS  906
             C+      C+W+     L   RWY++N ILP  + R II+GGR A  YEF P+ P+    
Sbjct  147   CITGKRSNCDWQEMGNGLIQSRWYSTNHILP--DGRQIIIGGRDAFNYEFHPKIPSTNNV  204

Query  907   TDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEG  1086
               LPFL QT +     NNLYPF+ L+ D  LFIF N  +ILF+Y KN + K +P++P   
Sbjct  205   FSLPFLQQTNDPREE-NNLYPFVFLNVDANLFIFTNNRAILFDYTKNTIVKTYPQIPDGD  263

Query  1087  SRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISG  1263
              R+YPSTGS+V+LPL + + +  + EV++CGGA  G+Y +A +G F+  L +CGR+ I+ 
Sbjct  264   PRNYPSTGSAVLLPLKNLEAQTIQAEVLVCGGAPRGSYLKATRGEFVGALNTCGRITITD  323

Query  1264  NKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVG  1443
                +W +E M  PR M DMVILP G +LI+NG   G AGWG   SP L P IY P   + 
Sbjct  324   PNPQWTIETMLLPRTMGDMVILPNGNVLIVNGAATGTAGWGIARSPVLSPVIYRPDNLLD  383

Query  1444  KRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMD  1623
              RF +     I RMYHS+A LL DGRVL+ GSNPN+ Y FT V  PTEL L+AF P Y+D
Sbjct  384   SRFEIQNPNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVLFPTELSLEAFSPSYLD  443

Query  1624  RRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
                 N RP+ +S           +YG+  +++F +        ++ +  +P F THS  M
Sbjct  444   SESANLRPQIISPVSRHK----FNYGQRVNIQFSISGLLNKNSIKVTMVAPGFNTHSNTM  499

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             NQRML L    +++            P S   APPGYY++ VV++ IPS   WV+ 
Sbjct  500   NQRMLVLSNGVVKQVGKSSYQMSCLFPKSGSLAPPGYYLLFVVHQDIPSEGIWVRI  555



>ref|XP_002968445.1| hypothetical protein SELMODRAFT_89852 [Selaginella moellendorffii]
 gb|EFJ30699.1| hypothetical protein SELMODRAFT_89852 [Selaginella moellendorffii]
Length=535

 Score =   418 bits (1075),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 244/543 (45%), Positives = 326/543 (60%), Gaps = 28/543 (5%)
 Frame = +1

Query  349   LNASVLVSEAASGQ-GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFN  525
             L+  VL+S +   Q GR+  + +N GV +MH  +TH +  +F D+   G S   L     
Sbjct  13    LSVVVLISSSTRAQPGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPSQINLA----  68

Query  526   GTRCKGSREDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYR  702
             G  C+ + +D +    C AHSV +D  +   R L   SDTWCSSG  L NGT++QTGG  
Sbjct  69    GGGCRDNPDDRTLKHDCTAHSVMFDYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDF  128

Query  703   DGSKRIQFFAPCVDK-TCNWKPGK-KHLYDERWYASNQILPGKNDRVIIVGGRRASTYEF  876
             DG  ++++  PC +  TC+W+  K + L+  RWYASNQ+LP  + RVI+VGGR A +YEF
Sbjct  129   DGFFKVRYMTPCPNGGTCDWQESKTEFLHSGRWYASNQLLP--DGRVIVVGGRSAFSYEF  186

Query  877   VPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVE  1056
             +P     Q   +LPFL +T +     NNLYPFLHL  D  LF+FANRDSIL NY  N V 
Sbjct  187   IPDRGAGQ--FELPFLKETNDPTF--NNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVL  242

Query  1057  KKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLK  1236
             +++P +PGE  R+YPS GSSVMLPLD  N F   E+++CGG++  AY  A     +   +
Sbjct  243   RRYPTLPGE-PRNYPSAGSSVMLPLDSANSFSNAEILVCGGSNKDAY--AYPAGQLPASQ  299

Query  1237  SCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPY  1416
             +CGRMV +     WN+ NMP  R M DMV+LPTGQ+LIING + G  GWG  +SP L P 
Sbjct  300   TCGRMVATSGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPV  359

Query  1417  IYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRL  1596
             I+ P   V  +F    A+ I RMYHS+A LLPDGRVL+AGSN ++ Y FT    PTELR+
Sbjct  360   IFDP---VSSKFETQAASTIPRMYHSTANLLPDGRVLVAGSNTHEYYTFTG-EFPTELRV  415

Query  1597  QAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSP  1776
             +AF P Y+D   D QRPK V+         V++YG  F V   L     + D+E +  S 
Sbjct  416   EAFSPAYLDPANDWQRPKLVNY------PGVINYGMPFSVDVSLPGNL-TGDIELTLLSA  468

Query  1777  PFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSIS  1956
             PFTTHS +  QR LKL  ++  R +        +APPS V APP +YM+  ++ GIP  +
Sbjct  469   PFTTHSFSQGQRQLKLAVSTPLRANGNTFTVKSSAPPSAVIAPPSFYMLVPLHNGIPGTA  528

Query  1957  RWV  1965
              WV
Sbjct  529   TWV  531



>ref|XP_004252835.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=570

 Score =   419 bits (1077),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 230/535 (43%), Positives = 315/535 (59%), Gaps = 20/535 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             G W  L+ + G+ AMHM L + + VV FD+   G S   L       +C+  + D +   
Sbjct  47    GSWNVLLSDIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPD----GKCRYDQNDTTLKV  102

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC---  738
              C AHSVEY+V +N+IRPL   +D WCSSG++  +G+++QTGG+ DG K ++ + PC   
Sbjct  103   DCTAHSVEYNVASNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGDKVVRVYKPCSNS  162

Query  739   -VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
               + TC+W+  +  L   RWY++N ILP  + R II+GGRRA  YEF P+  +   S  L
Sbjct  163   TTNSTCDWEEIQGGLIQRRWYSTNHILP--DGRQIIIGGRRAFNYEFYPKSASANNSYSL  220

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             PFL +T + N   NNLYPF+ L+ DG LFIFAN  +ILF+Y KN V K +P +PG   R+
Sbjct  221   PFLVKTNDPNKIENNLYPFVFLNVDGNLFIFANNRAILFDYMKNVVLKNYPEIPGGDPRN  280

Query  1096  YPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             YPSTGS+++LPL +    + + EV++CGGA  G+YT A  G F   L +CGR+ I+    
Sbjct  281   YPSTGSAILLPLKNLQAQEIQAEVLVCGGAPKGSYTSALNGNFSGALSTCGRITITDPNP  340

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
             +W ME MP  R M DMVILP G +LIING   G AGW  G  P L+P IY P      RF
Sbjct  341   QWIMETMPLARTMGDMVILPNGNVLIINGAATGTAGWECGRDPVLKPVIYRPDNPFDSRF  400

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
              +   + I RMYHS+A LL DGRVL+ GSNP+  Y FT V  PTEL L+AF P Y+D   
Sbjct  401   EIQNPSTIPRMYHSTAVLLRDGRVLVGGSNPHIYYNFTGVFFPTELSLEAFSPPYLDSVS  460

Query  1633  DNQRPKNVSVYVEGSPAA--VVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMN  1806
             +  RP+        SPA+   + YG+   +RF +  +     +  +  +P F THS  MN
Sbjct  461   EYLRPQIT------SPASQHAIGYGQRVPIRFKVAGRVDINLVTVTMVAPGFNTHSFTMN  514

Query  1807  QRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             QR+L L   +++          V  P +   APPGYY++ VV++ IPS   WVK 
Sbjct  515   QRLLVLVSENVKLIGKNAYQINVVTPNNAKLAPPGYYLLFVVHQDIPSEGIWVKI  569



>gb|KFK37635.1| hypothetical protein AALP_AA3G008700 [Arabis alpina]
Length=548

 Score =   418 bits (1075),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 230/534 (43%), Positives = 322/534 (60%), Gaps = 14/534 (3%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A  G G W+ L+ N G+ AMH  L H + V+ +D+   G S   L    NGT      + 
Sbjct  26    AYGGGGTWKLLLPNVGISAMHSQLLHNDHVIMYDRSNFGPSNISLP---NGTCLNSPNDI  82

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +S   C AHS+EYDV +N IRPL   S+TWCSSG +  +GT++QTGG ++G ++ + F+P
Sbjct  83    VSKRDCTAHSIEYDVASNQIRPLTVRSNTWCSSGGLTPDGTLLQTGGDKEGERKARLFSP  142

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
             C D TC+W      L   RWYASN +LP  + R II+GGR   +YEF P+  N      L
Sbjct  143   CDDNTCDWSEVDNGLATRRWYASNHVLP--DGRQIIIGGRAQFSYEFYPK-TNAPYLFSL  199

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             PFL QT + +   NNLYP + L+ DG LFIFAN  +IL +Y+KN V K +P +PG   RS
Sbjct  200   PFLTQTDDPH-DENNLYPSVFLNRDGNLFIFANNRAILLDYKKNMVVKTYPEIPGGDPRS  258

Query  1096  YPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             YPSTGSSV+LP+ + ++   ++EV++CGGA  G++    +   ++ L +C R+ I+    
Sbjct  259   YPSTGSSVLLPIKNLEDEMVQLEVLVCGGAPKGSFQLTSRNTHVKALDTCARIKINDANP  318

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
             +W +E MP  RVM DM++LP G +L+ING   G AGW  G  P L P +Y P K VG RF
Sbjct  319   QWLVEKMPRARVMGDMILLPDGHVLLINGGGSGTAGWERGREPVLNPDLYRPNKPVGSRF  378

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
                  T I RMYHS+A LL DGR+L+ GSNP++ Y FTNV  PTEL L+AF P Y++ + 
Sbjct  379   VTQNPTTIPRMYHSTAILLRDGRILVGGSNPHEFYKFTNVLFPTELSLEAFSPSYLESKH  438

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
              + RP+ V++    +  + ++YG+   +RF +  +  S  ++ +   P F THS +M+QR
Sbjct  439   SSHRPRIVNL----TSQSTINYGQILTLRFDVTGRVKSP-VKVTMVFPSFNTHSFSMHQR  493

Query  1813  MLKL-RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             +L L    ++ R         V  P S   APPGYYMV VVN+GIPS   WV+ 
Sbjct  494   LLILDHVFAVRRLGISSYEVKVKTPRSVNLAPPGYYMVFVVNQGIPSEGVWVRL  547



>ref|XP_007039386.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY23887.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=569

 Score =   419 bits (1076),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 234/543 (43%), Positives = 322/543 (59%), Gaps = 31/543 (6%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A + QG+W+ L  + G+ AMHMAL     +V FD+   G S   L +     +C    +D
Sbjct  39    AQTYQGKWKLLKRSIGISAMHMALLPNERIVTFDRTDFGPSNITLPQ----GKC---MKD  91

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             L    C+AHSVE+D     +RPL  +SDTWCSSG +  +GT++Q+GGYR G K +++F P
Sbjct  92    LQSSDCFAHSVEFDPATRAVRPLTILSDTWCSSGALSQDGTLVQSGGYRLGEKVVRYFKP  151

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM-QKSTD  912
             C+D  C+W+  +  L   RWYASNQILP  + ++I+VGGR   TYEF+P+  +  Q+   
Sbjct  152   CMD--CDWEEDQNGLLSPRWYASNQILP--DGKIIVVGGRYQFTYEFIPKASSSDQRLYQ  207

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPFL +T       NNLYPFLHLS+DG LF+FAN   IL +Y  N+V + +P MPG  S 
Sbjct  208   LPFLKETRYSPLVSNNLYPFLHLSTDGNLFVFANDRGILLDYVNNKVIRTYPVMPGGFSH  267

Query  1093  SYPSTGSSVMLPL-----DHKNRFQ--KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRM  1251
             +YPSTGSSV+LPL     D++N       EV+ICGG    +  +A  G F+   + CGR+
Sbjct  268   NYPSTGSSVLLPLKLLSTDNENNTSTPDAEVLICGGTPPDSNEKANIGIFVPASRYCGRL  327

Query  1252  VISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG  1431
             +I+    +W ME MP  RVM DM++LPTG +LIING  +G AGWG    P L P +Y P 
Sbjct  328   IITAASPEWEMEEMPINRVMGDMIMLPTGDVLIINGAAKGSAGWGVARKPVLNPVLYRPA  387

Query  1432  KTVGK----RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQ  1599
                      RF VL  + I R+YHS+A LL DGRVL+ GSNPN  Y F+ + +PTEL L+
Sbjct  388   DNPSSDKNTRFEVLSPSMIPRLYHSTAQLLSDGRVLVGGSNPNMNYNFSAL-YPTELSLE  446

Query  1600  AFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPP  1779
             AF P Y+       RP  ++V     P   + Y ++  + F L+      D+  +  +P 
Sbjct  447   AFYPPYLSST--KPRPSILAV----RPGLKLGYKQKVSLEFTLEGNVNQGDVYVTMVAPS  500

Query  1780  FTTHSVAMNQRMLKLRCTS-MERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSIS  1956
             FTTHS+AMNQR+L L     +++  +G       AP +   APPGYY + +V+EGIPS  
Sbjct  501   FTTHSIAMNQRLLVLALDEGVKKTPSGNYLVKGYAPETAALAPPGYYQLFLVHEGIPSKG  560

Query  1957  RWV  1965
              WV
Sbjct  561   TWV  563



>ref|XP_009797023.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score =   418 bits (1074),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 228/532 (43%), Positives = 317/532 (60%), Gaps = 20/532 (4%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             G+WQ LM N G+ AMH+ L + + V+ +D+   G S   L       +C+ +  DL+   
Sbjct  34    GKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGPSNISLP----DGKCRNNPNDLALKV  89

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              C AHSVEYDV  N++RPL   +D WCSSG++ S+G+++QTGG+ DG   ++   PC   
Sbjct  90    DCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGEHMVRVVKPC--S  147

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             TC+W+    +L   RWY++N ILP  + R II+GGR+A  YEF P+  +      LPFL 
Sbjct  148   TCDWQEMGNNLIQSRWYSTNHILP--DGRQIIIGGRKAFNYEFYPKTASTNNVFSLPFLQ  205

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             QT       NNL+PF+ L+ DG LFIFAN  +IL +Y+ N V K FP++PG   R+YPS+
Sbjct  206   QTNNPREE-NNLFPFVFLNVDGNLFIFANDRAILLDYKTNTVVKTFPQIPGGDPRNYPSS  264

Query  1108  GSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             GS+V+LPL + +++  + EV++CGGA  G+Y +A +G F+  L +CGR+ I+    +W M
Sbjct  265   GSAVLLPLKNLRSQTVQAEVLVCGGAPRGSYPKADKGEFLGALNTCGRITITDPNPQWTM  324

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MP  R M DMVILP G +LIING   G AGW    +P L P IY P      RF V  
Sbjct  325   ETMPLARTMGDMVILPNGNVLIINGAASGTAGWQIARNPVLSPVIYRPDNPSDSRFEVQN  384

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
                I RMYHS+A LL DGRVL+ GSNPN+ Y FT V  PT+L L+AF P Y+D+   N R
Sbjct  385   PNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVLFPTDLSLEAFSPSYLDQESANLR  444

Query  1645  PKNVSVYVEGSPAAVVD--YGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
             P+ +      SPA+ +   YG+   + F        + ++ +  +P F THS  MNQRML
Sbjct  445   PRII------SPASHLKYTYGQRVDILFTASGLLNRDLVKVTMVAPGFNTHSFTMNQRML  498

Query  1819  KLRCTSMERGDNGMV-NavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              L  + M R     V       P S + AP GYY++ VV++ IPS + WV+ 
Sbjct  499   VLPRSGMVRQVGRFVYQISCVFPKSGIFAPLGYYLLFVVHQDIPSEAIWVRI  550



>ref|XP_006304793.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
 gb|EOA37691.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
Length=549

 Score =   418 bits (1074),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 232/537 (43%), Positives = 321/537 (60%), Gaps = 19/537 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             +++  G W  L+ N G+ AMHM L H + VV FD+   G S   L    NG       + 
Sbjct  26    SSAAGGSWNVLLPNVGISAMHMQLLHNDRVVMFDRTNFGPSNISLP---NGNCRNNPNDA  82

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +S   C AHS+EYDV  NT+RPL   S+TWCSSG++  +G ++QTGG RDG+ + + F P
Sbjct  83    VSKIDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLIQTGGDRDGALKARTFTP  142

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF--PNMQKST  909
             C D  C+W      L   RWY+SNQ+LP  + + I++GG+    YEF P+   PN+    
Sbjct  143   CNDNKCDWVEIDNGLSKRRWYSSNQLLP--DGKQIVIGGQGQFNYEFFPKTTSPNV---V  197

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
             DLPFL +T +R    NNLYPF+ +++DG LFIFAN  ++L +Y KN+V K FP +PG   
Sbjct  198   DLPFLAETNDR-GQENNLYPFVFMNTDGNLFIFANNRAMLLDYVKNKVVKTFPAIPGGDP  256

Query  1090  RSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISG  1263
             RSYPSTGS+V+LPL +    + + EV++CGGA  G+Y +A ++  F++ L +C R+ I+ 
Sbjct  257   RSYPSTGSAVLLPLKNLEAAKIEAEVLVCGGAPKGSYLQAFRRKTFVKALDTCARIKIND  316

Query  1264  NKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVG  1443
                +W +E MP  RVM DM +LP G +LI+NG   G A W  G  P L P +Y P   V 
Sbjct  317   ADPQWTVETMPHARVMGDMTLLPNGDVLIVNGGASGSAAWELGREPVLAPDLYHPENPVN  376

Query  1444  KRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMD  1623
             KRF  L  T I RMYHS+A L+ DGRVL+ GSNP+  Y FT V  PTELRL+AF P Y++
Sbjct  377   KRFESLNPTTIPRMYHSAAVLVRDGRVLVGGSNPHAFYEFTGVLFPTELRLEAFSPAYLE  436

Query  1624  RRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
              +F   RPK  +   +      + YG    ++F +  +   + ++ +  SP FTTHS +M
Sbjct  437   PKFATLRPKIQTPKSQSR----IKYGTNLKLKFTVIGEVKGQ-VKVTMVSPSFTTHSFSM  491

Query  1804  NQRMLKLRCTSMER-GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             NQR+L L      R G +      V  P S + APPGYYM+ VVN+ IPS   WV+ 
Sbjct  492   NQRLLVLDNVKFTRKGRSTTYEVQVRTPKSAIIAPPGYYMMFVVNQNIPSEGVWVRL  548



>ref|XP_006389311.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP48225.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=551

 Score =   418 bits (1074),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 239/540 (44%), Positives = 323/540 (60%), Gaps = 21/540 (4%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             +  +   QGRW+ L  N G+ AMHM L H N VV FD+   G S   L     G RC   
Sbjct  27    IPSSDGSQGRWRLLHANVGISAMHMQLMHDNKVVIFDRTDFGPSNISL----PGGRC---  79

Query  547   REDLSDPS----CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSK  714
             R D SD +    C AHS+ YD++ +T RPL   +DTWCSSG +L NGT++QTGG+ DG  
Sbjct  80    RIDPSDEALKIDCTAHSILYDIITDTYRPLMVQTDTWCSSGAVLPNGTLVQTGGFHDGDN  139

Query  715   RIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPN  894
               + +  C D  C+W     +L   RWYA+NQILP  + R+II+GGRR  +YEF PR   
Sbjct  140   VTRMYTSCPDDICDWVEYPNYLSRRRWYATNQILP--DGRIIIIGGRREFSYEFFPRPSP  197

Query  895   MQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRM  1074
              +++  L  L +T E N   NNLYP++HL  DG LFIFAN  SILF+Y +NRV ++FPR+
Sbjct  198   RRQTFQLRLLIETREGNVE-NNLYPYVHLFPDGNLFIFANTRSILFDYNQNRVVREFPRI  256

Query  1075  PGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
             PG   R+YPSTGSSV+LPLD        EV++CGGA  GAY +A +G ++  + +CGR+ 
Sbjct  257   PGGDPRNYPSTGSSVLLPLDENEHSIDPEVLVCGGAPRGAYQQALRGTYVRAISTCGRLR  316

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+     W M+ MP PRVM DM++LPTG ++IING + G AGW  G   A  P +Y P  
Sbjct  317   ITDQNASWVMDTMPIPRVMGDMLLLPTGDVIIINGGQSGTAGWELGRQAATRPVMYHPSN  376

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
                +RFSV+  +   RMYHS+A LL DGRVL+ G NP+  Y F++V +PT+L L+ F P 
Sbjct  377   PSDQRFSVMEPSPRPRMYHSAAILLTDGRVLVGGGNPHIYYNFSDVFYPTDLSLETFSPP  436

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHS  1794
             Y+  ++ + RP  +SV    SP      G+ F + F + +      L     +P FTTHS
Sbjct  437   YLSTQYASIRPVILSVDDTVSP------GQRFLLSFSVGEYIAGSVLSVRIVAPSFTTHS  490

Query  1795  VAMNQRMLKLRCTS-MERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              +MNQRM+ LR    ++   +      V  P S   APPGYY++ VV+ GIPS   WV+ 
Sbjct  491   YSMNQRMVVLRIDEIIDNETSSSYTLSVVGPSSAEIAPPGYYLLYVVHSGIPSSGVWVRL  550



>gb|EPS72896.1| hypothetical protein M569_01859, partial [Genlisea aurea]
Length=516

 Score =   416 bits (1070),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 229/532 (43%), Positives = 322/532 (61%), Gaps = 18/532 (3%)
 Frame = +1

Query  382   SGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCK-GSREDL  558
             S  G W+ L  + G+ AMHM L + + VV FD+   G S   L    NG RC+  S E +
Sbjct  1     SAGGEWRLLQRSIGISAMHMQLLNDDRVVVFDRTDFGPSNLSLP---NG-RCRYDSHEMV  56

Query  559   SDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC  738
             S   C AHSV YDV +NT R L   +D WCSSG +L NGT++Q GG+ DG++ ++  +PC
Sbjct  57    SKKDCTAHSVLYDVSSNTFRALTVQTDPWCSSGAVLPNGTLLQIGGFNDGAQTVRMQSPC  116

