BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83119_g1_i1 len=1974 path=[1952:0-1973]

Length=1974
                                                                      Score     E

ref|XP_009771902.1|  PREDICTED: uncharacterized protein LOC104222370    405   8e-130   
ref|XP_009603107.1|  PREDICTED: uncharacterized protein LOC104098145    395   5e-126   
ref|XP_004243611.1|  PREDICTED: uncharacterized protein LOC101246265    395   5e-126   
ref|XP_002283205.1|  PREDICTED: uncharacterized protein LOC100247266    384   1e-121   Vitis vinifera
ref|XP_007217676.1|  hypothetical protein PRUPE_ppa024302mg             362   1e-114   
ref|XP_008229580.1|  PREDICTED: uncharacterized protein LOC103328936    362   2e-113   
emb|CDP08376.1|  unnamed protein product                                361   4e-113   
ref|XP_011026219.1|  PREDICTED: uncharacterized protein LOC105126...    352   2e-109   
ref|XP_011026221.1|  PREDICTED: uncharacterized protein LOC105126...    349   1e-108   
ref|XP_010093175.1|  hypothetical protein L484_013298                   349   2e-108   
ref|XP_006386280.1|  hypothetical protein POPTR_0002s05800g             347   5e-108   
ref|XP_006352001.1|  PREDICTED: uncharacterized protein LOC102602174    345   2e-107   
ref|XP_011044747.1|  PREDICTED: uncharacterized protein LOC105139...    341   1e-105   
ref|XP_011044745.1|  PREDICTED: uncharacterized protein LOC105139...    339   7e-105   
ref|XP_004251552.1|  PREDICTED: uncharacterized protein LOC101258824    338   1e-104   
ref|XP_011032779.1|  PREDICTED: uncharacterized protein LOC105131...    338   2e-104   
ref|XP_002530206.1|  conserved hypothetical protein                     337   2e-104   Ricinus communis
ref|XP_006437114.1|  hypothetical protein CICLE_v10031282mg             338   3e-104   
ref|XP_006484983.1|  PREDICTED: uncharacterized protein DDB_G0271...    338   4e-104   
ref|XP_011032776.1|  PREDICTED: uncharacterized protein LOC105131...    336   9e-104   
ref|XP_008380178.1|  PREDICTED: uncharacterized protein LOC103443...    337   1e-103   
ref|XP_008342335.1|  PREDICTED: uncharacterized protein LOC103405147    335   4e-103   
ref|XP_009377072.1|  PREDICTED: uncharacterized protein LOC103965727    334   9e-103   
ref|XP_002307564.2|  hypothetical protein POPTR_0005s22730g             332   1e-102   Populus trichocarpa [western balsam poplar]
ref|XP_002300865.2|  hypothetical protein POPTR_0002s05800g             331   8e-102   Populus trichocarpa [western balsam poplar]
ref|XP_006386281.1|  hypothetical protein POPTR_0002s05800g             331   1e-101   
gb|KDP36514.1|  hypothetical protein JCGZ_08897                         328   6e-101   
ref|XP_007048945.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    329   6e-101   
ref|XP_009356595.1|  PREDICTED: uncharacterized protein LOC103947...    323   2e-98    
gb|KHG17269.1|  Endo-alpha-N-acetylgalactosaminidase                    317   2e-96    
ref|XP_010272276.1|  PREDICTED: uncharacterized protein LOC104608...    317   8e-96    
ref|XP_010272275.1|  PREDICTED: uncharacterized protein LOC104608...    316   9e-96    
ref|XP_010272277.1|  PREDICTED: uncharacterized protein LOC104608...    315   4e-95    
ref|XP_011100505.1|  PREDICTED: uncharacterized protein LOC105178...    313   8e-95    
ref|XP_007048948.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    311   1e-94    
ref|XP_008380179.1|  PREDICTED: uncharacterized protein LOC103443...    311   4e-94    
ref|XP_010053987.1|  PREDICTED: uncharacterized protein LOC104442300    304   1e-91    
ref|XP_007048946.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    304   3e-91    
ref|XP_007048947.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    301   6e-91    
gb|EYU43169.1|  hypothetical protein MIMGU_mgv1a005581mg                302   8e-91    
ref|XP_004305846.1|  PREDICTED: uncharacterized protein LOC101295444    304   3e-90    
ref|XP_004499969.1|  PREDICTED: uncharacterized protein LOC101495...    297   6e-89    
ref|XP_004499968.1|  PREDICTED: uncharacterized protein LOC101495...    296   7e-89    
ref|XP_009356597.1|  PREDICTED: uncharacterized protein LOC103947...    296   2e-88    
ref|XP_008451829.1|  PREDICTED: uncharacterized protein LOC103492999    288   5e-86    
ref|XP_007048949.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    288   3e-84    
ref|XP_004147749.1|  PREDICTED: uncharacterized protein LOC101215061    283   5e-84    
ref|XP_010557153.1|  PREDICTED: uncharacterized protein LOC104826243    283   2e-83    
ref|XP_010035944.1|  PREDICTED: uncharacterized protein LOC104425...    283   3e-83    
ref|XP_011100506.1|  PREDICTED: uncharacterized protein LOC105178...    281   7e-83    
ref|XP_010035945.1|  PREDICTED: uncharacterized protein LOC104425...    280   6e-82    
ref|XP_011085649.1|  PREDICTED: uncharacterized protein LOC105167573    276   5e-81    
gb|KEH33680.1|  hypothetical protein MTR_3g450760                       270   3e-79    
gb|KCW89771.1|  hypothetical protein EUGRSUZ_A02029                     259   7e-76    
ref|XP_010522057.1|  PREDICTED: uncharacterized protein LOC104800...    263   9e-76    
ref|XP_010522056.1|  PREDICTED: uncharacterized protein LOC104800...    262   1e-75    
gb|KHN13178.1|  hypothetical protein glysoja_045502                     249   2e-71    
emb|CDY10214.1|  BnaC05g04570D                                          250   2e-71    
ref|XP_009795643.1|  PREDICTED: uncharacterized protein LOC104242...    249   2e-70    
ref|XP_009119043.1|  PREDICTED: uncharacterized protein LOC103844022    246   4e-70    
ref|XP_009785070.1|  PREDICTED: uncharacterized protein LOC104233378    236   5e-69    
ref|XP_003617375.1|  hypothetical protein MTR_5g090900                  244   5e-69    
emb|CDY06656.1|  BnaA10g04350D                                          244   6e-69    
ref|XP_006417897.1|  hypothetical protein EUTSA_v10007468mg             244   6e-69    
gb|KFK42983.1|  hypothetical protein AALP_AA1G064300                    240   5e-68    
ref|XP_009110978.1|  PREDICTED: uncharacterized protein LOC103836471    239   3e-67    
ref|XP_009628893.1|  PREDICTED: uncharacterized protein LOC104116...    239   5e-67    
emb|CDY15586.1|  BnaA08g28700D                                          236   5e-66    
emb|CDX86516.1|  BnaC08g01870D                                          234   2e-65    
ref|XP_010475403.1|  PREDICTED: uncharacterized protein LOC104754822    234   2e-65    
ref|XP_002892352.1|  hypothetical protein ARALYDRAFT_887868             231   3e-64    
ref|XP_010457790.1|  PREDICTED: uncharacterized protein LOC104739213    231   4e-64    
ref|XP_009589704.1|  PREDICTED: uncharacterized protein LOC104116...    227   1e-62    
ref|XP_010688901.1|  PREDICTED: uncharacterized protein LOC104902715    225   3e-62    
ref|XP_009795644.1|  PREDICTED: uncharacterized protein LOC104242...    225   6e-62    
ref|XP_003530723.1|  PREDICTED: uncharacterized protein LOC100777669    223   7e-62    
ref|XP_006366635.1|  PREDICTED: uncharacterized protein LOC102605064    227   9e-61    
gb|KHN11984.1|  hypothetical protein glysoja_019957                     219   2e-60    
ref|NP_172151.2|  protein JASON                                         220   3e-60    Arabidopsis thaliana [mouse-ear cress]
gb|KHN38345.1|  hypothetical protein glysoja_004010                     219   6e-60    
ref|XP_006304819.1|  hypothetical protein CARUB_v10012445mg             218   2e-59    
ref|XP_003519537.1|  PREDICTED: uncharacterized protein LOC100818...    217   3e-59    
ref|NP_001239769.1|  uncharacterized protein LOC100799259               216   6e-59    
ref|XP_006575641.1|  PREDICTED: uncharacterized protein LOC100818...    215   1e-58    
ref|XP_006410181.1|  hypothetical protein EUTSA_v10017740mg             212   6e-58    
ref|XP_010942510.1|  PREDICTED: uncharacterized protein LOC105060...    213   2e-57    
ref|XP_007141439.1|  hypothetical protein PHAVU_008G195700g             209   1e-56    
ref|XP_007141440.1|  hypothetical protein PHAVU_008G195700g             209   1e-56    
ref|XP_006853377.1|  hypothetical protein AMTR_s00032p00131610          207   6e-55    
ref|XP_007146237.1|  hypothetical protein PHAVU_006G023700g             198   5e-53    
ref|XP_008806685.1|  PREDICTED: uncharacterized protein LOC103719285    199   2e-52    
ref|XP_007146236.1|  hypothetical protein PHAVU_006G023700g             189   4e-50    
gb|AAM13918.1|  unknown protein                                         185   6e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777000.1|  PREDICTED: uncharacterized protein LOC103697018    189   7e-49    
ref|XP_008811132.1|  PREDICTED: uncharacterized protein LOC103722372    184   9e-48    
gb|EYU42807.1|  hypothetical protein MIMGU_mgv11b007351mg               179   8e-47    
emb|CDP08374.1|  unnamed protein product                                179   5e-46    
ref|XP_010462500.1|  PREDICTED: uncharacterized protein LOC104743076    174   1e-45    
ref|XP_006294380.1|  hypothetical protein CARUB_v10023398mg             176   3e-45    
ref|XP_009407083.1|  PREDICTED: uncharacterized protein LOC103989862    177   6e-45    
ref|XP_010927116.1|  PREDICTED: uncharacterized protein LOC105049236    176   2e-44    
gb|AAF24810.1|AC007592_3  F12K11.5                                      170   2e-43    Arabidopsis thaliana [mouse-ear cress]
ref|NP_180640.2|  uncharacterized protein                               170   5e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AAC20717.1|  unknown protein                                         170   7e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010241859.1|  PREDICTED: uncharacterized protein LOC104586356    162   7e-42    
ref|XP_009141103.1|  PREDICTED: uncharacterized protein LOC103865074    166   1e-41    
emb|CDY23981.1|  BnaC03g17100D                                          159   2e-39    
ref|XP_002879280.1|  hypothetical protein ARALYDRAFT_481999             159   6e-39    
ref|XP_010510282.1|  PREDICTED: uncharacterized protein LOC104786548    152   1e-36    
gb|KHM99653.1|  hypothetical protein glysoja_006496                     150   1e-36    
ref|XP_010469790.1|  PREDICTED: uncharacterized protein LOC104749...    147   4e-35    
ref|XP_010469791.1|  PREDICTED: uncharacterized protein LOC104749...    147   4e-35    
ref|NP_001051439.2|  Os03g0777100                                       145   7e-35    Oryza sativa Japonica Group [Japonica rice]
emb|CDX84817.1|  BnaA03g14130D                                          145   1e-34    
gb|EEC76265.1|  hypothetical protein OsI_13728                          147   1e-34    Oryza sativa Indica Group [Indian rice]
ref|XP_010414212.1|  PREDICTED: uncharacterized protein LOC104700...    145   1e-34    
ref|XP_010414211.1|  PREDICTED: uncharacterized protein LOC104700...    145   2e-34    
ref|XP_010942527.1|  PREDICTED: uncharacterized protein LOC105060...    145   2e-34    
ref|XP_009132753.1|  PREDICTED: uncharacterized protein LOC103857...    143   3e-34    
ref|XP_003559372.1|  PREDICTED: uncharacterized protein LOC100833527    145   3e-34    
gb|AAM19018.1|AC084748_8  hypothetical protein                          144   1e-33    Oryza sativa Japonica Group [Japonica rice]
dbj|BAH01513.1|  unnamed protein product                                144   1e-33    Oryza sativa Japonica Group [Japonica rice]
emb|CDY29642.1|  BnaA04g17850D                                          137   1e-31    
ref|XP_010941823.1|  PREDICTED: uncharacterized protein LOC105059978    137   5e-31    
gb|ACU16764.1|  unknown                                                 127   6e-31    Glycine max [soybeans]
ref|XP_002463801.1|  hypothetical protein SORBIDRAFT_01g006400          134   2e-30    Sorghum bicolor [broomcorn]
gb|EMT06993.1|  hypothetical protein F775_30635                         134   2e-30    
gb|ACG36204.1|  hypothetical protein                                    129   4e-30    Zea mays [maize]
gb|EMS46169.1|  hypothetical protein TRIUR3_23955                       133   6e-30    
ref|XP_006650673.1|  PREDICTED: uncharacterized protein LOC102719472    132   1e-29    
ref|NP_001130438.1|  uncharacterized protein LOC100191535               131   2e-29    Zea mays [maize]
gb|ACN36363.1|  unknown                                                 129   2e-29    Zea mays [maize]
gb|ACR34418.1|  unknown                                                 131   2e-29    Zea mays [maize]
emb|CDX97792.1|  BnaC04g41470D                                          130   2e-29    
ref|XP_009132754.1|  PREDICTED: uncharacterized protein LOC103857...    129   3e-29    
gb|ABR18181.1|  unknown                                                 133   3e-29    Picea sitchensis
gb|EMT06888.1|  hypothetical protein F775_12167                         130   6e-29    
ref|XP_008647301.1|  PREDICTED: uncharacterized protein LOC100191...    129   8e-29    
ref|XP_008647299.1|  PREDICTED: uncharacterized protein LOC100191...    129   8e-29    
ref|NP_001130670.1|  uncharacterized protein LOC100191773               129   1e-28    Zea mays [maize]
ref|XP_004951783.1|  PREDICTED: uncharacterized protein LOC101762196    125   2e-27    
ref|XP_009406745.1|  PREDICTED: uncharacterized protein LOC103989...    125   3e-27    
ref|XP_009406746.1|  PREDICTED: uncharacterized protein LOC103989...    125   3e-27    
ref|XP_010240600.1|  PREDICTED: uncharacterized protein LOC100845...    123   7e-27    
ref|XP_010240601.1|  PREDICTED: uncharacterized protein LOC100845...    123   8e-27    
gb|KHM99684.1|  hypothetical protein glysoja_006527                     120   2e-26    
ref|XP_004981563.1|  PREDICTED: uncharacterized protein LOC101785...    121   3e-26    
ref|XP_008647300.1|  PREDICTED: uncharacterized protein LOC100191...    120   1e-25    
gb|EMT21537.1|  hypothetical protein F775_15618                         119   4e-25    
ref|XP_002438836.1|  hypothetical protein SORBIDRAFT_10g026920          118   6e-25    Sorghum bicolor [broomcorn]
ref|XP_006657237.1|  PREDICTED: uncharacterized protein LOC102706111    117   7e-25    
ref|NP_001143671.1|  uncharacterized protein LOC100276394               117   1e-24    Zea mays [maize]
gb|ACN25562.1|  unknown                                                 117   1e-24    Zea mays [maize]
dbj|BAJ87049.1|  predicted protein                                      117   1e-24    
ref|XP_009408258.1|  PREDICTED: uncharacterized protein LOC103990737    110   3e-22    
gb|KDO40900.1|  hypothetical protein CISIN_1g029349mg                   104   8e-22    
ref|XP_004967263.1|  PREDICTED: uncharacterized protein LOC101766103    106   3e-21    
ref|XP_007137175.1|  hypothetical protein PHAVU_009G106000g           98.2    1e-20    
ref|XP_002451610.1|  hypothetical protein SORBIDRAFT_04g004570        99.4    5e-19    Sorghum bicolor [broomcorn]
ref|NP_001046012.1|  Os02g0168300                                     97.8    1e-18    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ87364.1|  predicted protein                                    96.3    1e-17    
gb|ACG31592.1|  hypothetical protein                                  93.6    7e-17    Zea mays [maize]
ref|NP_001132267.1|  uncharacterized protein LOC100193703             93.6    7e-17    Zea mays [maize]
ref|NP_001058327.1|  Os06g0670100                                     93.2    7e-17    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003570036.1|  PREDICTED: uncharacterized protein LOC100826550  91.3    4e-16    
gb|EAZ02028.1|  hypothetical protein OsI_24060                        89.7    9e-16    Oryza sativa Indica Group [Indian rice]
gb|AFW66379.1|  hypothetical protein ZEAMMB73_852353                  87.4    7e-15    
gb|KEH42481.1|  hypothetical protein MTR_1g069610                     86.7    1e-14    
ref|XP_001757272.1|  predicted protein                                85.9    5e-14    
gb|AFW66380.1|  hypothetical protein ZEAMMB73_852353                  84.3    7e-14    
ref|XP_001755894.1|  predicted protein                                84.3    1e-13    
ref|XP_004495071.1|  PREDICTED: uncharacterized protein LOC101492521  81.6    5e-13    
tpg|DAA36944.1|  TPA: hypothetical protein ZEAMMB73_678513            81.6    8e-13    
ref|XP_009781302.1|  PREDICTED: uncharacterized protein LOC104230241  81.3    8e-13    
ref|XP_008780393.1|  PREDICTED: uncharacterized protein LOC103700210  77.0    3e-12    
ref|NP_001144995.1|  uncharacterized protein LOC100278155             79.3    3e-12    Zea mays [maize]
ref|XP_004292231.1|  PREDICTED: uncharacterized protein LOC101308152  78.6    5e-12    
ref|XP_004247502.1|  PREDICTED: uncharacterized protein LOC101246864  78.2    7e-12    
ref|XP_006358415.1|  PREDICTED: uncharacterized protein LOC102596931  77.8    9e-12    
ref|XP_011080095.1|  PREDICTED: uncharacterized protein LOC105163450  77.8    1e-11    
ref|XP_009388297.1|  PREDICTED: uncharacterized protein LOC103975115  77.0    1e-11    
ref|XP_010454631.1|  PREDICTED: uncharacterized protein LOC104736362  73.6    2e-11    
gb|EMS58738.1|  hypothetical protein TRIUR3_23723                     77.0    2e-11    
gb|KDP26485.1|  hypothetical protein JCGZ_17643                       76.6    2e-11    
ref|XP_002526564.1|  conserved hypothetical protein                   76.6    2e-11    Ricinus communis
emb|CBI37166.3|  unnamed protein product                              76.3    3e-11    
ref|XP_006653594.1|  PREDICTED: histone H3.v1-like                    76.3    3e-11    
ref|XP_008235614.1|  PREDICTED: suppressor protein SRP40              76.3    3e-11    
emb|CDP03781.1|  unnamed protein product                              76.3    3e-11    
ref|XP_007144862.1|  hypothetical protein PHAVU_007G190400g           75.9    3e-11    
ref|XP_007199872.1|  hypothetical protein PRUPE_ppa006055mg           75.9    4e-11    
ref|XP_002963453.1|  hypothetical protein SELMODRAFT_438603           73.9    4e-11    
ref|XP_010264923.1|  PREDICTED: rRNA biogenesis protein rrp36         75.5    5e-11    
ref|XP_002988166.1|  hypothetical protein SELMODRAFT_426892           73.2    6e-11    
gb|AFK34817.1|  unknown                                               72.4    7e-11    
ref|XP_010093087.1|  hypothetical protein L484_005945                 74.7    8e-11    
ref|XP_006594039.1|  PREDICTED: uncharacterized protein LOC100793...  74.3    8e-11    
ref|XP_004981564.1|  PREDICTED: uncharacterized protein LOC101785...  74.3    9e-11    
ref|XP_003542435.1|  PREDICTED: uncharacterized protein LOC100793...  74.3    1e-10    
ref|XP_006594036.1|  PREDICTED: uncharacterized protein LOC100793...  74.3    1e-10    
ref|XP_006594038.1|  PREDICTED: uncharacterized protein LOC100793...  74.3    1e-10    
gb|EAZ31321.1|  hypothetical protein OsJ_15438                        74.3    1e-10    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006594037.1|  PREDICTED: uncharacterized protein LOC100793...  73.9    1e-10    
gb|EAY94824.1|  hypothetical protein OsI_16614                        74.3    1e-10    Oryza sativa Indica Group [Indian rice]
ref|XP_010920313.1|  PREDICTED: eisosome protein SEG2-like            73.6    2e-10    
gb|KHN48935.1|  hypothetical protein glysoja_025312                   73.6    2e-10    
ref|XP_003581420.1|  PREDICTED: uncharacterized protein LOC100842...  73.9    2e-10    
ref|XP_010695523.1|  PREDICTED: uncharacterized protein LOC104908140  73.6    2e-10    
ref|XP_010652403.1|  PREDICTED: uncharacterized protein LOC100256663  72.8    3e-10    
ref|XP_006588692.1|  PREDICTED: uncharacterized protein LOC100805...  72.4    4e-10    
ref|XP_006588691.1|  PREDICTED: uncharacterized protein LOC100805...  72.4    4e-10    
ref|XP_001770125.1|  predicted protein                                73.2    4e-10    
ref|XP_009411395.1|  PREDICTED: helicase swr-1                        72.4    5e-10    
ref|XP_009627215.1|  PREDICTED: uncharacterized protein LOC104117810  72.4    6e-10    
ref|XP_006857471.1|  hypothetical protein AMTR_s00067p00189180        72.0    7e-10    
ref|XP_004976193.1|  PREDICTED: altered inheritance of mitochondr...  72.0    8e-10    
gb|EMT07277.1|  hypothetical protein F775_03470                       71.6    9e-10    
ref|XP_008459951.1|  PREDICTED: uncharacterized protein LOC103498...  70.9    1e-09    
ref|XP_008459952.1|  PREDICTED: uncharacterized protein LOC103498...  70.5    1e-09    
ref|XP_010048173.1|  PREDICTED: uncharacterized protein LOC104437...  71.2    1e-09    
ref|XP_010048165.1|  PREDICTED: uncharacterized protein LOC104437...  71.2    1e-09    
ref|XP_006479470.1|  PREDICTED: dentin sialophosphoprotein-like i...  70.9    1e-09    
ref|XP_006443769.1|  hypothetical protein CICLE_v10020148mg           70.9    2e-09    
ref|XP_002989115.1|  hypothetical protein SELMODRAFT_427719           70.5    2e-09    
gb|EYU46411.1|  hypothetical protein MIMGU_mgv1a006566mg              70.1    2e-09    
gb|EYU46410.1|  hypothetical protein MIMGU_mgv1a006566mg              70.1    3e-09    
ref|XP_009336097.1|  PREDICTED: uncharacterized protein LOC103928740  68.9    5e-09    
ref|XP_011024450.1|  PREDICTED: uncharacterized protein LOC105125623  67.0    6e-09    
gb|KHN05877.1|  hypothetical protein glysoja_026465                   69.3    9e-09    
ref|XP_010522560.1|  PREDICTED: eisosome protein SEG2                 65.9    6e-08    
ref|XP_008802393.1|  PREDICTED: uncharacterized protein LOC103716248  62.4    1e-07    
ref|XP_006386917.1|  hypothetical protein POPTR_0002s26020g           64.7    1e-07    
ref|XP_008372373.1|  PREDICTED: lisH domain-containing protein C1...  63.9    2e-07    
ref|XP_008356212.1|  PREDICTED: lisH domain-containing protein C1...  63.5    3e-07    
ref|XP_008364322.1|  PREDICTED: lisH domain-containing protein C1...  63.5    3e-07    
ref|XP_007050196.1|  Uncharacterized protein isoform 1                63.2    4e-07    
ref|XP_006304427.1|  hypothetical protein CARUB_v10011017mg           62.8    5e-07    
ref|XP_010457430.1|  PREDICTED: uncharacterized protein LOC104738916  62.8    5e-07    
ref|XP_010482990.1|  PREDICTED: uncharacterized protein LOC104761579  62.4    6e-07    
gb|KFK42748.1|  hypothetical protein AALP_AA1G034400                  62.4    7e-07    
ref|XP_002303119.1|  hypothetical protein POPTR_0002s26020g           63.2    8e-07    Populus trichocarpa [western balsam poplar]
ref|XP_006418174.1|  hypothetical protein EUTSA_v10007735mg           62.0    8e-07    
emb|CDY32524.1|  BnaA09g50720D                                        62.8    1e-06    
ref|XP_009118674.1|  PREDICTED: uncharacterized protein LOC103843673  61.2    1e-06    
ref|XP_002889489.1|  hypothetical protein ARALYDRAFT_333726           61.2    1e-06    
emb|CDY10083.1|  BnaC08g43680D                                        60.8    2e-06    
ref|NP_171899.2|  uncharacterized protein                             60.1    3e-06    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140573.1|  PREDICTED: uncharacterized protein LOC101205962  59.7    4e-06    
gb|AAD10667.1|  Unknown protein                                       59.7    4e-06    Arabidopsis thaliana [mouse-ear cress]
gb|KGN46381.1|  hypothetical protein Csa_6G088090                     59.3    5e-06    
gb|EMS61078.1|  hypothetical protein TRIUR3_30334                     58.5    1e-05    
gb|EPS60982.1|  hypothetical protein M569_13820                       57.8    2e-05    
ref|XP_010475043.1|  PREDICTED: uncharacterized protein LOC104754529  57.4    2e-05    
ref|XP_010542902.1|  PREDICTED: eisosome protein SEG2-like            55.8    8e-05    
tpg|DAA36943.1|  TPA: hypothetical protein ZEAMMB73_678513            53.5    5e-04    



>ref|XP_009771902.1| PREDICTED: uncharacterized protein LOC104222370 [Nicotiana sylvestris]
Length=531

 Score =   405 bits (1041),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 256/491 (52%), Positives = 327/491 (67%), Gaps = 54/491 (11%)
 Frame = -3

Query  1651  APPSDHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCG  1472
             AP SD  S    VS+S +    EPV S NRSPLSSLF+SEE  E+ + L   E++KQ+ G
Sbjct  49    APCSDPKSH--LVSQSTS--TKEPVVSRNRSPLSSLFISEEKGED-NDLHQTEMDKQETG  103

Query  1471  TPELEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDS  1292
             TP+ E D KEL+DQAKFLKACGT+PETP E+RK   K +DLS   G+V+PLKF SWL D 
Sbjct  104   TPKSELDAKELRDQAKFLKACGTLPETPAELRKGLVKRKDLSTSTGDVEPLKFKSWLSDM  163

Query  1291  SIEKQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCM---------------------  1175
             ++++ NL   P+    P+K      K   S   +PSSCM                     
Sbjct  164   AVQELNLNLPPEDPITPSK-SNGLEKHYGSLARSPSSCMMDGHSSQNLSKSSIHGSGSSN  222

Query  1174  ---TFEEKSNsptvisaspttvppstTCR--QRSVRFDCkstksdmssalsksSFEVDSP  1010
                + E  +N     +AS  T   + + +   +SVRFDC+S  S +S   S S+  +DS 
Sbjct  223   TPASIEVNANQTHKYTASEITPTFAPSAQYMNKSVRFDCESDLSAVSCKSSSST--LDSQ  280

Query  1009  NSKA---------SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPI  857
             NSK          SPYPTPLKLSDEMQTPGTVFP ++DN+ANG+  RIRSQ+VY +LNP+
Sbjct  281   NSKQPGNSYALKNSPYPTPLKLSDEMQTPGTVFPAYLDNIANGKTARIRSQFVYPVLNPV  340

Query  856   ENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSE---IGLRESSTENNLN  686
               ASQ+KE+ +EDS S  DSNS LL S+M ES D  +EA+ +SE    GL+E++ + +  
Sbjct  341   YGASQLKELSDEDSYSILDSNSILLSSNMTESGDCPNEASFSSEQGMSGLKEATADKDFK  400

Query  685   VEASLSSWLKPSL------RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSP  524
             VEASLSSWLKPS       +Q +   +G ++H+G+T GDRPILG+VAAHW ++E S +SP
Sbjct  401   VEASLSSWLKPSSINQDEGKQHNGSVYGDNVHYGRTPGDRPILGLVAAHWKDDENSHISP  460

Query  523   K-WWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSG-SPISFNET  350
             K WWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E+ +SQRK+ SG +PI+FNET
Sbjct  461   KKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSQETSISQRKQFSGTTPITFNET  520

Query  349   EESDTALSQLH  317
             EESDTA SQ+H
Sbjct  521   EESDTAHSQVH  531



>ref|XP_009603107.1| PREDICTED: uncharacterized protein LOC104098145 [Nicotiana tomentosiformis]
Length=531

 Score =   395 bits (1016),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 254/491 (52%), Positives = 323/491 (66%), Gaps = 54/491 (11%)
 Frame = -3