Query  739   VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLP  918
                 C+W    + L   RWYA+ QILP  +  VI+VGGRR  +YEF PR  +   S +  
Sbjct  117   SGGDCDWVEFPRVLSRRRWYATAQILPDGD--VIVVGGRREYSYEFWPRRSD-SGSFEFD  173

Query  919   FLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSY  1098
             FL +T + +   NNLYPF+HL  DG LFIFAN  S+LF+YR+N V ++FP + G  +R+Y
Sbjct  174   FLRETSDDSE--NNLYPFVHLLPDGNLFIFANTRSVLFDYRRNDVVREFPEIRGGDARNY  231

Query  1099  PSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKW  1278
             PS+G+SV+LP+D        E+MICGGAS  AY  A +G F     +C R+ ++  + +W
Sbjct  232   PSSGASVLLPIDETAAESNSEIMICGGASPAAYQAALRGTFRRATSTCARLNLAAREPEW  291

Query  1279  NMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSV  1458
              +E+MP PRVM+DM+ILPTG  LI+NG   G AGW N   P++ P IY P +    RFSV
Sbjct  292   KLEHMPTPRVMSDMLILPTGDFLIVNGATSGAAGWENARDPSMRPLIYRPNEQPDGRFSV  351

Query  1459  LRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDN  1638
             +  ++  R+YHS+A LL DGR+L+ GSNP++ Y FT V +PT+L L++F P Y+    D+
Sbjct  352   MAESQRPRLYHSTAVLLADGRILVGGSNPHEYYNFTGVDYPTDLSLESFSPPYLSPDNDH  411

Query  1639  QRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRML  1818
              RP+            ++ Y K F V F  +   PS  +     +PPF+THS +MNQRM+
Sbjct  412   LRPRITDA------DRILSYHKPFTVDFTAESLNPSA-VTVRLLAPPFSTHSFSMNQRMV  464

Query  1819  KLRCTSMERGDNGM-VNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              L+  ++    + M  +   AAP +   APPGYY++ VV+  IPS   W+K 
Sbjct  465   VLKIAAISCDSSRMRCHVNAAAPSTAEIAPPGYYLLFVVHCEIPSHGSWIKI  516



>ref|XP_007227672.1| hypothetical protein PRUPE_ppa026498mg, partial [Prunus persica]
 gb|EMJ28871.1| hypothetical protein PRUPE_ppa026498mg, partial [Prunus persica]
Length=552

 Score =   418 bits (1074),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 242/568 (43%), Positives = 328/568 (58%), Gaps = 36/568 (6%)
 Frame = +1

Query  319   FLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRS  498
             +L +  P +++NA+   +   S  G+W  L ++ GV AMHM L   + V+ FD+   G S
Sbjct  1     YLTNPTPFSSINAT---TSNVSAGGQWVLLHKSIGVSAMHMQLLKNDKVILFDRTDMGLS  57

Query  499   GYQLR-----RRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTI  663
              +        R++N T  +     ++D  C AHS++YDV++  IRPL   SDTWCSSG +
Sbjct  58    NFSFPSGTGCRKYNDTHHR--NRTITD--CTAHSLQYDVISGNIRPLYVSSDTWCSSGAL  113

Query  664   LSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVII  843
               NGT++QTGGY  G ++I+  APC D  C W     +L D RWYAS QILP  + RVI+
Sbjct  114   DPNGTLIQTGGYGPGIRKIRTVAPCDDGKCEWTELPVNLADGRWYASTQILP--DGRVIV  171

Query  844   VGGRRASTYEFVPRFPNM-QKSTDLPFLHQT---YERNAGGNNLYPFLHLSSDGYLFIFA  1011
             VGGRRA +YEF P+  ++  K   L FL +T   YE     NNLYPFLHL  DG LFIFA
Sbjct  172   VGGRRAFSYEFYPKTDDVSSKRYYLSFLAETTDPYEE----NNLYPFLHLLPDGNLFIFA  227

Query  1012  NRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-----KVEVMICG  1176
             N  SIL +Y++NRV K+ P +P    R+YPSTGSSV+LPL            + EV+ICG
Sbjct  228   NNRSILLDYKQNRVVKELPVIPDGIKRTYPSTGSSVLLPLKMNGSLDGSDKPEAEVLICG  287

Query  1177  GASAGAYTEAKQGR-FIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILII  1353
             G+  GA+  +   R F+    SCGR+ ++    KW ME MP PRVM+DM++LPTG ++I+
Sbjct  288   GSPPGAFNMSNLNRVFVSASNSCGRIKLTDPDPKWVMEEMPMPRVMSDMLLLPTGDVIIL  347

Query  1354  NGVKRGCAGWGNGASPALEPYI---YSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRV  1524
             NG   G AGW + A+P   P +   Y P   +  RF VL  +   RMYHSSA LLPDG +
Sbjct  348   NGASNGTAGWEDAANPVFNPVLYKTYEPDPNL--RFVVLNPSSTPRMYHSSALLLPDGSI  405

Query  1525  LIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGK  1704
             L+ GSNP++ Y FT  P PT+L L+A+ P Y+       RP  +++    S   +V YG+
Sbjct  406   LVGGSNPHEMYNFTARPFPTDLSLEAYQPPYLGPLLAVLRPSILTIEARDS---IVSYGQ  462

Query  1705  EFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaap  1884
              F V F L        +     +P FTTHS +MNQRM+ L    +E             P
Sbjct  463   MFSVTFMLSVYRADPGISVVLITPSFTTHSFSMNQRMVVLDVARLENLSAFAYKIAAYGP  522

Query  1885  pspvaappGYYMVTVVNEGIPSISRWVK  1968
             P    APPGYYM+ +V+ G PS + WVK
Sbjct  523   PKTTVAPPGYYMLFLVHAGTPSHAVWVK  550



>ref|XP_008444780.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=563

 Score =   418 bits (1074),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 228/530 (43%), Positives = 319/530 (60%), Gaps = 15/530 (3%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DP  567
             G W  L EN GV+ MHM L H + VV FD+   G S       F   +C+    D++   
Sbjct  45    GGWHLLQENIGVLPMHMQLLHNDRVVIFDRTDFGASNLS----FPDGKCRTDPNDVALKL  100

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              C AHS+EYD+ +N+ RPL   +D WCS+G  +S+G ++QTGG+ DG +R++ F P  + 
Sbjct  101   DCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMSDGALVQTGGFNDGDRRVRIFKPYPNG  160

Query  748   TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLH  927
             + +W+     L   RWY +NQILP  + R I++GGRR  +YEFVP+     K+   PFL 
Sbjct  161   S-DWEEIPFALAVRRWYPTNQILP--DGRQIVIGGRRQFSYEFVPKTNGATKAYSFPFLV  217

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             +T +     NNLYPF+ L+ DG LF+FAN  SILF+Y +N+V K FP +PG   R YPST
Sbjct  218   ETNDPMIE-NNLYPFVFLNVDGNLFVFANNRSILFDYARNKVLKIFPAIPGGDPRCYPST  276

Query  1108  GSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNM  1284
             GS+ +LPL + +    + EV++CGGA  GA+ +A    F+  L +C ++ I+  K +W M
Sbjct  277   GSAALLPLRNLQAATIEAEVLVCGGAPKGAFDKAVNRIFVGALNTCAKIKITDPKPEWVM  336

Query  1285  ENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
             E MP  RVM DMV+LP G +LIING   G AGW N   P L P +Y P  + G RF +L 
Sbjct  337   ETMPMGRVMGDMVLLPNGNVLIINGAGSGTAGWDNARDPVLNPVLYRPNDSPGSRFRLLN  396

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
              + I R+YHS+A LL DGRVL+ GSNPN  Y FT VP PTELRL+AF P Y+D  F+N R
Sbjct  397   PSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNFTGVPFPTELRLEAFSPPYLDPEFENLR  456

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSED-LEFSAYSPPFTTHSVAMNQRMLK  1821
             PK +S     S    V + ++  VRF +     + + +E +  +PPF THS +M+QR+L 
Sbjct  457   PKILS----PSSQTTVSHAQQLAVRFTVTGNNVTLNAVEVTMVAPPFNTHSFSMSQRLLV  512

Query  1822  LRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             +   ++    N   +  V+ P S   AP GYY++ VV+  IPS   W++ 
Sbjct  513   IGGENVTDMGNATWDVHVSIPKSGTIAPSGYYLLFVVHREIPSNGIWIRL  562



>ref|XP_010458940.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score =   418 bits (1074),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 239/539 (44%), Positives = 328/539 (61%), Gaps = 28/539 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             GRW  L  + G+ AMHM L H N VV FD+   G S   L        C+ +    +   
Sbjct  42    GRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHL----CQNA----TVFD  93

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV---  741
             C AHS+ YDV +NT RPL    DTWCSSG++ ++G+++QTGGY  G + ++ F PC    
Sbjct  94    CSAHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGSGERTVRVFTPCDGVG  153

Query  742   DKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPF  921
               +C+W   + +L   RWY++NQILP  + R+IIVGGRRA +YEF P+ P  +   +L F
Sbjct  154   SLSCDWVENRAYLSSRRWYSTNQILP--DGRIIIVGGRRAFSYEFYPKNPG-KSVFNLRF  210

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T + N   NNLYPFLHL  DG LFIFANR SILF++  +R+ K+FP +PG   R+YP
Sbjct  211   LAETRDPNEE-NNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPAIPGGDKRNYP  269

Query  1102  STGSSVMLPL---DHKNRFQ-KVEVMICGGASAGAYTEAKQ---GRFIEGLKSCGRMVIS  1260
             STGSSV+LPL      NR +   EVM+CGGA  GA+ +A +     F+ G +SCGR+ ++
Sbjct  270   STGSSVLLPLLLTGESNRSKIAAEVMVCGGAPPGAFFKAARTIPKIFVGGSRSCGRLKVT  329

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-T  1437
                 +W ME MP PRVM DM++LP G +LIING   G AGW +  +  L P +Y P +  
Sbjct  330   DPNPRWIMEQMPSPRVMGDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPVLYLPDEPD  389

Query  1438  VGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDY  1617
               +RF +L  T+I RMYHS++ LL DGRVL+ GSNP+  Y FT  P+PTEL L+A++P Y
Sbjct  390   PTRRFEILAPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTASPYPTELSLEAYLPRY  449

Query  1618  MDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE-DLEFSAYSPPFTTHS  1794
             +D ++   RP  ++V + G     +  G+ F V F +      +  +     +P F+THS
Sbjct  450   LDPQYVRVRPTIITVELAGK----MLNGQGFAVTFVIPAFGMFDGGVSVRLVAPSFSTHS  505

Query  1795  VAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              AMNQRML LR   + +       A V  P +   APPGYYM+ VV+ GIPS++ WVK 
Sbjct  506   TAMNQRMLVLRVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  564



>ref|XP_011003791.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=551

 Score =   417 bits (1072),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 240/544 (44%), Positives = 324/544 (60%), Gaps = 21/544 (4%)
 Frame = +1

Query  355   ASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTR  534
              S  +  +   QG W+ L  N G+ AMHM L H N VV FD+   G S   L     G R
Sbjct  23    VSQTIPSSGGSQGNWRLLQANVGISAMHMQLMHDNKVVIFDRTDFGPSNISLP----GGR  78

Query  535   CKGSREDLSDPS----CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYR  702
             C   R D SD +    C AHS+ YD++ +T RPL   +DTWCSSG +L NGT++QTGG+ 
Sbjct  79    C---RIDPSDEALKIDCTAHSILYDIITDTYRPLMVQTDTWCSSGAVLPNGTLVQTGGFH  135

Query  703   DGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVP  882
             DG    + +  C + +C+W     +L   RWYA+NQILP  + R+II+GGRR  +YEF P
Sbjct  136   DGDNVTRMYTSCPNDSCDWVEYPNYLSRRRWYATNQILP--DGRIIIIGGRREFSYEFFP  193

Query  883   RFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKK  1062
             R    +++  L  L +T E N   NNLYP++HL  DG LFIFAN  SILF+Y +NRV ++
Sbjct  194   RPSPRRQTFQLRLLIETREGNVE-NNLYPYVHLLPDGNLFIFANTQSILFDYNQNRVVRE  252

Query  1063  FPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSC  1242
             FPR+PG   R+YPSTGSSV+LPLD        EV++CGGA  GAY +A +G +I  + +C
Sbjct  253   FPRIPGGDPRNYPSTGSSVLLPLDENEHSIDPEVLVCGGAPRGAYQQALRGTYIRAISTC  312

Query  1243  GRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIY  1422
             GR+ I+     W ME MP PRVM DM++LPTG ++IING + G AGW  G   A  P +Y
Sbjct  313   GRLRITDQNASWVMETMPIPRVMGDMLLLPTGDVIIINGGQLGTAGWELGRQAATRPVMY  372

Query  1423  SPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQA  1602
              P     +RFSV+  +   RMYHS+A LL DGRVL+ G NP+  Y F++V +PT+L L+ 
Sbjct  373   HPSNPSDQRFSVMEPSPRPRMYHSAAILLTDGRVLVGGGNPHIYYNFSDVFYPTDLSLET  432

Query  1603  FVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPF  1782
             F P Y+  ++ + RP  +SV    SP      G+ F + F + +      L     +P F
Sbjct  433   FSPPYLSTQYASIRPVILSVDDTVSP------GQRFLLSFSVGEYIAGSVLSVRIVAPSF  486

Query  1783  TTHSVAMNQRMLKLRCTSMERGD-NGMVNavvaappspvaappGYYMVTVVNEGIPSISR  1959
             TTHS +MNQRM+ LR   +   + +      V  P S   APPGYY++ VV+ GIPS   
Sbjct  487   TTHSYSMNQRMVVLRIDGIIHNETSSSYTLSVVGPSSAEIAPPGYYLLYVVHSGIPSSGV  546

Query  1960  WVKF  1971
             WV+ 
Sbjct  547   WVRL  550



>ref|XP_003561804.1| PREDICTED: galactose oxidase-like [Brachypodium distachyon]
Length=569

 Score =   417 bits (1073),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 239/545 (44%), Positives = 314/545 (58%), Gaps = 30/545 (6%)
 Frame = +1

Query  394   RWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-S  570
             RW  L  + GV AMHM L   + V+ FD+   G S   L       RC+ +  +   P  
Sbjct  34    RWDILQHSIGVSAMHMQLLRNDRVIIFDRTDFGPSNLSLP----DGRCRRNPHERVLPVD  89

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHS EYDV  N  RPL   +DTWCSSGT+  +GT++QTGG+ DG +  +  APCVD T
Sbjct  90    CTAHSAEYDVRTNAFRPLSVFTDTWCSSGTVSPDGTLVQTGGWNDGYRNARTMAPCVDGT  149

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM-QKSTDLPFLH  927
             C+W   +  L   RWYA+NQILP  + R  IVGGRR  +YEF P+  +    +  LPFL 
Sbjct  150   CDWNETQDALAANRWYATNQILP--DGRAFIVGGRRQFSYEFYPKQADHPSDAIALPFLV  207

Query  928   QTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPST  1107
             QT  ++   NNLYPF+HL+ DG LFIFA   ++L +Y++N++ + +P + G   R+YPS+
Sbjct  208   QT--KDPEENNLYPFVHLNIDGNLFIFAKNRAVLLDYKRNKIVRTYPELAGGDPRNYPSS  265

Query  1108  GSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNME  1287
             GSSV+LPL  K    + EV++CGGA AG+Y   K   F   L +CGR+ I+     W +E
Sbjct  266   GSSVLLPL--KPSPTEAEVLVCGGAPAGSYNATKDKSFPPALTTCGRIRITDAAPSWTIE  323

Query  1288  NMPGPRVMNDMVILPTG-QILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLR  1464
              MP PRVM DM++LP G ++ IING   G AGW +  +PA  P IY P    G RF    
Sbjct  324   TMPSPRVMGDMILLPNGAEVAIINGATDGSAGWESANTPAYAPLIYRPDHAPGDRFEEQS  383

Query  1465  ATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQR  1644
             A+ IAR+YHSSA LL DGRVL+ GSNP+  Y F+NV +PTEL L+AF P+Y+DR  D  R
Sbjct  384   ASGIARLYHSSAVLLRDGRVLVGGSNPHVYYNFSNVRYPTELSLEAFSPEYLDRTNDVLR  443

Query  1645  PKNVSVYVEGSPAAVVDYGKEFHVRFWLDKK-WPSED-------------LEFSAYSPPF  1782
             P        G+PA+V  YG    ++F +     PS               +  +  +P F
Sbjct  444   PAITDPSPTGAPASVT-YGGSMTLQFSVPAAPAPSSRRAHGGGGGGGLGFVSVTMVAPSF  502

Query  1783  TTHSVAMNQRMLKLRC--TSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSIS  1956
             TTHS  MNQR+L L    T+      G     V  P + V APPGYY+V VVN  IPS  
Sbjct  503   TTHSFGMNQRLLFLDVLETAASSSTPGAYEVSVVMPATAVIAPPGYYLVFVVNGHIPSEG  562

Query  1957  RWVKF  1971
              WV  
Sbjct  563   IWVHI  567



>ref|XP_002301997.2| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|EEE81270.2| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=506

 Score =   415 bits (1067),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 227/516 (44%), Positives = 309/516 (60%), Gaps = 14/516 (3%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNT  612
             MHM L   + VV +D+   GRS   L    +G     S E +    C AHSVEYDVL N 
Sbjct  1     MHMQLLSNDRVVIYDRTDFGRSNLSLP---DGKCRNDSSELVIKYDCTAHSVEYDVLANR  57

Query  613   IRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDER  792
              RPL   SD WCSSG ++ +G ++QTGG+ DG ++++ F+PC    C+W+     L  +R
Sbjct  58    FRPLMVQSDVWCSSGAVVPDGRLIQTGGFNDGERKVRIFSPCNGADCDWEEVGDGLKAKR  117

Query  793   WYASNQILPGKNDRVIIVGGRRASTYEFVPR--FPNMQKSTDLPFLHQTYERNAGGNNLY  966
             WYA++ ILP  + R II+GGRR   YEF P+   PN+     LPFL +T +R    NNLY
Sbjct  118   WYATSHILP--DGRQIIIGGRRQFNYEFYPKSSAPNVYS---LPFLMETNDRGIE-NNLY  171

Query  967   PFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDH-KN  1143
             PF+ L+ DG LFIFAN  +ILF+++ N+V K +P +PG   RSYPSTGS+V+LPL + + 
Sbjct  172   PFVFLNGDGNLFIFANNRAILFDHKTNKVVKTYPAIPGGDPRSYPSTGSAVLLPLKNLQA  231

Query  1144  RFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMV  1323
                + EV++CGGA  G++ + + G F++ L +C R+ I+    +W ME MP  RVM DM 
Sbjct  232   STIEAEVLVCGGAPKGSFAKVENGTFVQALDTCARIKINDPNPRWVMETMPTARVMGDMT  291

Query  1324  ILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAA  1503
             +LP G +LIING   G AGW  G  P L P +Y P    G RF +   + I RMYHS+A 
Sbjct  292   LLPNGNVLIINGAGAGTAGWEKGRDPVLNPVLYRPDDASGSRFELQNPSTIPRMYHSTAI  351

Query  1504  LLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPA  1683
             LL DGRVL+ GSNP+ GY FT V  PTEL L+AF P Y+D  FD+ RP  VS     S  
Sbjct  352   LLRDGRVLVGGSNPHIGYEFTGVLFPTELSLEAFSPSYLDPNFDDLRPTIVS--SSASEG  409

Query  1684  AVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMV  1863
               + YG++  VRF +  K  ++ +  +  +P F THS +MN R+L L    +      + 
Sbjct  410   KNIGYGQKLLVRFKVTSKIVTDMVSVTMVAPAFNTHSFSMNHRLLVLGNEKVTVVGTSIY  469

Query  1864  NavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             +  V  PPS   AP G+YM+ VV++ IPS   WVK 
Sbjct  470   DIQVMTPPSGDLAPSGHYMLYVVHQEIPSEGLWVKI  505



>ref|XP_006390288.1| hypothetical protein EUTSA_v10018361mg [Eutrema salsugineum]
 gb|ESQ27574.1| hypothetical protein EUTSA_v10018361mg [Eutrema salsugineum]
Length=552

 Score =   417 bits (1071),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 234/534 (44%), Positives = 318/534 (60%), Gaps = 14/534 (3%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A+   G WQ L+ N G+ AMH  L   + V+ FD+   G S   L    NG       + 
Sbjct  30    ASGAGGTWQLLLSNVGISAMHSQLLINDRVIIFDRTNFGPSNISLP---NGACHDSPNDA  86

Query  556   LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +S   C AHS+EYDV  N IRPL   S+TWCSSG +L +GT++QTGG +DG ++ + F+P
Sbjct  87    VSKQDCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVLPDGTLLQTGGDKDGERKARLFSP  146

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDL  915
             C D +C+W      L   RWYASN ILP  + R II+GGR    +EF P+  N      L
Sbjct  147   CQDNSCDWTEVDNGLAARRWYASNHILP--DGRQIIIGGRGQFNFEFFPK-TNAPNLYSL  203

Query  916   PFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRS  1095
             PFL QT +R    NNLYP++ L+SDG +FIFAN  +IL +Y KN V K +P +PG   RS
Sbjct  204   PFLSQTNDR-GDENNLYPYVFLNSDGNMFIFANNRAILLDYSKNNVFKTYPEIPGGDPRS  262

Query  1096  YPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYT-EAKQGRFIEGLKSCGRMVISGNK  1269
             YPSTGS+V+LP+ + +     +EV++CGGA  G++    ++  F++ L +C R+ I+   
Sbjct  263   YPSTGSAVLLPVKNLEATVVDLEVLVCGGAPKGSFDLSLRRNTFVKALDTCARIKINDAN  322

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
              +W +E MP  RVM DM +LP G +L+ING   G AGW  G  P L P +Y P K VG R
Sbjct  323   PQWIVEKMPRARVMGDMTLLPDGHVLLINGGSSGTAGWELGREPVLNPDLYHPDKPVGSR  382

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             F VL  + I RMYHS+A LL DGRVL+ GSNP+  Y FT V  PTELRL+AF P Y++ +
Sbjct  383   FEVLNPSTIPRMYHSTAGLLRDGRVLVGGSNPHAFYNFTGVLFPTELRLEAFSPSYLETQ  442

Query  1630  FDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQ  1809
             + + RP+ VS  ++    + ++YG    +RF +  +  S  ++ +   P FTTHS +MNQ
Sbjct  443   YRSIRPRIVSPTLQ----STINYGGILRLRFRVMGRVKSP-VKVTMVFPSFTTHSFSMNQ  497

Query  1810  RMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             R+L L      R         V  P S   APPG+YMV VVN+ IPS   WV+ 
Sbjct  498   RLLVLDHFGSSRMGLWTHEVRVKIPRSANLAPPGFYMVFVVNQDIPSEGIWVRL  551



>ref|XP_002970610.1| hypothetical protein SELMODRAFT_93556 [Selaginella moellendorffii]
 gb|EFJ28740.1| hypothetical protein SELMODRAFT_93556 [Selaginella moellendorffii]
Length=535

 Score =   416 bits (1069),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 244/542 (45%), Positives = 323/542 (60%), Gaps = 26/542 (5%)
 Frame = +1

Query  349   LNASVLVSEAASGQ-GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFN  525
             L+  VL+S +   Q GR+  + +N GV +MH  +TH +  +F D+   G S  Q+     
Sbjct  13    LSVVVLISSSTRAQPGRFDVIAQNAGVASMHTVVTHFSNAIFLDRTNIGPS--QINLAAG  70

Query  526   GTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRD  705
             G R       L    C AHSV +D  +   R L   SDTWCSSG  L NGT++QTGG  D
Sbjct  71    GCRDNPDDRTLKH-DCTAHSVMFDYFSGASRALSIYSDTWCSSGQFLPNGTLLQTGGDFD  129

Query  706   GSKRIQFFAPCVDK-TCNWKPGK-KHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFV  879
             G  ++++  PC +  TC+W+  K + L+  RWYASNQ+LP  + RVI+VGGR A +YEF+
Sbjct  130   GFFKVRYMTPCPNGGTCDWQESKTEFLHSGRWYASNQLLP--DGRVIVVGGRSAFSYEFI  187

Query  880   PRFPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEK  1059
             P     Q   +LPFL +T +     NNLYPFLHL  D  LF+FANRDSIL NY  N V +
Sbjct  188   PDRGAGQ--FELPFLKETNDPTF--NNLYPFLHLLPDNNLFVFANRDSILLNYFTNTVLR  243

Query  1060  KFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKS  1239
             ++P +PGE  R+YPS GSSVMLPLD  N F   E+++CGG++  AY  A     +   ++
Sbjct  244   RYPTLPGE-PRNYPSAGSSVMLPLDSANSFSNAEILVCGGSNKDAY--AYPAGQLPASQT  300

Query  1240  CGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYI  1419
             CGRMV +     WN+ NMP  R M DMV+LPTGQ+LIING + G  GWG  +SP L P I
Sbjct  301   CGRMVATSGDPNWNILNMPTRRNMGDMVLLPTGQVLIINGAQSGSQGWGYASSPCLNPVI  360

Query  1420  YSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQ  1599
             + P   V  +F    A+ I RMYHS+A LLPDGRVL+AGSN ++ Y FT    PTELR++
Sbjct  361   FDP---VSSKFETQAASTIPRMYHSTANLLPDGRVLVAGSNTHEYYTFTGA-FPTELRVE  416

Query  1600  AFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPP  1779
             AF P Y+D   D QRPK V+         V++YG  F V   L     + D+E +  S P
Sbjct  417   AFSPAYLDPANDWQRPKLVNY------PGVINYGMPFSVDVSLPGNL-TGDIELTLLSAP  469

Query  1780  FTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISR  1959
             FTTHS +  QR LKL  ++  R +        +APPS V APP +YM+  ++ GIP  + 
Sbjct  470   FTTHSFSQGQRQLKLAVSTPLRANGNTFTVKSSAPPSAVIAPPSFYMLFPLHNGIPGTAT  529

Query  1960  WV  1965
             WV
Sbjct  530   WV  531



>ref|XP_001771865.1| predicted protein [Physcomitrella patens]
 gb|EDQ63294.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   414 bits (1065),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 226/510 (44%), Positives = 319/510 (63%), Gaps = 22/510 (4%)
 Frame = +1

Query  439   MALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNNTI  615
             MALTH N V+ FD+   G S  +L   F    C+ +  DL+    C+AHS+E D+  + I
Sbjct  1     MALTHTNRVIMFDRTDYGPSQIKLPGGF----CRKNPRDLALKVDCWAHSIELDLTTSKI  56

Query  616   RPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERW  795
             RPL  ++DTWCSSG   ++G++ QTGG+ DG   ++          +WK  +  L   RW
Sbjct  57    RPLTVMTDTWCSSGAFQADGSLTQTGGWNDGGTAVRKIG--YTGLDDWKEFENSLAAARW  114

Query  796   YASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPFL  975
             YA+NQILP  + R I++GGRR   YEFVPRF   +    LP L QT +  A  NNLYPF+
Sbjct  115   YATNQILP--DGRQIVIGGRRQFNYEFVPRF-RGEGVHPLPLLAQTNDPEAE-NNLYPFV  170

Query  976   HLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQK  1155
             HLS+DG LFIFAN+DSIL NY+  +  ++FPR+ G G R+YPS+GSSV+LP+   + ++ 
Sbjct  171   HLSTDGNLFIFANQDSILLNYKTGKEVRRFPRLAG-GPRNYPSSGSSVLLPITAVDGYKA  229

Query  1156  VEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPT  1335
              EV++CGG+  G++     G+F + L++CGR++I+    +W +ENMP PRVM DM+ILPT
Sbjct  230   AEVLVCGGSPQGSFQNVGLGKFAQALQTCGRILITSPNPQWAIENMPSPRVMGDMLILPT  289

Query  1336  GQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPD  1515
              ++LIING K G AGWG    P+L P +Y+P     +RF  +  + I R+YHS+A +LPD
Sbjct  290   AEVLIINGAKFGTAGWGVARQPSLGPVLYTPET---RRFQEMTPSAIPRLYHSTAIVLPD  346

Query  1516  GRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVD  1695
             G++L+AGSNPN GY F  V +PTELR++ + P Y+ + ++ +RP     ++     A   
Sbjct  347   GKILVAGSNPNPGYSFVGVLNPTELRIEKYSPYYLYKGYNFRRP-----HITNIDNANPK  401

Query  1696  YGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavv  1875
             YG  F V F +        ++F  Y+PPF TH+ +MNQRML L          G+  A V
Sbjct  402   YGAAFKVTFKVATA--PTGVKFHLYAPPFVTHTYSMNQRMLVLGSKPPVAVGGGLYAATV  459

Query  1876  aappspvaappGYYMVTVVNEGIPSISRWV  1965
              APP+ V AP GYYM+TV+N G PS S W+
Sbjct  460   VAPPTGVIAPAGYYMLTVINGGTPSPSAWL  489



>tpg|DAA44472.1| TPA: glyoxal oxidase [Zea mays]
Length=580

 Score =   417 bits (1073),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 240/558 (43%), Positives = 324/558 (58%), Gaps = 34/558 (6%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             ++ A+   GRW     + GV AMHM L H + V+ FD+   G S   L       RC+ +
Sbjct  31    IAPASGAGGRWDLQQRSIGVSAMHMQLLHNDRVIIFDRTDFGHSNLSLPD----GRCRVN  86

Query  547   RED--LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
               +  L    C AHSVEYDV  N  RPL   +DTWCSSGT+  +GT++QTGG+ DG +  
Sbjct  87    PRERVLPQGDCTAHSVEYDVAANAFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGFRNA  146

Query  721   QFFAPCVD--KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF-P  891
             +    C D  ++C+W   +  L   RWYA+NQILP  + R  I+GGRR  +YEF P+  P
Sbjct  147   RTMPACSDGDESCDWSETQDALSANRWYATNQILP--DGRAFIIGGRRQFSYEFYPKAGP  204

Query  892   NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPR  1071
             +      +PFL QT  R+   NNLYPF+HL+ DG LFIF+N  ++L +Y  N++ + +P 
Sbjct  205   SDTSVIPMPFLVQT--RDPEENNLYPFVHLNIDGNLFIFSNNRAVLLDYSSNKIVRTYPV  262

Query  1072  MPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQ------GRFIEGL  1233
             +     R+YPS+GSSV+LPL  K    + EV++CGGA AG+Y   KQ      G F+  L
Sbjct  263   LGDGDPRNYPSSGSSVLLPL--KPNPTEAEVLVCGGAPAGSYNSTKQQQGGTAGAFVPAL  320

Query  1234  KSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTG-QILIINGVKRGCAGWGNGASPALE  1410
              +CGR+ I+     W +E MP PRVM DMV+LP G ++ IING   G AGW +  +PA  
Sbjct  321   TTCGRIKITDAAPAWVIETMPSPRVMGDMVLLPNGAEVAIINGAADGTAGWESAKTPAYA  380

Query  1411  PYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTEL  1590
             P +Y P  + G RF    A  +AR+YHSSA LL DGR+L+ GSNP+  Y F+NV  PT+L
Sbjct  381   PVVYRPDHSPGDRFEEQNAAGVARLYHSSAVLLRDGRLLVGGSNPHTYYNFSNVQFPTDL  440

Query  1591  RLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWL---------DKKWP  1743
              L+AF P+Y+D   D  RP+ +     G+PA+ V YG    +RF +          +   
Sbjct  441   SLEAFSPEYLDASNDMLRPRILDPSPTGAPAS-VGYGATMAIRFLVPALARRRRGGRAGG  499

Query  1744  SEDLEFSAYSPPFTTHSVAMNQRMLKLRCTS--MERGDNGMVNavvaappspvaappGYY  1917
               D+  +  +P FTTHS AMNQR+L L  T     RG  G  +A V  P + V APPGYY
Sbjct  500   LGDVSVTMVAPSFTTHSFAMNQRLLFLDVTKNVAVRGRAGAFSASVTMPATAVLAPPGYY  559

Query  1918  MVTVVNEGIPSISRWVKF  1971
             M+ VVN  IPS   WVK 
Sbjct  560   MLFVVNGHIPSEGIWVKI  577



>ref|NP_001149941.1| glyoxal oxidase precursor [Zea mays]
 gb|ACG37287.1| glyoxal oxidase [Zea mays]
Length=579

 Score =   417 bits (1072),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 239/557 (43%), Positives = 323/557 (58%), Gaps = 33/557 (6%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             ++ A+   GRW     + GV AMHM L H + V+ FD+   G S   L       RC+ +
Sbjct  31    IAPASGAGGRWDLQQRSIGVSAMHMQLLHNDRVIIFDRTDFGHSNLSLPD----GRCRVN  86

Query  547   RED--LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
               +  L    C AHSVEYDV  N  RPL   +DTWCSSGT+  +GT++QTGG+ DG +  
Sbjct  87    PRERVLPQGDCTAHSVEYDVAANAFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGFRNA  146

Query  721   QFFAPCVD--KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF-P  891
             +    C D  ++C+W   +  L   RWYA+NQILP  + R  I+GGRR  +YEF P+  P
Sbjct  147   RTMPACSDGDESCDWSETQDALSANRWYATNQILP--DGRAFIIGGRRQFSYEFYPKAGP  204

Query  892   NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPR  1071
             +      +PFL QT  R+   NNLYPF+HL+ DG LFIF+N  ++L +Y  N++ + +P 
Sbjct  205   SDTSVIPMPFLVQT--RDPEENNLYPFVHLNIDGNLFIFSNNRAVLLDYSSNKIVRTYPV  262

Query  1072  MPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQ-----GRFIEGLK  1236
             +     R+YPS+GSSV+LPL  K    + EV++CGGA AG+Y   KQ     G F+  L 
Sbjct  263   LGDGDPRNYPSSGSSVLLPL--KPNPTEAEVLVCGGAPAGSYNSTKQQGGTAGAFVPALT  320

Query  1237  SCGRMVISGNKHKWNMENMPGPRVMNDMVILPTG-QILIINGVKRGCAGWGNGASPALEP  1413
             +CGR+ I+     W +E MP PRVM DM++LP G ++ IING   G AGW +  +PA  P
Sbjct  321   TCGRIKITDATPAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWESAKTPAYAP  380

Query  1414  YIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELR  1593
              +Y P  + G RF    A  +AR+YHSSA LL DGR+L+ GSNP+  Y F+NV  PT+L 
Sbjct  381   VVYRPDHSPGDRFEEQNAAGVARLYHSSAVLLRDGRLLVGGSNPHTYYNFSNVQFPTDLS  440

Query  1594  LQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWL---------DKKWPS  1746
             L+AF P+Y+D   D  RP+ +     G+P A V YG    +RF +          +    
Sbjct  441   LEAFSPEYLDASNDMLRPRILDPSPTGAP-ATVGYGATMAIRFLVPALARRRRGGRAGGL  499

Query  1747  EDLEFSAYSPPFTTHSVAMNQRMLKLRCTS--MERGDNGMVNavvaappspvaappGYYM  1920
              D+  +  +P FTTHS AMNQR+L L  T     RG  G  +A V  P + V APPGYYM
Sbjct  500   GDVSVTMVAPSFTTHSFAMNQRLLFLDVTKNVAVRGRAGAFSASVTMPATAVLAPPGYYM  559

Query  1921  VTVVNEGIPSISRWVKF  1971
             + VVN  IPS   WVK 
Sbjct  560   LFVVNGHIPSEGIWVKI  576



>ref|XP_006342232.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   416 bits (1070),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 228/535 (43%), Positives = 309/535 (58%), Gaps = 17/535 (3%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A +  G+W  LM N G+ AMHM L + + V+ +D+   G S   L       +C+ + ++
Sbjct  30    ANAAGGKWDLLMPNIGISAMHMQLLNNDRVIMYDRTDFGASNIPLP----DGKCRNNPKE  85

Query  556   LS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
             L+    C AHSVEYDV  N+IRPL   +D WCSSG+  S+G+++QTGG+ DG   ++ F 
Sbjct  86    LALKVDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGKLMVRTFN  145

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC   TC+W+     L   RWY++N ILP  +   II+GGR A  YEF P+  +      
Sbjct  146   PC--NTCDWQEMGDGLVQSRWYSTNHILPDGSQ--IIIGGRDAFNYEFFPKTASTNNVFS  201

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPFL QT       NNLYPF+ L+ DG LFIF N  +IL +Y  N + K +P++PG   R
Sbjct  202   LPFLQQTNVPREE-NNLYPFVFLNVDGNLFIFTNDRAILLDYTTNTIVKTYPQIPGGDPR  260

Query  1093  SYPSTGSSVMLPLDH---KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISG  1263
             +YPSTGS+V+LPL +   +  F + EV++CGGA  G+Y  A +G F+  L +CGR+ I+ 
Sbjct  261   NYPSTGSAVLLPLKNLRSQTVFVQAEVLVCGGAPKGSYLRATKGDFVGALNTCGRITITD  320

Query  1264  NKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVG  1443
                +W ME MP PR M DMVILP G +LI+NG   G AGW    +P L P IY P     
Sbjct  321   PNPQWTMETMPLPRTMGDMVILPNGNVLIVNGAATGTAGWQIARNPVLSPVIYRPDNPSD  380

Query  1444  KRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMD  1623
              RF V     I RMYHS+A LL DGRVL+ GSNPN+ Y FT V  PTEL L+AF P Y+D
Sbjct  381   SRFEVQTPNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVVFPTELSLEAFSPSYLD  440

Query  1624  RRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
               F N RP+ +S            YG+   +RF        + ++ +  +P F THS  M
Sbjct  441   AEFANLRPQIIS----PDSHLKFTYGQRVDIRFTALGLLNRDSIKVTIVAPGFNTHSNTM  496

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             NQRML L    + +    +       P S   APPGYY++ VV++ IPS + WV+
Sbjct  497   NQRMLVLPRGIVRQVGRFVYEVSCVFPNSGKLAPPGYYLLFVVHQDIPSEAIWVR  551



>ref|XP_010536366.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=551

 Score =   415 bits (1067),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 233/536 (43%), Positives = 311/536 (58%), Gaps = 16/536 (3%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             +A+G GRWQ L  + G+ AMHM L   + VV FD+   G S   L       +C  S +D
Sbjct  27    SAAGGGRWQLLQSSIGISAMHMQLLRNDRVVIFDRTDFGPSNISLP----AGKCIDSPDD  82

Query  556   -LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
              +S   C AHSVEYDV +N  R L   SDTWCSSG+++ NGT++QTGG +DG +R++ F+
Sbjct  83    PVSKVDCTAHSVEYDVTSNRFRTLTVQSDTWCSSGSVIPNGTLVQTGGDKDGERRVRLFS  142

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC    C+W      L   RWYA+N ILP  + R II+GGRR   +E+ P+         
Sbjct  143   PCGSNGCDWSEIDDGLAVRRWYATNHILP--DGRQIIIGGRRQWNFEYYPKTAEAPNVYS  200

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPFL QT +R +  NNLYP + L+ DG LF+FAN  +IL +Y KN V + +P +PG   R
Sbjct  201   LPFLVQTNDRGSE-NNLYPNVFLNVDGNLFVFANNRAILLDYSKNIVIRTYPTVPGGDPR  259

Query  1093  SYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISGN  1266
             SYPSTGS+V+LPL +      + EV++CGGA  GA+ +A K+  F++ L +C R+ I+  
Sbjct  260   SYPSTGSAVLLPLKNLEASNVEAEVLVCGGAPRGAFEQALKERTFVKALDTCARIKITDQ  319

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK  1446
               KW ME MP  RVM DM++LP G +L+ING   G AGW  G  P L P +Y P    G 
Sbjct  320   NPKWVMETMPQARVMGDMILLPNGNVLLINGGSSGTAGWELGREPVLSPDLYRPDNPFGS  379

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF       I RMYHS+A LL DGRVL+ GSNP+  Y FTNV   TEL L+AF P Y+D 
Sbjct  380   RFETQNPNSIPRMYHSTAILLRDGRVLVGGSNPHTYYNFTNVLFRTELSLEAFSPSYLDS  439

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMN  1806
                N RPK +S   +      + Y  +  + F + +   +  ++ +   P F THS +MN
Sbjct  440   ESSNLRPKIISPKSQSR----IKYNTQLKLVFTISEAV-TNPVKVTMVYPSFNTHSFSMN  494

Query  1807  QRMLKLRCTSMER-GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             QR+L L      R G++      V  P S   AP GYYM+ VVN+ IPS   WV  
Sbjct  495   QRLLILDNVMFTRSGESATYEVEVKTPRSANLAPSGYYMMFVVNQDIPSDGIWVHL  550



>gb|EMT01589.1| hypothetical protein F775_04099 [Aegilops tauschii]
Length=566

 Score =   416 bits (1068),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 243/561 (43%), Positives = 318/561 (57%), Gaps = 30/561 (5%)
 Frame = +1

Query  346   ALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFN  525
             AL  + +   +  G GRW  L  + GV AMHM L H + V+ FD+   G+S   L     
Sbjct  16    ALACAGIAPASGGGGGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFGQSNLSLPD---  72

Query  526   GTRCK-GSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYR  702
               RC+   RE +    C AHS EYDV +NT RPL   +DTWCSSGT+  +GT++QTGG+ 
Sbjct  73    -GRCRRNPRERVLPVDCTAHSAEYDVASNTFRPLFVFTDTWCSSGTVAPDGTLVQTGGWN  131

Query  703   DGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVP  882
             DG + ++    C   +C+W   +  L   RWYA+NQILP  + R  IVGGRR   YEF P
Sbjct  132   DGYRNVRAMRACDGGSCDWNETQDALAANRWYATNQILP--DGRAFIVGGRRQFNYEFFP  189

Query  883   RFPNMQKSTD-LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEK  1059
             +      S   LPFL QT  R+   NNLYPF+HL+ DG LFIFA   ++L +Y+KN++ +
Sbjct  190   KADASDASAIALPFLVQT--RDPEENNLYPFVHLNIDGNLFIFAKNRAVLLDYKKNKIVR  247

Query  1060  KFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKS  1239
              +P + G   R+YPS+GSSV+LPL  K    + EV+ICGGA AG+Y   K+  F   L +
Sbjct  248   TYPELAGGDPRNYPSSGSSVLLPL--KPSPTEAEVLICGGAPAGSYNSTKEKTFFPALVT  305

Query  1240  CGRMVISGNKHKWNMENMPGPRVMNDMVILPTG-QILIINGVKRGCAGWGNGASPALEPY  1416
             CGR+ I+     W +E M  PRVM DM++LP G +++IING   G AGW    +PA  P 
Sbjct  306   CGRIKITDASPAWVIERMSSPRVMGDMILLPNGAEVVIINGAMDGTAGWEAANTPAYAPV  365

Query  1417  IYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRL  1596
             +Y P    G RF    AT IAR+YHSSA LL DGRVL+ GSNP+  Y F+N  +PTEL L
Sbjct  366   VYRPDHAPGDRFEEQSATDIARLYHSSAILLRDGRVLVGGSNPHIYYNFSNEQYPTELSL  425

Query  1597  QAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSED--------  1752
             +AF P+Y+D   D  RPK ++      PA  V YG    ++F +    P           
Sbjct  426   EAFSPEYLDSSNDALRPK-ITHPSPADPAVSVKYGDSMTLQFEVPAVAPRRRPRGGGDGD  484

Query  1753  ------LEFSAYSPPFTTHSVAMNQRMLKLRCT--SMERGDNGMVNavvaappspvaapp  1908
                   +  +  +P FTTHS  MNQR+L L     +   G  G   A V  P + V APP
Sbjct  485   GGSLGLVSVTMVAPSFTTHSFGMNQRLLFLDVAGPTALHGAAGAYEASVVMPATAVLAPP  544

Query  1909  GYYMVTVVNEGIPSISRWVKF  1971
             GYYMV VVN  IPS   WV  
Sbjct  545   GYYMVFVVNGHIPSEGVWVHI  565



>ref|XP_008350495.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=536

 Score =   414 bits (1065),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 231/543 (43%), Positives = 324/543 (60%), Gaps = 25/543 (5%)
 Frame = +1