Query  1651  APPSDHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCG  1472
             AP SD  S    VS+S++    EPV S NRSPLSSLF+ EE  E+   L   E++KQD G
Sbjct  49    APCSDPKSH--LVSQSIS--TKEPVVSRNRSPLSSLFIFEEKGED-DDLHQTEMDKQDTG  103

Query  1471  TPELEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDS  1292
             TP+ E D KEL+DQAKFLKACGT+PETP EIRK   K +DLS   G+V+PLKF SWL D 
Sbjct  104   TPKSELDAKELRDQAKFLKACGTLPETPAEIRKGLVKRKDLSTPTGDVEPLKFKSWLSDM  163

Query  1291  SIEKQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvpp  1112
             ++++ NL   P+    P+K      K S S   +PSSCM     S S +  S   +    
Sbjct  164   AVQELNLNLPPEDPITPSK-SNGLEKHSGSLARSPSSCMMDGHNSQSLSKSSIHGSGSSN  222

Query  1111  s--------------------------tTCRQRSVRFDCkstksdmssalsksSFEVDSP  1010
             +                               +SVRFDC+S  S +S   S S+  +DS 
Sbjct  223   TPASIKINANQTHKDIASEVTPTFAPSAQYMNKSVRFDCESDLSAVSCKSSSST--LDSQ  280

Query  1009  NSKA---------SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPI  857
             N+K          SPYPTPLKLSDEMQTPGTVFP ++DN+ANG+  RIRSQ+VY +LNP+
Sbjct  281   NAKQPGNSYALKNSPYPTPLKLSDEMQTPGTVFPAYLDNIANGKTARIRSQFVYPVLNPV  340

Query  856   ENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSE---IGLRESSTENNLN  686
              +ASQ+KE+ +EDS S  DS+S LL S+M ES +  +EA+ +SE    GL+E+S + +  
Sbjct  341   YSASQLKELSDEDSYSILDSSSILLSSNMTESGEWPNEASFSSEQGMSGLKEASADKDSK  400

Query  685   VEASLSSWLKPSL------RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSP  524
             VEASLSSWLKPS       +Q +   +G ++H+G+T GDRPILG+VAAHW ++E S +SP
Sbjct  401   VEASLSSWLKPSSINQDEGKQHNGSVYGDNVHYGRTPGDRPILGLVAAHWKDDENSHISP  460

Query  523   K-WWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSG-SPISFNET  350
             K WWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E+ +SQRK+ SG +PI+FNET
Sbjct  461   KKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSQETSISQRKQFSGTTPITFNET  520

Query  349   EESDTALSQLH  317
             EES+TA SQLH
Sbjct  521   EESNTAHSQLH  531



>ref|XP_004243611.1| PREDICTED: uncharacterized protein LOC101246265 [Solanum lycopersicum]
Length=529

 Score =   395 bits (1015),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 258/496 (52%), Positives = 321/496 (65%), Gaps = 61/496 (12%)
 Frame = -3

Query  1654  SAPPSDHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDC  1475
             S PP    S+   VS+SL P   EPV S +RSPLSSLF SEE  E+   L   +   QD 
Sbjct  44    SLPPD---SKSQLVSQSLAP--KEPVLSRSRSPLSSLFNSEEIGED-DYLHETDKANQDA  97

Query  1474  GTPELEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLD  1295
             GTP+ E   KEL+DQAKFLKACGT+PETP EIRK   KC+DLSA  G+V+PLKF SWL D
Sbjct  98    GTPKSELHTKELRDQAKFLKACGTLPETPAEIRKGLAKCKDLSASKGDVEPLKFKSWLSD  157

Query  1294  SSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMT-------------------  1172
              ++EK NL   PD    P+K  E   K+S S  HT +SCMT                   
Sbjct  158   VAVEKFNLDLLPDHPITPSKSNE-LEKKSGSSTHTSNSCMTEGQDGQGSPKNSIHGSGSA  216

Query  1171  -------FEEKSNsptvisaspttvppstTCRQRSVRFDCkstksdmssalsksSFEVDS  1013
                    F        V S       PS     ++VRFDC+S  S +SS  +   F +D 
Sbjct  217   NTPRSIEFNANQAHRDVASEVSPIFAPSAQYMNKTVRFDCESDLSAVSSKSTS--FALDC  274

Query  1012  PNSKA------------SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSI  869
              NSK             SPYPTPLKLSDEMQTPGTVFPT++DN+ NG+  RIRSQYVY +
Sbjct  275   ENSKQTEFSGSYSALKHSPYPTPLKLSDEMQTPGTVFPTYIDNIPNGKAARIRSQYVYPV  334

Query  868   LNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG---LRESSTE  698
             LNP++ ASQ+K++ +EDS S ++SNS+L  S M E  +  +EA+ +SE+G   LR++S +
Sbjct  335   LNPVDRASQLKDLSDEDSFSIENSNSRLWSSTMTEPGERPNEASFSSEVGTPGLRKASAD  394

Query  697   NNLNVEASLSSWLKPS--------LRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENE  542
             N+  VEASLSSWLKPS        L  SS    G ++H+G+T GDRPILG+VAAHW ++E
Sbjct  395   NDSKVEASLSSWLKPSSINQDEGKLHTSSGN--GNNVHYGRTPGDRPILGLVAAHWKDDE  452

Query  541   TSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGS-PI  365
              SR+SPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEES + QRK+ SG+ P 
Sbjct  453   DSRISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEESSIPQRKQYSGTRPF  512

Query  364   SFNETEESDTALSQLH  317
             +FN+ +E+DTA+SQ+H
Sbjct  513   AFNDMDETDTAISQVH  528



>ref|XP_002283205.1| PREDICTED: uncharacterized protein LOC100247266 [Vitis vinifera]
 emb|CBI22079.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   384 bits (985),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 235/478 (49%), Positives = 307/478 (64%), Gaps = 52/478 (11%)
 Frame = -3

Query  1639  DHASRP--PFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTP  1466
             DH  RP   FVS+S    + E + S NR  LS+LF++EE ++   SL SK+ +    G+ 
Sbjct  32    DHQHRPNASFVSQS---KSTETMISQNR--LSALFLAEEKED---SL-SKDRKSHVFGSS  82

Query  1465  ELEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSI  1286
             E E   KELKD+A+FLKACGT+ ETP EIRK S + +   + DG+++  KFHSWL ++SI
Sbjct  83    EPENIDKELKDEARFLKACGTLVETPAEIRKASRRLKSSPSQDGDLEHSKFHSWLPNTSI  142

Query  1285  EKQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisasptt-----  1121
             +K  L  QP + P P K CE+W KES     TPSSC++  + S   + +  S        
Sbjct  143   KKLQLDKQPVEPPTPIKQCEEWRKESSLLEQTPSSCISNGQSSTEGSTVGNSDVVINVHP  202

Query  1120  --------------vppstTCRQRSVRFDCkstksdmssalsksSF------EVDSPN--  1007
                             P+   R RSVRF+C++  +  SS  + S          +SP+  
Sbjct  203   NPVDDSVPSVSPWLSAPNVQRRNRSVRFECEADAALFSSGSASSEIASQTSKRYESPSNH  262

Query  1006  --SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKE  833
               SK SPYPTPLKL+DE+QTPGTVFP  + NL NG+  RIRSQYVYS+LNP+EN SQ   
Sbjct  263   SVSKLSPYPTPLKLNDELQTPGTVFPASLGNLENGKNARIRSQYVYSVLNPVENFSQWSA  322

Query  832   VInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP  653
             +        + S+S    S+MGES++   +A   + +G RE+S   +L VEASLSSWLKP
Sbjct  323   L------KEEGSHSNQFSSNMGESLESLDDATPKAHVGARETSVAEDLRVEASLSSWLKP  376

Query  652   S--LRQSSTQPF----GGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNS  491
             S  ++ ++ Q F      + H G+T GDRPI+G VAAHWNE+E +R+SPKWWDGNGIPNS
Sbjct  377   SSSIQDANDQNFEAVPAANRHFGRTPGDRPIIGTVAAHWNEDEPTRISPKWWDGNGIPNS  436

Query  490   THKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLH  317
             T+KYKEDQKVSWHATPFEERLEKALSEES++SQRK+++G PI+F E EESDTALSQL 
Sbjct  437   TNKYKEDQKVSWHATPFEERLEKALSEESMISQRKQINGEPINFEENEESDTALSQLQ  494



>ref|XP_007217676.1| hypothetical protein PRUPE_ppa024302mg, partial [Prunus persica]
 gb|EMJ18875.1| hypothetical protein PRUPE_ppa024302mg, partial [Prunus persica]
Length=411

 Score =   362 bits (929),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 279/439 (64%), Gaps = 47/439 (11%)
 Frame = -3

Query  1585  EPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACG  1406
             E V S NR  LSSLF +EE    +    SK+ E    G+P+++   KEL+++AKFLKACG
Sbjct  1     EVVISQNR--LSSLFSAEE----REGSPSKDRESPCYGSPQID---KELRNEAKFLKACG  51

Query  1405  TIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCE  1226
             T+ ETP+EIRK S K      HD   +P KF+SWL ++SI++     QPDQ   P K  E
Sbjct  52    TLVETPVEIRKASSKLNGSPHHDRGSEPPKFNSWLPNTSIKQLQQEDQPDQPLTPIKLGE  111

Query  1225  DWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTCRQRSVRFDCkstksdmss  1046
             +W K S    HTPSS  T +                     CR ++VRF+C    +    
Sbjct  112   EWGKGSRRSEHTPSSISTPD-------------------VQCRSKAVRFECDINTNSSRG  152

Query  1045  alsksSFE----VDSPN----SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIR  890
             + S++        ++P     SK S YPTPL LSDEMQTPGTVFP ++ N  NG+  RIR
Sbjct  153   SSSENYSRSAKVSETPGKQSISKPSVYPTPLTLSDEMQTPGTVFPANLGNFPNGK-ARIR  211

Query  889   SQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRE  710
             SQYVY++ NP+E  SQ K +        +D+NS+ L  ++ ES++ S  A   SE+G +E
Sbjct  212   SQYVYAVQNPVEGISQWKLM------KDEDTNSQGLSGELRESLNQSGNATPISEVGAKE  265

Query  709   SSTENNLNVEASLSSWLKPSLRQSSTQPF----GGSIHHGKTLGDRPILGMVAAHWNENE  542
             +S+    NVE+SLSSWLKP  R  + Q F    G + H G+T GDRPI+G+VA HWNE+E
Sbjct  266   TSSGQEFNVESSLSSWLKPVNRDDNNQNFGYVPGRTRHFGRTPGDRPIIGLVATHWNEDE  325

Query  541   TSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPIS  362
              +R+SPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEES +SQRK + G PI 
Sbjct  326   PTRISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEESFISQRKHIEGKPIV  385

Query  361   FNETEESDTALSQLHNGNQ  305
             F+ETEESDTALSQL + +Q
Sbjct  386   FDETEESDTALSQLQSSSQ  404



>ref|XP_008229580.1| PREDICTED: uncharacterized protein LOC103328936 [Prunus mume]
Length=501

 Score =   362 bits (928),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 224/466 (48%), Positives = 292/466 (63%), Gaps = 41/466 (9%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             SRP  VS+S      E V S NR  LSSLF +EE    +    SK+ E    G+P+++  
Sbjct  46    SRPHIVSQSSRNNQTEVVISQNR--LSSLFSAEE----REGSPSKDRESPCYGSPQID--  97

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
              KEL+++AKFLKACGT+ ETP+EIRK S K      HD   +P KF+SWL ++SI++   
Sbjct  98    -KELRNEAKFLKACGTLVETPVEIRKASSKLNGSPHHDRGSEPPKFNSWLPNTSIKQLQQ  156

Query  1270  VSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNspt------------visasp  1127
               QPDQ   P K  E+W K S    HTPSS M+ ++ +   +                + 
Sbjct  157   GDQPDQPLTPIKLGEEWGKGSRRSEHTPSS-MSNQQNTGGISISSTEGSGIVIDSTVKTE  215

Query  1126  ttvppstTCRQRSVRFDCkstksdmssalsksSFE----VDSPN----SKASPYPTPLKL  971
             +   P   CR ++VRF+C    +    + S++        ++P     SK S YPTPL L
Sbjct  216   SISTPDVQCRSKAVRFECDIDTNSSRGSSSENYTRSAKVSETPGKQSISKPSVYPTPLTL  275

Query  970   SDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnS  791
             SDEMQTPGTVFP ++ N  NG+  RIRSQYVY++ NP E  SQ K +        +DSNS
Sbjct  276   SDEMQTPGTVFPANLGNFPNGK-ARIRSQYVYAVQNPAEGISQWKLM------KDEDSNS  328

Query  790   KLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPF----  623
             + L  ++ ES++ S  A   SE+G +E+S+    NVE+SLSSWLKP  R  + Q F    
Sbjct  329   QGLSGELRESLNQSGNATPISEVGAKETSSGQEFNVESSLSSWLKPVNRDDNNQNFGYVP  388

Query  622   GGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATP  443
             G + H G+T GDRPI+G+VA HWNE+E +R+SPKWWDGNGIPNST+KYKEDQKVSWHATP
Sbjct  389   GRTRHFGRTPGDRPIIGLVATHWNEDEPTRISPKWWDGNGIPNSTNKYKEDQKVSWHATP  448

Query  442   FEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             FEERLEKALSEES +SQRK + G PI F+E+EESDTALSQL + +Q
Sbjct  449   FEERLEKALSEESFISQRKHIEGKPIVFDESEESDTALSQLQSSSQ  494



>emb|CDP08376.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   361 bits (926),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 232/484 (48%), Positives = 288/484 (60%), Gaps = 63/484 (13%)
 Frame = -3

Query  1612  SKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTP--ELEFDVKEL  1439
             S + TP       + NRSPLSSL ++EE   +K     K  E+Q+ GTP  E+  ++KEL
Sbjct  27    SSATTPAVKVGSVTRNRSPLSSLLLAEE---DKDGTPCKLKEEQELGTPKPEIGLNLKEL  83

Query  1438  KDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQP  1259
             KD+AKFLKACGT+PETP+EIR+ SEK +DLSA  G+ +  KF SWL ++S EK NL    
Sbjct  84    KDEAKFLKACGTLPETPVEIRQASEKWKDLSAQKGDHEHSKFRSWLTNTSAEKLNLEMNS  143

Query  1258  DQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTC-------  1100
             DQ   PTK CE WVK SDS  HTPSSC+T    +   +  S        + +        
Sbjct  144   DQPLTPTKHCERWVKLSDSLDHTPSSCLTEGLNAGRVSNSSVEGNETKNAGSVELIASPS  203

Query  1099  ------------------RQRSVRFDCkstksdmssalsksSFEVDSPN----------S  1004
                               + +SVRFDC S  S +++    S     S            +
Sbjct  204   HSLTGSSVPKDITPIIIGKNKSVRFDCDSDTSSVTTKSCPSETSSQSLKQSGSSSNLSIA  263

Query  1003  KASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIn  824
             K SPYPTPLKLSDEMQTPGTVFP ++D +  G+  RIRSQYVYS+LNP EN SQ K++ N
Sbjct  264   KFSPYPTPLKLSDEMQTPGTVFPAYLDVMGQGKNTRIRSQYVYSVLNPAENMSQWKDLKN  323

Query  823   edsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLR  644
             ED    Q S+S+       +S     +  + SE+G   +S    L VEASLSSWL    R
Sbjct  324   EDVNDYQSSHSR-------QSCREIDQETSASEVGTGRTSVGQELKVEASLSSWL----R  372

Query  643   QSSTQPFGGSIHHG----------KTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPN  494
              +   P G  +++G          +T GDRPILGMVAAHWN++E  +VSPKWWDGNGIPN
Sbjct  373   ATFPNPDGPVVNNGSSTSEKSQRGRTPGDRPILGMVAAHWNDDE-HQVSPKWWDGNGIPN  431

Query  493   STHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGS-PISFNETEESDTALSQLH  317
             ST+KYKEDQKVSWHATPFEERLEKALSEE+   QR + SG+ P   NETEE DTALSQL 
Sbjct  432   STNKYKEDQKVSWHATPFEERLEKALSEETFNLQRNQTSGTPPPDLNETEEDDTALSQLQ  491

Query  316   NGNQ  305
               N 
Sbjct  492   PSNH  495



>ref|XP_011026219.1| PREDICTED: uncharacterized protein LOC105126897 isoform X1 [Populus 
euphratica]
Length=511

 Score =   352 bits (902),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 225/464 (48%), Positives = 283/464 (61%), Gaps = 50/464 (11%)
 Frame = -3

Query  1597  PTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFL  1418
             PT  E     NR  LSSLF+SEE +E        ++E    G+P++    K L+D+AKFL
Sbjct  60    PTLQEAGVIKNR--LSSLFISEEKEESPRG----DIENPCLGSPQVN---KGLRDEAKFL  110

Query  1417  KACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPT  1238
             KACGT+PETP EIRK  +K +     D   D  KFHSWL ++S+EK  L +Q + S  P 
Sbjct  111   KACGTLPETPTEIRKACDKFKGSPGLDKYSDSSKFHSWLPNTSMEKLQLDNQDEDSRTPV  170

Query  1237  KDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisasptt-----------------vpps  1109
             K  E+  K S S   TPSSCMT  +        S    T                    +
Sbjct  171   KLWEELGKGSFSSEQTPSSCMTNVQSREDSESGSHKRMTKVQSDEIDNVATGAPWLSATN  230

Query  1108  tTCRQRSVRFDC---kstksdmssalsksSFEVDSPN----SKASPYPTPLKLSDEMQTP  950
                R RSVRF+C    S+         +   + +SP     SK SP PTPLK+SD+MQTP
Sbjct  231   VQSRNRSVRFECDFDTSSSKGSPENGCQVPRKYESPGNLSVSKPSPKPTPLKISDDMQTP  290

Query  949   GTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDM  770
             GTVFP +++ LANG+  RIRSQYVYS+LNP+ENASQ K +  +DS S + S       ++
Sbjct  291   GTVFPANLETLANGK-TRIRSQYVYSVLNPVENASQWKLLREDDSNSHEQS------GEL  343

Query  769   GESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSST--------QPFGGS  614
              ES++ S  A    E G++E+S+  +L VEASLSSW+KP   QS+T           G +
Sbjct  344   RESLEQSESATPKPEWGVKETSSGKDLMVEASLSSWVKPP--QSTTGEDKPNIGTAAGKN  401

Query  613   IHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEE  434
                G+T GDRPI+GMVAAHWNENE SR+SPKWWDGNGIPNST+KYKEDQKVSWHATPFEE
Sbjct  402   FSSGRTPGDRPIIGMVAAHWNENEASRISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEE  461

Query  433   RLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             RLEKALSEES + QRK +SG P+ F+E EESDTALS+L    Q+
Sbjct  462   RLEKALSEESFIPQRKPISGRPVVFDECEESDTALSRLQASTQA  505



>ref|XP_011026221.1| PREDICTED: uncharacterized protein LOC105126897 isoform X2 [Populus 
euphratica]
Length=510

 Score =   349 bits (896),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 220/450 (49%), Positives = 278/450 (62%), Gaps = 48/450 (11%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LSSLF+SEE +E        ++E    G+P++    K L+D+AKFLKACGT+PETP EIR
Sbjct  71    LSSLFISEEKEESPRG----DIENPCLGSPQVN---KGLRDEAKFLKACGTLPETPTEIR  123

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K  +K +     D   D  KFHSWL ++S+EK  L +Q + S  P K  E+  K S S  
Sbjct  124   KACDKFKGSPGLDKYSDSSKFHSWLPNTSMEKLQLDNQDEDSRTPVKLWEELGKGSFSSE  183

Query  1195  HTPSSCMTFEEKSNsptvisasptt-----------------vppstTCRQRSVRFDC--  1073
              TPSSCMT  +        S    T                    +   R RSVRF+C  
Sbjct  184   QTPSSCMTNVQSREDSESGSHKRMTKVQSDEIDNVATGAPWLSATNVQSRNRSVRFECDF  243

Query  1072  -kstksdmssalsksSFEVDSPN----SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANG  908
               S+         +   + +SP     SK SP PTPLK+SD+MQTPGTVFP +++ LANG
Sbjct  244   DTSSSKGSPENGCQVPRKYESPGNLSVSKPSPKPTPLKISDDMQTPGTVFPANLETLANG  303

Query  907   RFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATS  728
             +  RIRSQYVYS+LNP+ENASQ K +  +DS S + S       ++ ES++ S  A    
Sbjct  304   K-TRIRSQYVYSVLNPVENASQWKLLREDDSNSHEQS------GELRESLEQSESATPKP  356

Query  727   EIGLRESSTENNLNVEASLSSWLKPSLRQSST--------QPFGGSIHHGKTLGDRPILG  572
             E G++E+S+  +L VEASLSSW+KP   QS+T           G +   G+T GDRPI+G
Sbjct  357   EWGVKETSSGKDLMVEASLSSWVKPP--QSTTGEDKPNIGTAAGKNFSSGRTPGDRPIIG  414

Query  571   MVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQ  392
             MVAAHWNENE SR+SPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEES + Q
Sbjct  415   MVAAHWNENEASRISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEESFIPQ  474

Query  391   RKRMSGSPISFNETEESDTALSQLHNGNQS  302
             RK +SG P+ F+E EESDTALS+L    Q+
Sbjct  475   RKPISGRPVVFDECEESDTALSRLQASTQA  504



>ref|XP_010093175.1| hypothetical protein L484_013298 [Morus notabilis]
 gb|EXB53663.1| hypothetical protein L484_013298 [Morus notabilis]
Length=505

 Score =   349 bits (895),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 232/471 (49%), Positives = 290/471 (62%), Gaps = 56/471 (12%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             S+P  V +S  P     V S NR  LSSLF+SE+ +E  S    K++     G+PE++  
Sbjct  47    SQPHLVVESSQPKLTGVVISQNR--LSSLFLSEDKEESPS----KDMGNASVGSPEID--  98

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
              K+LK +AKFLKACGT+ ETP+EIRK+S K R    H G+    +FHSWL D+S EK  L
Sbjct  99    -KQLKKEAKFLKACGTLVETPIEIRKVSAKLRSSPLHGGDSGSSRFHSWLPDTSAEKLQL  157

Query  1270  VSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFE------------EKSNsptvisasp  1127
              +Q DQ P P K CE+ V  S S  +TPSS  T              E S + +  +A+ 
Sbjct  158   DNQIDQPPTPIKPCEERVMLSASLENTPSSGRTSNIQNMRRVSISSTEGSGTGSTSTAAK  217

Query  1126  ttv-------ppstTCRQRSVRFDCkstksdmssalsksSFE----VDSPNS----KASP  992
                         +  C+ +SVRF+C S  S    + S++  +     +SP +    K SP
Sbjct  218   VHASDSPQLLATNAQCKGKSVRFECDSDLSSSRGSSSENYSQNLKKAESPGNQSVLKPSP  277

Query  991   YPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedse  812
             YPTP KLSDE+QTPGTVFP H+DN +NG+  RIRSQYVY +LNP+E+ SQ   +      
Sbjct  278   YPTPHKLSDEIQTPGTVFPAHLDNFSNGKT-RIRSQYVYPVLNPVESVSQWNVL------  330

Query  811   ssqdsnSKLLFSDMGESVDLSS-EANATSEIGLRESSTENNLNVEASLSSWLKP--SLRQ  641
               +DSNS+ L S++ ES+D    E   + E+ L        + VEASLSSWLKP    + 
Sbjct  331   KEEDSNSQQLSSELRESLDQPKIEKERSKEVPLE-------VKVEASLSSWLKPVPHTQD  383

Query  640   SSTQPFGGSIHH---GKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKED  470
              + Q F G        KT  DRPI+GMVAAHWNE E SR+SPKWWDGNGIPNST+KYKED
Sbjct  384   GNNQKFVGVSDRPRVAKTPMDRPIIGMVAAHWNEEEPSRISPKWWDGNGIPNSTNKYKED  443

Query  469   QKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLH  317
             QKVSWHATPFEERLEKALSEES VSQRK +SG PI F+E EESDTALSQLH
Sbjct  444   QKVSWHATPFEERLEKALSEESFVSQRKPISGPPIMFDENEESDTALSQLH  494



>ref|XP_006386280.1| hypothetical protein POPTR_0002s05800g [Populus trichocarpa]
 gb|ERP64077.1| hypothetical protein POPTR_0002s05800g [Populus trichocarpa]
Length=495

 Score =   347 bits (891),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 220/450 (49%), Positives = 277/450 (62%), Gaps = 49/450 (11%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LSSLF+SEE +E        ++E    G+P++    K L+D+AKFLKACGT+PETP EIR
Sbjct  57    LSSLFLSEEKEESPRG----DIENPCLGSPQIN---KGLRDEAKFLKACGTLPETPTEIR  109

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K  +K +     D   +  KFHSWL ++S+EK  L +Q + S  P K  E+  K S S  
Sbjct  110   KACDKFKGSPGLDKYSESSKFHSWLPNTSMEKLQLDNQNEDSRTPVKLWEELGKGSFSSE  169

Query  1195  HTPSSCMTFEEKSNsptvisasptt-----------------vppstTCRQRSVRFDC--  1073
              TPSSCMT  +        S                             R RSVRF+C  
Sbjct  170   QTPSSCMTNVQSREDSESGSHKRMIKVQPDEIDNVATGAPWLSATKVQSRNRSVRFECDF  229

Query  1072  -kstksdmssalsksSFEVDSPN----SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANG  908
               S+    S    +   + +SP     SK SP PTPLK+SD+MQTPGTVFP +++ LANG
Sbjct  230   DTSSSKGSSENGCQVPRKYESPGNLSVSKPSPRPTPLKISDDMQTPGTVFPANLETLANG  289

Query  907   RFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATS  728
             +  RIRSQYVYS+LNP+ENASQ K ++ ED  +S + + +L       S++ S  A    
Sbjct  290   K-TRIRSQYVYSVLNPVENASQWK-LLREDDSNSHEQSGELF------SLEQSESATPKP  341

Query  727   EIGLRESSTENNLNVEASLSSWLKPSLRQSST--------QPFGGSIHHGKTLGDRPILG  572
             E G++E+S+  +L VEASLSSW+KP   QS+T           G +   G+T GDRPI+G
Sbjct  342   EWGVKETSSGKDLKVEASLSSWVKPP--QSTTGEDNPNIGTAAGKNFSSGRTPGDRPIIG  399

Query  571   MVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQ  392
             MVAAHWNENE SR+SPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEES +SQ
Sbjct  400   MVAAHWNENEASRISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEESFISQ  459

Query  391   RKRMSGSPISFNETEESDTALSQLHNGNQS  302
             RK +SG PI F+E EESDTALS L    Q+
Sbjct  460   RKPISGRPIVFDECEESDTALSLLQASTQA  489



>ref|XP_006352001.1| PREDICTED: uncharacterized protein LOC102602174 [Solanum tuberosum]
Length=485

 Score =   345 bits (886),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 228/462 (49%), Positives = 288/462 (62%), Gaps = 49/462 (11%)
 Frame = -3

Query  1591  AAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKA  1412
             A EP+ S NRSPLSSLF  E  +EE ++L  KEVE     TP  + D  +L++QAKFLKA
Sbjct  34    AKEPMVSRNRSPLSSLFTEE--NEETNTLGCKEVENLSLDTPMPQLDTNDLRNQAKFLKA  91

Query  1411  CGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKD  1232
             CGT+PETP EIR  S KC+DLSA   EV+PLK +SW  D++ +K NL S  DQ P P K 
Sbjct  92    CGTLPETPAEIRNFSMKCKDLSAPMEEVEPLKVNSWPSDTTYQKLNLNSLSDQ-PTPVKI  150

Query  1231  CEDWVK-ESDSPVHTPSSCMT------------------------FEEKSNsptvisasp  1127
               D VK  S S VHTPSSC+T                         E K+N     + + 
Sbjct  151   --DGVKTHSGSFVHTPSSCLTDGQSDQSLSKSFINGNENSSTPIFIEVKANLARNDNKAS  208

Query  1126  tt---vppstTCRQRSVRFDCkstksdmssalsksSFEVDSP------NSKASPY---PT  983
                    P+   R RSV F+ +S  S MSS    S     S       N  AS Y   PT
Sbjct  209   AASPITAPTAQYRYRSVHFESESDLSSMSSKCISSETSQSSEQSESSGNYNASKYSPYPT  268

Query  982   PLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessq  803
             PLKLSDEMQTPGTVFP ++D +   +  RIRSQYVY +LNP+++ SQ+KE+ +EDS S+Q
Sbjct  269   PLKLSDEMQTPGTVFPAYLDRMGIAKTARIRSQYVYPVLNPVDDVSQLKELSDEDSFSTQ  328