Query  349   LNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNG  528
              N SVL + AA G  +WQ L +N G+ AMHM L   + +V FD+   G+S   L    NG
Sbjct  16    FNFSVLTAHAAGG--KWQVL-KNVGISAMHMQLFKNDRIVMFDRTDFGKSNLSLA---NG  69

Query  529   TRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDG  708
                     +  +  C AHS E+ V  N +RPL  +SD WCSSG++ + G ++QTGG+  G
Sbjct  70    --------NCVNNDCTAHSAEFVVQTNALRPLTVLSDVWCSSGSMDAYGNLIQTGGFNSG  121

Query  709   SKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF  888
              +R++ F PC    C+WK     L   RWYA+N +LP  + R II+GGR    YEF P+ 
Sbjct  122   ERRVRVFTPCTG--CDWKETVDGLAVRRWYATNHMLP--DGREIIIGGRGQFNYEFSPKT  177

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
              +      LPFL QT +     NNLYPF+ L+ DG LFIFAN  +IL +Y KN V K +P
Sbjct  178   ESTSNVYSLPFLSQTNDPGQE-NNLYPFVFLNPDGNLFIFANNRAILLDYVKNAVVKTYP  236

Query  1069  RMPGEGSRSYPSTGSSVMLPLDHKNR-FQKVEVMICGGASAGAYTEAKQGRFIEGLKSCG  1245
             ++PG   RSYPSTGS+V+LPL +      + EV++CGGA  G++++A +G F+E L +C 
Sbjct  237   QIPGGDPRSYPSTGSAVLLPLKNLTAPAVEAEVLVCGGAPKGSFSQANKGVFVEALNTCA  296

Query  1246  RMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYS  1425
             R+ I+    +W +E MP  RVM DM++LP   +LIING   G AGW  G +P L P +Y 
Sbjct  297   RIKITDPNPQWIVETMPQARVMGDMILLPDSTVLIINGASSGAAGWEIGRNPVLNPVVYQ  356

Query  1426  PGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVF-TNVPHPTELRLQA  1602
             P   +G RF     T I RMYHSSA L+ DGRV++ GSNP+D Y F +NV  PTELRL+A
Sbjct  357   PDNAIGSRFEQQNPTTIPRMYHSSALLVRDGRVIVGGSNPHDKYQFGSNVLFPTELRLEA  416

Query  1603  FVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPF  1782
             F P+Y+D ++ + RP  ++   +    A + YG++  V+F L  ++    +  +  +PPF
Sbjct  417   FSPEYLDAKYADLRPTIIAPRNQ----AKIRYGRKLTVQFSLAGRFAMNSVSVTMVAPPF  472

Query  1783  TTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRW  1962
             +THS +MNQR+L L   +  +       A V  PPS   AP GYY++ VV++ IPS   +
Sbjct  473   STHSFSMNQRLLVLGAENTHQVGPTTYEAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIF  532

Query  1963  VKF  1971
             VK 
Sbjct  533   VKI  535



>ref|NP_177692.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAF87115.1|AC006434_11 F10A5.18 [Arabidopsis thaliana]
 gb|AEE35738.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score =   414 bits (1065),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 237/540 (44%), Positives = 322/540 (60%), Gaps = 20/540 (4%)
 Frame = +1

Query  361   VLVSEAASG-QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRC  537
             +L    ASG +G W+ L+ N G+ AMH  L H + V+ +D+   G S   L    NG  C
Sbjct  24    LLSCHVASGDEGTWELLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLP---NGA-C  79

Query  538   KGSRED-LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSK  714
             + S  D +S   C AHSVEYDV  N IRPL   S+TWCSSG +  +GT++QTGG  DG +
Sbjct  80    RSSPGDAVSKTDCTAHSVEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTGGDLDGER  139

Query  715   RIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPN  894
             +++   PC D +C+W      L   RWYA+N ILP  + R II+GGR    YEF P+  N
Sbjct  140   KVRLMDPCDDNSCDWIEVDNGLAARRWYATNHILP--DGRQIIIGGRGQFNYEFFPK-TN  196

Query  895   MQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRM  1074
                   +PFL +T +     NNLYPF+ L++DG LFIFAN  +IL +Y  N V + +P +
Sbjct  197   APNFYSIPFLSETNDP-GDENNLYPFVFLNTDGNLFIFANNRAILLDYSTNTVVRTYPEI  255

Query  1075  PGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMV  1254
             PG   RSYPSTGS+V+LP+  KN    +EV++CGGA  G+Y  + +  F++ L +C R+ 
Sbjct  256   PGGDPRSYPSTGSAVLLPI--KNLV--LEVLVCGGAPKGSYNLSWRNTFVKALDTCARIN  311

Query  1255  ISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK  1434
             I+    +W +E MP  RVM DM++LP G +L+ING   G A W  G  P L P +Y P K
Sbjct  312   INDVNPQWIVEKMPRARVMGDMMLLPDGNVLLINGGSSGTAAWELGREPVLHPDLYHPDK  371

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
              VG RF V   + I RMYHS A LL DGR+L+ GSNP+  Y FT V  PTELRL+AF P 
Sbjct  372   PVGSRFEVQNPSTIPRMYHSIATLLRDGRILVGGSNPHAFYNFTGVLFPTELRLEAFSPS  431

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHS  1794
             Y+D ++ + RP      V+  P   V+YG+   +RF +  +  S  ++ +   P FTTHS
Sbjct  432   YLDTKYSSLRPS----IVDPRPQTTVNYGRVLRLRFIVSGRVKSP-VKVTMLFPSFTTHS  486

Query  1795  VAMNQRMLKL-RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              +M+QR+L L    S + G + +    V  P S + APPGYYMV VVN+ IPS   WV+ 
Sbjct  487   FSMHQRLLVLDHVISFKLGISKIYEVRVRTPSSAILAPPGYYMVFVVNQDIPSEGLWVRL  546



>ref|XP_010471675.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score =   414 bits (1064),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 314/529 (59%), Gaps = 18/529 (3%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W+ L+ N G+ AMH  L H + V+ +D+   G S   L    NG   K   + +S   
Sbjct  35    GTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLP---NGACRKSPNDAVSKTD  91

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHSVEY+V  N+IRPL   S+TWCSSG +  +GT++QTGG RDG ++ + FAPC D +
Sbjct  92    CTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGERKTRLFAPCDDDS  151

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W      L   RWYASN +LP  + R II+GGR    YEF P+  N     +LPFL Q
Sbjct  152   CDWTEVDNGLAASRWYASNHVLP--DGRQIIIGGRDQFNYEFFPK-TNAPNLYELPFLAQ  208

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T +     NNLYP++ L++DG LFIFAN  +IL NY  N V K +P +PG   RSYPSTG
Sbjct  209   TTDPGQE-NNLYPYVFLNTDGNLFIFANNRAILLNYATNTVVKTYPEIPGGDPRSYPSTG  267

Query  1111  SSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKSCGRMVISGNKHKWNME  1287
             S+V+LP+  KN    +EV++CGGA  G+Y  A Q + FI+ L +C R+ I+    +W +E
Sbjct  268   SAVLLPI--KNLV--LEVLVCGGAPKGSYILASQRKTFIKALDTCARININDENPQWAVE  323

Query  1288  NMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRA  1467
              MP  RVM DM +LP G +L+ING   G A W  G  P   P IY P + VG RF    A
Sbjct  324   KMPRARVMGDMTLLPDGHVLLINGGSSGTAAWDLGREPVFNPDIYHPDRPVGSRFEPQNA  383

Query  1468  TKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRP  1647
               I RMYHS+A LL DGRV++ GSNP+  Y FT V  PTEL L+AF P Y++ ++ + RP
Sbjct  384   NAIPRMYHSTATLLRDGRVIVGGSNPHAYYNFTGVLFPTELSLEAFSPSYLESKYSSLRP  443

Query  1648  KNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLR  1827
                 V ++  P   ++YG+   +RF +  +  +  ++ +   P F THS +M+QR+L L 
Sbjct  444   ----VIMDPMPQTTINYGQILRLRFTVQGRVKTP-VKVTMVYPSFNTHSFSMSQRLLVLD  498

Query  1828  CTSMER-GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
                  R G + +    V  P S   APPGYYMV VVN+ IPS   WV+ 
Sbjct  499   HVLFLRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQDIPSEGVWVRL  547



>ref|XP_010554972.1| PREDICTED: galactose oxidase [Tarenaya hassleriana]
Length=565

 Score =   415 bits (1066),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 256/581 (44%), Positives = 349/581 (60%), Gaps = 32/581 (6%)
 Frame = +1

Query  274   LRTTLPCAITALLVLFLVSLRPCNALNASVLVS---EAASGQGRWQTLMENTGVVAMHMA  444
             +R   P A +  L+  +VS     + +  +L     E  +G GRW  L  + GV AMHM 
Sbjct  1     MRLETPAATSFFLLYAVVSTFIAGSTSDVILPRSPFEIFTG-GRWDLLQPSIGVSAMHMQ  59

Query  445   LTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPL  624
             L H N VV FD+  SG S   L  +        S  D     C AHS+ YDV++NT RPL
Sbjct  60    LLHNNKVVVFDRTDSGPSNLSLPSQ--------SCPDDVVFDCSAHSILYDVVSNTFRPL  111

Query  625   RFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT---CNWKPGKKHLYDERW  795
                SDTWCSSG++ S+G+++QTGGY  G + ++ F PC       C+W     +L   RW
Sbjct  112   TLRSDTWCSSGSLDSDGSLIQTGGYGAGDRAVRRFDPCFPNDVVLCDWAENSTYLSSRRW  171

Query  796   YASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST-DLPFLHQTYERNAGGNNLYPF  972
             Y++NQILP  + R+IIVGGRRA TYEF P+  N+ K    L FL +T +     NNLYPF
Sbjct  172   YSTNQILP--DGRIIIVGGRRAFTYEFYPK--NLDKPIFYLRFLAETRD-PIEENNLYPF  226

Query  973   LHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPL--DHKNR  1146
             LHL  DG LFIFANR SILF++  + V K+FP +PG   R+YPSTGSSV+LPL  D ++R
Sbjct  227   LHLLPDGNLFIFANRRSILFDFVNHTVVKEFPEIPGGDKRNYPSTGSSVLLPLWLDRESR  286

Query  1147  FQKVEVMICGGASAGAYTEAKQGR---FIEGLKSCGRMVISGNKHKWNMENMPGPRVMND  1317
                 E+MICGGA  G++ +A +     F+E  ++CGR+ ++    +W ME MP PRVM+D
Sbjct  287   TTAAEIMICGGAPPGSFLKAARTIPKIFVEASRTCGRLRVTDPNPRWVMEQMPAPRVMSD  346

Query  1318  MVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFSVLRATKIARMYHS  1494
             M++LPTG ++IING   G AGW +  +  L P++YSP +    +RF +L  T I RMYHS
Sbjct  347   MILLPTGDVIIINGATNGTAGWEDSTNAMLNPFLYSPDEPDPTRRFQILAPTLIPRMYHS  406

Query  1495  SAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEG  1674
             +A LLPDGR+L+ GSNP+  Y FT  P+PTEL L+A++P Y+D RF   RP  ++V + G
Sbjct  407   AALLLPDGRILVGGSNPHRNYNFTTRPYPTELSLEAYLPRYLDPRFSRLRPSVLTVEMAG  466

Query  1675  SPAAVVDYGKEFHVRFWLDKKWPSE-DLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGD  1851
             +    + YG  F V F +      +  +     +P F+THS AMNQR++ LR   + +  
Sbjct  467   T----MSYGNGFSVNFVIPAYGVFDGGISVRLVAPSFSTHSTAMNQRLVVLRVRRVMQLS  522

Query  1852  NGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFA  1974
                  A V  P +   APPGYYM+ VV+ GIPS + WVK A
Sbjct  523   VFAYKADVDGPSNANVAPPGYYMMFVVHRGIPSEAVWVKVA  563



>ref|XP_010471676.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=548

 Score =   414 bits (1064),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 314/529 (59%), Gaps = 18/529 (3%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             G W+ L+ N G+ AMH  L H + V+ +D+   G S   L    NG   K   + +S   
Sbjct  35    GTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLP---NGACRKSPNDAVSKTD  91

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHSVEY+V  N+IRPL   S+TWCSSG +  +GT++QTGG RDG ++ + FAPC D +
Sbjct  92    CTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGSRDGERKTRLFAPCDDDS  151

Query  751   CNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQ  930
             C+W      L   RWYASN +LP  + R II+GGR    YEF P+  N     +LPFL Q
Sbjct  152   CDWTEVDNGLAASRWYASNHVLP--DGRQIIIGGRDQFNYEFFPK-TNAPNLYELPFLAQ  208

Query  931   TYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTG  1110
             T +     NNLYP++ L++DG LFIFAN  +IL NY  N V K +P +PG   RSYPSTG
Sbjct  209   TTDPGQE-NNLYPYVFLNTDGNLFIFANNRAILLNYATNTVVKTYPEIPGGDPRSYPSTG  267

Query  1111  SSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKSCGRMVISGNKHKWNME  1287
             S+V+LP+  KN    +EV++CGGA  G+Y  A Q + FI+ L +C R+ I+    +W +E
Sbjct  268   SAVLLPI--KNLV--LEVLVCGGAPKGSYILASQRKTFIKALDTCARININDENPQWAVE  323

Query  1288  NMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRA  1467
              MP  RVM DM +LP G +L+ING   G A W  G  P   P IY P + VG RF    A
Sbjct  324   KMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPVFNPDIYHPDRPVGSRFEPQNA  383

Query  1468  TKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRP  1647
               I RMYHS+A LL DGRV++ GSNP+  Y FT V  PTEL L+AF P Y++ ++ + RP
Sbjct  384   NAIPRMYHSTATLLRDGRVIVGGSNPHAYYNFTGVLFPTELSLEAFSPSYLESKYSSLRP  443

Query  1648  KNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLR  1827
                 V ++  P   ++YG+   +RF +  +  +  ++ +   P F THS +M+QR+L L 
Sbjct  444   ----VIMDPMPQTTINYGQILRLRFTVQGRVKTP-VKVTMVYPSFNTHSFSMSQRLLVLD  498

Query  1828  CTSMER-GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
                  R G + +    V  P S   APPGYYMV VVN+ IPS   WV+ 
Sbjct  499   HVLFLRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQDIPSEGVWVRL  547



>ref|XP_002961909.1| hypothetical protein SELMODRAFT_77682 [Selaginella moellendorffii]
 gb|EFJ37169.1| hypothetical protein SELMODRAFT_77682 [Selaginella moellendorffii]
Length=551

 Score =   414 bits (1063),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 224/542 (41%), Positives = 323/542 (60%), Gaps = 33/542 (6%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRR---RFNGTRCKGSREDLS  561
             G W+ L++N G+ AMHM LTH N V+ FD   SG S         +  G+R  G  +   
Sbjct  27    GTWKLLVDNAGISAMHMVLTHNNKVILFDGFSSGPSNISQPSGECKNTGSRIPGKLD---  83

Query  562   DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV  741
                C AHSVEYDV  NTIRPL   +DTWCSS   +++GT++Q GG  +GS+ ++  A C 
Sbjct  84    ---CSAHSVEYDVATNTIRPLTIYTDTWCSSAVTIADGTLVQVGGLNNGSQTVRHLAAC-  139

Query  742   DKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPF  921
              + C+W   ++ L  +R ++S+ +LP  ++RVI+VGGR   +YEFVPR  N +   +L F
Sbjct  140   -QRCDWVESRQRLAVKRRFSSSHLLP--DNRVIVVGGRGQFSYEFVPRQDN-EGVHELSF  195

Query  922   LHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYP  1101
             L +T + +   +NLYPF+HL+ DG LF+FAN DSIL +Y+  +V K+FPRMPG  +R+YP
Sbjct  196   LAETNDLSQ--DNLYPFVHLTPDGNLFVFANSDSILLDYKTGKVVKRFPRMPGLEARNYP  253

Query  1102  STGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWN  1281
             S+GSSVML L+  + +   ++++CGGA    Y +A +G F+   ++CGR+ +      W 
Sbjct  254   SSGSSVMLALEGASDYSDAQILVCGGADPYNYAQASRGNFLNASQNCGRIKLGDASPSWA  313

Query  1282  MENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVL  1461
             ME MP PRVM DM++LPTG +LIING +RG AGW +  +PAL P +Y P   +  RF  L
Sbjct  314   MEAMPMPRVMGDMLLLPTGDVLIINGAQRGTAGWRSARNPALHPVLYKPNLKLYNRFQTL  373

Query  1462  RATKIARMYHSSAALLPDGRVLIAGSNPNDGYVF---TNVPHPTELRLQAFVPDYMDRRF  1632
              A    R++HSSA LLPD  VL+ GSNPN  Y F   T+  +PT++ L+ F P Y+D  +
Sbjct  374   TAASRPRLHHSSAILLPDASVLVGGSNPNGRYSFATATDGVYPTDVSLEVFSPPYLDSDY  433

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
               +RP   SV    SPA    +G    VR+ L   +       +  +PPF +H+V+M QR
Sbjct  434   AARRPSVTSVST-ASPA----HGTRLTVRYRLRGHFFPGTTGVALLAPPFASHAVSMGQR  488

Query  1813  MLKLRCTSMERGDNGMVNav---------vaappspvaappGYYMVTVVNEGIPSISRWV  1965
             M++L   ++   D+   +             AP S   AP GYYM+ VV+ G+PS + W+
Sbjct  489   MIRLPLHNVTLVDDAPASISGRVPTYEIETTAPRSASVAPSGYYMLFVVHAGLPSHATWI  548

Query  1966  KF  1971
               
Sbjct  549   NL  550



>ref|XP_006300296.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
 gb|EOA33194.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
Length=547

 Score =   414 bits (1063),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 236/534 (44%), Positives = 317/534 (59%), Gaps = 19/534 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A+   G W+ L+ N G+ AMH  L H + V+ +D+   G S   L    NG  C+ S  D
Sbjct  30    ASGAGGSWKLLLSNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLP---NGA-CRNSPND  85

Query  556   L-SDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
             + S   C AHSVEYDV  N+IRPL   S+TWCSSG +  +GT++QTGG RDG ++ + FA
Sbjct  86    IVSKTDCTAHSVEYDVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTGGDRDGERKTRLFA  145

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC D +C+W    K L   RWYASN +LP  + R IIVGG+    +EF P+  N      
Sbjct  146   PCDDGSCDWTEIDKGLNARRWYASNHVLP--DGRQIIVGGQGQFNFEFFPK-TNAPNLYS  202

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPFL QT +R    NNLYP++ L++DG LFIFAN  +IL NY  N V K +P +P    R
Sbjct  203   LPFLSQTNDRGEE-NNLYPYVFLNTDGNLFIFANNRAILLNYATNTVVKTYPEIPEGDPR  261

Query  1093  SYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISGNK  1269
             SYPSTGS+V+LP+  KN    +EV++CGGA  G+Y  + ++  F++ L +C R+ I+   
Sbjct  262   SYPSTGSAVLLPI--KNLV--LEVLVCGGAPKGSYNLSFRKKTFVKALDTCARININDAN  317

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKR  1449
              +W +E MP  RVM DM +LP G +L+ING   G A W  G  PA  P +Y P K VG R
Sbjct  318   PQWLVEKMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPAFNPDLYHPDKPVGSR  377

Query  1450  FSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRR  1629
             F V  A  I RMYHS A LL DGRVL+ GSNP+  Y FT V  PTEL L+AF P Y++ +
Sbjct  378   FEVQNANAIPRMYHSIATLLRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPSYLESQ  437

Query  1630  FDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQ  1809
             + + RP+     ++  P   ++Y +   +RF +  +  S  ++ +   P FTTHS +MNQ
Sbjct  438   YSSLRPR----IIDPMPQTTINYSRILRLRFTVSGRVKSP-VKVTMVYPSFTTHSFSMNQ  492

Query  1810  RMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             R+L L      R        +V  P S   APPGYYMV VVN+ IPS   W++ 
Sbjct  493   RLLVLDHVFSFRRGFRTYEVIVRTPSSAELAPPGYYMVFVVNQDIPSEGVWLRL  546



>ref|NP_172895.2| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAF43943.1|AC012188_20 Weak similarity to glyoxal oxidase (glx2) from Phanerochaete 
chrysosporium gb|L47287 [Arabidopsis thaliana]
 gb|AEE29162.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=564

 Score =   414 bits (1064),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 246/587 (42%), Positives = 345/587 (59%), Gaps = 41/587 (7%)
 Frame = +1

Query  259   METHQLRTTLPCAITALLVLFLVS----LRPCNALNASVLVSEAASGQGRWQTLMENTGV  426
             M   + +  L   + +    FL S    L P + L        A    GRW  L  + G+
Sbjct  1     MTQERFKNNLNAVVISFFFFFLCSTSDLLLPRSPL--------AILTGGRWDLLQPSVGI  52

Query  427   VAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLN  606
              AMHM L H N VV FD+   G S   L  +        + ++ +   C AHS+ YDV +
Sbjct  53    SAMHMQLLHNNKVVIFDRTDYGPSNVSLPSQ--------TCQNATVFDCSAHSILYDVAS  104

Query  607   NTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCV----DKTCNWKPGKK  774
             NT RPL    DTWCSSG++ ++G+++QTGGY +G + ++ F PC       +C+W   + 
Sbjct  105   NTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGNGERTVRVFTPCDGGVGSVSCDWIENRA  164

Query  775   HLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGG  954
             +L   RWY++NQILP  + R+IIVGGRRA  YEF P+ P  +   +L FL +T + N   
Sbjct  165   YLSSRRWYSTNQILP--DGRIIIVGGRRAFNYEFYPKDPG-ESVFNLRFLAETRDPNEE-  220

Query  955   NNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPL-  1131
             NNLYPFLHL  DG LFIFANR SILF++  +R+ K+FP++PG   R+YPSTGSSV+LPL 
Sbjct  221   NNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPQIPGGDKRNYPSTGSSVLLPLF  280

Query  1132  ---DHKNRFQKVEVMICGGASAGAYTEAKQ---GRFIEGLKSCGRMVISGNKHKWNMENM  1293
                D        EVM+CGGA  GA+ +A +     F+ G ++CGR+ ++    KW ME M
Sbjct  281   LTGDINRTKITAEVMVCGGAPPGAFFKAARTIPKIFVAGSRTCGRLKVTDPDPKWVMEQM  340