Query  802   dsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPF  623
             DSNS+L  S   +S     EA   SE+G+      +     A+      PS+ Q  ++  
Sbjct  329   DSNSRLFSSHTTDSDQRPEEATRISELGM------SGFGESAANKDSKPPSINQVQSKQH  382

Query  622   GGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATP  443
              G +H+G+T  DRPI+G+VAAHWN++ETSR+SPKWWDGNGIPNST+KYKEDQKVSWHATP
Sbjct  383   LGPVHYGRTPRDRPIIGLVAAHWNDDETSRISPKWWDGNGIPNSTNKYKEDQKVSWHATP  442

Query  442   FEERLEKALSEESLVSQRKRMSG-SPISFNETEESDTALSQL  320
             FEERLEKALSEE+ +SQR + SG +PI+ +E EES+TA SQ+
Sbjct  443   FEERLEKALSEETNISQRTQHSGTTPIAVHEAEESNTATSQV  484



>ref|XP_011044747.1| PREDICTED: uncharacterized protein LOC105139835 isoform X2 [Populus 
euphratica]
Length=484

 Score =   341 bits (874),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 229/479 (48%), Positives = 290/479 (61%), Gaps = 54/479 (11%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             SRP  +S     +   P A  +++ LSSLF+SEE +E        +VE     +P +   
Sbjct  18    SRPQAISSDSLRSKPAPEARVSKNRLSSLFLSEEKEESLGG----DVENPSLASPHIN--  71

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
              K L+D+AKFLKACGT  ETP+EIRK  EK     A D E +  KFHSWL ++SI+   L
Sbjct  72    -KGLRDEAKFLKACGTSTETPIEIRKACEKFNGSPALDKESEHSKFHSWLPNTSIKNLQL  130

Query  1270  VSQPDQSPKPTKDCEDWVKESDSPVHTPSS-CMT----------------FEEKSNsptv  1142
              +Q DQ   P K CE+W K S S   TPSS C+T                 + ++N    
Sbjct  131   DNQTDQPLTPVKLCEEWGKGSVSSEQTPSSSCVTNVHTSEESESGSHERVIKVQANENDD  190

Query  1141  isaspt-tvppstTCRQRSVRFDCkstksdmssalsksSFEV----DSPN----SKASPY  989
               A P          R +SVRF+C    S    + S++S +V    +SP     SK SP 
Sbjct  191   FVAGPPWLSASIVQGRNKSVRFECDFDTSSSKESSSENSCQVPGKYESPGNLSVSKPSPK  250

Query  988   PTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedses  809
             PTPLKL D+MQTPGTVFP +V++ ANG   RIRSQ+VYS+LNP+E+ASQ K +       
Sbjct  251   PTPLKLLDDMQTPGTVFPANVESSANGNT-RIRSQHVYSVLNPVESASQWKLL------K  303

Query  808   sqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP--------  653
               D NS  L  +  ES++ S  A    E G++ESS+  +L VE SLSSW KP        
Sbjct  304   EDDFNSHRLSGEPRESLEQSESATPKPERGVKESSSGKDLKVEESLSSWFKPLQSTLGED  363

Query  652   --SLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKY  479
               ++  +S++ F      G+T GDRPI+GMVAAHWNENE SR+SPKWWDGNGIPNST+KY
Sbjct  364   KPNIVTASSKNF----RFGRTPGDRPIIGMVAAHWNENEASRISPKWWDGNGIPNSTNKY  419

Query  478   KEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             KEDQKVSWHATPFEERLEKALSEES++SQRK +SG PI F+E EESDTALS+L    Q+
Sbjct  420   KEDQKVSWHATPFEERLEKALSEESVISQRKPISGRPIVFDECEESDTALSRLQPSTQA  478



>ref|XP_011044745.1| PREDICTED: uncharacterized protein LOC105139835 isoform X1 [Populus 
euphratica]
 ref|XP_011044746.1| PREDICTED: uncharacterized protein LOC105139835 isoform X1 [Populus 
euphratica]
Length=485

 Score =   339 bits (869),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 228/468 (49%), Positives = 284/468 (61%), Gaps = 56/468 (12%)
 Frame = -3

Query  1597  PTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFL  1418
             P   E   S NR  LSSLF+SEE +E        +VE     +P +    K L+D+AKFL
Sbjct  32    PAPQEARVSKNR--LSSLFLSEEKEESLGG----DVENPSLASPHIN---KGLRDEAKFL  82

Query  1417  KACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPT  1238
             KACGT  ETP+EIRK  EK     A D E +  KFHSWL ++SI+   L +Q DQ   P 
Sbjct  83    KACGTSTETPIEIRKACEKFNGSPALDKESEHSKFHSWLPNTSIKNLQLDNQTDQPLTPV  142

Query  1237  KDCEDWVKESDSPVHTPSS-CMT----------------FEEKSNsptvisaspt-tvpp  1112
             K CE+W K S S   TPSS C+T                 + ++N      A P      
Sbjct  143   KLCEEWGKGSVSSEQTPSSSCVTNVHTSEESESGSHERVIKVQANENDDFVAGPPWLSAS  202

Query  1111  stTCRQRSVRFDCkstksdmssalsksSFEV----DSPN----SKASPYPTPLKLSDEMQ  956
                 R +SVRF+C    S    + S++S +V    +SP     SK SP PTPLKL D+MQ
Sbjct  203   IVQGRNKSVRFECDFDTSSSKESSSENSCQVPGKYESPGNLSVSKPSPKPTPLKLLDDMQ  262

Query  955   TPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFS  776
             TPGTVFP +V++ ANG   RIRSQ+VYS+LNP+E+ASQ K +         D NS  L  
Sbjct  263   TPGTVFPANVESSANGNT-RIRSQHVYSVLNPVESASQWKLL------KEDDFNSHRLSG  315

Query  775   DMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP----------SLRQSSTQP  626
             +  ES++ S  A    E G++ESS+  +L VE SLSSW KP          ++  +S++ 
Sbjct  316   EPRESLEQSESATPKPERGVKESSSGKDLKVEESLSSWFKPLQSTLGEDKPNIVTASSKN  375

Query  625   FGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHAT  446
             F      G+T GDRPI+GMVAAHWNENE SR+SPKWWDGNGIPNST+KYKEDQKVSWHAT
Sbjct  376   F----RFGRTPGDRPIIGMVAAHWNENEASRISPKWWDGNGIPNSTNKYKEDQKVSWHAT  431

Query  445   PFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             PFEERLEKALSEES++SQRK +SG PI F+E EESDTALS+L    Q+
Sbjct  432   PFEERLEKALSEESVISQRKPISGRPIVFDECEESDTALSRLQPSTQA  479



>ref|XP_004251552.1| PREDICTED: uncharacterized protein LOC101258824 [Solanum lycopersicum]
Length=484

 Score =   338 bits (867),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 226/462 (49%), Positives = 283/462 (61%), Gaps = 50/462 (11%)
 Frame = -3

Query  1591  AAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKA  1412
             A EP+ S NRSPLSSLF   E +EE ++L  KEVE Q   TP  + D  EL++QAKFLKA
Sbjct  34    AKEPMVSRNRSPLSSLFT--EENEETNTLGCKEVENQSPDTPMEQLDTNELRNQAKFLKA  91

Query  1411  CGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKD  1232
             CGT+PETP EIR  S KC+DLSA   EV+PLK +SW  D++ +K N +   DQS  P K 
Sbjct  92    CGTLPETPAEIRNFSMKCKDLSAPMEEVEPLKVNSWPSDTTCQKLNSMLS-DQS-TPVKI  149

Query  1231  CEDWVK-ESDSPVHTPSSCMT------------------------FEEKSNsptvisasp  1127
               D VK  S S VHTPSSC+T                         E K+N     +   
Sbjct  150   --DGVKTHSGSLVHTPSSCLTDGQSDQSLSKSFINGSENSSTPIFIEVKANLARNDNKDS  207

Query  1126  tt---vppstTCRQRSVRFD------CkstksdmssalsksSFEVDSPNSKASPY---PT  983
                    P+   R RSV F+        S+K   S     S     S N  AS Y   PT
Sbjct  208   AASPLTAPTAKYRYRSVHFESESDLSSMSSKCISSKTSQNSEQSESSGNYHASKYSPYPT  267

Query  982   PLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessq  803
             PLKL+DEMQTPGTVFP ++D +   +  RIRSQYVY +LNP+++ASQ+KE+ +EDS S+Q
Sbjct  268   PLKLTDEMQTPGTVFPAYLDRMGIAKTARIRSQYVYPVLNPVDDASQLKELSDEDSYSTQ  327

Query  802   dsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPF  623
             DSNS+L  S   +S     EA   SE+G+      +     A+      PS+ Q  ++  
Sbjct  328   DSNSRLFSSHTTDSDQRPEEATRISELGM------SGFGESAANKDSKPPSINQVQSKQH  381

Query  622   GGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATP  443
              G +H+G+T  DRPI+G+VAAHWN++ETSR+SPKWWDGNGIPNST+KYKEDQKVSWH TP
Sbjct  382   LGPVHYGRTPRDRPIIGLVAAHWNDDETSRISPKWWDGNGIPNSTNKYKEDQKVSWHVTP  441

Query  442   FEERLEKALSEESLVSQRKRMSGS-PISFNETEESDTALSQL  320
             FEERLEKALSEE+  SQR + SG+ PI+ NE EES TA SQ+
Sbjct  442   FEERLEKALSEETNSSQRIQHSGTPPIAVNEAEESYTATSQV  483



>ref|XP_011032779.1| PREDICTED: uncharacterized protein LOC105131476 isoform X2 [Populus 
euphratica]
Length=484

 Score =   338 bits (866),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 228/479 (48%), Positives = 290/479 (61%), Gaps = 54/479 (11%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             SRP  +S     +   P A  +++ LSSLF+SEE +E        +VE     +P +   
Sbjct  18    SRPQAISSDSLRSKPAPEARVSKNRLSSLFLSEEKEESLGG----DVENPSLASPHIN--  71

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
              K L+D+AKFLKACGT  ETP+EIRK  EK     A D E +  KFHSWL ++SI+   L
Sbjct  72    -KGLRDEAKFLKACGTSTETPIEIRKACEKFNGSPALDKESEHSKFHSWLPNTSIKNLQL  130

Query  1270  VSQPDQSPKPTKDCEDWVKESDSPVHTPSS-CMT----------------FEEKSNsptv  1142
              +Q DQ   P K CE+W K S S   TPSS C+T                 + ++N    
Sbjct  131   DNQTDQPLTPVKLCEEWGKGSVSSEQTPSSSCVTNVHTSEESESGSHERVIKVQANENDD  190

Query  1141  isaspt-tvppstTCRQRSVRFDCkstksdmssalsksSFEV----DSPN----SKASPY  989
               A P          R +SVRF+C    S    + S++S +V    +SP     SK SP 
Sbjct  191   FVAGPPWLSASIVQGRNKSVRFECDFDTSSSKESSSENSCQVPGKYESPGNLSVSKPSPK  250

Query  988   PTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedses  809
             PTPLKL D+MQTPGTVFP +V++ ANG   RIRSQ+VYS+LNP+E+ASQ K +       
Sbjct  251   PTPLKLLDDMQTPGTVFPANVESSANGNT-RIRSQHVYSVLNPVESASQWKLL------K  303

Query  808   sqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP--------  653
               D NS  L  +  ES++ S  A    E G++ESS+  +L VE SLSSW KP        
Sbjct  304   EDDFNSHRLSGEPRESLEQSESATPKPERGVKESSSGKDLKVEESLSSWFKPLQSTLGED  363

Query  652   --SLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKY  479
               ++  +S++ F      G+T GDRPI+GMVAAHWNENE S++SPKWWDGNGIPNST+KY
Sbjct  364   KPNIVTASSKNF----RFGRTPGDRPIIGMVAAHWNENEPSQISPKWWDGNGIPNSTNKY  419

Query  478   KEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             KEDQKVSWHATPFEERLEKALSEES++SQRK +SG PI F+E EESDTALS+L    Q+
Sbjct  420   KEDQKVSWHATPFEERLEKALSEESVISQRKPISGRPIVFDECEESDTALSRLQPSTQA  478



>ref|XP_002530206.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32180.1| conserved hypothetical protein [Ricinus communis]
Length=461

 Score =   337 bits (864),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 222/456 (49%), Positives = 286/456 (63%), Gaps = 45/456 (10%)
 Frame = -3

Query  1639  DHASRPPFV-----SKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDC  1475
             DH  RPP +     ++SL P A   V S NR  LSSLF++EE ++ + + +     K DC
Sbjct  13    DHHRRPPNLVVSDSTRSLPPGA---VVSKNR--LSSLFLTEEREDLEWNKR-----KSDC  62

Query  1474  -GTPELEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLL  1298
              G+P++    KEL ++AKFLKACGT+PETP EIRK SEK R           L FHSWL 
Sbjct  63    FGSPQIN---KELANEAKFLKACGTLPETPSEIRKASEKLRVSPPAGKNSQSLDFHSWLP  119

Query  1297  DSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttv  1118
              +SI+K  L  + DQ P P K CE+W   S     TPSSC++    + +   +S S    
Sbjct  120   STSIKKLQLDKEIDQPPTPVKLCEEWGHGSVYSEQTPSSCIS---NAQNTARMSVSSVED  176

Query  1117  ppstTCRQRSVRFDCkstksdmssalsksSFEVDSPN----SKASPYPTPLKLSDEMQTP  950
               +   + +SVRF+C    S   S       + +SP     SK SP PTPLK+SDEMQTP
Sbjct  177   ATNVPFKNKSVRFECNLDTSSSESGHLNMR-KFESPEDIIVSKPSPKPTPLKISDEMQTP  235

Query  949   GTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDM  770
             GTVFP  ++ LANG+  RIRSQYV+ +L P+ENASQ K +  +DS S Q        S++
Sbjct  236   GTVFPASLEILANGKT-RIRSQYVHPLLKPVENASQWKVLQEDDSSSHQG------LSEL  288

Query  769   GESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFG--------GS  614
               S++   ++   SE+G++++S      VEASLSSWLKP   QS  +  G         +
Sbjct  289   KGSLEQLKDSTPKSEVGVKDTSAPET-KVEASLSSWLKPP--QSPHKDDGLNDGYEASKN  345

Query  613   IHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEE  434
                G+T  DRPI+GMVAAHWNENE S++SPKWWDGNGIPNST+KYKEDQKVSWHATPFEE
Sbjct  346   FRAGRTPMDRPIIGMVAAHWNENEPSQISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEE  405

Query  433   RLEKALSEESLVSQRKRMSGSPISFNETEESDTALS  326
             RLEKALSEES +SQ+K ++G PI F+E +ESDTALS
Sbjct  406   RLEKALSEESFISQKKPINGRPIVFDEHDESDTALS  441



>ref|XP_006437114.1| hypothetical protein CICLE_v10031282mg [Citrus clementina]
 gb|ESR50354.1| hypothetical protein CICLE_v10031282mg [Citrus clementina]
Length=510

 Score =   338 bits (867),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 215/464 (46%), Positives = 287/464 (62%), Gaps = 62/464 (13%)
 Frame = -3

Query  1585  EPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACG  1406
             E V S NR  LSSLF+SEE +E      S ++E Q   +PE++   K LKD+AKFLKACG
Sbjct  57    EAVISKNR--LSSLFLSEEKEES----WSNDIESQRLESPEID---KSLKDEAKFLKACG  107

Query  1405  TIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCE  1226
             T+ ETP EIRK S+K +   +   + +  KFHSWL ++SI K +L  + DQ P P K  E
Sbjct  108   TLIETPAEIRKASQKLKGSPSSGKDKESSKFHSWLPNTSITKLHLGRECDQPPSPIKLSE  167

Query  1225  DWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvpps---------------------  1109
             +W +ES S  HTPSSC++  + +   ++ S        +                     
Sbjct  168   EWGRESPSLEHTPSSCISNAQTTGRISISSTDCNVAGNANPEVMVNSNQSGSIASASPWI  227

Query  1108  ----tTCRQRSVRFDCkstksdmssalsksSFEV----DSPN----SKASPYPTPLKLSD  965
                   CR +SVRF+  S  S    + S +  ++    +SP+    SK SP PTPLKLSD
Sbjct  228   SGTNAQCRNKSVRFEFDSDASSSRDSSSGNISQICRKYESPDNENVSKNSPNPTPLKLSD  287

Query  964   EMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKL  785
             +MQTPGTV+PT++ +LA+G   RIRSQYVYS+ NP+E+ SQ+K +        +  +S  
Sbjct  288   DMQTPGTVYPTNLKSLADGN-TRIRSQYVYSVRNPVESVSQLKAL------EEEGFDSHE  340

Query  784   LFSDMGESVDLSSEANATSEI--GLRESSTENNLNVEASLSSWLKPSLRQS--STQPFGG  617
             L  ++ ES++     NAT E+  G+  SS   +L VEASLS+WLKP+   S  +++  GG
Sbjct  341   LSGELKESIE-----NATPELDTGVEGSSVGKDLKVEASLSAWLKPAASTSDDNSKSTGG  395

Query  616   SI----HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHA  449
             S     H  +  GDRPI+GMVAAHW E ET ++ PKWWDGNGIPNST+KYKEDQKVSWHA
Sbjct  396   SSRKNSHFARNPGDRPIIGMVAAHWIEEETPQIGPKWWDGNGIPNSTNKYKEDQKVSWHA  455

Query  448   TPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLH  317
             TPFEERLEKALSEE+ +SQRK +  +P+ F +TEE+DTALSQL 
Sbjct  456   TPFEERLEKALSEETFISQRKNIKENPVVFEDTEEADTALSQLR  499



>ref|XP_006484983.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=510

 Score =   338 bits (866),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 215/464 (46%), Positives = 287/464 (62%), Gaps = 62/464 (13%)
 Frame = -3

Query  1585  EPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACG  1406
             E V S NR  LSSLF+SEE +E      S ++E Q   +PE++   K LKD+AKFLKACG
Sbjct  57    EAVISKNR--LSSLFLSEEKEES----WSNDIESQRLESPEID---KSLKDEAKFLKACG  107

Query  1405  TIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCE  1226
             T+ ETP EIRK S+K +   +   + +  KFHSWL ++SI K +L  + DQ P P K  E
Sbjct  108   TLIETPAEIRKASQKLKGSPSSGKDKESSKFHSWLPNTSITKLHLGRECDQPPSPIKLSE  167

Query  1225  DWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvpps---------------------  1109
             +W +ES S  HTPSSC++  + +   ++ S        +                     
Sbjct  168   EWGRESPSLEHTPSSCISNAQTTGRISISSTDCNVAGNANPEVMVNSNQSGSIASASPWI  227

Query  1108  ----tTCRQRSVRFDCkstksdmssalsksSFEV----DSPN----SKASPYPTPLKLSD  965
                   CR +SVRF+  S  S    + S +  ++    +SP+    SK SP PTPLKLSD
Sbjct  228   SGTNAQCRNKSVRFEFDSDASSSKDSSSGNISQICRKYESPDNENVSKNSPNPTPLKLSD  287

Query  964   EMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKL  785
             +MQTPGTV+PT++ +LA+G   RIRSQYVYS+ NP+E+ SQ+K +        +  +S  
Sbjct  288   DMQTPGTVYPTNLKSLADGN-TRIRSQYVYSVWNPVESVSQLKAL------EEEGFDSHE  340

Query  784   LFSDMGESVDLSSEANATSEI--GLRESSTENNLNVEASLSSWLKPSLRQS--STQPFGG  617
             L  ++ ES++     NAT E+  G+  SS   +L VEASLS+WLKP+   S  +++  GG
Sbjct  341   LSGELKESIE-----NATPELDTGVEGSSVGKDLKVEASLSAWLKPAASTSDDNSKSTGG  395

Query  616   SI----HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHA  449
             S     H  +  GDRPI+GMVAAHW E ET ++ PKWWDGNGIPNST+KYKEDQKVSWHA
Sbjct  396   SSRKNSHFARNPGDRPIIGMVAAHWIEEETPQIGPKWWDGNGIPNSTNKYKEDQKVSWHA  455

Query  448   TPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLH  317
             TPFEERLEKALSEE+ +SQRK +  +P+ F +TEE+DTALSQL 
Sbjct  456   TPFEERLEKALSEETFISQRKNIKENPVVFEDTEEADTALSQLR  499



>ref|XP_011032776.1| PREDICTED: uncharacterized protein LOC105131476 isoform X1 [Populus 
euphratica]
 ref|XP_011032778.1| PREDICTED: uncharacterized protein LOC105131476 isoform X1 [Populus 
euphratica]
Length=485

 Score =   336 bits (862),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 227/468 (49%), Positives = 284/468 (61%), Gaps = 56/468 (12%)
 Frame = -3

Query  1597  PTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFL  1418
             P   E   S NR  LSSLF+SEE +E        +VE     +P +    K L+D+AKFL
Sbjct  32    PAPQEARVSKNR--LSSLFLSEEKEESLGG----DVENPSLASPHIN---KGLRDEAKFL  82

Query  1417  KACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPT  1238
             KACGT  ETP+EIRK  EK     A D E +  KFHSWL ++SI+   L +Q DQ   P 
Sbjct  83    KACGTSTETPIEIRKACEKFNGSPALDKESEHSKFHSWLPNTSIKNLQLDNQTDQPLTPV  142

Query  1237  KDCEDWVKESDSPVHTPSS-CMT----------------FEEKSNsptvisaspt-tvpp  1112
             K CE+W K S S   TPSS C+T                 + ++N      A P      
Sbjct  143   KLCEEWGKGSVSSEQTPSSSCVTNVHTSEESESGSHERVIKVQANENDDFVAGPPWLSAS  202

Query  1111  stTCRQRSVRFDCkstksdmssalsksSFEV----DSPN----SKASPYPTPLKLSDEMQ  956
                 R +SVRF+C    S    + S++S +V    +SP     SK SP PTPLKL D+MQ
Sbjct  203   IVQGRNKSVRFECDFDTSSSKESSSENSCQVPGKYESPGNLSVSKPSPKPTPLKLLDDMQ  262

Query  955   TPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFS  776
             TPGTVFP +V++ ANG   RIRSQ+VYS+LNP+E+ASQ K +         D NS  L  
Sbjct  263   TPGTVFPANVESSANGNT-RIRSQHVYSVLNPVESASQWKLL------KEDDFNSHRLSG  315

Query  775   DMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP----------SLRQSSTQP  626
             +  ES++ S  A    E G++ESS+  +L VE SLSSW KP          ++  +S++ 
Sbjct  316   EPRESLEQSESATPKPERGVKESSSGKDLKVEESLSSWFKPLQSTLGEDKPNIVTASSKN  375

Query  625   FGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHAT  446
             F      G+T GDRPI+GMVAAHWNENE S++SPKWWDGNGIPNST+KYKEDQKVSWHAT
Sbjct  376   F----RFGRTPGDRPIIGMVAAHWNENEPSQISPKWWDGNGIPNSTNKYKEDQKVSWHAT  431

Query  445   PFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             PFEERLEKALSEES++SQRK +SG PI F+E EESDTALS+L    Q+
Sbjct  432   PFEERLEKALSEESVISQRKPISGRPIVFDECEESDTALSRLQPSTQA  479



>ref|XP_008380178.1| PREDICTED: uncharacterized protein LOC103443161 isoform X1 [Malus 
domestica]
Length=507

 Score =   337 bits (863),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 219/471 (46%), Positives = 285/471 (61%), Gaps = 47/471 (10%)
 Frame = -3

Query  1627  RPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDV  1448
             RP  VS+S      E V S NR  LSSLF +EE    K    SK+ E    GTP+++   
Sbjct  47    RPHLVSQSSRNPQTEVVISQNR--LSSLFSAEE----KEGSPSKDWESGSYGTPQID---  97

Query  1447  KELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK-QNL  1271
             KEL+ +AKFLKACGTI ETP EIRK+S         D + +P KF+S L  +SI+  Q  
Sbjct  98    KELRKEAKFLKACGTIAETPAEIRKVSSTLNGSPHRDRDSEPPKFNSQLPKTSIKNLQQE  157

Query  1270  VSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEK-----------------SNsptv  1142
             + QPDQ P P K  E+W K S    HTPSS ++ ++                  S   + 
Sbjct  158   LDQPDQPPTPMKFNEEWGKGSGPSEHTPSSFVSNQQNNGRTTISSSGGSGIGTDSTVKSH  217

Query  1141  isaspttvppstTCRQRSVRFDCkstksdmssalsksSFE----VDSPN----SKASPYP  986
              + +     P    R ++VRFDC +  +    + S++  +     ++P     SK S YP
Sbjct  218   TNRTENITTPDVQFRGKAVRFDCNNDTNSSRGSSSENYNQSSKVCETPGKQSISKPSVYP  277

Query  985   TPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsess  806
             TPL LSDEMQTPGTVFP +++N  NG+  RIRSQYVYS+ NP +  SQ   +        
Sbjct  278   TPLTLSDEMQTPGTVFPANLENFPNGK-ARIRSQYVYSVQNPGDGISQQNVL------KD  330

Query  805   qdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQP  626
             +D NS  L  +  ES++    A   SE G ++ S+   +NVE+SLS+WLKP  + ++ Q 
Sbjct  331   EDPNSHGLSVEQRESLNHWGNATPISEEGAKQISSGQEVNVESSLSTWLKPVTQDNNNQ-  389

Query  625   FGG----SIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVS  458
             FG     + H G+T GDRPI+G+VA HWNE+E +RVSPKWWDGNGIPNST+KYKEDQKVS
Sbjct  390   FGNVPGRTRHFGRTPGDRPIIGLVATHWNEDEPTRVSPKWWDGNGIPNSTNKYKEDQKVS  449

Query  457   WHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             WHATPFEERLEKALSEES +SQRK + G PI F+E +ESDTALSQL + +Q
Sbjct  450   WHATPFEERLEKALSEESFISQRKNIEGKPIVFDENDESDTALSQLQSSSQ  500



>ref|XP_008342335.1| PREDICTED: uncharacterized protein LOC103405147 [Malus domestica]
Length=507

 Score =   335 bits (859),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 216/468 (46%), Positives = 283/468 (60%), Gaps = 47/468 (10%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             SRP  VS+S      E V S NR  LS+LF +EE +   S    K+ E    G+P+++  
Sbjct  46    SRPHLVSQSSRNPQTEVVLSQNR--LSALFSAEEQEGSPS----KDRESPRYGSPQID--  97

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK-QN  1274
              KEL+++AKFLKACGTI ETP EIRK+S +      HD + +P KF+SWL ++S    Q 
Sbjct  98    -KELRNEAKFLKACGTIAETPAEIRKVSSRLNGSPHHDRDSEPPKFNSWLPNTSFRNLQQ  156

Query  1273  LVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEK-----------------SNspt  1145
              + QPD    P K  E+W   S    HTPSSC   ++                  S   +
Sbjct  157   ELDQPDHPLTPMKYNEEWGMGSGPSEHTPSSCEFNQQNTGRIAISSSGGSGIGTDSTVKS  216

Query  1144  visaspttvppstTCRQRSVRFDCkstksdmssalsksSFE----VDSPN----SKASPY  989
               + +     P   CR ++VRF+C +  +    + S++        ++P     SK S Y
Sbjct  217   HTNRTENITTPDVQCRSKAVRFECDNNTNSSRGSSSENYNRSSKVCETPGKQSISKPSVY  276

Query  988   PTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedses  809
             PTPL LS+EMQTPGTVFP +++N  NGR  RIRSQYVYS+ NP++  SQ   + +ED +S
Sbjct  277   PTPLTLSEEMQTPGTVFPANLENFPNGR-ARIRSQYVYSVQNPVDGISQWNVLKDEDPKS  335

Query  808   sqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQ  629
                S       +  ES++    A  TSE G ++ S+   +NVE+SLS+WLKP + Q +  
Sbjct  336   LGHS------GEPRESLNDWGNATPTSEEGSKQMSSGQEVNVESSLSAWLKP-VTQDNNN  388

Query  628   PFG----GSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKV  461
              FG     + H G+T  DRPI+G+VA HWNE+E +RVSPKWWDGNGIPNST+KYKEDQKV
Sbjct  389   HFGYVPGQTRHFGRTPVDRPIIGLVATHWNEDEHTRVSPKWWDGNGIPNSTNKYKEDQKV  448

Query  460   SWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLH  317
             SWHATPFEERLEKALSEES +SQRK M G PI F+E +ESDTALSQL 
Sbjct  449   SWHATPFEERLEKALSEESFISQRKNMEGKPIVFDENDESDTALSQLQ  496



>ref|XP_009377072.1| PREDICTED: uncharacterized protein LOC103965727 [Pyrus x bretschneideri]
Length=507

 Score =   334 bits (857),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 217/472 (46%), Positives = 282/472 (60%), Gaps = 47/472 (10%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             SRP  VS+S      E V S NR  LS LF +EE    K    SK+ E    G+P+++  
Sbjct  46    SRPHLVSQSSRNPQTEVVISQNR--LSYLFSAEE----KEGSPSKDRESPRYGSPQID--  97

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK-QN  1274
              KEL+++AKFLKACGTI ETP EIRK+S +    S HD +  P KF+SWL ++SI   Q 
Sbjct  98    -KELRNEAKFLKACGTIAETPAEIRKVSSRLNGSSHHDRDSQPPKFNSWLPNTSIRNLQQ  156

Query  1273  LVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEK-----------------SNspt  1145
              + QPD    P K  E+W   S    HTP SC   ++                  S   +
Sbjct  157   ELDQPDHPLTPMKYNEEWGMGSGPSEHTPRSCEFNQQNTGRIAISSSGGSGLGTDSTVKS  216

Query  1144  visaspttvppstTCRQRSVRFDCkstksdmssalsksSFE----VDSPN----SKASPY  989
               + +     P   CR ++VRF+C +  +    + S++        ++P     SK S Y
Sbjct  217   HTNRTENITTPDVQCRSKTVRFECDNNTNSSRGSSSENYNRSSKICETPGKQSISKPSVY  276

Query  988   PTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedses  809
             PTPL LS+EMQTPGTVFP ++ N  NG+  RIRSQYVYS+ NP++  SQ   + +ED  S
Sbjct  277   PTPLTLSEEMQTPGTVFPANLQNFPNGK-ARIRSQYVYSVQNPVDGISQWNVLKDEDPNS  335

Query  808   sqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQ  629
                S       +  ES++    A  TS+ G ++ S+   +NVE+SLS+WLKP + Q +  
Sbjct  336   LGHS------GEPRESLNDWGNATPTSKEGSKQMSSGQEVNVESSLSAWLKP-VTQDNNN  388

Query  628   PFG----GSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKV  461
              FG     + H G+T  DRPI+G+VA HWNE+E +RVSPKWWDGNGIPNST+KYKEDQKV
Sbjct  389   HFGYVPGQTRHFGRTPVDRPIIGLVATHWNEDEHTRVSPKWWDGNGIPNSTNKYKEDQKV  448

Query  460   SWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             SWHATPFEERLEKALSEES +SQRK M G PI F+E +ESDTALSQL   +Q
Sbjct  449   SWHATPFEERLEKALSEESFISQRKNMEGKPIVFDENDESDTALSQLQTSSQ  500



>ref|XP_002307564.2| hypothetical protein POPTR_0005s22730g [Populus trichocarpa]
 gb|EEE94560.2| hypothetical protein POPTR_0005s22730g [Populus trichocarpa]
Length=467

 Score =   332 bits (852),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 213/432 (49%), Positives = 267/432 (62%), Gaps = 46/432 (11%)
 Frame = -3

Query  1495  EVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLK  1316
             +VE    G+P +    K L+D+AKFLKACGT+ ETP+EIRK  EK       D + +P K
Sbjct  42    DVENPCLGSPHIN---KGLRDEAKFLKACGTLTETPIEIRKACEKFNGSPTLDKDSEPSK  98

Query  1315  FHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSS-CMTFEEKSNsptvi  1139
             FHSWL  +SI+K  L +Q DQ   P K CE+W K S S   TPSS C+T    S      
Sbjct  99    FHSWLPSTSIKKLQLDNQTDQPLTPVKLCEEWGKGSVSSEQTPSSSCITNVHNSEDSESG  158

Query  1138  saspttvppst-----------------TCRQRSVRFDCkstksdmssalsksSFEV---  1019
             S        +                    R +SVRF+C    S    + S++S +V   
Sbjct  159   SRERVIKVQANENDDVVAGPPWLSASIVQSRNKSVRFECDFDTSSSKGSSSENSCQVPGK  218

Query  1018  -DSPN----SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIE  854
              +SP     SK SP PTPLKL D+MQTPGTVFP +++   NG+  R RSQ+VYS+LNP+E
Sbjct  219   YESPGNLSVSKPSPKPTPLKLLDDMQTPGTVFPANLETSDNGKT-RFRSQHVYSVLNPVE  277

Query  853   NASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEAS  674
             +ASQ K +  +D  S +      L  +  ES++ S  A    E G++ESS+  +L VEAS
Sbjct  278   SASQWKLLKEDDFNSLR------LSGEPRESLEQSESATPKPERGVKESSSGKDLKVEAS  331

Query  673   LSSWLKPSLRQSST---QPFGGS-----IHHGKTLGDRPILGMVAAHWNENETSRVSPKW  518
             LSSW KPS  QS+     P  G+        G+T GDRPI+GMVAAHWNENE S++SPKW
Sbjct  332   LSSWFKPS--QSTLGEDNPNTGTASSKNFRFGRTPGDRPIIGMVAAHWNENEPSQISPKW  389

Query  517   WDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESD  338
             WDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEES++SQRK +SG PI F+E EESD
Sbjct  390   WDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEESVISQRKPISGRPIVFDECEESD  449

Query  337   TALSQLHNGNQS  302
             TALS+L    Q+
Sbjct  450   TALSRLQTSTQA  461



>ref|XP_002300865.2| hypothetical protein POPTR_0002s05800g [Populus trichocarpa]
 gb|EEE80138.2| hypothetical protein POPTR_0002s05800g [Populus trichocarpa]
Length=488

 Score =   331 bits (848),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 215/450 (48%), Positives = 271/450 (60%), Gaps = 56/450 (12%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LSSLF+SEE +E        ++E    G+P++    K L+D+AKFLKACGT+PETP EIR
Sbjct  57    LSSLFLSEEKEESPRG----DIENPCLGSPQIN---KGLRDEAKFLKACGTLPETPTEIR  109

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K  +K +     D   +  KFHSWL ++S+EK  L +Q + S  P K  E+  K S S  
Sbjct  110   KACDKFKGSPGLDKYSESSKFHSWLPNTSMEKLQLDNQNEDSRTPVKLWEELGKGSFSSE  169

Query  1195  HTPSSCMTFEEKSNsptvisasptt-----------------vppstTCRQRSVRFDC--  1073
              TPSSCMT  +        S                             R RSVRF+C  
Sbjct  170   QTPSSCMTNVQSREDSESGSHKRMIKVQPDEIDNVATGAPWLSATKVQSRNRSVRFECDF  229

Query  1072  -kstksdmssalsksSFEVDSPN----SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANG  908
               S+    S    +   + +SP     SK SP PTPLK+SD+MQTPGTVFP +++ LANG
Sbjct  230   DTSSSKGSSENGCQVPRKYESPGNLSVSKPSPRPTPLKISDDMQTPGTVFPANLETLANG  289

Query  907   RFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATS  728
             +  RIRSQYVYS+LNP+ENASQ K ++ ED  +S + + +L       S++ S  A    
Sbjct  290   K-TRIRSQYVYSVLNPVENASQWK-LLREDDSNSHEQSGELF------SLEQSESATPKP  341

Query  727   EIGLRESSTENNLNVEASLSSWLKPSLRQSST--------QPFGGSIHHGKTLGDRPILG  572
             E G++E+S+  +L VEASLSSW+KP   QS+T           G +   G+T GDRPI+G
Sbjct  342   EWGVKETSSGKDLKVEASLSSWVKPP--QSTTGEDNPNIGTAAGKNFSSGRTPGDRPIIG  399

Query  571   MVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQ  392
             MVAAHWNENE SR+SPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEES +SQ
Sbjct  400   MVAAHWNENEASRISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEESFISQ  459

Query  391   RKRMSGSPISFNETEESDTALSQLHNGNQS  302
             R         F+E EESDTALS L    Q+
Sbjct  460   R-------AFFDECEESDTALSLLQASTQA  482



>ref|XP_006386281.1| hypothetical protein POPTR_0002s05800g [Populus trichocarpa]
 gb|ERP64078.1| hypothetical protein POPTR_0002s05800g [Populus trichocarpa]
Length=502

 Score =   331 bits (848),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 215/450 (48%), Positives = 271/450 (60%), Gaps = 56/450 (12%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LSSLF+SEE +E        ++E    G+P++    K L+D+AKFLKACGT+PETP EIR
Sbjct  71    LSSLFLSEEKEESPRG----DIENPCLGSPQIN---KGLRDEAKFLKACGTLPETPTEIR  123

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K  +K +     D   +  KFHSWL ++S+EK  L +Q + S  P K  E+  K S S  
Sbjct  124   KACDKFKGSPGLDKYSESSKFHSWLPNTSMEKLQLDNQNEDSRTPVKLWEELGKGSFSSE  183

Query  1195  HTPSSCMTFEEKSNsptvisasptt-----------------vppstTCRQRSVRFDC--  1073
              TPSSCMT  +        S                             R RSVRF+C  
Sbjct  184   QTPSSCMTNVQSREDSESGSHKRMIKVQPDEIDNVATGAPWLSATKVQSRNRSVRFECDF  243

Query  1072  -kstksdmssalsksSFEVDSPN----SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANG  908
               S+    S    +   + +SP     SK SP PTPLK+SD+MQTPGTVFP +++ LANG
Sbjct  244   DTSSSKGSSENGCQVPRKYESPGNLSVSKPSPRPTPLKISDDMQTPGTVFPANLETLANG  303

Query  907   RFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATS  728
             +  RIRSQYVYS+LNP+ENASQ K ++ ED  +S + + +L       S++ S  A    
Sbjct  304   K-TRIRSQYVYSVLNPVENASQWK-LLREDDSNSHEQSGELF------SLEQSESATPKP  355

Query  727   EIGLRESSTENNLNVEASLSSWLKPSLRQSST--------QPFGGSIHHGKTLGDRPILG  572
             E G++E+S+  +L VEASLSSW+KP   QS+T           G +   G+T GDRPI+G
Sbjct  356   EWGVKETSSGKDLKVEASLSSWVKPP--QSTTGEDNPNIGTAAGKNFSSGRTPGDRPIIG  413

Query  571   MVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQ  392
             MVAAHWNENE SR+SPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEES +SQ
Sbjct  414   MVAAHWNENEASRISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEESFISQ  473

Query  391   RKRMSGSPISFNETEESDTALSQLHNGNQS  302
             R         F+E EESDTALS L    Q+
Sbjct  474   R-------AFFDECEESDTALSLLQASTQA  496



>gb|KDP36514.1| hypothetical protein JCGZ_08897 [Jatropha curcas]
Length=458

 Score =   328 bits (840),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 207/468 (44%), Positives = 267/468 (57%), Gaps = 61/468 (13%)
 Frame = -3

Query  1639  DHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPEL  1460
             D   RP FVS S +  +    A+ +++ LSSLF++EE +E   +    ++E    G+ ++
Sbjct  12    DDRRRPHFVSNSASTPSKPTEAAVSKNRLSSLFLTEEGEESTYN----DMENLYVGSQQI  67

Query  1459  EFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK  1280
                 K L D+AKFLKACGT+PETP EIRK S++ + L   D +     FHSWLL++   K
Sbjct  68    N---KGLVDEAKFLKACGTLPETPAEIRKASDELKGLPPFDNDSKSSDFHSWLLNTPTNK  124

Query  1279  QNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKS-------------------  1157
               L    D+   P K C++   +S SP  TPSSC++  + +                   
Sbjct  125   LQL----DKPSTPIKLCKELRNDSASPGLTPSSCISNVQNTGRISVSSIEDGEAGNVKTA  180

Query  1156  ------NsptvisaspttvppstTCRQRSVRFDCkstksdmssalsksSFEVDSPNSKAS  995
                   N     S S      +  C+ RSVRF+C    S      S     V    SK S
Sbjct  181   KVHVSKNDDITPSVSQRLSDTNVPCKNRSVRFECSLDTSSSKGYESPGDLSV----SKRS  236

Query  994   PYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIneds  815
             P PTPLKLSDEMQTPGTVFP +++ +ANG+  RIRSQYVYS+LNP+EN SQ K       
Sbjct  237   PKPTPLKLSDEMQTPGTVFPANLEVVANGK-ARIRSQYVYSVLNPVENVSQWK-------  288

Query  814   essqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSS  635
                      ++  D   S  L ++    SE+G  + S+   L  EASLSSW+KP      
Sbjct  289   ---------VIQEDDFISHQLENQT-PKSELGAEQDSSVQELKAEASLSSWIKPPQSVHD  338

Query  634   TQPFGGS---IHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQK  464
                   S      G+T  DRPI+GMVAAHWNENE S +SP+WWDGNGIPNST+KYKEDQK
Sbjct  339   ADDANASSKNFRLGRTPTDRPIIGMVAAHWNENEPSHISPRWWDGNGIPNSTNKYKEDQK  398

Query  463   VSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             VSWHATPFEERLEKALSEES +SQ+K + G PI F+E +ESDTALS +
Sbjct  399   VSWHATPFEERLEKALSEESFISQKKHIDGRPIVFDEQDESDTALSTM  446



>ref|XP_007048945.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 1 [Theobroma cacao]
 gb|EOX93102.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 1 [Theobroma cacao]
Length=492

 Score =   329 bits (843),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 223/465 (48%), Positives = 284/465 (61%), Gaps = 49/465 (11%)
 Frame = -3

Query  1639  DHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPEL  1460
             D  SRP  VS S   T  E   S NR  LSSLF+    DEEK    S  +     G+P++
Sbjct  42    DDRSRPHLVSSSSKST--ERGVSRNR--LSSLFL----DEEKGDCPSNHL-----GSPQI  88

Query  1459  EFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK  1280
             +   K LKD+AKFLKACGTIPETP EIRK S + +      G+ +P KF SWL ++SI+K
Sbjct  89    D---KGLKDEAKFLKACGTIPETPAEIRKASRRFKQSPPCGGDSEPSKFQSWLPNTSIDK  145

Query  1279  QNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSC----------MTFEEKSNs-ptvisa  1133
               L  Q DQ P P K  E   +  DS  +TP+S           M   E S +     + 
Sbjct  146   FQLDKQSDQPPTPIKLFEALERGPDSSENTPTSISNAANTGRFSMGSTEGSEALSVDKTV  205

Query  1132  spttvppstTCRQRSVRFDCks-tksdmssalsksSFEVDSPN----SKASPYPTPLKLS  968
                 V  S   R +SVRF+C+S   S  S    ++S +++ P     SK SP PTPLKLS
Sbjct  206   KIDIVSTSAYGRNKSVRFECESDASSSKSENGGQNSKKLELPGYQSASKPSPNPTPLKLS  265

Query  967   DEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSK  788
             DEMQTPGTVFP++++NLANG+  RIRSQYVYS+LNP ENASQ+  +        +  +SK
Sbjct  266   DEMQTPGTVFPSNLENLANGKT-RIRSQYVYSVLNPAENASQLNVM------KEEPFSSK  318

Query  787   LLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH  608
              +  +  +S +    A     +G+  +S      VE SLSSWLKP  +Q++      +I 
Sbjct  319   EMLGEPKKSPERPENAALKLGMGVEGTSRAEESEVEGSLSSWLKP--KQNNIDDRYKNIQ  376

Query  607   --------HGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWH  452
                      G+T GDRPI+GMVAAHWNE E+S V+PKWWDGNGIPNST+KYKEDQKVSWH
Sbjct  377   SNYSKLPPFGRTPGDRPIIGMVAAHWNEEESSHVTPKWWDGNGIPNSTNKYKEDQKVSWH  436

Query  451   ATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLH  317
             ATPFEERLEKALS+ESL+SQ K ++ +P+ F+ET+ESDTALSQL 
Sbjct  437   ATPFEERLEKALSDESLISQSKHVNKTPMVFDETDESDTALSQLR  481



>ref|XP_009356595.1| PREDICTED: uncharacterized protein LOC103947410 isoform X1 [Pyrus 
x bretschneideri]
Length=507

 Score =   323 bits (828),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 212/472 (45%), Positives = 288/472 (61%), Gaps = 47/472 (10%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             SRP  VS+S      E V S NR  LSSLF++EE  +E S ++ +E       +P+++  
Sbjct  46    SRPHLVSQSSRNPQTEVVISQNR--LSSLFLAEE--KEGSPIEDRE--SASYVSPQID--  97

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK-QN  1274
              KE +++AKFLKACGTI ETP EIRK+S +       D + +P KF+S L ++SI+  Q 
Sbjct  98    -KERRNEAKFLKACGTIAETPAEIRKVSSRLNGSPHRDRDSEPPKFNSQLPNTSIKNLQQ  156

Query  1273  LVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEK-----------------SNspt  1145
              + QPDQ P P K  E+W K S     TPSS ++ ++                  S   +
Sbjct  157   ELDQPDQPPTPMKFNEEWGKGSGPSEQTPSSFVSNQQNNGRTTISSSGGSGIGTDSTVKS  216

Query  1144  visaspttvppstTCRQRSVRFDCkstksdmssalsksSFEV----DSPN----SKASPY  989
               + +     P    R ++VRFDC +  +    + S++  +     ++P     SK S Y
Sbjct  217   HTNRTENITTPDVQFRSKAVRFDCNNDTNSSRGSSSENYNQCSKVCETPGKQSISKPSVY  276

Query  988   PTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedses  809
             PTPL LSDEMQTPGTVFP +++N  NG+  RIRSQYVYS+ NP +  SQ   +       
Sbjct  277   PTPLTLSDEMQTPGTVFPANLENFPNGK-ARIRSQYVYSVQNPGDGISQQNVL------K  329

Query  808   sqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQ  629
              +D NS  L  +  ES++    A   S+   ++ S+   +NVE+SLS+WLKP  + ++ Q
Sbjct  330   DEDPNSHGLSVEQRESLNHWGNATPISKERAKQISSGQEVNVESSLSTWLKPVTQDNNNQ  389

Query  628   PFG----GSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKV  461
              FG     + H G+T GDRPI+G+VA HWNE++ +RVSPKWWDGNGIPNST+KYKEDQKV
Sbjct  390   -FGYVPSQTRHFGRTPGDRPIIGLVATHWNEDKPTRVSPKWWDGNGIPNSTNKYKEDQKV  448

Query  460   SWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             SWHATPFEERLEKALSEES +SQRK + G PI F+E +ESDTALSQL + +Q
Sbjct  449   SWHATPFEERLEKALSEESFISQRKNIEGKPIVFDENDESDTALSQLQSSSQ  500



>gb|KHG17269.1| Endo-alpha-N-acetylgalactosaminidase [Gossypium arboreum]
Length=489

 Score =   317 bits (812),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 211/462 (46%), Positives = 286/462 (62%), Gaps = 52/462 (11%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             SRP  V+     T  E   S NR  LSSLFV    DEEK    S ++E     +P++   
Sbjct  45    SRPHLVASCSKST--ERTVSRNR--LSSLFV----DEEKGDSPSNDLE-----SPQIN--  89

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
              K LKD+AKFLK+CGTIPETP+EIRK S K +      G+ +  K+ SWL ++SI+K  L
Sbjct  90    -KGLKDEAKFLKSCGTIPETPVEIRKASHKFKQSPPCGGDSETSKYRSWLPNTSIDKLQL  148

Query  1270  VSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTC---  1100
               + DQ P P+K  E  +  SDS  +TPSSC++    +   ++ S   +    +      
Sbjct  149   DKKSDQPPTPSKLFE-VLGRSDSSDNTPSSCISNAANTGMSSICSTEGSEATTADKTAKT  207

Query  1099  ---------RQRSVRFDCkstksdmssalsksSFEVDSPN----SKASPYPTPLKLSDEM  959
                      R +SVRF+C+S  S  S  + ++  ++++      SK SP PTPLKLSDEM
Sbjct  208   GIFSTSAYERNKSVRFECESDASSKSENIGQNPEKLEALGYQSASKYSPNPTPLKLSDEM  267

Query  958   QTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLF  779
             QTPGTVFP++V   ANG+  RIRS+YV+ +LNP+ NAS +  +        +  +SK +F
Sbjct  268   QTPGTVFPSNVGIFANGK-TRIRSEYVHLVLNPVGNASPLNAM------KKEPLSSKEMF  320

Query  778   SDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH---  608
             ++  ES +     N T ++G++++S   +   E SLS+WLKP  +Q +      +IH   
Sbjct  321   NEQEESPE--RLENGTPKLGVKQASLGKDSEDEGSLSAWLKP--KQITIDDPDKNIHVTS  376

Query  607   -----HGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATP  443
                    +T GDRPI+GMVAAHWNE+E+SR+SPKWWDGNGIPNST+KYKEDQKVSWHATP
Sbjct  377   SKTPQFNRTPGDRPIIGMVAAHWNEDESSRISPKWWDGNGIPNSTNKYKEDQKVSWHATP  436

Query  442   FEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLH  317
             FEERLEKALSEESL+SQRK +  + +S +E +ESDTALSQL 
Sbjct  437   FEERLEKALSEESLISQRKPVDRTLMSLDEIDESDTALSQLR  478



>ref|XP_010272276.1| PREDICTED: uncharacterized protein LOC104608095 isoform X2 [Nelumbo 
nucifera]
Length=524

 Score =   317 bits (811),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 204/479 (43%), Positives = 278/479 (58%), Gaps = 50/479 (10%)
 Frame = -3

Query  1618  FVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEF----D  1451
              +S S+     +  + ++R+ LSSL +SEE    K     +++E  + G+P  +     D
Sbjct  38    IISDSVASKGKQGGSIASRNQLSSLLLSEE----KEGFPCEDLENHNPGSPLPDVYGDGD  93

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
             V+ELKD+AKFLKACG + ETP EIRK SEK +D + H+G+ +P  FHSWL  +SI+K   
Sbjct  94    VRELKDEAKFLKACGALLETPAEIRKASEKIKDAAIHNGDSEPSNFHSWLPGASIKKLQW  153

Query  1270  VSQPDQ-SPKPTKDCEDWVKESDSPVHT--------------------------PSSCMT  1172
                P+Q S  P K CE+  KESDS  HT                          PS+ +T
Sbjct  154   DEHPNQISISPVKLCEELGKESDSQNHTSVSMPKGQELVGRDYTRHHECSEVENPSTAIT  213

Query  1171  FE-EKSNsptvisaspttvppstTCRQRSVRFDCkstksdmssalsksSFEVDSPN--SK  1001
             F    S + T    +P     ++  + + VRF C+    ++ S            +  S+
Sbjct  214   FPLHPSTNETSALVTPEIPAIASESKNKCVRFKCELDTENLPSNGKSLKSNSSGRHNESE  273

Query  1000  ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIne  821
             +SPYPTPLKL+DEMQTPGT++P ++D   NG   RIRSQYVY +LNP+EN SQ K +  E
Sbjct  274   SSPYPTPLKLTDEMQTPGTIYPVNLDKYGNGNNARIRSQYVYPVLNPVENFSQWKALKEE  333

Query  820   dsessqdsnSKLL--FSDMGESVDLSSEANATSEIGL---RESSTENNLNVEASLSSWLK  656
             D  + Q+          ++  +V   +  + ++++ +   RE+       V+ASLS WLK
Sbjct  334   DFSTHQEQLGHTGDSLEEIASAVPEYASVSYSNKLEMEQERENMAVKESKVDASLSHWLK  393

Query  655   PSL-------RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIP  497
             PS        +     P G S     + GDRPILGMVAAHWN+ E SR+S KWWDGNGIP
Sbjct  394   PSSPPKDDADQNCGVFPGGRSYSSKTSDGDRPILGMVAAHWNDEEPSRISSKWWDGNGIP  453

Query  496   NSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             NST+KYKEDQKV WHATPFEERLEKALSEESL  +RK ++G PI+F E EE+DTA+S+L
Sbjct  454   NSTNKYKEDQKVHWHATPFEERLEKALSEESLGYKRKLVNGRPINFEENEETDTAVSRL  512



>ref|XP_010272275.1| PREDICTED: uncharacterized protein LOC104608095 isoform X1 [Nelumbo 
nucifera]
Length=525

 Score =   316 bits (810),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 204/480 (43%), Positives = 278/480 (58%), Gaps = 51/480 (11%)
 Frame = -3

Query  1618  FVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEF----D  1451
              +S S+     +  + ++R+ LSSL +SEE    K     +++E  + G+P  +     D
Sbjct  38    IISDSVASKGKQGGSIASRNQLSSLLLSEE----KEGFPCEDLENHNPGSPLPDVYGDGD  93

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
             V+ELKD+AKFLKACG + ETP EIRK SEK +D + H+G+ +P  FHSWL  +SI+K   
Sbjct  94    VRELKDEAKFLKACGALLETPAEIRKASEKIKDAAIHNGDSEPSNFHSWLPGASIKKLQW  153

Query  1270  VSQPDQ-SPKPTKDCEDWVKESDSPVHT---------------------------PSSCM  1175
                P+Q S  P K CE+  KESDS  HT                           PS+ +
Sbjct  154   DEHPNQISISPVKLCEELGKESDSQNHTSVSSMPKGQELVGRDYTRHHECSEVENPSTAI  213

Query  1174  TFE-EKSNsptvisaspttvppstTCRQRSVRFDCkstksdmssalsksSFEVDSPN--S  1004
             TF    S + T    +P     ++  + + VRF C+    ++ S            +  S
Sbjct  214   TFPLHPSTNETSALVTPEIPAIASESKNKCVRFKCELDTENLPSNGKSLKSNSSGRHNES  273

Query  1003  KASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIn  824
             ++SPYPTPLKL+DEMQTPGT++P ++D   NG   RIRSQYVY +LNP+EN SQ K +  
Sbjct  274   ESSPYPTPLKLTDEMQTPGTIYPVNLDKYGNGNNARIRSQYVYPVLNPVENFSQWKALKE  333

Query  823   edsessqdsnSKLL--FSDMGESVDLSSEANATSEIGL---RESSTENNLNVEASLSSWL  659
             ED  + Q+          ++  +V   +  + ++++ +   RE+       V+ASLS WL
Sbjct  334   EDFSTHQEQLGHTGDSLEEIASAVPEYASVSYSNKLEMEQERENMAVKESKVDASLSHWL  393

Query  658   KPSL-------RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGI  500
             KPS        +     P G S     + GDRPILGMVAAHWN+ E SR+S KWWDGNGI
Sbjct  394   KPSSPPKDDADQNCGVFPGGRSYSSKTSDGDRPILGMVAAHWNDEEPSRISSKWWDGNGI  453

Query  499   PNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             PNST+KYKEDQKV WHATPFEERLEKALSEESL  +RK ++G PI+F E EE+DTA+S+L
Sbjct  454   PNSTNKYKEDQKVHWHATPFEERLEKALSEESLGYKRKLVNGRPINFEENEETDTAVSRL  513



>ref|XP_010272277.1| PREDICTED: uncharacterized protein LOC104608095 isoform X3 [Nelumbo 
nucifera]
Length=524

 Score =   315 bits (806),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 202/464 (44%), Positives = 272/464 (59%), Gaps = 51/464 (11%)
 Frame = -3

Query  1570  SNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEF----DVKELKDQAKFLKACGT  1403
             ++R+ LSSL +SEE    K     +++E  + G+P  +     DV+ELKD+AKFLKACG 
Sbjct  53    ASRNQLSSLLLSEE----KEGFPCEDLENHNPGSPLPDVYGDGDVRELKDEAKFLKACGA  108

Query  1402  IPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQ-SPKPTKDCE  1226
             + ETP EIRK SEK +D + H+G+ +P  FHSWL  +SI+K      P+Q S  P K CE
Sbjct  109   LLETPAEIRKASEKIKDAAIHNGDSEPSNFHSWLPGASIKKLQWDEHPNQISISPVKLCE  168

Query  1225  DWVKESDSPVHT---------------------------PSSCMTFE-EKSNsptvisas  1130
             +  KESDS  HT                           PS+ +TF    S + T    +
Sbjct  169   ELGKESDSQNHTSVSSMPKGQELVGRDYTRHHECSEVENPSTAITFPLHPSTNETSALVT  228

Query  1129  pttvppstTCRQRSVRFDCkstksdmssalsksSFEVDSPN--SKASPYPTPLKLSDEMQ  956
             P     ++  + + VRF C+    ++ S            +  S++SPYPTPLKL+DEMQ
Sbjct  229   PEIPAIASESKNKCVRFKCELDTENLPSNGKSLKSNSSGRHNESESSPYPTPLKLTDEMQ  288

Query  955   TPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLL--  782
             TPGT++P ++D   NG   RIRSQYVY +LNP+EN SQ K +  ED  + Q+        
Sbjct  289   TPGTIYPVNLDKYGNGNNARIRSQYVYPVLNPVENFSQWKALKEEDFSTHQEQLGHTGDS  348