Query  1294  PGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFSVLRAT  1470
             P PRVM+DM++LP G +LIING   G AGW +  +  L P +Y P +    +RF +L  T
Sbjct  341   PSPRVMSDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPILYLPEEPDQTRRFEILTPT  400

Query  1471  KIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPK  1650
             +I RMYHS++ LL DGRVL+ GSNP+  Y FT  P+PTEL L+A++P Y+D ++   RP 
Sbjct  401   RIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTARPYPTELSLEAYLPRYLDPQYARVRPT  460

Query  1651  NVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE-DLEFSAYSPPFTTHSVAMNQRMLKLR  1827
              ++V + G+    + YG+ F V F +      +  +     +P F+THS AMNQR+L LR
Sbjct  461   IITVELAGN----MLYGQAFAVTFAIPAFGMFDGGVSVRLVAPSFSTHSTAMNQRLLVLR  516

Query  1828  CTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
                + +       A V  P +   APPGYYM+ VV+ GIPS++ WVK
Sbjct  517   VRRVSQLSVFAYKADVDGPTNSYVAPPGYYMMFVVHRGIPSVAVWVK  563



>ref|XP_009625411.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase-like [Nicotiana 
tomentosiformis]
Length=550

 Score =   413 bits (1062),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 234/535 (44%), Positives = 320/535 (60%), Gaps = 17/535 (3%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A +  G+WQ LM N G+ AMHM L + + V+ +D+   G S   L    NG +C+ +  D
Sbjct  29    ANAAGGQWQLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLP---NG-KCRNNPND  84

Query  556   LS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
             L+    C AHSVEYDV  N++RPL   +D WCSSG++ S+G+++QTGG+ DG + ++   
Sbjct  85    LALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVDSDGSLVQTGGFNDGERMVRVVK  144

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC   TC+W+    +L   RWY++N ILP  + R II+GGR+A  YEF P+  +      
Sbjct  145   PC--STCDWQEMGSNLIQSRWYSTNHILP--DGRQIIIGGRKAFNYEFYPKTASTNNVFS  200

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPFL QT       NNL+PF+  + DG LFIFAN  +ILF+Y+ N+V K +P++PG   R
Sbjct  201   LPFLQQTNNPREE-NNLFPFVFXNVDGNLFIFANDRAILFDYKANKVVKTYPQIPGGDPR  259

Query  1093  SYPSTGSSVMLPLDHKNRFQKV--EVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGN  1266
             +YPS+ S+V+LPL +  R QKV  EV++CGGA  G+Y +A +G FI  L +CGR+ I+  
Sbjct  260   NYPSSDSAVLLPLKNL-RTQKVQAEVLVCGGAPRGSYPKADKGEFIGALNTCGRITITDP  318

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK  1446
               +W ME MP  R M DMVILP G +LIING   G AGW     P L P IY P   +G 
Sbjct  319   NPQWTMETMPLARTMGDMVILPNGNVLIINGAAAGTAGWQIAGKPVLSPVIYRPDNPLGS  378

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF V  +  I R+YHS+A LL DGRVL  GSNPN+ Y FT V  PT+L L+AF P Y+D 
Sbjct  379   RFEVQNSNVIPRIYHSTAILLRDGRVLTGGSNPNEFYNFTGVLFPTDLSLEAFSPSYLDP  438

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMN  1806
                N R + +S+           YG+   +RF +     ++ ++ +  +P F THS  MN
Sbjct  439   ESANLRSQIISLASRHK----TKYGQSVSIRFTVSGLLNTDLVKVTMVAPGFNTHSNTMN  494

Query  1807  QRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             QRML L    + R      +  +  P S   APPGYYM+ VV++ IPS   WVK 
Sbjct  495   QRMLVLSSGKVRRIGKSTYHINLIFPSSGKLAPPGYYMLFVVHQDIPSKGIWVKI  549



>ref|XP_010924630.1| PREDICTED: uncharacterized protein LOC105047413 [Elaeis guineensis]
Length=590

 Score =   414 bits (1065),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 222/536 (41%), Positives = 315/536 (59%), Gaps = 25/536 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP-  567
             G W+ + EN GV AMH+ +   N  + FD    G S   L +          R D + P 
Sbjct  71    GEWKLVRENAGVSAMHLVIMKNNKAIMFDTTVLGPSQIALPQ-------GNCRVDPNSPV  123

Query  568   ---SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPC  738
                 C+AH+VE+D+    +RPL+ ++DTWCSSG   + GT++QTGGY DG + +++  PC
Sbjct  124   KALDCWAHAVEFDIDTAEVRPLKVLTDTWCSSGGFDAEGTLVQTGGYNDGGRAVRYLKPC  183

Query  739   VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVP---RFPNMQKST  909
                 C+W+     L  ++WY++ QILP  N   ++VGGRR   YE+VP   +   +Q   
Sbjct  184   AG--CDWEEFTYDLSAQKWYSTQQILP--NGSFVVVGGRREFNYEYVPPAGKANTVQDVR  239

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
             DLPFL +T   +   NNLYPF+HL++DG LFIFAN  +IL + + + V +++P +PG GS
Sbjct  240   DLPFLRET--TDVIENNLYPFVHLNTDGNLFIFANDRAILLDPKADTVIREYPSLPG-GS  296

Query  1090  RSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNK  1269
             R+YP++G SV+LPLD +      EV+ICGG    ++  +    F+  L SCGR+ ++   
Sbjct  297   RNYPASGMSVLLPLDLRRTDVNPEVLICGGCPRDSFNLSAVKIFVPALTSCGRIAVNNPD  356

Query  1270  HKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG-KTVGK  1446
               WNME MP PR + DM++LP  ++LIING  +G AGW     P L P +Y PG      
Sbjct  357   AAWNMEEMPMPRTLGDMLLLPNAEVLIINGAAKGSAGWRQAKEPVLTPVLYRPGLADADG  416

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF VL  + I RMYHS++A+LPDG +L+AGSN ND Y F     PTELR++ F P Y+D 
Sbjct  417   RFRVLAPSTIPRMYHSTSAVLPDGDILVAGSNTNDRYRFIGEEFPTELRVEKFRPPYLDP  476

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMN  1806
               +N RP    + V   P   + YG+ F + F   +    +DL  + Y+PPFTTH ++MN
Sbjct  477   ALNNHRP---VIDVNVLPGEGMKYGRNFTIAFTTTEPVERDDLMVTMYAPPFTTHGISMN  533

Query  1807  QRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFA  1974
             QR+L L+         G     V APPS   APPGYY+V VV+ G+PS + WVK +
Sbjct  534   QRLLILKTEEFATKSVGSYAITVVAPPSAAYAPPGYYLVHVVHRGVPSKAVWVKIS  589



>ref|XP_002520142.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42197.1| conserved hypothetical protein [Ricinus communis]
Length=567

 Score =   413 bits (1062),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 236/539 (44%), Positives = 320/539 (59%), Gaps = 28/539 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             GRW  L E+ G+ AMH+ +   N V+ FD+   G S   L       +C+ + E +    
Sbjct  42    GRWVLLQESIGISAMHIQVLKNNKVIMFDRTDFGHSNLSLPY----GKCRFNDEAVML-D  96

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKT  750
             C AHSV YD+  NT RPL  I++TWCSSG++ SNG ++QTGG   G + ++ F PC D +
Sbjct  97    CTAHSVLYDIATNTFRPLMIITNTWCSSGSLDSNGVLVQTGGDGKGERVVRTFTPCDDDS  156

Query  751   CNW---KPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNM-QKSTDLP  918
             C+W         L + RWY+SNQILP  + R+IIVGGRR  TYEF P+  ++ + +  LP
Sbjct  157   CDWVELSNSSSTLLNRRWYSSNQILP--DGRIIIVGGRRVFTYEFYPKGSSLVRDNMTLP  214

Query  919   FLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSY  1098
             FL +T +     NNLYPFLHL  DG LFIFAN  SILF+Y +N V K+FP +PG GSR++
Sbjct  215   FLVKTRDP-LEENNLYPFLHLLPDGNLFIFANNRSILFDYSRNLVIKEFPVLPG-GSRNF  272

Query  1099  PSTGSSVMLPL--------DHKNRFQKVEVMICGGASAGAYTEAK-QGRFIEGLKSCGRM  1251
             P TGSSV+LPL           N   + EVM+CGG+  GAY +A  +  ++E  ++CGR+
Sbjct  273   PCTGSSVLLPLRINRGNGVGVNNYMAEAEVMVCGGSQPGAYLKAHLENIYMEASRTCGRL  332

Query  1252  VISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG  1431
              ++    +W +E MP PR+MND+++LPTG ++IING   G AGW +  +P   P +Y   
Sbjct  333   KVTDPNPEWVIEFMPMPRIMNDLLLLPTGDVIIINGAANGSAGWNDAVNPVFHPVLYLTE  392

Query  1432  KTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVP  1611
                 +RF VL  T I RMYHS+AALLPDGR+L+ GSNP+  Y FT  P+ TE+ L+AF P
Sbjct  393   ADPTQRFIVLNPTTIPRMYHSTAALLPDGRILVGGSNPHPTYNFTAYPYRTEMSLEAFYP  452

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTH  1791
              Y+D      RP  ++  VEG+    V Y   F V F L        +     +  F TH
Sbjct  453   PYLDSIHAPLRPSILT--VEGA----VSYNWMFSVTFVLTLYREDLGIGVKLMTASFNTH  506

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             S  MNQRM+ L+  S+ R         V  P +   APPGYYM+ VV+ GIPS + WVK
Sbjct  507   SFGMNQRMIVLKVVSVWRLSEFAHKVNVVGPTNVNVAPPGYYMLFVVHAGIPSHAVWVK  565



>gb|KGN60010.1| hypothetical protein Csa_3G865940 [Cucumis sativus]
Length=556

 Score =   413 bits (1061),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 234/566 (41%), Positives = 324/566 (57%), Gaps = 34/566 (6%)
 Frame = +1

Query  322   LVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSG  501
             +V L  C+ L  + +    A+  G W+ L    G+ AMHM L H + VV FD  G G S 
Sbjct  6     VVVLFFCHVLLFAGMSFTQAAAAGHWKLLQGTIGISAMHMQLLHNDRVVMFDGTGFGPSN  65

Query  502   YQL-----RRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTIL  666
                      R +NG R            C AHSVEYDV  NT RPL   +D WCSSG  +
Sbjct  66    LSFPTARCARSYNGRRISFD--------CTAHSVEYDVATNTFRPLAVQTDMWCSSGGAM  117

Query  667   SNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIV  846
              +GT++QTGG++ G + ++ F PC   TC+W+     L   RWYA+N ILP  +   II+
Sbjct  118   RDGTLVQTGGFKAGDRTVRIFKPC--PTCDWEEIPMGLLTRRWYATNHILPDGSQ--III  173

Query  847   GGRRASTYEFVPR-----FP-----NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGY  996
             GGR+  +YEF P+     +P     ++ ++  LPFL QT + +A  NNLYPF+ L  DG 
Sbjct  174   GGRKRFSYEFFPKPAAFNWPLAKTNSVPEAYRLPFLIQTNDGHAE-NNLYPFVFLHIDGS  232

Query  997   LFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICG  1176
             LFIFAN  +ILF+Y KN++ K FP++PG   R+YPSTGS+V+LPL+ + +  +VEVM+CG
Sbjct  233   LFIFANNRAILFDYTKNKILKTFPKIPGGDPRNYPSTGSAVILPLNLQAKLLEVEVMVCG  292

Query  1177  GASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIIN  1356
             GA  GA  +A+ G F+E L +C R+ I+    KW +E MP  RVM DM++LP G +L+IN
Sbjct  293   GAPKGASIKARNGVFVEALNTCARIKITSPNPKWLLEIMPLSRVMGDMLLLPNGNVLLIN  352

Query  1357  GVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAG  1536
             G   G AGW    +P L P +Y P    G RF V   +   RMYHS+A LL DGR+L+ G
Sbjct  353   GGSFGTAGWELARNPVLNPVLYLPNNPHGSRFEVNDPSTTPRMYHSTAILLRDGRILVGG  412

Query  1537  SNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHV  1716
             SNP  GY F+ V  PTEL L+AF P Y+D  F   RP      +E     +V +G+   V
Sbjct  413   SNPQPGYNFSGVLFPTELSLEAFHPPYLDPEFAALRP----TIIEPRSQVMVFHGQRLKV  468

Query  1717  RFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERG--DNGMVNavvaapps  1890
              F +  +     +  +  +PPF THS +MNQR+L L  +++        M    V  P S
Sbjct  469   EFTVIDELDPTKVSVTMLAPPFNTHSFSMNQRLLVLGRSNVTTTIWPELMYEVEVNVPVS  528

Query  1891  pvaappGYYMVTVVNEGIPSISRWVK  1968
                AP G+Y++ VV++ +PS   WV+
Sbjct  529   GNIAPSGFYILFVVHQCVPSEGIWVQ  554



>ref|XP_004298452.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=576

 Score =   414 bits (1063),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 247/568 (43%), Positives = 325/568 (57%), Gaps = 28/568 (5%)
 Frame = +1

Query  307   LLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRG  486
             L  LF+ S  P    N    +  A    G+W  L +N GV AMHM L   N VV FD+  
Sbjct  21    LFSLFIAS--PDANFNDMSSLPAAPYDGGQWILLHKNIGVSAMHMQLLKNNKVVLFDRTD  78

Query  487   SGRSGYQLRRRFNGTRCKG-SREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTI  663
              G S           +C+G S ++ +   C  HS+ YDV ++T R L   SDTWCSSG +
Sbjct  79    MGPSNATYPD--GAVQCRGYSVKNRTVTDCTPHSLLYDVASDTFRALVVNSDTWCSSGAV  136

Query  664   LSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVII  843
               NG ++QTGGY  G + I+ F+PC D TC W   +  L   RWYA+NQILP  + RVI+
Sbjct  137   DPNGNLVQTGGYGTGIQTIRTFSPCDDDTCQWDEMETKLLAHRWYATNQILP--DGRVIV  194

Query  844   VGGRRASTYEFVPRFPNM-QKSTDLPFLHQT---YERNAGGNNLYPFLHLSSDGYLFIFA  1011
             VGGRRA +YEF P+  +M  +   + FL +T   YE     NNLYPFLHL  DG LF+FA
Sbjct  195   VGGRRAFSYEFYPKADDMSSRLYYMRFLWETADPYEE----NNLYPFLHLLPDGNLFVFA  250

Query  1012  NRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ-----KVEVMICG  1176
             N  S+LFNY  N V K+FP M G   RSYP+TGSSV+LPL            +VEV+ICG
Sbjct  251   NNRSVLFNYTSNAVVKEFPAMRGGVKRSYPATGSSVLLPLKMDAVLDGSGRPEVEVLICG  310

Query  1177  GASAGAYTEAKQGR---FIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQIL  1347
             G+  GAY ++   R   ++    SCGR+ +S    +W ME MP PRVM DM++LP G ++
Sbjct  311   GSYGGAYNKSNLNRVKVYVGASASCGRIRLSDPDPEWAMEEMPRPRVMGDMLLLPNGDVI  370

Query  1348  IINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFSVLRATKIARMYHSSAALLPDGRV  1524
             I+NG   G AGW +  +P L P +Y   +    +RF  L  T I RMYHSS  LLPDGR+
Sbjct  371   ILNGAANGTAGWEDAINPVLHPVMYKTYEPDPRRRFVTLNPTTIPRMYHSSCLLLPDGRI  430

Query  1525  LIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGK  1704
             L+ GSNP++ Y F     PTEL L+A++P Y+       RP  +S+    +   +V YG+
Sbjct  431   LVGGSNPHEMYNFRRA-FPTELSLEAYLPPYLSSTAAPLRPTIISIEAREN---IVSYGQ  486

Query  1705  EFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaap  1884
             EF V F L    P   +  +  +P FTTHS+AMNQR++ L   S++R            P
Sbjct  487   EFSVNFGLSVYRPDVAISVALVAPSFTTHSLAMNQRVVVLEVASLKRLSVFDYKITARGP  546

Query  1885  pspvaappGYYMVTVVNEGIPSISRWVK  1968
             PS   APPGYYMV +V+ GIP  + WVK
Sbjct  547   PSSTVAPPGYYMVFIVHAGIPGQALWVK  574



>ref|XP_011045140.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=511

 Score =   411 bits (1056),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 232/522 (44%), Positives = 315/522 (60%), Gaps = 22/522 (4%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG-SREDLSDPSCYAHSVEYDVLNN  609
             MHM L + + VV +D+   G+S   L       +C+  SRE +    C AHSVEYDVL N
Sbjct  1     MHMQLLNNDRVVIYDRTDYGKSNISLPH----GKCRNNSRELVIKYDCTAHSVEYDVLAN  56

Query  610   TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDE  789
               RPL   +D WCSSG ++ +G+++QTGG+ DG ++++ F PC +  C+W      L   
Sbjct  57    KFRPLMVQTDVWCSSGAVVPDGSLIQTGGFNDGRRKVRTFYPC-NGDCDWVETGDGLKAR  115

Query  790   RWYASNQILPGKNDRVIIVGGRRASTYEFVPRF--PNMQKSTDLPFLHQTYERNAGGNNL  963
             RWYA+N ILP  + + I++GGRR   YEF P+   PN+     LPFL QT +R    NNL
Sbjct  116   RWYATNHILP--DGKQIVIGGRRQFNYEFYPKTSSPNVYS---LPFLLQTNDRGIE-NNL  169

Query  964   YPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKN  1143
             YPF+ L+SDG LFIFAN  +ILF+Y+  +V K +P +PG   RSYPSTGS+V+LPL + +
Sbjct  170   YPFVFLNSDGNLFIFANNRAILFDYKTGKVVKTYPAIPGGDPRSYPSTGSAVLLPLKNLD  229

Query  1144  RFQ-KVEVMICGGASAGAYTEA-----KQGRFIEGLKSCGRMVISGNKHKWNMENMPGPR  1305
                 + EV++CGGA  G++  A      + +F + L +CGR+ I+    +W ME MP  R
Sbjct  230   AATIEAEVLVCGGAPKGSFEMATKRKSAERKFNKALDTCGRIKINEPSPQWVMETMPCAR  289

Query  1306  VMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARM  1485
             VM DM +LP G +LIING   G AGW NG  PAL P +Y P    G RF  L  + I RM
Sbjct  290   VMGDMTLLPNGVVLIINGAGDGTAGWENGRRPALSPVLYWPDGAAGSRFEQLNPSTIPRM  349

Query  1486  YHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVY  1665
             YHS+A LL DGRVL+ GSNP+ GY FT V  PTEL L+AF P Y+D +  + RPK VS  
Sbjct  350   YHSTAILLRDGRVLVGGSNPHIGYDFTGVLFPTELSLEAFSPPYLDSKNKHLRPKIVS--  407

Query  1666  VEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMER  1845
                S    + YG++  VRF +  K  ++ +  +  +P F THS +MN R+L LR  ++  
Sbjct  408   STASKGKYIGYGQKLWVRFKVIGKLKADMVSVTMVAPAFNTHSFSMNHRLLALRNENVTY  467

Query  1846  GDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
                 + +  V  P S   AP GYYM+ VV++ IPSI  WVK 
Sbjct  468   VRTSIYDIQVTTPSSGYLAPSGYYMLYVVHQYIPSIGIWVKL  509



>ref|XP_006433075.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
 gb|ESR46315.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
Length=546

 Score =   412 bits (1058),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 230/549 (42%), Positives = 313/549 (57%), Gaps = 37/549 (7%)
 Frame = +1

Query  349   LNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNG  528
             L  S ++   A  QG W  L E+ G+ AMHM L H N V+ FD+   G+S   L    + 
Sbjct  24    LIPSQVLPPYAGSQGEWNLLHESIGISAMHMQLLHDNRVIMFDRTDFGQSNLSL----SS  79

Query  529   TRCKGSRED-LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRD  705
              RC+    D +    C AHS+ YDV  N  RPL   +DTWCSSG++L NGT++Q+GGY D
Sbjct  80    GRCRFDPYDTVLHTDCTAHSILYDVATNAYRPLMVQTDTWCSSGSVLPNGTLVQSGGYND  139

Query  706   GSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR  885
             G   ++ F PC D  C+W    +HL + RWYA+NQILP     +I    +    YEF P+
Sbjct  140   GDHVVRTFTPCDDDQCDWIELPQHLSERRWYATNQILPDGRIIIIGGRRQF--NYEFYPK  197

Query  886   ------FPNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKN  1047
                   FP   ++  L FL +T  R+   NNLYPF+HL  DG LFIFAN  SILF+Y++N
Sbjct  198   SDEDLSFP---QTFMLHFLLET--RDYAENNLYPFVHLLPDGNLFIFANTRSILFDYKQN  252

Query  1048  RVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKV--EVMICGGASAGAYTEAKQGRF  1221
             +V K++P +PG   R+YPSTGSSV+LPLD +N    V  E+MICGGA   ++  A QG F
Sbjct  253   KVLKEYPEIPGADPRNYPSTGSSVLLPLDERNGSTSVQAEIMICGGAQNASFALATQGVF  312

Query  1222  IEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASP  1401
             I  + +CGR+V+S     W ME MP PRVM DM++LP G ++IING + G AGW     P
Sbjct  313   IRAISTCGRLVVSHANPSWVMEEMPLPRVMGDMILLPNGDVIIINGAQLGTAGWELARGP  372

Query  1402  ALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHP  1581
                P IY P +   +RFSV+  +   RMYHSSA             NP+  Y FTNV +P
Sbjct  373   MTRPIIYRPSEQTSRRFSVMEPSTRPRMYHSSAIF-----------NPHIYYNFTNVVYP  421

Query  1582  TELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEF  1761
             T+L L+A+ P Y+   +   RPK +S+         + Y   F VRF +++   +  +  
Sbjct  422   TDLSLEAYSPPYLSAEYATVRPKILSL------NETIGYKATFQVRFSVEEYLSAGVVSV  475

Query  1762  SAYSPPFTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEG  1941
                +P FTTHS  MNQRM+ L+   +    + + +    AP +   APPGYY++ VV+  
Sbjct  476   RLIAPSFTTHSFGMNQRMVVLKILEVSHVTSYVYHLAAVAPSTAEIAPPGYYLLFVVHAE  535