Query  781   FSDMGESVDLSSEANATSEIGL---RESSTENNLNVEASLSSWLKPSL-------RQSST  632
               ++  +V   +  + ++++ +   RE+       V+ASLS WLKPS        +    
Sbjct  349   LEEIASAVPEYASVSYSNKLEMEQERENMAVKESKVDASLSHWLKPSSPPKDDADQNCGV  408

Query  631   QPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWH  452
              P G S     + GDRPILGMVAAHWN+ E SR+S KWWDGNGIPNST+KYKEDQKV WH
Sbjct  409   FPGGRSYSSKTSDGDRPILGMVAAHWNDEEPSRISSKWWDGNGIPNSTNKYKEDQKVHWH  468

Query  451   ATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             ATPFEERLEKALSEESL  +RK ++G PI+F E EE+DTA+S+L
Sbjct  469   ATPFEERLEKALSEESLGYKRKLVNGRPINFEENEETDTAVSRL  512



>ref|XP_011100505.1| PREDICTED: uncharacterized protein LOC105178674 isoform X1 [Sesamum 
indicum]
Length=483

 Score =   313 bits (801),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 210/475 (44%), Positives = 281/475 (59%), Gaps = 56/475 (12%)
 Frame = -3

Query  1612  SKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKD  1433
             S+S   T  EPV S +R+ LSSLF   + D+E  SL   E  +        E  V ELKD
Sbjct  13    SRSNLITPPEPVVSRSRNALSSLF---QCDDE--SLGQGEEGRNPLPK---ELGVAELKD  64

Query  1432  QAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQ  1253
             +AKFLKACGT+P+TP+EIRK SEK +D+ A  GE    K  SWL ++SIEK  L  Q D+
Sbjct  65    EAKFLKACGTLPQTPIEIRKASEKWQDIPARIGEEKSSKLISWLPNASIEKLKLEKQSDE  124

Query  1252  SPKPTKDCEDWVKESDSPVHTPSSCMT-------------------------FEEKSNsp  1148
             SP+P K  E+ +      + +PSSC+T                           +     
Sbjct  125   SPRPVKIHEESLTGLGYSLDSPSSCLTDGHMGRVSSSSIQRRDIQNVFTALEVRDSETHS  184

Query  1147  tvisaspttvppstTCRQRSVRFDCkstk----------sdmssalsksSFEVDSPNSKA  998
                S SP    PS  C+ +SVRFD +S +             S    +  F      +K 
Sbjct  185   ETSSISPGFFAPSVQCKNKSVRFDSESDRSAFSSKGSSSEGASQHSKQPRFVGSRSVTKP  244

Query  997   SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
             SPYPTPLKL+DEMQTPGTVFP +++++   +  ++RSQYV+ +L+P++N SQ  E+ +E+
Sbjct  245   SPYPTPLKLTDEMQTPGTVFPAYMNDIGGEKVIKVRSQYVHPVLDPVKNPSQWNELKDEN  304

Query  817   sessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP-SLRQ  641
             S+S     S      + ++ +L+  +  TS++ +   S    +  EASLSSWLKP S +Q
Sbjct  305   SDSQHHRES------LKQNDELNLMSTPTSKLAVEHLSVGEEMKNEASLSSWLKPPSAKQ  358

Query  640   SSTQPFGGSI-----HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYK  476
                    GS+     +  +T  DRPILGMVAAHWN++E S VSPKWWDGNGIPNST+KYK
Sbjct  359   DGNNKQFGSVSGEKGYLRRTPADRPILGMVAAHWNDDEESHVSPKWWDGNGIPNSTNKYK  418

Query  475   EDQKVSWHATPFEERLEKALSEESLVSQRKRMSGS-PISFNETEESDTALSQLHN  314
             EDQKVSWHATPFEERLEKALSEE+ +SQRK +S + P+ F+E+EESDTALS L +
Sbjct  419   EDQKVSWHATPFEERLEKALSEETFISQRKPVSKTPPVDFSESEESDTALSHLQS  473



>ref|XP_007048948.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 4, partial [Theobroma cacao]
 gb|EOX93105.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 4, partial [Theobroma cacao]
Length=460

 Score =   311 bits (797),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 212/465 (46%), Positives = 274/465 (59%), Gaps = 70/465 (15%)
 Frame = -3

Query  1564  RSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPL  1385
             R+ LSSLF+    DEEK    S  +     G+P+++   K LKD+AKFLKACGTIPETP 
Sbjct  6     RNRLSSLFL----DEEKGDCPSNHL-----GSPQID---KGLKDEAKFLKACGTIPETPA  53

Query  1384  EIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESD  1205
             EIRK S + +      G+ +P KF SWL ++SI+K  L  Q DQ P P K  E   +  D
Sbjct  54    EIRKASRRFKQSPPCGGDSEPSKFQSWLPNTSIDKFQLDKQSDQPPTPIKLFEALERGPD  113

Query  1204  SPVHTPSSC----------MTFEEKSNs-ptvisaspttvppstTCRQRSVRFDCks-tk  1061
             S  +TP+S           M   E S +     +     V  S   R +SVRF+C+S   
Sbjct  114   SSENTPTSISNAANTGRFSMGSTEGSEALSVDKTVKIDIVSTSAYGRNKSVRFECESDAS  173

Query  1060  sdmssalsksSFEVDSPN----SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRI  893
             S  S    ++S +++ P     SK SP PTPLKLSDEMQTPGTVFP++++NLANG+  RI
Sbjct  174   SSKSENGGQNSKKLELPGYQSASKPSPNPTPLKLSDEMQTPGTVFPSNLENLANGKT-RI  232

Query  892   RSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLR  713
             RSQYVYS+LNP ENASQ+  +        +  +SK +  +  +S +    A     +G+ 
Sbjct  233   RSQYVYSVLNPAENASQLNVM------KEEPFSSKEMLGEPKKSPERPENAALKLGMGVE  286

Query  712   ESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH--------HGKTLGDRPILGMVAAH  557
              +S      VE SLSSWLKP  +Q++      +I          G+T GDRPI+GMVAAH
Sbjct  287   GTSRAEESEVEGSLSSWLKP--KQNNIDDRYKNIQSNYSKLPPFGRTPGDRPIIGMVAAH  344

Query  556   WNENETSRVSPKWWDGNGIPNSTHKYKE-------------------------DQKVSWH  452
             WNE E+S V+PKWWDGNGIPNST+KYKE                         DQKVSWH
Sbjct  345   WNEEESSHVTPKWWDGNGIPNSTNKYKEVNLFAGGIIFLQYRALLDECLSCLQDQKVSWH  404

Query  451   ATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLH  317
             ATPFEERLEKALS+ESL+SQ K ++ +P+ F+ET+ESDTALSQL 
Sbjct  405   ATPFEERLEKALSDESLISQSKHVNKTPMVFDETDESDTALSQLR  449



>ref|XP_008380179.1| PREDICTED: uncharacterized protein LOC103443161 isoform X2 [Malus 
domestica]
Length=480

 Score =   311 bits (796),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 206/463 (44%), Positives = 271/463 (59%), Gaps = 58/463 (13%)
 Frame = -3

Query  1627  RPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDV  1448
             RP  VS+S      E V S NR  LSSLF +EE    K    SK+ E    GTP+++   
Sbjct  47    RPHLVSQSSRNPQTEVVISQNR--LSSLFSAEE----KEGSPSKDWESGSYGTPQID---  97

Query  1447  KELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK-QNL  1271
             KEL+ +AKFLKACGTI ETP EIRK+S         D + +P KF+S L  +SI+  Q  
Sbjct  98    KELRKEAKFLKACGTIAETPAEIRKVSSTLNGSPHRDRDSEPPKFNSQLPKTSIKNLQQE  157

Query  1270  VSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEK-----------------SNsptv  1142
             + QPDQ P P K  E+W K S    HTPSS ++ ++                  S   + 
Sbjct  158   LDQPDQPPTPMKFNEEWGKGSGPSEHTPSSFVSNQQNNGRTTISSSGGSGIGTDSTVKSH  217

Query  1141  isaspttvppstTCRQRSVRFDCkstksdmssalsksSFEVDSPNSKASPYPTPLKLSDE  962
              + +     P    R ++VRFDC +                D+ +S+ S   +    +  
Sbjct  218   TNRTENITTPDVQFRGKAVRFDCNN----------------DTNSSRGS---SSENYNQS  258

Query  961   MQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLL  782
              +TPGTVFP +++N  NG+  RIRSQYVYS+ NP +  SQ   +        +D NS  L
Sbjct  259   SKTPGTVFPANLENFPNGK-ARIRSQYVYSVQNPGDGISQQNVL------KDEDPNSHGL  311

Query  781   FSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGG----S  614
               +  ES++    A   SE G ++ S+   +NVE+SLS+WLKP  + ++ Q FG     +
Sbjct  312   SVEQRESLNHWGNATPISEEGAKQISSGQEVNVESSLSTWLKPVTQDNNNQ-FGNVPGRT  370

Query  613   IHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEE  434
              H G+T GDRPI+G+VA HWNE+E +RVSPKWWDGNGIPNST+KYKEDQKVSWHATPFEE
Sbjct  371   RHFGRTPGDRPIIGLVATHWNEDEPTRVSPKWWDGNGIPNSTNKYKEDQKVSWHATPFEE  430

Query  433   RLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             RLEKALSEES +SQRK + G PI F+E +ESDTALSQL + +Q
Sbjct  431   RLEKALSEESFISQRKNIEGKPIVFDENDESDTALSQLQSSSQ  473



>ref|XP_010053987.1| PREDICTED: uncharacterized protein LOC104442300 [Eucalyptus grandis]
Length=489

 Score =   304 bits (779),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 204/467 (44%), Positives = 274/467 (59%), Gaps = 65/467 (14%)
 Frame = -3

Query  1576  ASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIP  1397
             A  +R+PL++LF+S+ N++       K+ E    G+P +    KEL+D+ KFLKACGT+ 
Sbjct  32    AVVSRNPLAALFLSDGNEDSPC----KDSESLVYGSPLIS---KELRDEGKFLKACGTLQ  84

Query  1396  ETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLV--SQPDQSPKPTKDCED  1223
             ETP+EIRK S +         + +  KFHSWL  SSIE+  L    Q + SP+P K  + 
Sbjct  85    ETPIEIRKASSRPMASPNKGRDSENSKFHSWLPVSSIERLQLEPNKQHELSPRPLKLSDK  144

Query  1222  WVKESDSPVHTPSSCMTFEE--------------------------KSNsptvisasptt  1121
             W K S+S  HT SSC+  E+                          + N     + SP+ 
Sbjct  145   WGKGSNSDEHTASSCILDEQNVGTSSISSSEGSWAFNIKTTGKHHKRQNDSIATALSPSK  204

Query  1120  vppstTCRQRSVRFDC---kstksdmssalsksSFE-VDSPN----SKASPYPTPLKLSD  965
                +  CR +SVRF+C    S   D +S ++  SFE  +SPN    S A P+PTP++L++
Sbjct  205   STVNAKCRNKSVRFECDVDGSLSRDSTSEIASRSFEESESPNVQNNSNAGPHPTPMRLTE  264

Query  964   EMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKL  785
             EMQTPGTVFP +++ L+  +  RIRS+YVYS+LNP+++ SQ K +++ +S         L
Sbjct  265   EMQTPGTVFPAYMEKLSPQK-ARIRSEYVYSVLNPVQSVSQWKSLMDGESNC------NL  317

Query  784   LFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP----------SLRQSS  635
             L  ++ +S +        SE+   E+S      VE SLSSWLKP            R  +
Sbjct  318   LLEELEDSSEQPGSTRKKSEMHFEETSARKESKVETSLSSWLKPPQNKWDDNDHKFRAVA  377

Query  634   TQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSW  455
             T+    S  HG T  DRPI+G+VAAHWNENET  + PKWWDGNGIPNST+KYKEDQKVSW
Sbjct  378   TR---KSQFHG-TPSDRPIIGLVAAHWNENETQTL-PKWWDGNGIPNSTNKYKEDQKVSW  432

Query  454   HATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHN  314
             HATPFEERLEKALSEES +SQRK+  G P++F   EESDTALS   N
Sbjct  433   HATPFEERLEKALSEESSLSQRKQPQGMPLTFERDEESDTALSHFRN  479



>ref|XP_007048946.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOX93103.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 2, partial [Theobroma cacao]
Length=503

 Score =   304 bits (778),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 210/441 (48%), Positives = 265/441 (60%), Gaps = 49/441 (11%)
 Frame = -3

Query  1639  DHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPEL  1460
             D  SRP  VS S   T  E   S NR  LSSLF+    DEEK    S  +     G+P++
Sbjct  42    DDRSRPHLVSSSSKST--ERGVSRNR--LSSLFL----DEEKGDCPSNHL-----GSPQI  88

Query  1459  EFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK  1280
             +   K LKD+AKFLKACGTIPETP EIRK S + +      G+ +P KF SWL ++SI+K
Sbjct  89    D---KGLKDEAKFLKACGTIPETPAEIRKASRRFKQSPPCGGDSEPSKFQSWLPNTSIDK  145

Query  1279  QNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSC----------MTFEEKSNs-ptvisa  1133
               L  Q DQ P P K  E   +  DS  +TP+S           M   E S +     + 
Sbjct  146   FQLDKQSDQPPTPIKLFEALERGPDSSENTPTSISNAANTGRFSMGSTEGSEALSVDKTV  205

Query  1132  spttvppstTCRQRSVRFDCks-tksdmssalsksSFEVDSPN----SKASPYPTPLKLS  968
                 V  S   R +SVRF+C+S   S  S    ++S +++ P     SK SP PTPLKLS
Sbjct  206   KIDIVSTSAYGRNKSVRFECESDASSSKSENGGQNSKKLELPGYQSASKPSPNPTPLKLS  265

Query  967   DEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSK  788
             DEMQTPGTVFP++++NLANG+  RIRSQYVYS+LNP ENASQ+  +        +  +SK
Sbjct  266   DEMQTPGTVFPSNLENLANGK-TRIRSQYVYSVLNPAENASQLNVM------KEEPFSSK  318

Query  787   LLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH  608
              +  +  +S +    A     +G+  +S      VE SLSSWLKP  +Q++      +I 
Sbjct  319   EMLGEPKKSPERPENAALKLGMGVEGTSRAEESEVEGSLSSWLKP--KQNNIDDRYKNIQ  376

Query  607   --------HGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWH  452
                      G+T GDRPI+GMVAAHWNE E+S V+PKWWDGNGIPNST+KYKEDQKVSWH
Sbjct  377   SNYSKLPPFGRTPGDRPIIGMVAAHWNEEESSHVTPKWWDGNGIPNSTNKYKEDQKVSWH  436

Query  451   ATPFEERLEKALSEESLVSQR  389
             ATPFEERLEKALS+ESL+SQR
Sbjct  437   ATPFEERLEKALSDESLISQR  457



>ref|XP_007048947.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 3, partial [Theobroma cacao]
 gb|EOX93104.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 3, partial [Theobroma cacao]
Length=452

 Score =   301 bits (771),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 199/416 (48%), Positives = 255/416 (61%), Gaps = 45/416 (11%)
 Frame = -3

Query  1564  RSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPL  1385
             R+ LSSLF+    DEEK    S  +     G+P+++   K LKD+AKFLKACGTIPETP 
Sbjct  6     RNRLSSLFL----DEEKGDCPSNHL-----GSPQID---KGLKDEAKFLKACGTIPETPA  53

Query  1384  EIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESD  1205
             EIRK S + +      G+ +P KF SWL ++SI+K  L  Q DQ P P K  E   +  D
Sbjct  54    EIRKASRRFKQSPPCGGDSEPSKFQSWLPNTSIDKFQLDKQSDQPPTPIKLFEALERGPD  113

Query  1204  SPVHTPSSC----------MTFEEKSNs-ptvisaspttvppstTCRQRSVRFDCks-tk  1061
             S  +TP+S           M   E S +     +     V  S   R +SVRF+C+S   
Sbjct  114   SSENTPTSISNAANTGRFSMGSTEGSEALSVDKTVKIDIVSTSAYGRNKSVRFECESDAS  173

Query  1060  sdmssalsksSFEVDSPN----SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRI  893
             S  S    ++S +++ P     SK SP PTPLKLSDEMQTPGTVFP++++NLANG+  RI
Sbjct  174   SSKSENGGQNSKKLELPGYQSASKPSPNPTPLKLSDEMQTPGTVFPSNLENLANGKT-RI  232

Query  892   RSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLR  713
             RSQYVYS+LNP ENASQ+  +        +  +SK +  +  +S +    A     +G+ 
Sbjct  233   RSQYVYSVLNPAENASQLNVM------KEEPFSSKEMLGEPKKSPERPENAALKLGMGVE  286

Query  712   ESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH--------HGKTLGDRPILGMVAAH  557
              +S      VE SLSSWLKP  +Q++      +I          G+T GDRPI+GMVAAH
Sbjct  287   GTSRAEESEVEGSLSSWLKP--KQNNIDDRYKNIQSNYSKLPPFGRTPGDRPIIGMVAAH  344

Query  556   WNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQR  389
             WNE E+S V+PKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+ESL+SQR
Sbjct  345   WNEEESSHVTPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSDESLISQR  400



>gb|EYU43169.1| hypothetical protein MIMGU_mgv1a005581mg [Erythranthe guttata]
Length=478

 Score =   302 bits (773),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 200/416 (48%), Positives = 251/416 (60%), Gaps = 55/416 (13%)
 Frame = -3

Query  1459  EFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK  1280
             E   +ELKD+AKFLKACGT+ ETP+EIR    +C D SA   EV P    ++   +SIEK
Sbjct  71    EVHARELKDEAKFLKACGTLLETPVEIRNALRECVDTSAQK-EVSP----NFSPSASIEK  125

Query  1279  QNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMT--------------------FEEK  1160
               L  Q D+SPKP K CE+WV  S S V   SS MT                        
Sbjct  126   LKLEKQSDESPKPVKICEEWVTGSGSLVDNSSSSMTDGNYTRRDSMNSIQSNDVENVVTP  185

Query  1159  SNsptvisaspttvppstTCRQRSVRFDCkstksdmssal--sksSFEVDSPNSKASPYP  986
             ++ P   + SP     S  C+ +SVRF+C+S  S  SS    + S    +S  SK SPYP
Sbjct  186   TDVPDNGTYSPEVFATSVKCKNKSVRFECQSDSSSFSSESSGTYSGSAGNSSVSKPSPYP  245

Query  985   TPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsess  806
             TPLKL+DEMQTPGT FPT ++NLA G+  R+RSQYVYS+LNPI+  SQ+KE         
Sbjct  246   TPLKLTDEMQTPGTAFPTFMNNLAGGKPNRVRSQYVYSVLNPIDYPSQLKE---------  296

Query  805   qdsnSKLLFSDMGESVDLSSEANATSEIGL----RESSTENNLNVEASLSSWLKPSL---  647
                   L    + ES   + EA +     L     E+S+  +   EASLSSWLKP+    
Sbjct  297   ------LEEDHLRESPKPNEEATSLLSPTLVRVTEENSSGKDCKNEASLSSWLKPTRLTN  350

Query  646   RQSSTQPFGG-SIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKED  470
                + +  G  ++H G + GDRPILGMVA HWN++ TS VSPKWWDGNGIPN+T+KYKED
Sbjct  351   EDGNMEQIGAENVHCGTSPGDRPILGMVAVHWNDDGTSHVSPKWWDGNGIPNTTNKYKED  410

Query  469   QKVSWHATPFEERLEKALSEESLVSQRKRMSGS----PISFNET-EESDTALSQLH  317
             QKVSWHATPFEERLEKALS+++++ QRK MSGS     I FNE+ EESDTA S++ 
Sbjct  411   QKVSWHATPFEERLEKALSDDTIIYQRKPMSGSGTPPKIEFNESEEESDTASSKVQ  466



>ref|XP_004305846.1| PREDICTED: uncharacterized protein LOC101295444 [Fragaria vesca 
subsp. vesca]
Length=616

 Score =   304 bits (779),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 207/481 (43%), Positives = 278/481 (58%), Gaps = 65/481 (14%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             SRP  VS S    A   V S NR  L+SLF+    D+EK    S++ E    GTP+ E  
Sbjct  155   SRPNLVSHSSRSGA---VVSQNR--LASLFL----DQEKGESPSRDKESPGYGTPQTE--  203

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
              K+LK++AKFLKACGTI ETP+EIRK S K      HD + +P KF+SWL ++SI+K   
Sbjct  204   -KDLKNEAKFLKACGTIVETPVEIRKAS-KFNGSPHHDRDSEPSKFNSWLPNTSIKKLQQ  261

Query  1270  VSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTC---  1100
              +QP+Q P P K  E W   S+   HTP S  + ++ +    + S   + +  +++    
Sbjct  262   ENQPEQPPTPVKLFEQWRTGSE---HTPISYESNQQSTGRSFLSSTEGSGIGTASSVKIH  318

Query  1099  ----------------------RQRSVRFDCkstksdmssalsksSFE----VDSPN---  1007
                                   R +SVRF+C    +    + S +        ++P    
Sbjct  319   SDRAENTVTPTSPSHSATDVQGRGKSVRFECDFDTASSKGSSSGNYSRSVKIAETPGKQG  378

Query  1006  -SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
              SK S YPTPL LS+EMQTPGTV+P+      NG+  RIRSQ+VYS   P E  S+    
Sbjct  379   TSKYSDYPTPLTLSEEMQTPGTVYPSGQGTFPNGK-SRIRSQFVYSFPYP-EGTSRWN--  434

Query  829   InedsessqdsnSKLLFSDMGESVDLSSEANAT--SEIGLRESSTENNLNVEASLSSWLK  656
                     ++ +S    S    SV L    NAT  SE G ++ S+   L VE+S+S+WL+
Sbjct  435   ------VPEEEDSNSHGSSFEPSVSLKQSGNATPISEEGKKDISSGKELQVESSMSAWLE  488

Query  655   PSLRQSSTQPFGGSI----HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNST  488
             P  +  +    G +     + G+T GDRPI+G+VA HWNE++++R+SPKWWDGNGIPNST
Sbjct  489   PVTQDDNNPNLGDASVRNRYFGRTPGDRPIIGLVATHWNEDDSTRISPKWWDGNGIPNST  548

Query  487   HKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGN  308
             +KYKEDQKVSWHATPFEERLEKALSEE+ +SQRK + G PI F+E EESDTALSQL + +
Sbjct  549   NKYKEDQKVSWHATPFEERLEKALSEETFISQRKNIEGMPIVFDENEESDTALSQLQSSS  608

Query  307   Q  305
             Q
Sbjct  609   Q  609



>ref|XP_004499969.1| PREDICTED: uncharacterized protein LOC101495785 isoform X2 [Cicer 
arietinum]
Length=471

 Score =   297 bits (760),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 201/455 (44%), Positives = 264/455 (58%), Gaps = 51/455 (11%)
 Frame = -3

Query  1579  VASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTI  1400
             V S NR  LSSLF+SEE  E+      K  ++        + D +ELKD+AKFLKACGTI
Sbjct  35    VVSRNR--LSSLFLSEEG-EDNVGHNGKNFDEGS------QRDDRELKDEAKFLKACGTI  85

Query  1399  PETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDW  1220
               TP +I+K SEK +   ++  +  P KF SWLLDSS +   +  QP   P P K CE+W
Sbjct  86    ASTPDKIQKASEKLKVSPSYSKDSGPPKFRSWLLDSSAQNVPIDVQPFNPPTPKKQCEEW  145

Query  1219  VKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTC--------------------  1100
              K ++   HTPSSC++    +++        T    S +C                    
Sbjct  146   EKRTECSDHTPSSCIS---NAHNTQWDHLDSTEGSGSGSCHPSDGTEMNMASVSPWPSTT  202

Query  1099  ----RQRSVRFDCkstksdmssalsksSFEVDSPNSKASPYPTPLKLSDEMQTPGTVFPT  932
                 R RS  F+C++  S   S+        ++     SP PTP+KLS+ MQTPGTV+P 
Sbjct  203   YTKERNRSTHFECETEISSCESSDYSGWHMKNT----ESPNPTPIKLSEGMQTPGTVYPA  258

Query  931   HVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDL  752
                 L NG+ P++ SQ+VY   +  E+ S+ K ++ E+   S   + KL      ES + 
Sbjct  259   ISKELPNGK-PQVMSQFVYPTSSLGEDISKSK-ILEEEEPISVQDSRKL-----SESSEQ  311

Query  751   SSEANATSEIGLRESSTENNLNVEASLSSWLKPS---LRQSSTQPFGGSIHHGKTLGDRP  581
             S  A +T + GL +   EN   VE SLSSWLKP+   L + S +   G IH  KT  DRP
Sbjct  312   SQNATSTPDKGLNKMPCENEFKVEESLSSWLKPASVILEERSKKMEMGYIHVRKTPADRP  371

Query  580   ILGMVAAHWNENETSRVSP-KWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEES  404
             I+GMVAAHW E+E S V P KWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEE+
Sbjct  372   IIGMVAAHWIEDEHSDVPPPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEET  431

Query  403   LVSQRKRMSGSPISFNETEESDTALSQLHNGNQSH  299
             ++S+RK + G PI+F+E+EESDTALSQL +   S 
Sbjct  432   VISKRKDVCGKPIAFDESEESDTALSQLKSSTHSQ  466



>ref|XP_004499968.1| PREDICTED: uncharacterized protein LOC101495785 isoform X1 [Cicer 
arietinum]
Length=472

 Score =   296 bits (759),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 201/455 (44%), Positives = 264/455 (58%), Gaps = 51/455 (11%)
 Frame = -3

Query  1579  VASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTI  1400
             V S NR  LSSLF+SEE  E+      K  ++        + D +ELKD+AKFLKACGTI
Sbjct  36    VVSRNR--LSSLFLSEEG-EDNVGHNGKNFDEGS------QRDDRELKDEAKFLKACGTI  86

Query  1399  PETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDW  1220
               TP +I+K SEK +   ++  +  P KF SWLLDSS +   +  QP   P P K CE+W
Sbjct  87    ASTPDKIQKASEKLKVSPSYSKDSGPPKFRSWLLDSSAQNVPIDVQPFNPPTPKKQCEEW  146

Query  1219  VKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTC--------------------  1100
              K ++   HTPSSC++    +++        T    S +C                    
Sbjct  147   EKRTECSDHTPSSCIS---NAHNTQWDHLDSTEGSGSGSCHPSDGTEMNMASVSPWPSTT  203

Query  1099  ----RQRSVRFDCkstksdmssalsksSFEVDSPNSKASPYPTPLKLSDEMQTPGTVFPT  932
                 R RS  F+C++  S   S+        ++     SP PTP+KLS+ MQTPGTV+P 
Sbjct  204   YTKERNRSTHFECETEISSCESSDYSGWHMKNT----ESPNPTPIKLSEGMQTPGTVYPA  259

Query  931   HVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDL  752
                 L NG+ P++ SQ+VY   +  E+ S+ K ++ E+   S   + KL      ES + 
Sbjct  260   ISKELPNGK-PQVMSQFVYPTSSLGEDISKSK-ILEEEEPISVQDSRKL-----SESSEQ  312

Query  751   SSEANATSEIGLRESSTENNLNVEASLSSWLKPS---LRQSSTQPFGGSIHHGKTLGDRP  581
             S  A +T + GL +   EN   VE SLSSWLKP+   L + S +   G IH  KT  DRP
Sbjct  313   SQNATSTPDKGLNKMPCENEFKVEESLSSWLKPASVILEERSKKMEMGYIHVRKTPADRP  372

Query  580   ILGMVAAHWNENETSRVSP-KWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEES  404
             I+GMVAAHW E+E S V P KWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEE+
Sbjct  373   IIGMVAAHWIEDEHSDVPPPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEET  432

Query  403   LVSQRKRMSGSPISFNETEESDTALSQLHNGNQSH  299
             ++S+RK + G PI+F+E+EESDTALSQL +   S 
Sbjct  433   VISKRKDVCGKPIAFDESEESDTALSQLKSSTHSQ  467



>ref|XP_009356597.1| PREDICTED: uncharacterized protein LOC103947410 isoform X2 [Pyrus 
x bretschneideri]
Length=480

 Score =   296 bits (758),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 200/464 (43%), Positives = 274/464 (59%), Gaps = 58/464 (13%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             SRP  VS+S      E V S NR  LSSLF++EE  +E S ++ +E       +P+++  
Sbjct  46    SRPHLVSQSSRNPQTEVVISQNR--LSSLFLAEE--KEGSPIEDRE--SASYVSPQID--  97