Query  1942  IPSISRWVK  1968
             IPS   WVK
Sbjct  536   IPSSGMWVK  544



>ref|XP_010670858.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=545

 Score =   412 bits (1058),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 234/539 (43%), Positives = 319/539 (59%), Gaps = 19/539 (4%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDL  558
             A+G GRW  L ++ G+ AMHM L + + V+ +D+   G S   L        C+    D 
Sbjct  19    AAGGGRWHLLKKSIGISAMHMQLLNDDRVIIYDRTDFGSSNLPLASE----NCRIDPNDQ  74

Query  559   S-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +    C AHS EYD L+NT RPL  ++DTWCSSGT L NGT+MQTGG+ DG + ++ F P
Sbjct  75    ALQIDCTAHSAEYDSLSNTFRPLTVLTDTWCSSGTTLPNGTLMQTGGFNDGERVVRTFQP  134

Query  736   CVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST--  909
                  C+W      L D RWYA+N +LP  + R II+GGRRA  YEF P+      S   
Sbjct  135   SCSG-CDWVEFPNKLLDRRWYATNHVLP--DGRSIIIGGRRAPNYEFYPKDGTSFSSQLY  191

Query  910   DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGS  1089
              LPFL QT++     NNLYP++ L  DG LFIFAN  +ILF+Y  N + + +P +PG   
Sbjct  192   KLPFLSQTHDPQQE-NNLYPYVFLHVDGNLFIFANNRAILFDYNNNVIVRTYPTIPGGDP  250

Query  1090  RSYPSTGSSVMLPLDHKNR--FQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVIS  1260
             RSYPSTGS+V+LPL +       + EV+ICGGA  G+Y +A   G+F+  LK+C R+ I+
Sbjct  251   RSYPSTGSAVLLPLKNLELGLNMQFEVLICGGAPLGSYLKALNMGQFLPALKTCARININ  310

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
              +   W++E MP  RVM DM+ILP   ++IING   G AGW  G  P L P IY P    
Sbjct  311   DHNPSWSLETMPMARVMGDMLILPNEDVIIINGAGSGTAGWELGRDPVLSPVIYHPDNIR  370

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF+V R+T I R+YHSSA LL DGRV++ GSNP+  Y FTNV +PTEL L+AF P Y+
Sbjct  371   GSRFTVQRSTNIPRLYHSSAILLRDGRVVVGGSNPHRTYNFTNVLYPTELSLEAFSPSYL  430

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             D      RP  ++V + GS    + YG+   V+F +      + ++ +   PPF THS +
Sbjct  431   DPTKVEIRPI-INVPISGS---RIRYGEVIKVKFLIVGSNNLDLIKVTMLRPPFNTHSFS  486

Query  1801  MNQRMLKLRCTS-MERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFA  1974
             M+QR+L L  T  ++    G     +  P S   APPG+Y+  VV++ +PS   WV+  
Sbjct  487   MSQRLLVLTNTKPVKLTGTGQFQVNIMIPGSANIAPPGFYIFFVVHQNVPSKGVWVQLT  545



>ref|XP_010540180.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=565

 Score =   412 bits (1059),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 238/548 (43%), Positives = 322/548 (59%), Gaps = 31/548 (6%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
              A+G GRWQ L+ + G+ AMHM L   + V+ FD+   G S   L     G  C+ +  D
Sbjct  32    TAAGGGRWQLLLRSVGISAMHMQLLRNDRVIMFDRTDFGPSNISLP----GGNCRSNPND  87

Query  556   -LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
              +S   C AHSVE+DV++N IRPL   S+TWCSSG+++ +GT++QTGG  DG +R + F+
Sbjct  88    RVSKVDCTAHSVEFDVISNGIRPLTVQSNTWCSSGSVMPDGTLVQTGGDLDGERRARLFS  147

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF--PNMQKS  906
             PC    C+WK  +  L   RWYASN ILP  +   IIVGGR    +EF P+   PN+   
Sbjct  148   PCFSNDCDWKELENGLALRRWYASNHILPDGSQ--IIVGGRGQFNFEFYPKTKDPNVY--  203

Query  907   TDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEG  1086
              +LPFL QT +R +  NNLYPF+ L+ DG LF+FAN  +IL +Y KN V K +P +PG  
Sbjct  204   -NLPFLAQTNDRGSE-NNLYPFVFLNVDGNLFVFANNRAILLDYNKNTVVKTYPAIPGGD  261

Query  1087  SRSYPSTGSSVMLPLDHKNRFQ-KVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVIS  1260
              RSYPSTGS+V+LPL +      + EV++CGGA  GAY +A ++  FI+ L +C R+ I+
Sbjct  262   PRSYPSTGSAVLLPLKNLEAIDVEAEVLVCGGAPRGAYEQAWRRNNFIKALNTCARIRIT  321

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
                 +W +E+MP  RVM DM +LP G +LIING   G A W  G  P   P +Y P   V
Sbjct  322   DPNPQWVVESMPQARVMGDMTLLPNGDVLIINGGASGTAAWELGRDPIFAPDLYRPDNPV  381

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF       I RMYHS+A LL DGRVL+ GSNP+  Y FT V  PTEL L+AF+P Y+
Sbjct  382   GSRFETQNPNTIPRMYHSTAVLLRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFLPSYL  441

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
             D++F N RP   S   +      + Y  +  ++F +  +  S  ++ +   P FTTHS +
Sbjct  442   DQQFSNLRPMITSPKSQ----VKIKYNMKLKLKFTVSGEVKSP-VKVTMVFPSFTTHSFS  496

Query  1801  MNQRMLKLRCTS----------MERGDN-GMVNavvaappspvaappGYYMVTVVNEGIP  1947
             MNQR+L L              + +G +       V  P S   APPGYYM+ VVN+ IP
Sbjct  497   MNQRVLVLDNIKTPKIWDFFNFLRKGKSTSTYEVEVKTPRSANIAPPGYYMMFVVNQDIP  556

Query  1948  SISRWVKF  1971
             S   WV+ 
Sbjct  557   SEGIWVQL  564



>ref|XP_008466667.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=655

 Score =   415 bits (1067),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 238/579 (41%), Positives = 330/579 (57%), Gaps = 47/579 (8%)
 Frame = +1

Query  298   ITALLVLFLVSLRPCNALNASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFD  477
             I  ++VLF      C+AL  + +    A+  G W+ L    G+ AMHM L H + V+ FD
Sbjct  102   IEQMVVLFF-----CHALLFAGMSFTQAAAAGHWKLLQGTIGISAMHMQLLHNDRVIMFD  156

Query  478   QRGSGRSGYQLRRRFNGTRC----KGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTW  645
               G G S       F G RC     G R       C AHSVEYDV  NT RPL   +D W
Sbjct  157   GTGFGPSNLS----FPGARCARTYNGRRISFD---CTAHSVEYDVATNTFRPLAVQTDMW  209

Query  646   CSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGK  825
             CSSG  + +GT++QTGG++ G + ++ F PC   +C+W+     L   RWYA+N ILP  
Sbjct  210   CSSGGAMRDGTLVQTGGFKAGDRTVRIFKPCT--SCDWEEIPMGLLTRRWYATNHILPDG  267

Query  826   NDRVIIVGGRRASTYEFVPR-----FP-----NMQKSTDLPFLHQTYERNAGGNNLYPFL  975
             +   II+GGR+  +YEF P+     +P     ++ ++  LPFL QT + +A  NNLYPF+
Sbjct  268   SQ--IIIGGRKRFSYEFFPKPAAFNWPLAKTNSVPEAYRLPFLMQTNDGHAE-NNLYPFV  324

Query  976   HLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQK  1155
              L  DG LFIFAN  +ILF+Y KN+V K FP++PG   R+YPSTGS+V+LPL+ + +  +
Sbjct  325   FLHIDGSLFIFANNRAILFDYTKNKVLKTFPKIPGGDPRNYPSTGSAVILPLNLQGKLLE  384

Query  1156  VEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPT  1335
             VEVM+CGGA  GA+ +A+ G F+E L +C R+ I+    KW +E MP  RVM DM++LP 
Sbjct  385   VEVMVCGGAPKGAHIKARNGVFVEALNTCARIKITSPNPKWVLEIMPLSRVMGDMLLLPN  444

Query  1336  GQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALLPD  1515
             G +L+ING   G AGW    +P L P +Y P    G RF V   +   RMYHS+A LL D
Sbjct  445   GNVLLINGGSFGTAGWELARNPVLNPVLYLPNNLPGSRFEVNDPSTTPRMYHSTAILLRD  504

Query  1516  GRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVD  1695
             GR+L+ GSNP+ GY F+    PTEL L+AF P Y+D  F   RP      +E     +V 
Sbjct  505   GRILVGGSNPHPGYNFSGFLFPTELSLEAFHPPYLDPEFAALRP----TIIEPRSQIMVF  560

Query  1696  YGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMERGD-------N  1854
             +G+   V F +  +     +  +  +PPF THS +MNQR+L      + RG+        
Sbjct  561   HGQRLKVEFTVIDEMDPTKISVTMLAPPFNTHSFSMNQRLL-----VVGRGNVTTTIWPE  615

Query  1855  GMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              M    V  P S   AP G+Y++ VV++ +PS   WV+ 
Sbjct  616   LMYEVEVNIPVSGNIAPSGFYILFVVHQCVPSEGIWVQI  654



>ref|XP_006342230.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   411 bits (1057),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 238/538 (44%), Positives = 320/538 (59%), Gaps = 21/538 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A +  G+W  LM N G+ AMHM L + + V+ +D+   G S   L    NG +C+ + +D
Sbjct  30    AYAAGGKWDLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLP---NG-KCRNNPKD  85

Query  556   LS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
             L+    C AHSVEYDV  N+IRPL   +D WCSSG+  S+GT++QTGG+ DG   ++ F 
Sbjct  86    LALKVDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGRNMVRTFK  145

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC   TC+W+     L   RWY++NQILP  + R II+GGR A  YEF P+  +  K   
Sbjct  146   PC--STCDWQEIGTGLIQGRWYSANQILP--DGRQIIIGGRDAFNYEFYPKTASTNKVFS  201

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             LPF+ QT       NNLYPF+ L+ DG LFIFAN  +IL +Y  N + K +P++PG   R
Sbjct  202   LPFIQQT-NVPKEENNLYPFVFLNVDGNLFIFANNRAILLDYTTNTIVKTYPQIPGGDPR  260

Query  1093  SYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKSCGRMVISGN  1266
             +YPSTGS+V+LPL + + +  + EV++CGGA  G+Y +A +   F+  L +CGR+ I+  
Sbjct  261   NYPSTGSAVLLPLKNLQAQTIQAEVLVCGGAPIGSYLKAARANTFVGALNTCGRITITDP  320

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK  1446
               +W ME MP  R M DMVILP G ILI+NG   G AGWG   +P L P IY P    G 
Sbjct  321   NPQWTMETMPLARTMGDMVILPNGNILIVNGAAAGTAGWGIARNPVLSPVIYRPDNPFGS  380

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF V     I RMYHS+  LL DGRVL+ GSNPN+ Y FT V  PT+L L+AF P Y+D 
Sbjct  381   RFEVQNPNAIPRMYHSTTVLLRDGRVLVGGSNPNELYNFTRVLFPTDLSLEAFSPSYLDS  440

Query  1627  RFDNQRPKNVSVYVEGSPAA--VVDYGKEFHVRFWLDKKWPSEDL-EFSAYSPPFTTHSV  1797
                N RP+ +      SPA+   + YG+  ++RF L     + +L + +  +P F THS 
Sbjct  441   NSTNLRPQII------SPASHKTIKYGQRVNIRFTLSGSLLNTNLIKVTMVAPGFNTHSN  494

Query  1798  AMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              MNQRML L    +++            P S   APPGYYM+ VVN+ IPS   W+K 
Sbjct  495   TMNQRMLVLSSEKIKKTGIFTYQISSIFPNSGKLAPPGYYMLFVVNQDIPSEGIWIKI  552



>ref|XP_002890054.1| hypothetical protein ARALYDRAFT_888820 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66313.1| hypothetical protein ARALYDRAFT_888820 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score =   412 bits (1058),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 240/540 (44%), Positives = 332/540 (61%), Gaps = 29/540 (5%)
 Frame = +1

Query  391   GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPS  570
             GRW  L  + G+ AMHM L H N VV FD+   G S   L  +   T   G+  D     
Sbjct  41    GRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQ---TCQNGTVFD-----  92

Query  571   CYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK-  747
             C AHS+ YDV +NT RPL    DTWCSSG++ ++G+++QTGGY  G + ++ F PC +  
Sbjct  93    CSAHSILYDVASNTYRPLTLRYDTWCSSGSLNASGSLIQTGGYGAGERTVRIFTPCDEGV  152

Query  748   ---TCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLP  918
                +C+W   + +L   RWY++NQILP  + R+IIVGGRRA TYEF P+ P  +   +L 
Sbjct  153   GSVSCDWVENRAYLSSRRWYSTNQILP--DGRIIIVGGRRAFTYEFYPKNPG-ESVFNLR  209

Query  919   FLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSY  1098
             FL +T + N   NNLYPFLHL  DG LFIFANR SILF++  +R+ K+FP +PG   R+Y
Sbjct  210   FLAETRDPNEE-NNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGGDKRNY  268

Query  1099  PSTGSSVMLP--LDHKNRFQKV--EVMICGGASAGAYTEAKQ---GRFIEGLKSCGRMVI  1257
             PSTGSSV+LP  L  +N   K+  EVM+CGGA  GA+ +A +     F+   ++CGR+ +
Sbjct  269   PSTGSSVLLPIFLTGENNRSKIMAEVMVCGGAPPGAFLKAARTIPKIFVGASRTCGRLKV  328

Query  1258  SGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-  1434
             +    KW ME MP PRVM+DM++LP G +LIING   G AGW +  +  L P +Y P + 
Sbjct  329   TDPNPKWVMEQMPSPRVMSDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPILYLPDEP  388

Query  1435  TVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPD  1614
                +RF +L  T+I RMYH+++ LL DGRVL+ GSNP+  Y FT  P+PTEL L+A++P 
Sbjct  389   DPTRRFEILTPTRIPRMYHAASLLLSDGRVLVGGSNPHRNYNFTARPYPTELSLEAYLPR  448

Query  1615  YMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE-DLEFSAYSPPFTTH  1791
             Y+D ++   RP  ++V + G+    + YG+ F V F +      +        +P F+TH
Sbjct  449   YLDPQYARVRPTIITVELAGN----MLYGQAFAVTFAIPAFGMFDGGASVRLVAPSFSTH  504

Query  1792  SVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             S AMNQR+L LR   + +       A V  P +   APPGYYM+ VV+ GIPS++ WVK 
Sbjct  505   STAMNQRLLVLRVRRVSQLSVFAYKADVDGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI  564



>ref|XP_001783776.1| predicted protein [Physcomitrella patens]
 gb|EDQ51428.1| predicted protein [Physcomitrella patens]
Length=525

 Score =   410 bits (1054),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 236/540 (44%), Positives = 327/540 (61%), Gaps = 24/540 (4%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             ++   + QG W+ L++N G+ +MH A+TH NTV+F D+   GRS   L    NG  C+ +
Sbjct  6     LASLTNAQGTWELLLDNAGIASMHTAVTHYNTVIFLDRTNIGRSEIDLP---NG-ECREN  61

Query  547   REDLS-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
              ++L+    C AHSV +D  +N++R L   +D WCSSG    +GT++QTGG  +G K+I+
Sbjct  62    DDELALKKDCTAHSVMFDPSSNSVRALWVQTDPWCSSGQFQGDGTMVQTGGDFEGIKKIR  121

Query  724   FFAPC-VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQ  900
                PC  D  C+W   +  L + RWYA+NQILP    +++I GGR A TYEFVP+    +
Sbjct  122   TLVPCGRDDECDWVEERTELSEGRWYATNQILPDGKTQIVI-GGRDAYTYEFVPKRNRNE  180

Query  901   KSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPG  1080
                 L  L  T   +A G+N+YP++HL   G L+IFANRDSI+ NY+ ++V K FPR+PG
Sbjct  181   GVFYLKLLEDT--NSAQGDNMYPYVHLLPSGDLYIFANRDSIVLNYKTDKVVKTFPRIPG  238

Query  1081  EGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVIS  1260
             E  R+YPS GSSVMLP+D  + +  VEV++CGGA   A+T  +Q ++   L +CGRMV++
Sbjct  239   E-PRNYPSAGSSVMLPIDQASSYTVVEVLVCGGARNRAFTNYRQ-QYPASL-TCGRMVVT  295

Query  1261  GNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTV  1440
              N  KW ME+MP PR M DM+ILP G++LIING + G  GWG  ++  L P  Y+     
Sbjct  296   DNDPKWAMEDMPMPRTMGDMIILPMGEVLIINGAENGSQGWGRASNAVLTPVKYAT-YNA  354

Query  1441  GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYM  1620
             G RF  L A+ I R+YHS+A LL DGR+L+AGSN +  Y FT    PTELR+ AF P Y+
Sbjct  355   GNRFETLAASDIPRVYHSTANLLVDGRILLAGSNTHQYYTFTGR-FPTELRIDAFSPPYL  413

Query  1621  DRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVA  1800
               R +N RP      +  SP + + YG++F + F + ++      E +  S PF THS A
Sbjct  414   STRNNNIRPT-----MTKSPGS-IGYGEKFAITFTVAER--HGGFELNMKSTPFVTHSYA  465

Query  1801  MNQRMLKLRCTS--MERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKFA  1974
             M QRMLKL  T               V APP+   APPGYYM+  V + IP  + WVK  
Sbjct  466   MGQRMLKLEVTEPVASAATQNSFAVDVIAPPTAELAPPGYYMLWPVQDWIPGTAAWVKIG  525



>gb|AAG12543.1|AC007797_3 Unknown Protein [Arabidopsis thaliana]
Length=504

 Score =   409 bits (1052),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 228/515 (44%), Positives = 307/515 (60%), Gaps = 14/515 (3%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNT  612
             MHM L H + VV +D+   G S   L    NG      ++ +S   C AHS+EYDV  NT
Sbjct  1     MHMQLLHNDRVVMYDRTNFGPSNISLP---NGNCRDNPQDAVSKIDCTAHSIEYDVATNT  57

Query  613   IRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDER  792
             IRPL   S+TWCSSG++  +G ++QTGG RDG  + + F+PC +  C+W      L   R
Sbjct  58    IRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKTRTFSPCNNNQCDWVEMNNGLKKRR  117

Query  793   WYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLYPF  972
             WYASN ILP  + + I++GG+    YEF P+  N      LPFL +T+++    NNLYPF
Sbjct  118   WYASNHILP--DGKQIVMGGQGQFNYEFFPKTTN-PNVVALPFLAETHDQ-GQENNLYPF  173

Query  973   LHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ  1152
             + +++DG LF+FAN  +IL +Y KN V K FP +PG   R+YPSTGS+V+LPL +     
Sbjct  174   VFMNTDGNLFMFANNRAILLDYVKNTVVKTFPAIPGGDPRNYPSTGSAVLLPLKNLEADN  233

Query  1153  -KVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVIL  1329
              + EV++CGGA  G+Y  A++  F++ L +C R+ I+  K +W +E MP  RVM DM+ L
Sbjct  234   VETEVLVCGGAPKGSYNLARKKTFVKALDTCARIKINDAKPEWAVEKMPHARVMGDMIPL  293

Query  1330  PTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRFSVLRATKIARMYHSSAALL  1509
             P G +L+ING   G A W  G +P L P +Y P   VG RF  LR T I RMYHS+A LL
Sbjct  294   PNGDVLLINGGSFGTAAWELGRTPVLAPDLYHPENPVGSRFESLRPTTIPRMYHSAAILL  353

Query  1510  PDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAV  1689
              DGRVL+ GSNP+  Y +T V  PTEL L+AF P Y+ R F N RPK +S      P ++
Sbjct  354   RDGRVLVGGSNPHAFYNYTGVLFPTELSLEAFSPVYLQREFSNLRPKIIS----PEPQSM  409

Query  1690  VDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRCTSMER-GDNGMVN  1866
             + YG    ++F +  +  +   + +   P FTTHS AMNQR+L L      R G + M  
Sbjct  410   IKYGTNLKLKFSVTGEV-TTPAKVTMVFPTFTTHSFAMNQRVLVLDNVKFTRKGKSPMYE  468

Query  1867  avvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
               V  P S   A PGYYM+ VVN+ IPS   WVK 
Sbjct  469   VQVRTPRSANIAWPGYYMIFVVNQDIPSEGVWVKL  503



>gb|KFK43688.1| hypothetical protein AALP_AA1G160100 [Arabis alpina]
Length=560

 Score =   411 bits (1056),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 251/584 (43%), Positives = 343/584 (59%), Gaps = 37/584 (6%)
 Frame = +1

Query  259   METHQLRTTLPCAITALLVLFLVS----LRPCNALNASVLVSEAASGQGRWQTLMENTGV  426
             M+  + +  L   + +L   FL S    L P + L  ++L        GRW  L  + G+
Sbjct  1     MKEERFKKNLHVIVLSLFFFFLCSTSDLLLPRSPL--TILTG------GRWDLLQPSVGI  52

Query  427   VAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDPSCYAHSVEYDVLN  606
              AMHM L H N VV FD+   G S   L  +     C+ +    +   C AHS+ YDV +
Sbjct  53    SAMHMQLLHNNKVVIFDRTDYGPSNLLLPPQ----TCQNA----TVFDCSAHSLLYDVAS  104

Query  607   NTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYD  786
             NT RPL    DTWCSSG++ ++G+++QTGGY  G K ++ F PC   +C+W   + +L  
Sbjct  105   NTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGVGEKAVRIFTPCDGVSCDWVENRAYLSS  164

Query  787   ERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTDLPFLHQTYERNAGGNNLY  966
              RWY++NQILP  + R+IIVGGRRA TYEF P+ P  +    L FL +T + N   NNLY
Sbjct  165   RRWYSTNQILP--DGRIIIVGGRRAFTYEFYPKNPR-KSVFYLRFLVETKDPNE-ENNLY  220

Query  967   PFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPL---DH  1137
             PFLHL  DG LFIFANR SILF++  +R+ K+FP +PG   R+YPSTGSSV+LPL     
Sbjct  221   PFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPEIPGGDRRNYPSTGSSVLLPLYLTQE  280

Query  1138  KNRFQ-KVEVMICGGASAGAYTEAKQG---RFIEGLKSCGRMVISGNKHKWNMENMPGPR  1305
              NR Q   EVM+CGGA  GA+ +A +     F+   ++CGR+ ++     W ME MP PR
Sbjct  281   NNRSQTTAEVMVCGGAPPGAFLKAARTIPQIFVGASRTCGRLKVTDPNATWVMEQMPSPR  340

Query  1306  VMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGK-TVGKRFSVLRATKIAR  1482
             VM DM++LP G +LIING   G AGW +  +  L P +Y P +    +RF VL    I R
Sbjct  341   VMPDMILLPNGDVLIINGATNGTAGWEDATNAVLNPILYLPDEPDPTRRFEVLAPAWIPR  400

Query  1483  MYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPKNVSV  1662
             MYHS++ LL DGRVL+ GSNP+  Y FT  P+PTEL L+A+ P Y+D ++   RP  ++V
Sbjct  401   MYHSASLLLSDGRVLVGGSNPHRNYNFTARPYPTELSLEAYHPRYLDPQYARVRPSILTV  460

Query  1663  YVEGSPAAVVDYGKEFHVRFWLDKKWPSED-LEFSAYSPPFTTHSVAMNQRMLKLRCTSM  1839
              + G+    + YGK F V F +      +  +     +P F+THS AMNQR+L LR   +
Sbjct  461   ELAGN----MLYGKNFTVTFVIPAYGMFDGVVSVRLVAPSFSTHSTAMNQRLLVLRVRRV  516

Query  1840  ERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
              +       A V  P +   APPGYYM+ VV+ GIPS++ WVK 
Sbjct  517   NQLSVFAYKADVDGPINSYVAPPGYYMMFVVHRGIPSVAVWVKL  560



>ref|XP_006477507.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=555

 Score =   411 bits (1056),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 243/547 (44%), Positives = 323/547 (59%), Gaps = 38/547 (7%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP  567
             +G+W+ L  + GV AMHMAL   + ++ FD+   G S   L +   G   KG   + SD 
Sbjct  27    EGKWKLLKRSIGVSAMHMALLPNDRIIAFDRSHFGPSNITLPQ---GKCIKGVELETSD-  82

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              CYAH+VE+D +   +RPL   +DTWCSSG +L+NG ++QTGGYR G + +++  PC D 
Sbjct  83    -CYAHAVEFDPITRKVRPLTIQTDTWCSSGALLANGVLVQTGGYRLGERVVRYLKPCSD-  140

Query  748   TCNWKPGKKH-LYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST--DLP  918
              C+W+   ++ L   RWYASNQILP  N ++I+VGGR   TYEF+PR  +  +     LP
Sbjct  141   -CDWEEDHQNGLISPRWYASNQILP--NGKIIVVGGRFQFTYEFIPRTSDSDRKILYQLP  197

Query  919   FLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSY  1098
             FL +T       NNLYPFLHLS+DG LFIFAN  +IL +Y  NRV K +P MPG  SR+Y
Sbjct  198   FLKETMHSPKIPNNLYPFLHLSTDGNLFIFANDRAILLDYVNNRVMKNYPVMPGGISRNY  257

Query  1099  PSTGSSVMLPLD------HKNRFQK----VEVMICGGASAGAYTEAKQGR-FIEGLKSCG  1245
             PSTGSSV+LP++      H N   K     +V+ICGG    +   A + + F+   KSCG
Sbjct  258   PSTGSSVLLPVNLSSINVHINNNNKPVVHSQVLICGGTLPDSNENAAEAQIFLRAAKSCG  317

Query  1246  RMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYS  1425
             R+ I+    KW ME MP  RVM DM++LPTG +LIING  +G AGWG    P L P IY 
Sbjct  318   RLTITAQNPKWEMEEMPLNRVMGDMILLPTGDVLIINGAAKGTAGWGAAREPVLNPVIYC  377

Query  1426  PGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAF  1605
             P      RF +L  + I R+YHS+A LL DGRVL+ GSNPN  Y F+ +  PTEL L+AF
Sbjct  378   PKI---NRFRILSPSLIPRLYHSTAHLLSDGRVLVGGSNPNVNYNFSAL-FPTELSLEAF  433

Query  1606  VPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLE---FSAYSP  1776
              P Y +   +  RP   +V     P A +    ++   F L  K  S DL     +  +P
Sbjct  434   YPPYFNLMSNRSRPSISTV----KPGAFLKL--KYTENFLLGFKLRSGDLGEIFVTMVAP  487

Query  1777  PFTTHSVAMNQRMLKLRCTSMERGDN--GMVNavvaappspvaappGYYMVTVVNEGIPS  1950
              FTTHS AMNQR+L L      +  N  G      +APP+   APPGYY + +VN+G+PS
Sbjct  488   SFTTHSFAMNQRLLVLELHGAVQTSNTAGDYIVQCSAPPTAALAPPGYYQLFLVNDGVPS  547

Query  1951  ISRWVKF  1971
              + WV+ 
Sbjct  548   KAVWVQM  554



>ref|XP_010041767.1| PREDICTED: galactose oxidase [Eucalyptus grandis]
 gb|KCW84906.1| hypothetical protein EUGRSUZ_B01735 [Eucalyptus grandis]
Length=551

 Score =   410 bits (1055),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 237/533 (44%), Positives = 315/533 (59%), Gaps = 20/533 (4%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-D  564
             +G W+ L  + G+ AMHM L   N VV FD+   G S   L     G RC+    D +  
Sbjct  33    EGEWRLLRPSIGISAMHMQLLRNNKVVVFDRTDFGPSNISLP----GGRCRYDSNDTALK  88

Query  565   PSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD  744
               C AHSV YDV  N+ RPL   +DTWCSSG +   G+++QTGG+ DG   ++ F PC  
Sbjct  89    VDCTAHSVLYDVETNSFRPLMVQTDTWCSSGAVSPGGSLVQTGGFNDGDHAVRIFTPCNA  148

Query  745   KTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD----  912
              +C+W     +L   RWYA+NQILP  + R+II+GGRR   YEF P+  +   ++     
Sbjct  149   DSCDWVEYPGYLSRRRWYATNQILP--DGRIIIIGGRREFNYEFYPKNEDPYSASSGSFW  206

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             L FL +T  R+   NNLYPF+HL  DG LFIFAN  SI  +Y +NRV K+FP +P    R
Sbjct  207   LQFLLET--RDESENNLYPFVHLLPDGNLFIFANTRSISLDYNRNRVVKEFPPIPISDPR  264

Query  1093  SYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISGNKH  1272
             +YPS+GSSV+LP+D +N+  + E+MICGGA  GA+ EA +G F+    SCGR+ +S    
Sbjct  265   NYPSSGSSVLLPID-ENQAIEAEIMICGGAPRGAFAEAGRGNFVRASSSCGRLRVSDEDP  323

Query  1273  KWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGKRF  1452
             +W MENMP  RVM DM++L TG ++IINGV+RG AGW  G SP   P +Y P      RF
Sbjct  324   RWVMENMPIARVMGDMLLLATGDVIIINGVERGTAGWELGQSPVTRPVVYRPNGNPDWRF  383

Query  1453  SVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRF  1632
             SV+ A+ I R+YHSSA LL DGRVL+ GSNP+  Y F NV +PT+L L+AF P Y+    
Sbjct  384   SVMSASPIPRLYHSSAILLADGRVLVGGSNPHRYYNFANVEYPTDLSLEAFSPPYLSIEH  443

Query  1633  DNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQR  1812
                RP+  SV        ++  G+ F + F++        L     +P FTTHS+AMNQR
Sbjct  444   KPFRPQISSV------NEILMLGQPFSLTFFVPLYLSENLLSVRIVAPSFTTHSLAMNQR  497

Query  1813  MLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             M+ L+   + R            P +    PPGYYM+ VV+ GIPS   WVK 
Sbjct  498   MVVLKLVGVSRLTPDSYQLTAVGPSTAEIGPPGYYMLFVVHAGIPSWGSWVKI  550



>ref|XP_004147870.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 ref|XP_004166816.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=537

 Score =   410 bits (1053),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 230/547 (42%), Positives = 316/547 (58%), Gaps = 34/547 (6%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQL-----RRRFNGTRCKG  543
             A+  G W+ L    G+ AMHM L H + VV FD  G G S          R +NG R   
Sbjct  6     AAAAGHWKLLQGTIGISAMHMQLLHNDRVVMFDGTGFGPSNLSFPTARCARSYNGRRISF  65

Query  544   SREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
                      C AHSVEYDV  NT RPL   +D WCSSG  + +GT++QTGG++ G + ++
Sbjct  66    D--------CTAHSVEYDVATNTFRPLAVQTDMWCSSGGAMRDGTLVQTGGFKAGDRTVR  117

Query  724   FFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPR-----F  888
              F PC   TC+W+     L   RWYA+N ILP  +   II+GGR+  +YEF P+     +
Sbjct  118   IFKPC--PTCDWEEIPMGLLTRRWYATNHILPDGSQ--IIIGGRKRFSYEFFPKPAAFNW  173

Query  889   P-----NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRV  1053
             P     ++ ++  LPFL QT + +A  NNLYPF+ L  DG LFIFAN  +ILF+Y KN++
Sbjct  174   PLAKTNSVPEAYRLPFLIQTNDGHAE-NNLYPFVFLHIDGSLFIFANNRAILFDYTKNKI  232

Query  1054  EKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYTEAKQGRFIEGL  1233
              K FP++PG   R+YPSTGS+V+LPL+ + +  +VEVM+CGGA  GA  +A+ G F+E L
Sbjct  233   LKTFPKIPGGDPRNYPSTGSAVILPLNLQAKLLEVEVMVCGGAPKGASIKARNGVFVEAL  292

Query  1234  KSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEP  1413
              +C R+ I+    KW +E MP  RVM DM++LP G +L+ING   G AGW    +P L P
Sbjct  293   NTCARIKITSPNPKWLLEIMPLSRVMGDMLLLPNGNVLLINGGSFGTAGWELARNPVLNP  352

Query  1414  YIYSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELR  1593
              +Y P    G RF V   +   RMYHS+A LL DGR+L+ GSNP  GY F+ V  PTEL 
Sbjct  353   VLYLPNNPHGSRFEVNDPSTTPRMYHSTAILLRDGRILVGGSNPQPGYNFSGVLFPTELS  412

Query  1594  LQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYS  1773
             L+AF P Y+D  F   RP      +E     +V +G+   V F +  +     +  +  +
Sbjct  413   LEAFHPPYLDPEFAALRP----TIIEPRSQVMVFHGQRLKVEFTVIDELDPTKVSVTMLA  468

Query  1774  PPFTTHSVAMNQRMLKLRCTSMERG--DNGMVNavvaappspvaappGYYMVTVVNEGIP  1947
             PPF THS +MNQR+L L  +++        M    V  P S   AP G+Y++ VV++ +P
Sbjct  469   PPFNTHSFSMNQRLLVLGRSNVTTTIWPELMYEVEVNVPVSGNIAPSGFYILFVVHQCVP  528

Query  1948  SISRWVK  1968
             S   WV+
Sbjct  529   SEGIWVQ  535



>ref|XP_002889034.1| hypothetical protein ARALYDRAFT_895435 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65293.1| hypothetical protein ARALYDRAFT_895435 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   410 bits (1054),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 237/541 (44%), Positives = 326/541 (60%), Gaps = 22/541 (4%)
 Frame = +1

Query  361   VLVSEAASG-QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRC  537
             +L    ASG +G W+ L+ N G+ AMH  L H + V+ +D+   G S   L    NG  C
Sbjct  24    LLSCHVASGDEGTWELLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLP---NGA-C  79

Query  538   KGSRED-LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSK  714
             + S  D +S+  C AHSVEYDV  N IRPL   S+TWCSSG +  +GT+ QTGG +DG +
Sbjct  80    RSSPGDAVSNIDCTAHSVEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLQQTGGDKDGER  139

Query  715   RIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPN  894
             +++ FAPC D  C+W      L   RWYA+N +LP  + R II+GGR    +EF P+  N
Sbjct  140   KVRLFAPCDDNICDWTEVDNGLAARRWYATNHVLP--DGRQIIIGGRGQFNFEFFPK-TN  196

Query  895   MQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRM  1074
                   LPFL +T + +   NNLYP++ L++DG LFIFAN  +IL +Y +N V K +P +
Sbjct  197   APNLYSLPFLSETNDPDE--NNLYPYVFLNTDGNLFIFANNRAILLDYSRNTVVKTYPEI  254

Query  1075  PGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAYT-EAKQGRFIEGLKSCGRM  1251
             PG   RSYPSTGS+V+LP+  KN    +EV++CGGA  G+Y    ++  F++ L +C R+
Sbjct  255   PGGDPRSYPSTGSAVLLPI--KNLV--LEVLVCGGAPKGSYDLSQRRNTFVKALDTCARI  310

Query  1252  VISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPG  1431
              I+    +W +E MP  RVM DM++LP G +L+ING   G A W  G  P   P IY P 
Sbjct  311   NINDVNPQWIVEKMPRARVMGDMMLLPDGNVLLINGGGSGTAAWELGREPVFNPDIYHPD  370

Query  1432  KTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVP  1611
             K VG RF     +KI RMYHS+A LL DGRVL+ GSNP+  Y FT V  PTELRL+AF P
Sbjct  371   KPVGLRFEAQNPSKIPRMYHSTATLLRDGRVLVGGSNPHAFYNFTGVLFPTELRLEAFSP  430

Query  1612  DYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTH  1791
              Y+D ++ + RP      V+    + ++YG+   +R+ +  +  S  ++ +   P FTTH
Sbjct  431   SYLDPKYSSIRPS----IVDPRSQSTINYGRILRLRYTVTGRVKSP-VKVTMLFPSFTTH  485

Query  1792  SVAMNQRMLKL-RCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
             S +M+QR+L L    S   G + +    V  P SP+ APPGYYMV VVN+ IPS   WV+
Sbjct  486   SFSMHQRLLVLDHVISFRLGISRIYEVRVRTPSSPILAPPGYYMVFVVNQDIPSEGLWVR  545

Query  1969  F  1971
              
Sbjct  546   L  546



>ref|XP_002468154.1| hypothetical protein SORBIDRAFT_01g040550 [Sorghum bicolor]
 gb|EER95152.1| hypothetical protein SORBIDRAFT_01g040550 [Sorghum bicolor]
Length=585

 Score =   411 bits (1057),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 235/554 (42%), Positives = 318/554 (57%), Gaps = 27/554 (5%)
 Frame = +1

Query  364   LVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKG  543
             +   + +G GRW  L  + GV AMHM L H + V+ FD+   G S   L       R   
Sbjct  37    IAPASGAGGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGSSNLSLPD--GHCRVNP  94

Query  544   SREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQ  723
                 L    C AHS EYDV  N  RPL   +DTWCSS T+  +GT++QTGG+ DG +  +
Sbjct  95    RERVLPRGDCTAHSAEYDVAANAFRPLSVFTDTWCSSATVAPDGTLVQTGGWNDGFRNAR  154

Query  724   FFAPC----VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF-  888
                 C     DK+C+W   +  L   RWYA+NQILP  + R  IVGGRR   YEF P+  
Sbjct  155   TMPACGGTGDDKSCDWSEKQDVLAANRWYATNQILP--DGRAFIVGGRRQFNYEFYPKAG  212

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
             P+      +PFL +T  ++   NNLYPF+HL+ DG LFIF+N  ++L +Y+ N++ + +P
Sbjct  213   PSDTSVVQMPFLART--KDPEENNLYPFVHLNIDGNLFIFSNNRAVLLDYKSNKIVRTYP  270

Query  1069  RMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAY--TEAKQGRFIEGLKSC  1242
              +     R+YPS+GSSV+LPL  K    + EV++CGGA AG+Y  T+   G F+  L +C
Sbjct  271   MLGDGDPRNYPSSGSSVLLPL--KPNPTEAEVLVCGGAPAGSYNSTKGGAGTFVPALTTC  328

Query  1243  GRMVISGNKHKWNMENMPGPRVMNDMVILPTG-QILIINGVKRGCAGWGNGASPALEPYI  1419
             GR+ I+     W +E MP PRVM DM++LP G ++ IING   G AGW +  +PA  P +
Sbjct  329   GRIKITDAAPAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWESAKTPAYAPVV  388

Query  1420  YSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQ  1599
             Y P  + G RF    AT +AR+YHSS  LL DGR+L+ GSNP+  Y F+NV  PT+L L+
Sbjct  389   YRPDHSPGDRFEEQTATGVARLYHSSVVLLRDGRLLVGGSNPHTYYNFSNVQFPTDLSLE  448

Query  1600  AFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE--------DL  1755
             AF P+Y+D   D  RP+ +     G+P++V  YG    ++F +               D+
Sbjct  449   AFSPEYLDASNDMLRPRILDPSPTGAPSSVA-YGATMTLQFSVPASARRRRGDAAGLGDV  507

Query  1756  EFSAYSPPFTTHSVAMNQRMLKLRCTS--MERGDNGMVNavvaappspvaappGYYMVTV  1929
               +  +P FTTHS AMNQR+L L  T     RG  G  NA V  P + V APPGYYMV V
Sbjct  508   SVTMVAPSFTTHSFAMNQRLLFLDVTKNVAVRGRAGTFNASVTMPATAVLAPPGYYMVFV  567

Query  1930  VNEGIPSISRWVKF  1971
             VN  IPS   WV+ 
Sbjct  568   VNGHIPSEGIWVQI  581



>ref|XP_007157402.1| hypothetical protein PHAVU_002G066900g [Phaseolus vulgaris]
 gb|ESW29396.1| hypothetical protein PHAVU_002G066900g [Phaseolus vulgaris]
Length=515

 Score =   409 bits (1050),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 239/526 (45%), Positives = 328/526 (62%), Gaps = 27/526 (5%)
 Frame = +1

Query  433   MHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLS-DPSCYAHSVEYDVLNN  609
             MHM + + N V+ FD+   G S   L       RC+ +  DL+    C AHSV YD+ +N
Sbjct  1     MHMQVMYDNKVLIFDRTDFGPSNISLSHH----RCRFNPRDLALKLDCTAHSVLYDLSHN  56

Query  610   TIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVD-KTCNWKPGKKH-LY  783
             T+RPL   +D WCSSG ++ +G+++QTGG+ DG   ++ F PC    TC+W+  + H L 
Sbjct  57    TLRPLTLRTDAWCSSGALVPDGSLLQTGGFNDGYTTLRSFTPCPQHNTCDWREIRNHNLS  116

Query  784   DERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD---LPFLHQTYERNAGG  954
             + RWY+SNQILP  + ++IIVGGR + TYEFVP+  N   S+    LPFL  T + N G 
Sbjct  117   NSRWYSSNQILP--SGKIIIVGGRNSFTYEFVPK--NDVPSSSFHYLPFLKLTRDSNRGE  172

Query  955   -NNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSYPSTGSSVMLPL  1131
              NNLYPFLHL  DG LFIFANR+SILF+Y  N+V + FP +PG+  R+YPST SSV+LPL
Sbjct  173   ENNLYPFLHLLPDGNLFIFANRNSILFDYTTNKVLRNFPIIPGQEKRNYPSTASSVLLPL  232

Query  1132  D----HKNRFQKVEVMICGGASAGAYTEAKQGR-FIEGLKSCGRMVISGNKHKWNMENMP  1296
             +    +  R    E+MICGGA  G ++ A   + F+E  ++CGR+ ++ +   W ME MP
Sbjct  233   NLTGLNGTRLPDAEIMICGGAYPGTFSLANTLKIFLEASRTCGRLRVTDSNPVWVMETMP  292

Query  1297  GPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVG--KRFSVLRAT  1470
              PRVM DM++LPTG ++I+NG   G AGW N A+P L P +Y PG  VG   +F +L   
Sbjct  293   TPRVMPDMILLPTGNVIIVNGAMNGTAGWENAANPVLYPVLYRPG-LVGPFPKFQLLAPA  351

Query  1471  KIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDRRFDNQRPK  1650
                RMYHSSA LLPDGRVL+ GSNP+  Y F   P+PTEL L A+ P+Y+  +FD+ RP 
Sbjct  352   STPRMYHSSAVLLPDGRVLVGGSNPHRVYDFRANPYPTELSLDAYYPEYLGIQFDSLRPS  411

Query  1651  NVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAMNQRMLKLRC  1830
              V+V    + A+   YG+ F V   L   +    L  +  +P FTTHS AMNQR+L L+ 
Sbjct  412   IVAVEAVNNTAS---YGRVFAVNISL-WDYRVGGLGVTLVAPSFTTHSFAMNQRLLLLQV  467

Query  1831  TSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVK  1968
              ++++        V   PPS   APPG+YM+ VV+ G+PS + WV+
Sbjct  468   LAVQQVATSGYRVVARGPPSQAVAPPGFYMLFVVHAGVPSTAVWVQ  513



>ref|XP_011026783.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=547

 Score =   409 bits (1052),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 237/555 (43%), Positives = 322/555 (58%), Gaps = 31/555 (6%)
 Frame = +1

Query  340   CNALNASVLVSEAASGQ---GRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQL  510
             C  L  S L + A   Q   G+W+ L  + G+ AMHM L   + ++ FD +GSG S   L
Sbjct  8     CLILVTSSLFTLALGSQTHRGKWKLLKRSIGISAMHMQLLPNDKIIAFDWKGSGPSNISL  67

Query  511   RRRFNGTRCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQT  690
                  G +C    E  +D  CY+HSVE+D  +  IRPL   +DTWCSSG +L NG ++Q+
Sbjct  68    P----GGKCVVDSETTTD--CYSHSVEFDPSSRRIRPLTITTDTWCSSGALLPNGILIQS  121