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK-QN  1274
              KE +++AKFLKACGTI ETP EIRK+S +       D + +P KF+S L ++SI+  Q 
Sbjct  98    -KERRNEAKFLKACGTIAETPAEIRKVSSRLNGSPHRDRDSEPPKFNSQLPNTSIKNLQQ  156

Query  1273  LVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEK-----------------SNspt  1145
              + QPDQ P P K  E+W K S     TPSS ++ ++                  S   +
Sbjct  157   ELDQPDQPPTPMKFNEEWGKGSGPSEQTPSSFVSNQQNNGRTTISSSGGSGIGTDSTVKS  216

Query  1144  visaspttvppstTCRQRSVRFDCkstksdmssalsksSFEVDSPNSKASPYPTPLKLSD  965
               + +     P    R ++VRFDC +                D+ +S+ S      + S 
Sbjct  217   HTNRTENITTPDVQFRSKAVRFDCNN----------------DTNSSRGSSSENYNQCS-  259

Query  964   EMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKL  785
               +TPGTVFP +++N  NG+  RIRSQYVYS+ NP +  SQ   +        +D NS  
Sbjct  260   --KTPGTVFPANLENFPNGK-ARIRSQYVYSVQNPGDGISQQNVL------KDEDPNSHG  310

Query  784   LFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFG----G  617
             L  +  ES++    A   S+   ++ S+   +NVE+SLS+WLKP  + ++ Q FG     
Sbjct  311   LSVEQRESLNHWGNATPISKERAKQISSGQEVNVESSLSTWLKPVTQDNNNQ-FGYVPSQ  369

Query  616   SIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFE  437
             + H G+T GDRPI+G+VA HWNE++ +RVSPKWWDGNGIPNST+KYKEDQKVSWHATPFE
Sbjct  370   TRHFGRTPGDRPIIGLVATHWNEDKPTRVSPKWWDGNGIPNSTNKYKEDQKVSWHATPFE  429

Query  436   ERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             ERLEKALSEES +SQRK + G PI F+E +ESDTALSQL + +Q
Sbjct  430   ERLEKALSEESFISQRKNIEGKPIVFDENDESDTALSQLQSSSQ  473



>ref|XP_008451829.1| PREDICTED: uncharacterized protein LOC103492999 [Cucumis melo]
Length=447

 Score =   288 bits (738),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 204/467 (44%), Positives = 261/467 (56%), Gaps = 90/467 (19%)
 Frame = -3

Query  1645  PSDHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTP  1466
             P  H    P  SK   P  A       R+ LSSLF+SEEN+E       K+   +  G+P
Sbjct  44    PRSHLVSEPPCSKYRAPVVA-------RNQLSSLFLSEENEESPK----KDSGSKSFGSP  92

Query  1465  ELEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSI  1286
                   KEL D+AKFLKACG I ETP EIRK S K  + S                    
Sbjct  93    RY---TKELMDEAKFLKACGAIVETPAEIRKTSRKLSNASL-------------------  130

Query  1285  EKQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEE---------KSNsptvisa  1133
                                     ES S   +PSSC+T E+         + +     +A
Sbjct  131   ------------------------ESGSAERSPSSCITGEQTQRVSAQHIEGSENGSEAA  166

Query  1132  spttvppstTCRQRSVRFDCkstksdmssalsksSFEVDSPNS-------KASPYPTPLK  974
               +     TTCR +SVRF+C   +S   S+      +V   +S       K+SPYPTPL+
Sbjct  167   LSSPDNMMTTCRSKSVRFECDINESPSRSSSGSGREKVKGFDSLGNRSVSKSSPYPTPLQ  226

Query  973   LSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsn  794
             LSDEMQTPGTVFP    NL +G+  RIRSQYVYS++NP+E+A+Q+K +        +DSN
Sbjct  227   LSDEMQTPGTVFPA---NLDHGK-ARIRSQYVYSVMNPVESAAQLKAL------KEEDSN  276

Query  793   SKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP-SLRQSSTQPFGG  617
              + +  +MGESV+         E  +R ++ E +L VEASLS+WLKP S     ++ FG 
Sbjct  277   LEGVSKEMGESVEELEMMTPMPERNVRANAREKDLMVEASLSAWLKPVSTHDDDSKKFGA  336

Query  616   ---SIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHAT  446
                SI  GK+ GDRPI+GMVAAHWNE+E  +VSPK WDGNGIPNST+KYKEDQKVSWHAT
Sbjct  337   AHRSIRVGKSAGDRPIIGMVAAHWNEDEPIQVSPKEWDGNGIPNSTNKYKEDQKVSWHAT  396

Query  445   PFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             PFEERLEKALSEES+V+ RK   G  ++F+  EE DTA+S+L +  Q
Sbjct  397   PFEERLEKALSEESIVT-RKNFQGKLVAFD--EEDDTAVSRLQSSIQ  440



>ref|XP_007048949.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 5 [Theobroma cacao]
 gb|EOX93106.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
isoform 5 [Theobroma cacao]
Length=573

 Score =   288 bits (736),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 214/475 (45%), Positives = 270/475 (57%), Gaps = 75/475 (16%)
 Frame = -3

Query  1639  DHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPEL  1460
             D  SRP  VS S   T  E   S NR  LSSLF+    DEEK    S  +     G+P++
Sbjct  42    DDRSRPHLVSSSSKST--ERGVSRNR--LSSLFL----DEEKGDCPSNHL-----GSPQI  88

Query  1459  EFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEK  1280
             +   K LKD+AKFLKACGTIPETP EIRK S + +      G+ +P KF SWL ++SI+K
Sbjct  89    D---KGLKDEAKFLKACGTIPETPAEIRKASRRFKQSPPCGGDSEPSKFQSWLPNTSIDK  145

Query  1279  QNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSC----------MTFEEKSNsptvisas  1130
               L  Q DQ P P K  E   +  DS  +TP+S           M   E S + +V    
Sbjct  146   FQLDKQSDQPPTPIKLFEALERGPDSSENTPTSISNAANTGRFSMGSTEGSEALSVDKTV  205

Query  1129  pt-tvppstTCRQRSVRFDCks-tksdmssalsksSFEVDSPN----SKASPYPTPLKLS  968
                 V  S   R +SVRF+C+S   S  S    ++S +++ P     SK SP PTPLKLS
Sbjct  206   KIDIVSTSAYGRNKSVRFECESDASSSKSENGGQNSKKLELPGYQSASKPSPNPTPLKLS  265

Query  967   DEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSK  788
             DEMQTPGTVFP++++NLANG+  RIRSQYVYS+LNP ENASQ+  +        +  +SK
Sbjct  266   DEMQTPGTVFPSNLENLANGK-TRIRSQYVYSVLNPAENASQLNVM------KEEPFSSK  318

Query  787   LLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH  608
              +  +  +S +    A     +G+  +S      VE SLSSWLKP  +Q++      +I 
Sbjct  319   EMLGEPKKSPERPENAALKLGMGVEGTSRAEESEVEGSLSSWLKP--KQNNIDDRYKNIQ  376

Query  607   --------HGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKE-------  473
                      G+T GDRPI+GMVAAHWNE E+S V+PKWWDGNGIPNST+KYKE       
Sbjct  377   SNYSKLPPFGRTPGDRPIIGMVAAHWNEEESSHVTPKWWDGNGIPNSTNKYKEVNLFAGG  436

Query  472   ------------------DQKVSWHATPFEERLEKALSEESLVSQRKR-MSGSPI  365
                               DQKVSWHATPFEERLEKALS+ESL+SQR   +S  PI
Sbjct  437   IIFLQYRALLDECLSCLQDQKVSWHATPFEERLEKALSDESLISQRYACLSALPI  491



>ref|XP_004147749.1| PREDICTED: uncharacterized protein LOC101215061 [Cucumis sativus]
 ref|XP_004161553.1| PREDICTED: uncharacterized protein LOC101223561 [Cucumis sativus]
 gb|KGN53516.1| hypothetical protein Csa_4G063990 [Cucumis sativus]
Length=448

 Score =   283 bits (724),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 197/455 (43%), Positives = 263/455 (58%), Gaps = 66/455 (15%)
 Frame = -3

Query  1636  HASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELE  1457
             H  R   +S        EPV + N+  LSSLF+SEEN++       K+   +  G+P   
Sbjct  42    HRPRSHLLSDPPCSKYGEPVVARNQ--LSSLFLSEENEDSPK----KDSGSKSFGSPRY-  94

Query  1456  FDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQ  1277
                KEL D+AKFLKACG I ETP EIRK S K  + S   G  +         + + E+ 
Sbjct  95    --TKELMDEAKFLKACGAIVETPAEIRKTSRKLSNASLESGSAERSPSSCITGEQNTERV  152

Query  1276  NLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTCR  1097
                     S +  +  ED    S++ +++P + MT                      TCR
Sbjct  153   --------SAQHIEGSEDG---SEAALNSPDNVMT----------------------TCR  179

Query  1096  QRSVRFDCkstksdmssalsksSFEV-------DSPNSKASPYPTPLKLSDEMQTPGTVF  938
              + VRF+C   +S   S+      +V       +   SK+SPYPTPL+LSDEMQTPGTVF
Sbjct  180   SKFVRFECDINESPSRSSSGSGREKVQGFALSGNRSVSKSSPYPTPLQLSDEMQTPGTVF  239

Query  937   PTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESV  758
             P    NL +G+  RIRSQYVYS++NP+E+A+Q+K +        +DSN + +  +MGESV
Sbjct  240   PA---NLDHGK-ARIRSQYVYSVMNPVESAAQLKAL------KEEDSNLEGVSKEMGESV  289

Query  757   DLSSEANATSEIGLRESSTENNLNVEASLSSWLKP-SLRQSSTQPFGGS---IHHGKTLG  590
             +         E  +R ++ E +L VEASLS+WLKP S      + FG +   I  GK+ G
Sbjct  290   EELEMMTPMPERNVRTNTREKDLMVEASLSAWLKPVSTHDDDGKKFGAADRPIRVGKSAG  349

Query  589   DRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSE  410
             DRPI+GMVAAHWNE+E  ++SPK WDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSE
Sbjct  350   DRPIIGMVAAHWNEDEPIQISPKEWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSE  409

Query  409   ESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             ES+V+ RK   G  ++F+  EE DTA+S+L +  Q
Sbjct  410   ESIVT-RKNFQGKLVAFD--EEDDTAVSRLQSSIQ  441



>ref|XP_010557153.1| PREDICTED: uncharacterized protein LOC104826243 [Tarenaya hassleriana]
Length=503

 Score =   283 bits (725),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 194/459 (42%), Positives = 259/459 (56%), Gaps = 67/459 (15%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LS+LF+SEE         S   EK    +  +  D K LKD+A+FLKACGTIPETP+EIR
Sbjct  65    LSALFMSEEK------AASPRPEKDGFDSDFIHID-KGLKDEARFLKACGTIPETPMEIR  117

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K S+K +D   H+ +    +FHSW+   S  K  +  + ++ P P K CE+ V+ + +  
Sbjct  118   KASKK-QDTPEHERDSGSSQFHSWISSGSAVKFRMDEKNEEPPTPLKVCEELVQHTVTSE  176

Query  1195  HTPSSCMTFEEKSNsptvisasptt----------------------vppstTCRQRSVR  1082
              TPSSC+T    S   +  S+                               + R ++VR
Sbjct  177   QTPSSCVTNPPNSGRISSGSSDAGEEGLGSIGTEFRGEMDRTCRPTPAAGKVSGRIKTVR  236

Query  1081  FDC-----------kstksdmssalsksSFEVDSPNSKASPYPTPLKLSDEMQTPGTVFP  935
             F+C             + S  +  ++K++F   SPN      PTPLKLSDEMQTPGT+FP
Sbjct  237   FECDFDQPYFSGSSHGSSSGNTEMIAKTNFVATSPN------PTPLKLSDEMQTPGTIFP  290

Query  934   THVDNLANGRF-PRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESV  758
              +++  + GR  PRIRSQ+VY +  PIENAS  K     +        +K+   D  E +
Sbjct  291   ANLE--STGRVKPRIRSQFVYPVSKPIENASLSK---VPEESDGSQERAKVQVCD--EQI  343

Query  757   DLSSEANATSEIGLR---ESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHH----GK  599
             ++ +    ++E+G R   ESS E  L VEAS S WLK  +++ S++      H       
Sbjct  344   EVGT---PSAELGRRKGEESSREKGLKVEASFSPWLK-RVKEDSSENVAAFSHRTPRVAM  399

Query  598   TLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKA  419
             T GDRPI+GMVAAHWN  + S+ SPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKA
Sbjct  400   TPGDRPIIGMVAAHWNAEQLSQNSPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKA  459

Query  418   LSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             LSEES +SQRKR SG  +   E  E DTA+SQL +  +S
Sbjct  460   LSEESFISQRKRYSGG-VRAMEEAEGDTAMSQLQHSAES  497



>ref|XP_010035944.1| PREDICTED: uncharacterized protein LOC104425065 isoform X1 [Eucalyptus 
grandis]
 gb|KCW47453.1| hypothetical protein EUGRSUZ_K01238 [Eucalyptus grandis]
Length=518

 Score =   283 bits (724),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 202/470 (43%), Positives = 265/470 (56%), Gaps = 70/470 (15%)
 Frame = -3

Query  1591  AAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKA  1412
             AAE + S NR  L+SLF+    DE++  ++ +++E +  G+P +  DVK   D+AKFLKA
Sbjct  60    AAEALGSRNR--LASLFL----DEDREDIRGEDLENRAFGSPHISKDVK---DEAKFLKA  110

Query  1411  CGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKD  1232
             CGTIPETP EIRK ++K      + G+ +  +FHSWL  +SI K  L    + SP P K 
Sbjct  111   CGTIPETPAEIRKATDKFMFSPPNHGDSESSEFHSWLPHTSIRKLQLTKPTEVSPTPVKL  170

Query  1231  CEDWVKESDSPVHTPSSCM-----TF-----------EEKSNsptvisaspttvpps---  1109
               D   +S S  H P+SC      TF           EE +N  T I A   +   +   
Sbjct  171   FVDSGSDSASQEHAPTSCKSNVESTFSIPLNSTEGSSEENTNMATEILAVENSSISTPIT  230

Query  1108  -------tTCRQRSVRFDCkstksdmssalsksSFEVDSPNS-------------KASPY  989
                    T  R +SV FD      D      +SSF  D+ +S             K SPY
Sbjct  231   PWPSTSHTQYRSKSVHFD-----PDADICSLRSSFTKDASHSIKDSELLGNQSTVKPSPY  285

Query  988   PTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedses  809
             PTPLKLSDEMQTPGTVFP +++NL  G+ PRIRS+Y+YS+ N  +N  Q+K    ED+++
Sbjct  286   PTPLKLSDEMQTPGTVFPANMENLPYGK-PRIRSEYIYSVPNSYQNNMQLKGFKEEDADN  344

Query  808   sqdsnSKLLFSDMGESVDLSSEANATSEIGLRESST--ENNLNVEASLSSWLKPSLRQSS  635
              +          + ES  L+   N T   G R   T        E +LS+WLKP L+  +
Sbjct  345   HRP------LGQLNES--LAQPVNETLNRGTRLDKTPLGQGFEGETTLSAWLKPPLQMEN  396

Query  634   TQPFGGSI-----HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKED  470
                  GS+      H ++  DRPI+G+VAAHW E+E S V  KWWDGNGIPNST+KYKED
Sbjct  397   DGSKFGSVSYRKTRHSRSPTDRPIIGLVAAHWKEDEQSHVPQKWWDGNGIPNSTNKYKED  456

Query  469   QKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             QKVSWHATPFEERLEKALSEE+ VS RK +SG+ +   E  + DTA+SQL
Sbjct  457   QKVSWHATPFEERLEKALSEETFVSVRKNLSGASVPV-EDADGDTAVSQL  505



>ref|XP_011100506.1| PREDICTED: uncharacterized protein LOC105178674 isoform X2 [Sesamum 
indicum]
Length=471

 Score =   281 bits (718),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 201/475 (42%), Positives = 269/475 (57%), Gaps = 68/475 (14%)
 Frame = -3

Query  1612  SKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKD  1433
             S+S   T  EPV S +R+ LSSLF   + D+E  SL   E  +        E  V ELKD
Sbjct  13    SRSNLITPPEPVVSRSRNALSSLF---QCDDE--SLGQGEEGRNPLPK---ELGVAELKD  64

Query  1432  QAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQ  1253
                         ETP+EIRK SEK +D+ A  GE    K  SWL ++SIEK  L  Q D+
Sbjct  65    ------------ETPIEIRKASEKWQDIPARIGEEKSSKLISWLPNASIEKLKLEKQSDE  112

Query  1252  SPKPTKDCEDWVKESDSPVHTPSSCMT-------------------------FEEKSNsp  1148
             SP+P K  E+ +      + +PSSC+T                           +     
Sbjct  113   SPRPVKIHEESLTGLGYSLDSPSSCLTDGHMGRVSSSSIQRRDIQNVFTALEVRDSETHS  172

Query  1147  tvisaspttvppstTCRQRSVRFDCkstk----------sdmssalsksSFEVDSPNSKA  998
                S SP    PS  C+ +SVRFD +S +             S    +  F      +K 
Sbjct  173   ETSSISPGFFAPSVQCKNKSVRFDSESDRSAFSSKGSSSEGASQHSKQPRFVGSRSVTKP  232

Query  997   SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
             SPYPTPLKL+DEMQTPGTVFP +++++   +  ++RSQYV+ +L+P++N SQ  E+ +E+
Sbjct  233   SPYPTPLKLTDEMQTPGTVFPAYMNDIGGEKVIKVRSQYVHPVLDPVKNPSQWNELKDEN  292

Query  817   sessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP-SLRQ  641
             S+S     S      + ++ +L+  +  TS++ +   S    +  EASLSSWLKP S +Q
Sbjct  293   SDSQHHRES------LKQNDELNLMSTPTSKLAVEHLSVGEEMKNEASLSSWLKPPSAKQ  346

Query  640   SSTQPFGGSI-----HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYK  476
                    GS+     +  +T  DRPILGMVAAHWN++E S VSPKWWDGNGIPNST+KYK
Sbjct  347   DGNNKQFGSVSGEKGYLRRTPADRPILGMVAAHWNDDEESHVSPKWWDGNGIPNSTNKYK  406

Query  475   EDQKVSWHATPFEERLEKALSEESLVSQRKRMSGS-PISFNETEESDTALSQLHN  314
             EDQKVSWHATPFEERLEKALSEE+ +SQRK +S + P+ F+E+EESDTALS L +
Sbjct  407   EDQKVSWHATPFEERLEKALSEETFISQRKPVSKTPPVDFSESEESDTALSHLQS  461



>ref|XP_010035945.1| PREDICTED: uncharacterized protein LOC104425065 isoform X2 [Eucalyptus 
grandis]
 gb|KCW47454.1| hypothetical protein EUGRSUZ_K01238 [Eucalyptus grandis]
Length=515

 Score =   280 bits (715),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 201/470 (43%), Positives = 263/470 (56%), Gaps = 73/470 (16%)
 Frame = -3

Query  1591  AAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKA  1412
             AAE + S NR  L+SLF+ E+       ++ +++E +  G+P +  DVK   D+AKFLKA
Sbjct  60    AAEALGSRNR--LASLFLDED-------IRGEDLENRAFGSPHISKDVK---DEAKFLKA  107

Query  1411  CGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKD  1232
             CGTIPETP EIRK ++K      + G+ +  +FHSWL  +SI K  L    + SP P K 
Sbjct  108   CGTIPETPAEIRKATDKFMFSPPNHGDSESSEFHSWLPHTSIRKLQLTKPTEVSPTPVKL  167

Query  1231  CEDWVKESDSPVHTPSSCM-----TF-----------EEKSNsptvisaspttvpps---  1109
               D   +S S  H P+SC      TF           EE +N  T I A   +   +   
Sbjct  168   FVDSGSDSASQEHAPTSCKSNVESTFSIPLNSTEGSSEENTNMATEILAVENSSISTPIT  227

Query  1108  -------tTCRQRSVRFDCkstksdmssalsksSFEVDSPNS-------------KASPY  989
                    T  R +SV FD      D      +SSF  D+ +S             K SPY
Sbjct  228   PWPSTSHTQYRSKSVHFD-----PDADICSLRSSFTKDASHSIKDSELLGNQSTVKPSPY  282

Query  988   PTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedses  809
             PTPLKLSDEMQTPGTVFP +++NL  G+ PRIRS+Y+YS+ N  +N  Q+K    ED+++
Sbjct  283   PTPLKLSDEMQTPGTVFPANMENLPYGK-PRIRSEYIYSVPNSYQNNMQLKGFKEEDADN  341

Query  808   sqdsnSKLLFSDMGESVDLSSEANATSEIGLRESST--ENNLNVEASLSSWLKPSLRQSS  635
              +          + ES  L+   N T   G R   T        E +LS+WLKP L+  +
Sbjct  342   HRP------LGQLNES--LAQPVNETLNRGTRLDKTPLGQGFEGETTLSAWLKPPLQMEN  393

Query  634   TQPFGGSI-----HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKED  470
                  GS+      H ++  DRPI+G+VAAHW E+E S V  KWWDGNGIPNST+KYKED
Sbjct  394   DGSKFGSVSYRKTRHSRSPTDRPIIGLVAAHWKEDEQSHVPQKWWDGNGIPNSTNKYKED  453

Query  469   QKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             QKVSWHATPFEERLEKALSEE+ VS RK +SG+ +   E  + DTA+SQL
Sbjct  454   QKVSWHATPFEERLEKALSEETFVSVRKNLSGASVPV-EDADGDTAVSQL  502



>ref|XP_011085649.1| PREDICTED: uncharacterized protein LOC105167573 [Sesamum indicum]
Length=497

 Score =   276 bits (707),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 264/466 (57%), Gaps = 63/466 (14%)
 Frame = -3

Query  1603  LTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAK  1424
             L PTA       N++ LSSLF+S++    K           +   P  E  V+ELKD+AK
Sbjct  47    LIPTA------HNKNALSSLFLSDDGSLRKGG---------EGLNPLHEDHVRELKDEAK  91

Query  1423  FLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPK  1244
             FLKACGT+ ETP+EIRK S K   LS    E + L F+SWL ++SIEK  L +QPD+SP+
Sbjct  92    FLKACGTLLETPVEIRKASRKF--LSTQYKEDESLNFNSWLPNASIEKLKLENQPDESPE  149

Query  1243  PTKDCEDWVKESDSPVHTPSSCMT--------------------------FEEKSNsptv  1142
             P    E     + S V +PSSCMT                            +     + 
Sbjct  150   PVIISE--ALGAGSSVDSPSSCMTDGHNTRRDSVISNASSDIQTVITPIDVPDDETHSSA  207

Query  1141  isaspttvppstTCRQRSVRFDCkstksdmssalsksSFEVDSPN----SKASPYPTPLK  974
             IS+       +  C+ +SVRF+C+S     S++ S+      S      +K SPYPTPLK
Sbjct  208   ISSVSPEDVANVPCKNKSVRFECESDSPASSASSSQHPKLSGSAGKCCVAKVSPYPTPLK  267

Query  973   LSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsn  794
             L+DEM+TPGTVFP ++ ++A  +  RIRSQYV   L+ +E  SQ  E         ++S+
Sbjct  268   LTDEMETPGTVFPAYLHDMAGRKSTRIRSQYV-PFLDRVEYPSQWNEA------KDENSD  320

Query  793   SKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSL--RQSSTQPFG  620
                L      + + + ++     + + + S   +   E S SSWLKP L    S+ + FG
Sbjct  321   PNHLRGPFEPNDEAALKSTPVLSMLMEDLSVVKDTKDEVSSSSWLKPYLPNHDSNNEQFG  380

Query  619   ----GSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWH  452
                  ++H   T GDRPILG+VAAHWN++ETS +SPKWWDGNGIPNST+KYKEDQKVSWH
Sbjct  381   PTSSKNVHSCPTPGDRPILGLVAAHWNDDETSCISPKWWDGNGIPNSTNKYKEDQKVSWH  440

Query  451   ATPFEERLEKALSEESLVSQRKRMSGS-PISFNETEESDTALSQLH  317
             ATPFE RLEKALSEE+ + +RK ++G+ P+  NE +ESDTA S L 
Sbjct  441   ATPFEVRLEKALSEETFIPRRKPIAGTPPLHLNEADESDTASSGLQ  486



>gb|KEH33680.1| hypothetical protein MTR_3g450760 [Medicago truncatula]
Length=439

 Score =   270 bits (691),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 180/429 (42%), Positives = 244/429 (57%), Gaps = 49/429 (11%)
 Frame = -3

Query  1573  SSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPE  1394
             +++R+ LS+LF++EE +E+      +  E+        + D ++LKD+AKFLKACGTI  
Sbjct  37    ATSRNRLSTLFLTEEGEEDNVHRNGRNFEEGS------QNDDRQLKDEAKFLKACGTIAS  90

Query  1393  TPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVK  1214
             TP EIRK SEK +   +   +  P KF SWLLD+S E      QP   P P K CE+W K
Sbjct  91    TPAEIRKASEKLKVSPSCSNDSGPPKFRSWLLDTSAENVPTNVQPFNPPTPKKQCEEWEK  150

Query  1213  ESDSPVHTPSSCMTFEEK-------SNsptvisaspttvppstTCRQRSVRFDCkstksd  1055
              +D   HTPSSC++           S+  +   +           R +SVRF+C +  S 
Sbjct  151   RTDCSDHTPSSCISNAHNTQWEYHDSSEGSGQGSYHPIDGTENKGRNKSVRFECDNDISS  210

Query  1054  mssalsksSFEVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVY  875
               S+         +     SP PTP+K+S+EMQTPGTV+P              +SQ+VY
Sbjct  211   CESSAYGGWHTKKT----ESPNPTPMKISNEMQTPGTVYPA-------------KSQFVY  253

Query  874   SILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTEN  695
               ++  E+ S+ K ++ E+      ++ K     M +S++ S     TS     ES+   
Sbjct  254   PNISLGEDVSKSK-ILEEEDYVPAQNSRK-----MNKSIEQSQN---TSTPDKSEST---  301

Query  694   NLNVEASLSSWLKPS---LRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSP  524
                VE  LSSWLKP+   L +   +         KT  DRPI+GMVAAHW E+E S   P
Sbjct  302   ---VEEGLSSWLKPASVILEERRKKMEMAYNQTRKTPDDRPIIGMVAAHWIEDENSDAPP  358

Query  523   -KWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETE  347
              KWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSE+++++QRK + G PI+F+E E
Sbjct  359   PKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEDTIIAQRKDICGKPIAFDENE  418

Query  346   ESDTALSQL  320
             ESDTALS L
Sbjct  419   ESDTALSHL  427



>gb|KCW89771.1| hypothetical protein EUGRSUZ_A02029 [Eucalyptus grandis]
Length=392

 Score =   259 bits (663),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 224/381 (59%), Gaps = 58/381 (15%)
 Frame = -3

Query  1318  KFHSWLLDSSIEKQNLV--SQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEE------  1163
             KFHSWL  SSIE+  L    Q + SP+P K  + W K S+S  HT SSC+  E+      
Sbjct  14    KFHSWLPVSSIERLQLEPNKQHELSPRPLKLSDKWGKGSNSDEHTASSCILDEQNVGTSS  73

Query  1162  --------------------KSNsptvisaspttvppstTCRQRSVRFDC---kstksdm  1052
                                 + N     + SP+    +  CR +SVRF+C    S   D 
Sbjct  74    ISSSEGSWAFNIKTTGKHHKRQNDSIATALSPSKSTVNAKCRNKSVRFECDVDGSLSRDS  133

Query  1051  ssalsksSFE-VDSPN----SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRS  887
             +S ++  SFE  +SPN    S A P+PTP++L++EMQTPGTVFP +++ L+  +  RIRS
Sbjct  134   TSEIASRSFEESESPNVQNNSNAGPHPTPMRLTEEMQTPGTVFPAYMEKLSPQK-ARIRS  192

Query  886   QYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRES  707
             +YVYS+LNP+++ SQ K +++ +S         LL  ++ +S +        SE+   E+
Sbjct  193   EYVYSVLNPVQSVSQWKSLMDGESNC------NLLLEELEDSSEQPGSTRKKSEMHFEET  246

Query  706   STENNLNVEASLSSWLKP----------SLRQSSTQPFGGSIHHGKTLGDRPILGMVAAH  557
             S      VE SLSSWLKP            R  +T+    S  HG T  DRPI+G+VAAH
Sbjct  247   SARKESKVETSLSSWLKPPQNKWDDNDHKFRAVATR---KSQFHG-TPSDRPIIGLVAAH  302

Query  556   WNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMS  377
             WNENET  + PKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEES +SQRK+  
Sbjct  303   WNENETQTL-PKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEESSLSQRKQPQ  361

Query  376   GSPISFNETEESDTALSQLHN  314
             G P++F   EESDTALS   N
Sbjct  362   GMPLTFERDEESDTALSHFRN  382



>ref|XP_010522057.1| PREDICTED: uncharacterized protein LOC104800816 isoform X2 [Tarenaya 
hassleriana]
Length=496

 Score =   263 bits (671),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 194/460 (42%), Positives = 247/460 (54%), Gaps = 63/460 (14%)
 Frame = -3

Query  1576  ASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIP  1397
               S+++PLS+LF SE +   K         K+  G   +  D K LKD+A+FLKACGT+P
Sbjct  59    GQSSQNPLSALFQSEASPGPK---------KEGSGLDSIHID-KGLKDEARFLKACGTLP  108

Query  1396  ETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWV  1217
             +TP+EIR  S K +D   H+ +    +FHSW+  S   K  +     + P P K CE+  
Sbjct  109   KTPMEIRNASRK-QDTPQHERDSVSSQFHSWISGSLAVKSLMDENTYEPPTPLKACEEMG  167

Query  1216  KESDSPVHTPSSCMT-----------FEEKSNsptvisaspttvppstTCRQ--------  1094
             + S +   TP SC+T           F E +        +        TCR         
Sbjct  168   QHSVASEQTPGSCVTDAQNSGRIASIFSEVNEEGLGNIGTEFEGEVDKTCRATPAAGNVS  227

Query  1093  ---RSVRFDCkstksdmssalsksSFE----VDSPN-SKASPYPTPLKLSDEMQTPGTVF  938
                +SVRF+C   + + S +   SS      +  PN +  SP PTPLKLSDEMQTPGTVF
Sbjct  228   GRIKSVRFECDFDQPNSSGSSYNSSSRKPEMMARPNFAVTSPNPTPLKLSDEMQTPGTVF  287

Query  937   PTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESV  758
             P +++    G+ P+IRSQ+VY +   IENA+  K                   S+ GES+
Sbjct  288   PAYLELAGRGK-PKIRSQFVYPLSKRIENATLSKFPAE---------------SESGESL  331

Query  757   DLSSEANATSEIGLR---ESSTENNLNVEAS-LSSWLKPSLRQSSTQPFGGSIHHGKTLG  590
             +   +  A  EI  R   ESS E  L VEAS  S WLK    ++       S     T G
Sbjct  332   E-RDKTQACKEIHGRKGEESSCERVLKVEASSFSPWLKQGNEENGDNAAALSPRAAMTPG  390

Query  589   DRPILGMVAAHWNENETS-RVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             DRPI+GMVAAHWN  E S +VSPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS
Sbjct  391   DRPIIGMVAAHWNVEELSTQVSPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALS  450

Query  412   EESLVS--QRKRMSGSPISFNETEESDTALSQL-HNGNQS  302
             +ES VS  QRK   G      E  E +TA+SQL H+  QS
Sbjct  451   KESFVSQTQRKTYDGGMGVMEEEAEGETAISQLQHSAAQS  490



>ref|XP_010522056.1| PREDICTED: uncharacterized protein LOC104800816 isoform X1 [Tarenaya 
hassleriana]
Length=497

 Score =   262 bits (670),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 194/460 (42%), Positives = 247/460 (54%), Gaps = 62/460 (13%)
 Frame = -3

Query  1576  ASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIP  1397
               S+++PLS+LF SE          S   +K+  G   +  D K LKD+A+FLKACGT+P
Sbjct  59    GQSSQNPLSALFQSE--------AASPGPKKEGSGLDSIHID-KGLKDEARFLKACGTLP  109

Query  1396  ETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWV  1217
             +TP+EIR  S K +D   H+ +    +FHSW+  S   K  +     + P P K CE+  
Sbjct  110   KTPMEIRNASRK-QDTPQHERDSVSSQFHSWISGSLAVKSLMDENTYEPPTPLKACEEMG  168

Query  1216  KESDSPVHTPSSCMT-----------FEEKSNsptvisaspttvppstTCRQ--------  1094
             + S +   TP SC+T           F E +        +        TCR         
Sbjct  169   QHSVASEQTPGSCVTDAQNSGRIASIFSEVNEEGLGNIGTEFEGEVDKTCRATPAAGNVS  228

Query  1093  ---RSVRFDCkstksdmssalsksSFE----VDSPN-SKASPYPTPLKLSDEMQTPGTVF  938
                +SVRF+C   + + S +   SS      +  PN +  SP PTPLKLSDEMQTPGTVF
Sbjct  229   GRIKSVRFECDFDQPNSSGSSYNSSSRKPEMMARPNFAVTSPNPTPLKLSDEMQTPGTVF  288

Query  937   PTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESV  758
             P +++    G+ P+IRSQ+VY +   IENA+  K                   S+ GES+
Sbjct  289   PAYLELAGRGK-PKIRSQFVYPLSKRIENATLSKFPAE---------------SESGESL  332

Query  757   DLSSEANATSEIGLR---ESSTENNLNVEAS-LSSWLKPSLRQSSTQPFGGSIHHGKTLG  590
             +   +  A  EI  R   ESS E  L VEAS  S WLK    ++       S     T G
Sbjct  333   E-RDKTQACKEIHGRKGEESSCERVLKVEASSFSPWLKQGNEENGDNAAALSPRAAMTPG  391

Query  589   DRPILGMVAAHWNENETS-RVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             DRPI+GMVAAHWN  E S +VSPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS
Sbjct  392   DRPIIGMVAAHWNVEELSTQVSPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALS  451

Query  412   EESLVS--QRKRMSGSPISFNETEESDTALSQL-HNGNQS  302
             +ES VS  QRK   G      E  E +TA+SQL H+  QS
Sbjct  452   KESFVSQTQRKTYDGGMGVMEEEAEGETAISQLQHSAAQS  491



>gb|KHN13178.1| hypothetical protein glysoja_045502 [Glycine soja]
Length=430

 Score =   249 bits (636),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 186/448 (42%), Positives = 234/448 (52%), Gaps = 99/448 (22%)
 Frame = -3

Query  1564  RSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKD--QAKFLKACGTIPET  1391
             R+ LS+LF+SEE  E+        V + D  +     +V  LK   +AKFLKA GT+  T
Sbjct  39    RNRLSTLFLSEEERED-------SVMRDDGKS----IEVGSLKGDSEAKFLKAGGTLART  87

Query  1390  PLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKE  1211
             PLE                                 K +L  QP     P K CE+  + 
Sbjct  88    PLE---------------------------------KSHLDGQPFNPSTPVKCCEEGGER  114

Query  1210  SDSPVHTPSSCMTFEEKSNsptvisaspttvppstTC------------------RQRSV  1085
             +DS   TPSSC++  + +   T+ S          +                   R + V
Sbjct  115   TDSLEQTPSSCISNAQSTQCDTIDSTEGIRTGSLHSLDKNTASVSPWPSTTYTKRRNKFV  174

Query  1084  RFDCkstksdmssalsksSF--EVDSPNS----KASPYPTPLKLSDEMQTPGTVFPTHVD  923
             RF+C S  S   S+        + DSPN+    K SP PTP+KLSDEMQTPG V+P   D
Sbjct  175   RFECGSDLSSCDSSDYGGRHMKKTDSPNNESAYKPSPNPTPMKLSDEMQTPGMVYPATKD  234

Query  922   NLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSE  743
              L NG+ PR++SQ+VY I NP ++ SQ K                  F +  ESV+LS  
Sbjct  235   -LPNGK-PRLKSQFVYPINNPGDDVSQKK------------------FEE-SESVELSQI  273

Query  742   ANATSEIGLRESSTENNLNVEASLSSWLKPSL-----RQSSTQPFGGSIHHGKTLGDRPI  578
               +T E GL++ S EN   VE SLSSWLKP+      R    Q     +   KT  DRPI
Sbjct  274   TTSTPEKGLKKMSCENVCKVEESLSSWLKPAAVILEERNKRMQTAYNQVR--KTPADRPI  331

Query  577   LGMVAAHWNENETSRVSP-KWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESL  401
             +GMVAAHWNE+E S+  P KWWDGNGIPNST+KYKEDQKV WHATPFEERLEKALSEE++
Sbjct  332   IGMVAAHWNEDEDSQAPPPKWWDGNGIPNSTNKYKEDQKVKWHATPFEERLEKALSEETV  391

Query  400   VSQRKRMSGSPISFNETEESDTALSQLH  317
             +SQRK   G  I F++ EESDTALSQL 
Sbjct  392   ISQRKDACGKSIPFDDNEESDTALSQLQ  419



>emb|CDY10214.1| BnaC05g04570D [Brassica napus]
Length=459

 Score =   250 bits (638),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 178/411 (43%), Positives = 232/411 (56%), Gaps = 42/411 (10%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LS+LF      EEK+   +  V+K+      +  D K LKD+A+FLKACGTIPETP+EIR
Sbjct  53    LSALF----RPEEKAEASTPCVDKERFDLDSIHID-KGLKDEARFLKACGTIPETPIEIR  107

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K S+K      H G      FHSW+  SS     L    D+SP P K CED  + S +  
Sbjct  108   KASQKLTS-PQHSGSS---HFHSWISSSSA----LGFHVDESPTPIKACEDVGRPSFTSE  159

Query  1195  HTPSSCM-----------TFEEKSNsptvisasptt--vppstTCRQRSVRFDCkstksd  1055
              TPSSC+            F +     ++ +A          T  + +SVRF+C   +S 
Sbjct  160   QTPSSCVIDVRDNSRITSAFNDADEVESISTAVKGDLDRSMLTAGKTKSVRFECDLEQSH  219

Query  1054  mssalsksSFEVDSPNSK-----ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIR  890
              S++   SS        K     +SP PTPLKLSDEMQTPGT++P ++++   GR PRIR
Sbjct  220   SSNSSQNSSSRKPQMGGKVSFILSSPNPTPLKLSDEMQTPGTIYPANMESAGKGRRPRIR  279

Query  889   SQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRE  710
             SQ+V+S+ N +ENAS     I +  + S  S  +  +    E +D  +  +AT    + E
Sbjct  280   SQFVHSVSNLMENAS-----IYKAHDDSHGSLEQAKWQAYKEQIDGETPTSATYGEKVEE  334

Query  709   SSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRV  530
             +S E     EAS S WL P  +  + +  G S     T GDRPI+G+VAAHWNE+E + V
Sbjct  335   NSYEKLSKFEASFSPWLNPINKDCNERTPGVS---AITPGDRPIIGLVAAHWNEDEETEV  391

Query  529   SPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEE---SLVSQRK  386
             SPKWWDGNGIPN+T KYKEDQKVSWHATPFE RLEK LSEE   SL  +RK
Sbjct  392   SPKWWDGNGIPNTTTKYKEDQKVSWHATPFEVRLEKVLSEEGGQSLFPRRK  442



>ref|XP_009795643.1| PREDICTED: uncharacterized protein LOC104242314 isoform X1 [Nicotiana 
sylvestris]
Length=524

 Score =   249 bits (635),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 179/232 (77%), Gaps = 3/232 (1%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVI  827
             SK SPYPTPLKL+DEMQTPGT FP ++D++   +  RIRSQ+VY +LNP++NASQ+KE++
Sbjct  294   SKYSPYPTPLKLTDEMQTPGTFFPAYLDHMGIAKTGRIRSQFVYPVLNPVDNASQLKELL  353

Query  826   nedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSL  647
             NEDS S+QDSNS+LL S   +      EAN  S++G+    TE +++ ++   +  +   
Sbjct  354   NEDSYSTQDSNSRLLSSHTTDFDQRPDEANLISDLGIF-GFTETSVDKDSKPLTINQVQS  412

Query  646   RQSSTQPFGG-SIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKED  470
             +Q     +GG ++H+ KT GDRPI+G+VAAHWN++ETSR+SPKWWDGNGIPNST+KYKED
Sbjct  413   KQHLGSVYGGENVHYSKTPGDRPIIGLVAAHWNDDETSRISPKWWDGNGIPNSTNKYKED  472

Query  469   QKVSWHATPFEERLEKALSEESLVSQRKRMSGS-PISFNETEESDTALSQLH  317
             QKVSWHATPFEERLEKALS+E+ + QR ++S + PI+  ETEE DTA+SQ H
Sbjct  473   QKVSWHATPFEERLEKALSQETNIPQRTQLSETLPIALGETEEPDTAISQKH  524


 Score =   126 bits (317),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 97/144 (67%), Gaps = 7/144 (5%)
 Frame = -3

Query  1600  TPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKF  1421
             TPT  EP+ S NRSPLSSL    E+ +E ++L  +E+E Q   TP  + D  +L++QAKF
Sbjct  65    TPTK-EPLVSRNRSPLSSLLT--EDKDETNTLGCEEMENQSSDTPITQLDTNDLRNQAKF  121

Query  1420  LKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQ-SPK  1244
             LKACGT+PETP EIR  S KC++LSA   EV+PLKF+SW  D++ +K    SQPDQ +P 
Sbjct  122   LKACGTLPETPAEIRNCSVKCQNLSAPVEEVEPLKFNSWPSDATFQKLISNSQPDQLTPI  181

Query  1243  PTKDCEDWVKESDSPVHTPSSCMT  1172
              T       K+S S VHTPSSC+T
Sbjct  182   RTNGVN---KQSGSLVHTPSSCLT  202



>ref|XP_009119043.1| PREDICTED: uncharacterized protein LOC103844022 [Brassica rapa]
Length=453

 Score =   246 bits (629),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 173/405 (43%), Positives = 227/405 (56%), Gaps = 40/405 (10%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LS+LF  EE  +  SS  S  ++K+      +  D+  L+D+A+FLKACGTIPETP+EIR
Sbjct  59    LSALFRPEE--KAASSNSSPCLDKERFDLDSIHIDIG-LRDEARFLKACGTIPETPIEIR  115

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K S+K      H G   P  FHSW+  SS     L    D+SP P K CED  + S +  
Sbjct  116   KASQKLTS-PQHSG---PSHFHSWISSSSA----LGFHVDESPTPIKACEDVGRPSFTSE  167

Query  1195  HTPSSCM-----------TFE-----EKSNsptvisaspttvppstTCRQRSVRFDCkst  1064
              TPSSC+            F      E   +        +  P  T  + +SVRF+C   
Sbjct  168   QTPSSCVIDVRDNSRITSAFNDADEVESIGTAVKGELDRSARPMLTAGKTKSVRFECDLE  227

Query  1063  ksdmssalsksSFEVDSPNSK-----ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFP  899
             +S  S++   SS        K     +SP PTPLKLSDEMQTPGT++P ++++   GR P
Sbjct  228   QSHSSNSSQNSSSRKPQMGGKVSFILSSPNPTPLKLSDEMQTPGTIYPANMESAGKGRRP  287

Query  898   RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
             RIRSQ+V+S+ N +ENAS  K       + S+ S  +  + D  E +D  +  +AT    
Sbjct  288   RIRSQFVHSVSNLMENASLYK-----AQDDSRGSLEQAKWQDYKEQIDGETPTSATHGEK  342

Query  718   LRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENET  539
             + E+S E     EAS S WL P  +  +    G    +  T GDRPI+G+VAAHW+E+E 
Sbjct  343   VEENSYEKLSKFEASFSPWLNPINKDCNEMTPG---VYAITPGDRPIIGLVAAHWDEDEE  399

Query  538   SRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEES  404
             + V PKWWDGNGIPN+T KYKEDQKVSWHATPFE RLEK LSEE 
Sbjct  400   TEVLPKWWDGNGIPNTTTKYKEDQKVSWHATPFEVRLEKVLSEEG  444



>ref|XP_009785070.1| PREDICTED: uncharacterized protein LOC104233378, partial [Nicotiana 
sylvestris]
Length=219

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 161/206 (78%), Gaps = 10/206 (5%)
 Frame = -3

Query  967  DEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSK  788
            DEMQTPGTVFP ++DN+ANG+  RIRSQ+VY +LNP+  ASQ+KE+ +EDS S  DSNS 
Sbjct  1    DEMQTPGTVFPAYLDNIANGKTARIRSQFVYPVLNPVYGASQLKELSDEDSYSILDSNSI  60

Query  787  LLFSDMGESVDLSSEANATSE---IGLRESSTENNLNVEASLSSWLKPSL------RQSS  635
            LL S+M ES D  +EA+ +SE    GL+E++ + +  VEASLSSWLKPS       +Q +
Sbjct  61   LLSSNMTESGDCPNEASFSSEQGMSGLKEATADKDFKVEASLSSWLKPSSINQDEGKQHN  120

Query  634  TQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPK-WWDGNGIPNSTHKYKEDQKVS  458
               +G ++H+G+T GDRPILG+VAAHW ++E S +SPK WWDGNGIPNST+KYKEDQKVS
Sbjct  121  GSVYGDNVHYGRTPGDRPILGLVAAHWKDDENSHISPKKWWDGNGIPNSTNKYKEDQKVS  180

Query  457  WHATPFEERLEKALSEESLVSQRKRM  380
            WHATPFEERLEKALS+E+ +SQR  +
Sbjct  181  WHATPFEERLEKALSQETSISQRYSI  206



>ref|XP_003617375.1| hypothetical protein MTR_5g090900 [Medicago truncatula]
 gb|AET00334.1| hypothetical protein MTR_5g090900 [Medicago truncatula]
Length=473

 Score =   244 bits (622),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 173/455 (38%), Positives = 240/455 (53%), Gaps = 48/455 (11%)
 Frame = -3

Query  1624  PPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVK  1445
             PP    +   + A+ + S NR  LSS+     + EEK  L        D GT + +   +
Sbjct  39    PPLFISNPPRSTADVLISWNR--LSSIV----SKEEKEGL----ARNADVGTQDYD---Q  85

Query  1444  ELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVS  1265
              L+D+ KFLKACGTI  TP EIRK S K +     D + DPL+FHSWL ++S+EK  L  
Sbjct  86    GLRDEVKFLKACGTIAGTPAEIRKTSAKLKVSPVCDSDSDPLRFHSWLPNTSVEKLQLNV  145

Query  1264  QPDQSPKPTKDCEDWVKESDSPVHTPSSCM--------------------TFEEKSNspt  1145
                  P P K C++    +DS  HTPSS +                    +      +  
Sbjct  146   PLVDPPTPIKICQELGDSTDSFEHTPSSFVFKAQGTQHDSPDYVEGSWTRSIHTAYKTRK  205

Query  1144  visaspttvppstTCRQRSVRFDCkstksdmssalsksSFEVD-SPNS----KASPYPTP  980
               ++        T  + +SVRF C+       S       + + SP+S    K SPYPTP
Sbjct  206   NEASVTPWPAADTQKQNKSVRFKCECDLVSYQSPPDDWHMKKNKSPDSQSACKQSPYPTP  265

Query  979   LKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqd  800
             LKL D+MQTPGTV+PT +++L +G+  R+RSQ++Y   NP +N      +        Q 
Sbjct  266   LKLFDDMQTPGTVYPTSLEDLYDGKH-RVRSQFIYPNCNPGQN------IFLSKLLEEQV  318

Query  799   snSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPS--LRQSSTQP  626
              N +   S++G+S++         E GL++   E    +EASLSSWLKP+  + +   + 
Sbjct  319   FNPEQDLSELGDSIERDQNQTPAPEKGLKKIENETESKIEASLSSWLKPASIIMEGENEE  378

Query  625   FGGSIHHGKTLGDRPILGMVAAHWNENETSRVSP-KWWDGNGIPNSTHKYKEDQKVSWHA  449
                +        DRPI+G+V+A  NE++ S +SP KW  GNGIPNST KYKEDQ V WHA
Sbjct  379   METADCKIPQSADRPIIGVVSAQLNEDKNSHISPPKWRIGNGIPNSTKKYKEDQMVKWHA  438

Query  448   TPFEERLEKALSEESLVSQRKRMSGSPISFNETEE  344
             TPFEERL+KALSEE+ VSQRK     P++F E EE
Sbjct  439   TPFEERLDKALSEENFVSQRKLAIAKPVAFEEIEE  473



>emb|CDY06656.1| BnaA10g04350D [Brassica napus]
Length=477

 Score =   244 bits (622),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 179/437 (41%), Positives = 238/437 (54%), Gaps = 50/437 (11%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LS+LF  EE     +S    + E+ D  +  ++   K L+D+A+FLKACGTIPETP+EIR
Sbjct  59    LSALFRPEEKAASSNSSPCLDKERFDLDSIHID---KGLRDEARFLKACGTIPETPIEIR  115

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K S+K      H G   P  FHSW+  SS     L    D+SP P K CED  + S +  
Sbjct  116   KASQKLTS-PQHSG---PSHFHSWISSSSA----LGFHVDESPTPIKACEDVGRPSFTSE  167

Query  1195  HTPSSCM-----------TFE-----EKSNsptvisaspttvppstTCRQRSVRFDCkst  1064
              TPSSC+            F      E   +        +  P  T  + +SVRF+C   
Sbjct  168   QTPSSCVIDVRENARITSAFNDADEVENIGTAVKGELDRSARPMLTAGKTKSVRFECDLE  227

Query  1063  ksdmssalsksSFEVDSPNSK-----ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFP  899
             +S  S++   SS        K     +SP PTPLKLSD MQTPGT++P ++++   GR P
Sbjct  228   QSQSSNSSQNSSSRKPQMGGKVSFILSSPNPTPLKLSDAMQTPGTIYPANMESAGKGRRP  287

Query  898   RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
             RIRSQ+V+S+ N +ENAS  K       + S  S  +  + D  E +D  +  +AT    
Sbjct  288   RIRSQFVHSVSNLMENASLYK-----AQDDSHGSLEQAKWQDYKEQIDGETPTSATHGEK  342

Query  718   LRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENET  539
             + E+S E     EAS S WL P  +  +    G    +  T GD+PI+G+VA HW+E+E 
Sbjct  343   VEENSYEKLSKFEASFSPWLNPINKDCNEMTPGV---NAITPGDKPIIGLVATHWDEDEE  399

Query  538   SRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSE---ESLVSQRKRMSGSP  368
             + + PKWWDGNGIPN+T KYKEDQKVSWHATPFE RLEK LSE   ESL  +RK      
Sbjct  400   TEILPKWWDGNGIPNTTTKYKEDQKVSWHATPFEVRLEKVLSEEGGESLFPRRK------  453

Query  367   ISFNETEESDTALSQLH  317
             +   E EE D+ +SQL 
Sbjct  454   LEVMEDEE-DSDISQLQ  469



>ref|XP_006417897.1| hypothetical protein EUTSA_v10007468mg [Eutrema salsugineum]
 gb|ESQ36250.1| hypothetical protein EUTSA_v10007468mg [Eutrema salsugineum]
Length=492

 Score =   244 bits (623),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 187/454 (41%), Positives = 246/454 (54%), Gaps = 72/454 (16%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LS+LF+SEE      S  S  ++K+      +  D K L+D+A+FLKACGTIP+TP+EIR
Sbjct  66    LSALFLSEEK-----SASSPCLDKERFDLDSIHID-KGLRDEARFLKACGTIPQTPVEIR  119

Query  1375  KLSEKCRDLSA--HDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDS  1202
             K S    +LS+  H G      FHSW+  SS    +L    D+SP P K CE   + S +
Sbjct  120   KASH---NLSSPQHSGSS---HFHSWISSSSALGFHL----DESPTPMKACEKVGRPSFT  169

Query  1201  PVHTPSSCMT----------------FEEKSNsptvisaspttvppstTCRQRSVRFDCk  1070
                TPSSC+                   E   +        +  P  T  + +SVRF+C 
Sbjct  170   SEQTPSSCIIDVRDTARISPASCDADEVESIGTAFKGEFDRSDKPMLTAGKTKSVRFECD  229

Query  1069  stksdms-----------salsksSFEVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVD  923
               +S  S               K SF V SPN      PTPLKLSDEMQTPGT++P +++
Sbjct  230   LDQSHSSNSSENSSSRKPEMGGKISFTVSSPN------PTPLKLSDEMQTPGTIYPANME  283

Query  922   NLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSE  743
             +   GR PRIRSQ+V+S+ N +ENAS  K  +N +   S +     ++    E ++  + 
Sbjct  284   SAGRGR-PRIRSQFVHSVSNLMENASLYK--VNGELHGSLEQAQSQVYK---EQIEGETP  337

Query  742   ANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH-----HGKTLGDRPI  578
              +AT    + ESS E     EAS S WLKP + +   +  G         +  T GDRPI
Sbjct  338   TSATYVEKVEESSDEKLSKFEASFSPWLKP-INEDCNEKIGVLKDRTPGINAMTPGDRPI  396

Query  577   LGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEE---  407
             +G+VAAHWNEN  + +SPKWWDGNGIPNST KYKEDQKVSWHATPFE RLEKALSEE   
Sbjct  397   IGLVAAHWNENAQTEISPKWWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKALSEEGGQ  456

Query  406   SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             SL  +RK      +   E +E D+ +SQL +  Q
Sbjct  457   SLFPRRK------LEVMEEDEEDSDISQLQHSVQ  484



>gb|KFK42983.1| hypothetical protein AALP_AA1G064300 [Arabis alpina]
Length=444

 Score =   240 bits (613),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 184/445 (41%), Positives = 242/445 (54%), Gaps = 70/445 (16%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LS LF+SEE     S L  K  +        +  D K L+D+A+FLKACGTIPETP+EIR
Sbjct  35    LSDLFLSEEKAASSSCLDKKRFD-----LDSIHID-KGLRDEARFLKACGTIPETPIEIR  88

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K S+K    S  D      +FHSW+  SS    +L    D+SP P K+C++  + S S  
Sbjct  89    KASQKLS--SPQDS--GSAEFHSWISSSSAIGFHL----DESPTPMKNCKEEGRPSFSSE  140

Query  1195  HTPSSCM---------TFE-EKSNsptvisaspttvppstTCRQRSVRFDCkstksdmss  1046
              T SSC+         T E E   +        +  P  T  + +SVRF+C   +S  S 
Sbjct  141   QTLSSCVINVPDTASDTDEVESIGTAFKGELDRSDKPMLTAGKTKSVRFECDLDQSHSSK  200

Query  1045  alsksSFEVDSPNSK-----ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQY  881
             +   SS       SK     +SP PTPLKLSDEMQTPGT++P ++++   GR PRIRSQ+
Sbjct  201   SSEDSSSRKPEMGSKISFTVSSPNPTPLKLSDEMQTPGTIYPANMESAGRGR-PRIRSQF  259

Query  880   VYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG--LRES  707
             V+S+ N +ENAS  K                 +  D+ E   +  E+ +++  G  + ES
Sbjct  260   VHSVSNLMENASLYK-----------------VHKDLLEKEQIEGESPSSATYGEIVEES  302

Query  706   STENNLNVEASLSSWLKPSLRQ--------SSTQPFGGSIHHGKTLGDRPILGMVAAHWN  551
             S E     EAS S WLK    +        +   P   +I    T G RPI+G+VA+HWN
Sbjct  303   SDEKLSKFEASFSPWLKRISEECDENIAVLNDRTPRVAAI----TPGYRPIIGLVASHWN  358

Query  550   ENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEE---SLVSQRKRM  380
             ENE + +SPKWWDGNGIPNST KYKEDQKVSWHATPFE RLEKALSEE   +L  +RK  
Sbjct  359   ENEQTDISPKWWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKALSEEGGQNLFPRRK--  416

Query  379   SGSPISFNETEESDTALSQLHNGNQ  305
                 +   E EE D+ +SQ+ +  Q
Sbjct  417   ----LDVMEEEEVDSDISQMQHSVQ  437



>ref|XP_009110978.1| PREDICTED: uncharacterized protein LOC103836471 [Brassica rapa]
Length=466

 Score =   239 bits (609),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 180/441 (41%), Positives = 239/441 (54%), Gaps = 63/441 (14%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LS+LF SEE   E +S      E+ D  +  ++   K L+D+A+FLKACGTIPETP+EIR
Sbjct  58    LSALFQSEE---EAASSPCLGKERFDLDSIHID---KGLRDEARFLKACGTIPETPVEIR  111

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K S+K      H G      FHSW+  SS    +L    D+SP P K CE+  + S +  
Sbjct  112   KESQKLNS-PQHSGTS---YFHSWISSSSALGFHL----DESPTPLKACEEVGRPSLASE  163

Query  1195  HTPSSCMTFE----------------EKSNsptvisaspttvppstTCRQRSVRFDCkst  1064
              TPSSC+  +                E   +        +  P  T  + +SVRF+C   
Sbjct  164   QTPSSCVIDDGDTARVSSASGDADEVESIGTALKGELDRSGRPMLTAGKTKSVRFECDLD  223