Query  691   GGYRDGSKRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTY  870
             GG+R G + ++ F PC +  C+W   K  L   RWYASNQILP  N ++I+VGG     Y
Sbjct  122   GGFRLGDRVVRSFTPCAN--CDWVEKKNGLITSRWYASNQILP--NGKIIVVGGLNQFNY  177

Query  871   EFVPRFPNMQKST-DLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKN  1047
             EF+P+     ++   LPFL +T       NNLYPFLHL+  G LFIFAN  +IL ++  N
Sbjct  178   EFIPKTSTSDQTLYQLPFLKETRYSPLIPNNLYPFLHLTPGGKLFIFANDRAILLDHVNN  237

Query  1048  RVEKKFPRMPGEGSRSYPSTGSSVMLPLDHKNRFQ---KVEVMICGGASAGAYTEAKQGR  1218
             +V K +P MPG  SR+YPSTGSSV+LPL   + F    + EV ICGG    +   A  G 
Sbjct  238   KVVKNYPVMPGGVSRNYPSTGSSVLLPLILSSNFNNHPEAEVFICGGTVPDSNQMANVGV  297

Query  1219  FIEGLKSCGRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGAS  1398
             FI   KSCGR+VI+ N   W ME MP  R+M DM++LPTG +LIING  +G AGW  G  
Sbjct  298   FIAASKSCGRLVITANNPSWEMEEMPLNRLMGDMILLPTGDVLIINGAAKGSAGWYAGRE  357

Query  1399  PALEPYIYSPGKTV---GKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTN  1569
             P L P +Y P   +     RF ++  +KI R+YHS+A LL DGRVL+ GSNPN  Y FT 
Sbjct  358   PVLNPVLYRPDAPITAKTSRFEIMSPSKIPRLYHSTAHLLSDGRVLVGGSNPNSNYNFTA  417

Query  1570  VPHPTELRLQAFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE  1749
             + +PTEL ++ F P Y        RP    +  + +P   ++Y ++F + F +  +W  E
Sbjct  418   L-YPTELSVEVFYPPYFSPNV--SRP----LISKINPGTNLEYKQKFSMHFHI-HQWHEE  469

Query  1750  --DLEFSAYSPPFTTHSVAMNQRMLKLRCTS-MERGDNGMVNavvaappspvaappGYYM  1920
                +  +  +P FT+HS +MNQR+L L   S  ++ D       V AP +   APPGYY 
Sbjct  470   LGKIYVTMVAPSFTSHSYSMNQRLLVLALDSEAQKVDFSNYVVDVHAPATATLAPPGYYQ  529

Query  1921  VTVVNEGIPSISRWV  1965
             + VV+EG+PS   WV
Sbjct  530   LFVVHEGVPSKGTWV  544



>ref|XP_009337677.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=536

 Score =   409 bits (1050),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 231/544 (42%), Positives = 321/544 (59%), Gaps = 29/544 (5%)
 Frame = +1

Query  352   NASVLVSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGT  531
             N SVL + AA G  +WQ L +N G+ AMHM L   + +V FD+   G+S   L    NG 
Sbjct  17    NFSVLTAHAAGG--KWQVL-KNVGISAMHMQLFKNDRIVLFDRTDFGKSNLSLP---NG-  69

Query  532   RCKGSREDLSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGS  711
                    +  +  C AHS E+ V  N +RPL  +SD WCSSG++ + G ++QTGG   G 
Sbjct  70    -------NCVNNDCTAHSAEFVVQTNAVRPLTVLSDVWCSSGSMDAYGNLIQTGGNNIGE  122

Query  712   KRIQFFAPCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFP  891
             +R++ F PC    C+WK     L   RWYA+N ILP  + R II+GGR    YEF P+  
Sbjct  123   RRVRVFTPCTG--CDWKEIVDGLAARRWYATNHILP--DGREIIIGGRGQFNYEFYPKTA  178

Query  892   NMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPR  1071
             +      LPFL QT +     NNLYPF+ L+ DG LF+FAN  +IL +Y KN V K +P+
Sbjct  179   STSNVYSLPFLSQTNDPGQE-NNLYPFVFLNPDGNLFVFANNRAILLDYVKNVVVKTYPQ  237

Query  1072  MPGEGSRSYPSTGSSVMLPLDHKNRFQ---KVEVMICGGASAGAYTEAKQGRFIEGLKSC  1242
             +PG   RSYPSTGS+V+LPL  KN      + EV++CGGA  G++ +A +G F+E L +C
Sbjct  238   IPGGDPRSYPSTGSAVLLPL--KNLMAPSVEAEVLVCGGAPKGSFVQANKGTFVEALNTC  295

Query  1243  GRMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIY  1422
              R+ I+    +W +E MP  RVM DM++LP   +L+ING   G AGW  G +P   P +Y
Sbjct  296   ARIKITDPNPQWIVETMPQARVMGDMLLLPDSTVLLINGASSGVAGWEIGRNPVFNPVVY  355

Query  1423  SPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTN-VPHPTELRLQ  1599
              P   VG RF     T I RMYHSSA L+ DGRV++ GSNP++ Y F N V  PTELRL+
Sbjct  356   RPDNAVGSRFEQQNPTTIPRMYHSSALLVRDGRVIVGGSNPHEKYQFGNDVLFPTELRLE  415

Query  1600  AFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPP  1779
             AF P+Y+D ++ N RP   ++   G+ A  + YG +  ++F L   +    +  +  +PP
Sbjct  416   AFSPEYLDAKYANLRP---TILAPGNQAK-IHYGIKLAIQFSLTGTFAKNSVSVTMVAPP  471

Query  1780  FTTHSVAMNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISR  1959
             F+THS +MNQR+L L   ++++         V  PPS   AP GYY++ VV++ IPS   
Sbjct  472   FSTHSFSMNQRLLVLGAENVQQVGPTTYQVQVTTPPSKNLAPSGYYILFVVHQQIPSEGI  531

Query  1960  WVKF  1971
             +VK 
Sbjct  532   FVKI  535



>ref|XP_004984953.1| PREDICTED: galactose oxidase-like [Setaria italica]
Length=575

 Score =   410 bits (1053),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 235/556 (42%), Positives = 321/556 (58%), Gaps = 32/556 (6%)
 Frame = +1

Query  367   VSEAASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGS  546
             ++ A+   GRW  L  + GV AMHM L H + V+ FD+   GRS   L     G RC+ +
Sbjct  30    IAPASGSGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGRSNLSL----PGGRCRVN  85

Query  547   REDLSDP--SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRI  720
               + + P   C AHS EYDV  N  RPL   +DTWCSSGT+  +GT++QTGG+ DG +  
Sbjct  86    PRERALPGGDCTAHSAEYDVAANAARPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNA  145

Query  721   QFFAPC---VDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRF-  888
             +    C     K+C+W   +  L   RWYA+NQILP  + R  I+GGRR  +YEF P+  
Sbjct  146   RTMPVCGGSDGKSCDWSEKQDALAANRWYATNQILP--DGRAFIIGGRRQFSYEFYPKAD  203

Query  889   PNMQKSTDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFP  1068
             P+      +PFL QT  R+   NNLYPF+HL+ DG LFIFA   +IL +Y++N+V + +P
Sbjct  204   PSDTSVIQMPFLVQT--RDPEENNLYPFVHLNIDGNLFIFAKNRAILLDYKRNKVARTYP  261

Query  1069  RMPGEGSRSYPSTGSSVMLPLDHKNRFQKVEVMICGGASAGAY--TEAKQGRFIEGLKSC  1242
              +     R+YPS+GSSV+LPL  K    + EV++CGGA +G+Y  T+     F+  L +C
Sbjct  262   VLADGDPRNYPSSGSSVLLPL--KPNPTEAEVLVCGGAPSGSYNSTKGSARTFVPALATC  319

Query  1243  GRMVISGNKHKWNMENMPGPRVMNDMVILPTG-QILIINGVKRGCAGWGNGASPALEPYI  1419
             GR+ I+     W +E MP PRVM DM++LP G ++ IING   G AGW    +P   P I
Sbjct  320   GRIKITDPSPAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWEAAGTPNYAPVI  379

Query  1420  YSPGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQ  1599
             Y P ++ G RF    AT +AR+YHSS  LL DGR+L+ GSNP+  Y F+ V  PTEL L+
Sbjct  380   YRPDRSPGDRFEEQAATGVARLYHSSVVLLRDGRLLVGGSNPHTYYNFSGVEFPTELSLE  439

Query  1600  AFVPDYMDRRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSE----------  1749
             AF P+Y+D+  D  RP+ +     G+ A+ V YG    ++F +                 
Sbjct  440   AFSPEYLDQSNDMLRPRILDPSPIGA-ASSVSYGTTLKLQFSVPASARRRRGGAGGFGLG  498

Query  1750  DLEFSAYSPPFTTHSVAMNQRMLKLRC--TSMERGDNGMVNavvaappspvaappGYYMV  1923
             ++  +  +P FTTHS AMNQR+L L    T+  RG  G  N     P + V APPGYYMV
Sbjct  499   EVSVTMVAPSFTTHSFAMNQRLLFLEVGKTAAVRGRAGTYNVSATMPATAVLAPPGYYMV  558

Query  1924  TVVNEGIPSISRWVKF  1971
              VVN  +PS   WV  
Sbjct  559   FVVNGHVPSEGIWVHI  574



>emb|CDY47509.1| BnaAnng09070D [Brassica napus]
Length=554

 Score =   409 bits (1050),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 237/537 (44%), Positives = 327/537 (61%), Gaps = 20/537 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A+   G W+ L+ N G+ AMH  L   + V+ +D+   G S   L    NGT C+ S  D
Sbjct  32    ASGAGGTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLP---NGT-CRDSPND  87

Query  556   -LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
              +S   C AHS+EYDV  N IRPL   S+TWCSSG +  +GT++QTGG +DG ++ + F 
Sbjct  88    SVSKRDCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTGGDKDGERKARLFY  147

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC D +C+W      L  +RWYASN +LP  + R IIVGGR    +EF P+  N   +  
Sbjct  148   PCDDDSCDWSEIDNALNVKRWYASNHVLP--DGRQIIVGGRDEFNFEFFPK-TNAPNTYS  204

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             L FL +T + +   NNLYP + L++DG LFIFAN  +IL +Y KN V K +P++PG   R
Sbjct  205   LRFLSETNDLDQE-NNLYPNVFLNTDGNLFIFANNRAILLDYAKNTVVKTYPKIPGGEPR  263

Query  1093  SYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISGN  1266
             SYPSTGS+V+LP+ + +    ++EV++CGGA  G+Y  A  +  F++GL +C R+ I+  
Sbjct  264   SYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALNENTFVKGLDTCARIKINDA  323

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK  1446
               KW +E MP PR+M DM++LP GQ+L+ING   G AGW  G  P L P +Y P K VG 
Sbjct  324   NPKWVLEKMPRPRIMGDMIVLPNGQVLLINGGSSGSAGWELGREPVLNPDLYHPDKPVGS  383

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF +   + I RMYHS+A LL DGRVL+ GSNP++ Y FT V  PTELRL+AF P Y++ 
Sbjct  384   RFQIQNPSTIPRMYHSTATLLRDGRVLVGGSNPHEFYNFTGVLFPTELRLEAFSPSYLES  443

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWL--DKKWPSEDLEFSAYSPPFTTHSVA  1800
             ++ N RP+ +S  +     + V+YG    +RF +  + K P   ++ +   P FTTHS +
Sbjct  444   QYRNIRPRIMSPSLH----STVNYGGVLRLRFRVLGEVKTP---VKVTMAFPSFTTHSFS  496

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             M+QR+L L   +  R         V  P S   APPGYYMV VVN+ IPS   WV+ 
Sbjct  497   MSQRLLVLDHVTSLRIGQWTYEVRVKTPRSANLAPPGYYMVFVVNQDIPSEGIWVRL  553



>ref|XP_009106213.1| PREDICTED: galactose oxidase isoform X2 [Brassica rapa]
Length=554

 Score =   408 bits (1049),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 236/537 (44%), Positives = 327/537 (61%), Gaps = 20/537 (4%)
 Frame = +1

Query  376   AASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSRED  555
             A+   G W+ L+ N G+ AMH  L   + V+ +D+   G S   L    NGT C+ S  D
Sbjct  32    ASGAGGTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLP---NGT-CRDSPND  87

Query  556   -LSDPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFA  732
              +S   C AHS+EYDV  N IRPL   S+TWCSSG +  +GT++QTGG +DG ++ + F 
Sbjct  88    SVSKRDCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTGGDKDGERKARLFY  147

Query  733   PCVDKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKSTD  912
             PC D++C+W      L  +RWYASN +LP  + R IIVGGR    +EF P+  N   +  
Sbjct  148   PCDDESCDWSEIDNALNVKRWYASNHVLP--DGRQIIVGGRDEFNFEFFPK-TNAPNTYS  204

Query  913   LPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSR  1092
             L FL +T + +   NNLYP + L++DG LF+FAN  +IL +Y KN V K +P +PG   R
Sbjct  205   LRFLSETNDLDQE-NNLYPNVFLNTDGNLFVFANNRAILLDYSKNTVVKTYPEIPGGEPR  263

Query  1093  SYPSTGSSVMLPL-DHKNRFQKVEVMICGGASAGAYTEA-KQGRFIEGLKSCGRMVISGN  1266
             SYPSTGS+V+LP+ + +    ++EV++CGGA  G+Y  A  +  F++GL +C R+ I+  
Sbjct  264   SYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALNENTFVKGLDTCARIKINDA  323

Query  1267  KHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVGK  1446
               KW +E MP PR+M DM++LP GQ+L+ING   G AGW  G  P L P +Y P K VG 
Sbjct  324   NPKWVLEKMPRPRIMGDMIVLPNGQVLLINGGSSGSAGWELGREPVLNPDLYHPDKPVGS  383

Query  1447  RFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMDR  1626
             RF +   + I RMYHS+A LL DGRVL+ GSNP++ Y FT V  PTELRL+AF P Y++ 
Sbjct  384   RFQIQNPSTIPRMYHSTATLLRDGRVLVGGSNPHEFYNFTGVLFPTELRLEAFSPSYLES  443

Query  1627  RFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWL--DKKWPSEDLEFSAYSPPFTTHSVA  1800
             ++ N RP+ +S  +     + V+YG    +RF +  + K P   ++ +   P FTTHS +
Sbjct  444   QYRNIRPRIMSPSLH----STVNYGGVLRLRFRVLGEVKTP---VKVTMAFPSFTTHSFS  496

Query  1801  MNQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             M+QR+L L   +  R         V  P S   APPGYYMV VVN+ IPS   WV+ 
Sbjct  497   MSQRLLVLDHVTSLRIGQWTYEVRVKTPRSANLAPPGYYMVFVVNQDIPSEGIWVRL  553



>ref|XP_004238617.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=557

 Score =   408 bits (1049),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 224/536 (42%), Positives = 308/536 (57%), Gaps = 16/536 (3%)
 Frame = +1

Query  379   ASGQGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDL  558
             A+  G+W  LM N G+ AMHM L + + VV +D+   G S   L       +C+ +  DL
Sbjct  32    AAAGGKWDLLMSNIGISAMHMQLLNDDRVVIYDRTDFGMSNISLP----DGKCRNNNNDL  87

Query  559   S-DPSCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAP  735
             +    C AHSVEYDV  N++RPL   ++ WCSSG+  S+G+++QTGG  DG   I+ + P
Sbjct  88    ALKVDCTAHSVEYDVSTNSVRPLMIQTNVWCSSGSATSDGSLVQTGGSNDGKFVIRVYRP  147

Query  736   CV---DKTCNWKPGKKHLYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKS  906
             C+      C+W   +  L   RWY++N ILP  +   II+GGR A  YEF P+  +    
Sbjct  148   CIIGKKSNCDWLEIENGLIQSRWYSTNHILPDGSQ--IIIGGRDAFNYEFFPKTASTNNV  205

Query  907   TDLPFLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEG  1086
              +LPFL QT +     NNLYPF+ L+ DG LFIF N  +ILF+Y  N + K +P++PG  
Sbjct  206   FNLPFLQQTNDPREE-NNLYPFVFLNVDGNLFIFTNNRAILFDYTTNMIVKTYPQIPGGD  264

Query  1087  SRSYPSTGSSVMLPLDH-KNRFQKVEVMICGGASAGAYTEAKQGRFIEGLKSCGRMVISG  1263
              R+YPSTGS+V+LPL + +    + EV++CGGA  G+Y +A +G FI  L +CGR+ I+ 
Sbjct  265   PRNYPSTGSAVLLPLKNLEAHTIQAEVLVCGGAPRGSYLKATRGEFIGALNTCGRITITD  324

Query  1264  NKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYSPGKTVG  1443
                +W ME MP PR M DMVILP G +LI+NG   G AGW     P L P IY P     
Sbjct  325   PNPQWTMETMPLPRTMGDMVILPNGNVLIVNGAAMGSAGWEIARGPVLSPVIYRPDNLPD  384

Query  1444  KRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAFVPDYMD  1623
              RF V     I RMYHS+A LL DGRVL+ GSNPN+ Y FT V  PTEL L+AF P Y+D
Sbjct  385   SRFEVQNPNAIPRMYHSTAVLLRDGRVLVGGSNPNEFYNFTGVLFPTELSLEAFSPSYLD  444

Query  1624  RRFDNQRPKNVSVYVEGSPAAVVDYGKEFHVRFWLDKKWPSEDLEFSAYSPPFTTHSVAM  1803
                 + RP+ +S            +G+   ++F +        ++ +  +P F THS  M
Sbjct  445   SESAHLRPQIISPVSRHK----FKHGQRVDIQFSISGLVNKNSIKVTMIAPGFNTHSNTM  500

Query  1804  NQRMLKLRCTSMERGDNGMVNavvaappspvaappGYYMVTVVNEGIPSISRWVKF  1971
             NQRML L    +++      +     P S   APPGYY++ VV++ IPS   WV+ 
Sbjct  501   NQRMLVLTNGVVKQVGKSSYHMNCLFPKSGSLAPPGYYLLFVVHQDIPSEGIWVRI  556



>ref|XP_006439219.1| hypothetical protein CICLE_v10024435mg [Citrus clementina]
 gb|ESR52459.1| hypothetical protein CICLE_v10024435mg [Citrus clementina]
Length=555

 Score =   408 bits (1048),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 241/546 (44%), Positives = 323/546 (59%), Gaps = 36/546 (7%)
 Frame = +1

Query  388   QGRWQTLMENTGVVAMHMALTHRNTVVFFDQRGSGRSGYQLRRRFNGTRCKGSREDLSDP  567
             +G+W+ L  + GV AMHMAL   + ++ FD+   G S   L +   G   KG   + SD 
Sbjct  27    EGKWKLLKRSIGVSAMHMALLPNDRIIAFDRSHFGPSNITLPQ---GKCIKGVELETSD-  82

Query  568   SCYAHSVEYDVLNNTIRPLRFISDTWCSSGTILSNGTIMQTGGYRDGSKRIQFFAPCVDK  747
              CYAH+VE+D +   +RPL   +DTWCSSG +L+NG ++QTGGYR G + +++  PC D 
Sbjct  83    -CYAHAVEFDPITRKVRPLTIQTDTWCSSGALLANGVLVQTGGYRLGERVVRYLKPCSD-  140

Query  748   TCNWKPGKKH-LYDERWYASNQILPGKNDRVIIVGGRRASTYEFVPRFPNMQKST--DLP  918
              C+W+   ++ L   RWYASNQILP  N ++I+VGGR   TYEF+PR  +  +     LP
Sbjct  141   -CDWEEDHQNGLISPRWYASNQILP--NGKIIVVGGRFQFTYEFIPRTSDSDRKILYQLP  197

Query  919   FLHQTYERNAGGNNLYPFLHLSSDGYLFIFANRDSILFNYRKNRVEKKFPRMPGEGSRSY  1098
             FL +T       NNLYPFLHLS+DG LFIFAN  +IL +Y  NRV K +P MPG  SR+Y
Sbjct  198   FLKETMHSPKIPNNLYPFLHLSTDGNLFIFANDRAILLDYVNNRVMKNYPVMPGGISRNY  257

Query  1099  PSTGSSVMLPLD------HKNRFQK----VEVMICGGASAGAYTEAKQGR-FIEGLKSCG  1245
             PSTGSSV+LP++      H N   K     +V+ICGG    +   A + + F+   KSCG
Sbjct  258   PSTGSSVLLPVNLSSINVHINNNNKPVVHSQVLICGGTLPDSNENAAEAQIFLPAAKSCG  317

Query  1246  RMVISGNKHKWNMENMPGPRVMNDMVILPTGQILIINGVKRGCAGWGNGASPALEPYIYS  1425
             R+ I+    KW ME MP  RVM DM++LPTG +LIING  +G AGWG    P L P IY 
Sbjct  318   RLTITAQNPKWEMEEMPLNRVMGDMILLPTGDVLIINGAAKGTAGWGAAREPVLNPVIYC  377

Query  1426  PGKTVGKRFSVLRATKIARMYHSSAALLPDGRVLIAGSNPNDGYVFTNVPHPTELRLQAF  1605
             P      RF +L  + I R+YHS+A LL DGRVL+ GSNPN  Y F+ +  PTEL LQAF
Sbjct  378   PKI---NRFRILSPSLIPRLYHSTAHLLSDGRVLVGGSNPNVNYNFSAL-FPTELSLQAF  433

Query  1606  VPDYMDRRFDNQRPKNVSVYVEGSPAAV--VDYGKEFHVRFWLDKKWPSEDLEFSAYSPP  1779
              P Y +   +  RP   +V     P A   + Y + F + F L +     ++  +  +P 
Sbjct  434   YPPYFNLMSNRSRPSISTV----KPGAFLKLKYTENFSLGFKL-RSGDLGEIFVTMVAPS  488

Query  1780  FTTHSVAMNQRMLKLRCTSMERGDN--GMVNavvaappspvaappGYYMVTVVNEGIPSI  1953
             FTTHS AMNQR+L L      +  N  G      +APP+   APPGY  + +VN+G+PS 
Sbjct  489   FTTHSFAMNQRLLVLELHGAVQKSNTAGDYIVQCSAPPTAALAPPGYCQLFLVNDGVPSK  548

Query  1954  SRWVKF  1971
             + WV+ 
Sbjct  549   AVWVQI  554



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6329964200262