Query  1063  ksdmssalsksSF---EVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRI  893
             +S  S++   SS    E+    + +SP PTPLKLSDEMQTPGTV+P ++++   GR PRI
Sbjct  224   QSQSSNSSENSSSRKPEMGGKTTVSSPNPTPLKLSDEMQTPGTVYPANMESARKGR-PRI  282

Query  892   RSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLR  713
             RSQ+V+S+ N +E+AS                    L++   +S     +     E    
Sbjct  283   RSQFVHSVSNLMEDAS--------------------LYNVHDDSYGSLEQEQIEGETPTS  322

Query  712   ESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH-----HGKTLGDRPILGMVAAHWNE  548
              +S E     EAS S  L P + +   + FG  I      +  T GDRPI+G+VAAHWNE
Sbjct  323   ATSDEKISKFEASSSPSLYP-INEDGGEDFGVLIDITPGVNAMTPGDRPIIGLVAAHWNE  381

Query  547   NETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSP  368
             NE + VSPKWWDGNGIPNST KYKEDQKVSWHATPFE RLEKALSEE  +S   R +   
Sbjct  382   NEQTEVSPKWWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKALSEEGGMSLFPRRN---  438

Query  367   ISFNETEESDTALSQLHNGNQ  305
             +   E +E D+ +SQL +  Q
Sbjct  439   LEVMEEDEEDSDISQLQHSVQ  459



>ref|XP_009628893.1| PREDICTED: uncharacterized protein LOC104116524 isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   239 bits (611),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 171/219 (78%), Gaps = 3/219 (1%)
 Frame = -3

Query  1003  KASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIn  824
             K SPYPTPLKL+DEMQTPGT+FP ++D++   +  RIRSQ+VY +LNP++NASQ+ E++N
Sbjct  296   KYSPYPTPLKLTDEMQTPGTIFPAYLDHMGIAKTARIRSQFVYPVLNPVDNASQLNELLN  355

Query  823   edsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLR  644
             EDS S+QDSNS+LL S    S     EAN  S++G+    TE +++ ++   S  +   +
Sbjct  356   EDSYSTQDSNSRLLSSHTTGSDQRPDEANLKSDLGI-SGFTETSVDKDSKPLSINQVQSK  414

Query  643   QSSTQPFGG-SIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQ  467
             Q     +GG ++H+G+T GDRPI+G+VAAHWN++ETSR+SPKWWDGNGIPNST+KYKEDQ
Sbjct  415   QHLGSVYGGENVHYGRTPGDRPIIGLVAAHWNDDETSRISPKWWDGNGIPNSTNKYKEDQ  474

Query  466   KVSWHATPFEERLEKALSEESLVSQRKRMSGS-PISFNE  353
             KVSWHATPFEERLEKALS+E+ + +R ++SG+ PI+F E
Sbjct  475   KVSWHATPFEERLEKALSQETNIPERTQLSGTLPIAFGE  513


 Score =   134 bits (338),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 107/162 (66%), Gaps = 10/162 (6%)
 Frame = -3

Query  1654  SAPPSDHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDC  1475
             +AP +D  S    VS+S TPT  EP+ S NRSPLSSL    E+ +E ++L  +EVE Q  
Sbjct  51    NAPCTDSQSN--IVSQS-TPTK-EPLVSCNRSPLSSLLT--EDKDETNTLGCEEVENQSS  104

Query  1474  GTPELEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLD  1295
              TP  + D  +L++QAKFLKACGT+PETP EIR  S KC+DLSA   EV+PLKFHSW  D
Sbjct  105   DTPMAQLDANDLRNQAKFLKACGTLPETPAEIRTCSVKCKDLSAPVEEVEPLKFHSWPSD  164

Query  1294  SSIEKQNLVSQPDQ-SPKPTKDCEDWVKESDSPVHTPSSCMT  1172
             ++ +K    SQPDQ +P  T       K+S S VHTPSSC+T
Sbjct  165   ATFQKLISNSQPDQLTPIRTDGVN---KQSGSLVHTPSSCLT  203



>emb|CDY15586.1| BnaA08g28700D [Brassica napus]
Length=466

 Score =   236 bits (601),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 177/441 (40%), Positives = 237/441 (54%), Gaps = 63/441 (14%)
 Frame = -3

Query  1555  LSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPLEIR  1376
             LS+LF SEE++     L     E+ D  +  ++   K L+D+A+FLKACGTIP TP+EIR
Sbjct  58    LSALFRSEESEASSPCLGK---ERFDLDSIHID---KGLRDEARFLKACGTIPATPVEIR  111

Query  1375  KLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESDSPV  1196
             K S+K      H G      FHSW+  SS    +L    D+SP P K CE+  + S +  
Sbjct  112   KASQKPTS-PQHSGAS---YFHSWISSSSALGFHL----DESPTPLKACEELGRPSLTSD  163

Query  1195  HTPSSCMTFE----------------EKSNsptvisaspttvppstTCRQRSVRFDCkst  1064
              TPSSC+  +                E   +        +  P  T  + +SVRF+C   
Sbjct  164   QTPSSCVIDDGDTARVSSASGDADEVESIGTAFKGDLDRSGRPMLTAGKTKSVRFECDLD  223

Query  1063  ksdmssalsksSF---EVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRI  893
             +S  S++   SS    E+    + +SP PTPLKLSDEMQTPGTV+P ++++   GR PRI
Sbjct  224   QSQSSNSSENSSSRKPEMGGKTTVSSPNPTPLKLSDEMQTPGTVYPANMESARKGR-PRI  282

Query  892   RSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLR  713
             RSQ+V+S+ N +E+AS                    L++   +S     +     E    
Sbjct  283   RSQFVHSVSNLMEDAS--------------------LYNVHDDSYGSLEQEQIEGETPTS  322

Query  712   ESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH-----HGKTLGDRPILGMVAAHWNE  548
              +S E     EAS S  L P + +   + FG  I      +  T GDRPI+G+VAAHWNE
Sbjct  323   ATSDERLSKFEASSSPSLYP-INEDGGEDFGVLIDITPGVNAMTPGDRPIIGLVAAHWNE  381

Query  547   NETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSP  368
             NE + VSPKWWDGNGIPNST KYKEDQKVSWHATPFE RLEKALSEE  +S   R +   
Sbjct  382   NEQTEVSPKWWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKALSEEGGLSLFPRRN---  438

Query  367   ISFNETEESDTALSQLHNGNQ  305
             +   E +E D+ + QL +  Q
Sbjct  439   LEVMEEDEEDSDIPQLQHSVQ  459



>emb|CDX86516.1| BnaC08g01870D [Brassica napus]
Length=472

 Score =   234 bits (597),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 182/445 (41%), Positives = 239/445 (54%), Gaps = 62/445 (14%)
 Frame = -3

Query  1567  NRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETP  1388
             ++S LS+LF SEE +E  S    KE    D     +  D K L+D+A+FLKACGTIPETP
Sbjct  59    SQSHLSALFRSEEEEEASSPCLGKERFDLD----SIHID-KGLRDEARFLKACGTIPETP  113

Query  1387  LEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKES  1208
             +EIRK S+K               FHSW+  SS    +L    D+SP P K CE+  + S
Sbjct  114   IEIRKASQKLSSPQRSGASY----FHSWISSSSALGFHL----DESPTPLKACEELGRPS  165

Query  1207  DSPVHTPSSCMTFE----------------EKSNsptvisaspttvppstTCRQRSVRFD  1076
              +   TPSSC+  +                E   +        +  P  T  + +SVRF+
Sbjct  166   VTSEQTPSSCVIDDGDTARISSASGDADEVESIGTAFKGELDRSGRPLFTAGKTKSVRFE  225

Query  1075  CkstksdmssalsksSF---EVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGR  905
             C   +S  S++   SS    E+   ++ +SP PTPLKLSDEMQTPGTV+P ++++   GR
Sbjct  226   CDLDQSQSSNSSENSSSRKPEMGGKSTVSSPNPTPLKLSDEMQTPGTVYPANMESARKGR  285

Query  904   FPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSE  725
              PRIRSQ+V+S+ N +E+AS                    L++   +S     +     E
Sbjct  286   -PRIRSQFVHSVSNLMEDAS--------------------LYNVHDDSYGSIEQEQIEGE  324

Query  724   IGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFG--GSIHHG---KTLGDRPILGMVAA  560
                  +S E     EAS S  L P + +   + FG    I  G    T GDRPI+G+VAA
Sbjct  325   TPTSATSDEKLSRFEASSSPSLYP-INEDGGEDFGVLNDITPGVNAMTPGDRPIIGLVAA  383

Query  559   HWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRM  380
             HWNENE + VSPKWWDGNGIPNST KYKEDQKVSWHATPFE RLEKALSEE  +S   R 
Sbjct  384   HWNENEQTEVSPKWWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKALSEEGGLSLFPRR  443

Query  379   SGSPISFNETEESDTALSQLHNGNQ  305
             +   +   E +E D  +SQL +  Q
Sbjct  444   N---LEAMEEDEEDLDISQLQHSVQ  465



>ref|XP_010475403.1| PREDICTED: uncharacterized protein LOC104754822 [Camelina sativa]
Length=489

 Score =   234 bits (598),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 184/455 (40%), Positives = 245/455 (54%), Gaps = 73/455 (16%)
 Frame = -3

Query  1555  LSSLFVSEEN-------DEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIP  1397
             LS+LF+S+E        D+EK  L S  ++K              L+D+A+FLKACGTIP
Sbjct  63    LSALFLSKEKAASSPCLDKEKFDLDSIHIDKG-------------LRDEARFLKACGTIP  109

Query  1396  ETPLEIRKLSEKCRDLSA--HDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCED  1223
             ETP+EIRK S+K   LS+  H G      FHSW+  SS    +L     +SP PTK CE+
Sbjct  110   ETPIEIRKASQK---LSSPQHAGSS---HFHSWISSSSTMGSHLA----ESPTPTKACEE  159

Query  1222  WVKESDSPVHTPSSCM----------------TFEEKSNsptvisaspttvppstTCRQR  1091
               + S +    PSSC+                T  E   +      + +  P  T  + +
Sbjct  160   MGRPSFTSEQAPSSCVIDVRDSARISSASSDGTEVESIGTAIKGELNGSGRPTLTVGKTK  219

Query  1090  SVRFDCkstksdmssalsksSFEVDSPNSK-----ASPYPTPLKLSDEMQTPGTVFPTHV  926
             SVRF+C   +S  S++   SS        K      SP PTPL+LSDEMQTPGT++P ++
Sbjct  220   SVRFECDLDQSHSSNSSENSSSRKSEMGGKFCFTANSPNPTPLRLSDEMQTPGTIYPANM  279

Query  925   DNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSS  746
             ++   GR PRIRSQ+V+S+ N +ENAS  K V+N+   S + +  ++      E ++  +
Sbjct  280   ESAGRGR-PRIRSQFVHSVSNVMENASLYK-VLNDAHGSLEQAEPQIY----KEKIEYET  333

Query  745   EANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTL-----GDRP  581
              ++AT    + ESS E     EAS S WL   + + + +    S      L     GDRP
Sbjct  334   PSSATYGEKVEESSDEKLSKFEASFSPWLN-QINEDNNENIAVSNDRTPGLAAITPGDRP  392

Query  580   ILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEE--  407
             I+G+V A W ENE + +SP+ WDGNGIPNST KYKEDQKVSWHATPFE RLEKALSEE  
Sbjct  393   IIGLVPAQWIENEQTDISPRMWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKALSEEGG  452

Query  406   -SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
              SL  QRK          E  E DT LSQL +  Q
Sbjct  453   QSLFPQRKLE-----VMMEEVEGDTDLSQLQHSVQ  482



>ref|XP_002892352.1| hypothetical protein ARALYDRAFT_887868 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68611.1| hypothetical protein ARALYDRAFT_887868 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score =   231 bits (590),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 186/461 (40%), Positives = 240/461 (52%), Gaps = 91/461 (20%)
 Frame = -3

Query  1555  LSSLFVSEE-------NDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIP  1397
             LS+LF+SEE       +D+E+  L S  ++K              L+D+A+FLKACGTIP
Sbjct  66    LSALFLSEEKAASSPCHDKERFDLDSIHIDKG-------------LRDEARFLKACGTIP  112

Query  1396  ETPLEIRKLSEKCRDLSA--HDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCED  1223
             ETP+EIRK S+K   LS+  H G      FHSW+  SS    +L     +S  P K CE+
Sbjct  113   ETPIEIRKGSQK---LSSPQHSGSS---HFHSWISSSSAIGSHLA----ESSTPMKACEE  162

Query  1222  WVKESDSPVHTPSSCM----------------TFEEKSNsptvisaspttvppstTCRQR  1091
               + S +   T SSC+                T  E   +        T  P  T  + +
Sbjct  163   VGRPSFTSEQTTSSCVIDVRDSARISSASSDGTEVESVGTAIKGELDRTARPTFTAGKNK  222

Query  1090  SVRFDCkstksdmssalsksS-----------FEVDSPNSKASPYPTPLKLSDEMQTPGT  944
             SVRF+C   +S  S++   SS           F V SPN      PTPLKLSDEMQTPGT
Sbjct  223   SVRFECDLDQSHSSNSSENSSSRKPEMGGKICFTVSSPN------PTPLKLSDEMQTPGT  276

Query  943   VFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGE  764
             ++P ++++   GR PRIRSQ+V+S+ N +ENAS  K  ++                D  E
Sbjct  277   LYPANMESAGRGR-PRIRSQFVHSVSNIMENASLYKCYMDSHGSL-----------DYEE  324

Query  763   SVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHH-----GK  599
              ++  + ++AT    + ESS E     EAS S WL   + + S +    S          
Sbjct  325   QIEGETPSSATYGEKVEESSDEKLSKFEASFSPWLN-QINEDSNENIAVSNERTPGVAAI  383

Query  598   TLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKA  419
             T GDRPI+G+VAA W ENE + +SPK WDGNGIPNST KYKEDQKVSWHATPFE RLEKA
Sbjct  384   TPGDRPIIGLVAAQWIENEQTEISPKLWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKA  443

Query  418   LSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             LSEE   SL  QRK          E  E DT +SQL +  Q
Sbjct  444   LSEEGGQSLFPQRKLE-----VMMEEVEGDTDISQLQHSVQ  479



>ref|XP_010457790.1| PREDICTED: uncharacterized protein LOC104739213 [Camelina sativa]
Length=485

 Score =   231 bits (589),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 182/455 (40%), Positives = 248/455 (55%), Gaps = 69/455 (15%)
 Frame = -3

Query  1576  ASSNRSPLSSLFVSEEN-------DEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFL  1418
             A  +++ LS+LF+S+E        D+EK  L S  ++K              L+D+A+FL
Sbjct  56    AQDSQNDLSALFLSKEKAASSPCLDKEKFDLDSIHIDKG-------------LRDEARFL  102

Query  1417  KACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPT  1238
             KACGTIPETP+EIRK S+       H G      FHSW+  SS    +L     +SP PT
Sbjct  103   KACGTIPETPIEIRKASQTISS-PQHSGSS---HFHSWISSSSAMGSHLA----ESPTPT  154

Query  1237  KDCEDWVKESDSPVHTPSSCM----------------TFEEKSNsptvisaspttvppst  1106
             K CE+  + S +   TPSSC+                T  E  ++        +  P  T
Sbjct  155   KACEEVARLSFTSEQTPSSCVIDVRDSARISSASSDGTEVESISTAIKGELDASGRPMLT  214

Query  1105  TCRQRSVRFDCkstksdmssalsksSFEVDSPNSK-----ASPYPTPLKLSDEMQTPGTV  941
               + +SVRF+C   +S  SS+   SS        K      SP PTPL+LSDEMQTPGT+
Sbjct  215   VGKTKSVRFECDLDQSHSSSSSENSSSRKSEMGGKFCFTANSPNPTPLRLSDEMQTPGTI  274

Query  940   FPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGES  761
             +P+++++   GR PRIRSQ+V+S+ N +ENAS  K V+N+   S Q +  ++      E 
Sbjct  275   YPSNMESAGRGR-PRIRSQFVHSVSNVMENASLYK-VLNDAHGSLQQAEPQVY----KEK  328

Query  760   VDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP---SLRQSSTQPFGGSIHHGKTLG  590
             ++  + ++AT    + ESS E     EAS S WL     ++  S+ +  G +     T G
Sbjct  329   IECETPSSATYGEKVEESSDEKLSKFEASFSPWLNQINENIAVSNDRTPGLA---AITPG  385

Query  589   DRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSE  410
             DRPI+G+V + W ENE + +SP+ WDGNGIPNST KYKEDQKVSWHATPFE RLEKALS+
Sbjct  386   DRPIIGLVPSQWIENEQTEISPRLWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKALSD  445

Query  409   E---SLVSQRKRMSGSPISFNETEESDTALSQLHN  314
             E   SL  QRK          E  E DT +SQL +
Sbjct  446   ENGQSLFPQRKLE-----VMMEEVEGDTNISQLQH  475



>ref|XP_009589704.1| PREDICTED: uncharacterized protein LOC104116524 isoform X2 [Nicotiana 
tomentosiformis]
Length=500

 Score =   227 bits (579),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 159/203 (78%), Gaps = 2/203 (1%)
 Frame = -3

Query  1003  KASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIn  824
             K SPYPTPLKL+DEMQTPGT+FP ++D++   +  RIRSQ+VY +LNP++NASQ+ E++N
Sbjct  296   KYSPYPTPLKLTDEMQTPGTIFPAYLDHMGIAKTARIRSQFVYPVLNPVDNASQLNELLN  355

Query  823   edsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLR  644
             EDS S+QDSNS+LL S    S     EAN  S++G+    TE +++ ++   S  +   +
Sbjct  356   EDSYSTQDSNSRLLSSHTTGSDQRPDEANLKSDLGI-SGFTETSVDKDSKPLSINQVQSK  414

Query  643   QSSTQPFGG-SIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQ  467
             Q     +GG ++H+G+T GDRPI+G+VAAHWN++ETSR+SPKWWDGNGIPNST+KYKEDQ
Sbjct  415   QHLGSVYGGENVHYGRTPGDRPIIGLVAAHWNDDETSRISPKWWDGNGIPNSTNKYKEDQ  474

Query  466   KVSWHATPFEERLEKALSEESLV  398
             KVSWHATPFEERLEKALS+E+ +
Sbjct  475   KVSWHATPFEERLEKALSQETNI  497


 Score =   134 bits (337),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 107/162 (66%), Gaps = 10/162 (6%)
 Frame = -3

Query  1654  SAPPSDHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDC  1475
             +AP +D  S    VS+S TPT  EP+ S NRSPLSSL    E+ +E ++L  +EVE Q  
Sbjct  51    NAPCTDSQSN--IVSQS-TPTK-EPLVSCNRSPLSSLLT--EDKDETNTLGCEEVENQSS  104

Query  1474  GTPELEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLD  1295
              TP  + D  +L++QAKFLKACGT+PETP EIR  S KC+DLSA   EV+PLKFHSW  D
Sbjct  105   DTPMAQLDANDLRNQAKFLKACGTLPETPAEIRTCSVKCKDLSAPVEEVEPLKFHSWPSD  164

Query  1294  SSIEKQNLVSQPDQ-SPKPTKDCEDWVKESDSPVHTPSSCMT  1172
             ++ +K    SQPDQ +P  T       K+S S VHTPSSC+T
Sbjct  165   ATFQKLISNSQPDQLTPIRTDGVN---KQSGSLVHTPSSCLT  203



>ref|XP_010688901.1| PREDICTED: uncharacterized protein LOC104902715 [Beta vulgaris 
subsp. vulgaris]
Length=444

 Score =   225 bits (573),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 158/237 (67%), Gaps = 20/237 (8%)
 Frame = -3

Query  1003  KASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIn  824
             KASPYPTP K+SD+MQTPGTVF T++ +L+ G   RIRSQYVY++LNPIEN  Q+ E+  
Sbjct  208   KASPYPTPNKISDDMQTPGTVFATNMKSLSKGNG-RIRSQYVYTVLNPIENLCQLDELKE  266

Query  823   edsessqdsnSKLLFSDMGESVDLSSEANAT--SEIGLRESSTENNLNVEASLSSWLKPS  650
             E+S  +   + +          DLS   NAT  S +G  ++  +     + SLS+WLKP 
Sbjct  267   ENSVQAASDHER----------DLSERGNATPSSAMGSSKNEVQEEKLGDVSLSAWLKPP  316

Query  649   --LRQSSTQPFGGSIHH----GKTLGDRPILGMVAAHWNENE-TSRVSPKWWDGNGIPNS  491
                       FG + +     G+T GDRPI+G+VA HWNE E  S +SPK WDGNGIPNS
Sbjct  317   PFKEDGRCDNFGAARYRKPNMGRTPGDRPIIGLVATHWNEQEEASHISPKGWDGNGIPNS  376

Query  490   THKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             T KYKEDQKV WHATPFEERLEKALSEE+ + QRK ++G+PI+F E E  DTA SQL
Sbjct  377   TTKYKEDQKVCWHATPFEERLEKALSEETFLPQRKPITGTPITFEENEGQDTATSQL  433



>ref|XP_009795644.1| PREDICTED: uncharacterized protein LOC104242314 isoform X2 [Nicotiana 
sylvestris]
Length=499

 Score =   225 bits (574),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 160/206 (78%), Gaps = 2/206 (1%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVI  827
             SK SPYPTPLKL+DEMQTPGT FP ++D++   +  RIRSQ+VY +LNP++NASQ+KE++
Sbjct  294   SKYSPYPTPLKLTDEMQTPGTFFPAYLDHMGIAKTGRIRSQFVYPVLNPVDNASQLKELL  353

Query  826   nedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSL  647
             NEDS S+QDSNS+LL S   +      EAN  S++G+    TE +++ ++   +  +   
Sbjct  354   NEDSYSTQDSNSRLLSSHTTDFDQRPDEANLISDLGIF-GFTETSVDKDSKPLTINQVQS  412

Query  646   RQSSTQPFGG-SIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKED  470
             +Q     +GG ++H+ KT GDRPI+G+VAAHWN++ETSR+SPKWWDGNGIPNST+KYKED
Sbjct  413   KQHLGSVYGGENVHYSKTPGDRPIIGLVAAHWNDDETSRISPKWWDGNGIPNSTNKYKED  472

Query  469   QKVSWHATPFEERLEKALSEESLVSQ  392
             QKVSWHATPFEERLEKALS+E+ + Q
Sbjct  473   QKVSWHATPFEERLEKALSQETNIPQ  498


 Score =   126 bits (317),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 97/144 (67%), Gaps = 7/144 (5%)
 Frame = -3

Query  1600  TPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKF  1421
             TPT  EP+ S NRSPLSSL    E+ +E ++L  +E+E Q   TP  + D  +L++QAKF
Sbjct  65    TPTK-EPLVSRNRSPLSSLLT--EDKDETNTLGCEEMENQSSDTPITQLDTNDLRNQAKF  121

Query  1420  LKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQ-SPK  1244
             LKACGT+PETP EIR  S KC++LSA   EV+PLKF+SW  D++ +K    SQPDQ +P 
Sbjct  122   LKACGTLPETPAEIRNCSVKCQNLSAPVEEVEPLKFNSWPSDATFQKLISNSQPDQLTPI  181

Query  1243  PTKDCEDWVKESDSPVHTPSSCMT  1172
              T       K+S S VHTPSSC+T
Sbjct  182   RTNGVN---KQSGSLVHTPSSCLT  202



>ref|XP_003530723.1| PREDICTED: uncharacterized protein LOC100777669 [Glycine max]
Length=432

 Score =   223 bits (569),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 179/448 (40%), Positives = 230/448 (51%), Gaps = 98/448 (22%)
 Frame = -3

Query  1564  RSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPETPL  1385
             R+ LS+LF+SEE +   +S+   + +  + G+ + ++       +AKFLKA  T+  TPL
Sbjct  40    RNQLSTLFLSEERE---NSVVRDDRKSFEVGSQKGDY-------EAKFLKAGDTLARTPL  89

Query  1384  EIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKESD  1205
             E                                 K + V QP     P K CE+  K +D
Sbjct  90    E---------------------------------KAHPVGQPFNPSTPVKCCEEGGKRTD  116

Query  1204  SPVHTPSS---------CMTFEEKSNsptvisaspttvppstTC-----------RQRSV  1085
             S   TPSS         C T +      T    S      +T             R +S+
Sbjct  117   SLEQTPSSCISNVLSTQCDTLDSTEGIRTGSLHSLDKNDKNTASVSPWPSTTYTRRNKSI  176

Query  1084  RFDCkstksdmssalsksSF--EVDSPNS----KASPYPTPLKLSDEMQTPGTVFPTHVD  923
              F+C S  S   S+        + DS N+    K SP PTP+KLSDEMQTPGT +P+  D
Sbjct  177   GFECDSDLSSCDSSDYGGRHMKKTDSLNNESTYKPSPNPTPMKLSDEMQTPGTAYPSAKD  236

Query  922   NLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSE  743
              L NG+ PR++SQ+VY I NP  + SQ K                  F +  ESV+ S  
Sbjct  237   -LPNGK-PRVKSQFVYPIYNPGHHFSQKK------------------FEE-SESVEPSQV  275

Query  742   ANATSEIGLRESSTENNLNVEASLSSWLKPSL-----RQSSTQPFGGSIHHGKTLGDRPI  578
               +TSE  L++ S EN   VE SLSSWLKP+      R    Q     +   KT  DRPI
Sbjct  276   TTSTSEKELKKMSCENECKVEESLSSWLKPAAVILEERNKRMQTSYNQVR--KTPADRPI  333

Query  577   LGMVAAHWNENETSRVSP-KWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESL  401
             +GMVAAHWN++  S+  P KWWDGNGIPNST+KYKEDQKV+WHAT FEERLEKALSEE++
Sbjct  334   IGMVAAHWNKDGDSQAPPPKWWDGNGIPNSTNKYKEDQKVNWHATSFEERLEKALSEETV  393

Query  400   VSQRKRMSGSPISFNETEESDTALSQLH  317
             +SQRK   G  I F+E EESDTALSQL 
Sbjct  394   ISQRKDTCGKSIPFDENEESDTALSQLQ  421



>ref|XP_006366635.1| PREDICTED: uncharacterized protein LOC102605064 [Solanum tuberosum]
Length=727

 Score =   227 bits (578),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 176/305 (58%), Gaps = 44/305 (14%)
 Frame = -3

Query  1630  SRPPFVSKSLTPTAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             S+   VS+SL P   EPV S NRSPLSSLF SEE  E+    ++ + + QD GTP+ E  
Sbjct  49    SKSQLVSQSLAPK--EPVVSRNRSPLSSLFNSEEKGEDDYLREAGKAD-QDAGTPKSELH  105

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
              KEL+DQAKFLKACGT+PETP EIRK   KC+DLSA  G+V+PLKF SWL D ++EK NL
Sbjct  106   TKELRDQAKFLKACGTLPETPAEIRKGLAKCKDLSASKGDVEPLKFKSWLSDVAVEKFNL  165

Query  1270  VSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMT--------------------------F  1169
                PD    P+K  E   K+S S  HT SSCM                           F
Sbjct  166   DLLPDHPITPSKSNE-LEKQSGSLTHTSSSCMMDGQNGQSSPKNSIHGSGSANTPTSIEF  224

Query  1168  EEKSNsptvisaspttvppstTCRQRSVRFDCkstksdmssalsksSFEVDSPNSKA---  998
                       S       PS     ++VRFDC       + +   +SF +DS NSK    
Sbjct  225   NANQAHRDAASEVSPIFAPSAQYMNKTVRFDC--ESDLSAVSSKSTSFALDSENSKQAEF  282

Query  997   ---------SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENAS  845
                      SPYPTPLKLSDEMQTPGTVFPT++DN+ANG+  RIRSQYVY +LNP++ AS
Sbjct  283   SGNYSALKHSPYPTPLKLSDEMQTPGTVFPTYMDNIANGKAARIRSQYVYPVLNPVDRAS  342

Query  844   QMKEV  830
             Q+K++
Sbjct  343   QLKDL  347


 Score =   207 bits (528),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 136/168 (81%), Gaps = 10/168 (6%)
 Frame = -3

Query  790  KLLFSDMGESVDLSSEANATSEIG---LRESSTENNLNVEASLSSWLKPSL------RQS  638
            +L  S+M ES ++ +EA+ +SE+G   LR++S +N+  VEASLSSWLKPS       +Q 
Sbjct  560  RLWSSNMTESGEMPNEASFSSELGTPGLRKASADNDSKVEASLSSWLKPSSINQDEGKQH  619

Query  637  STQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVS  458
            ++  +G ++H+G+T GDRPILG+VAAHW ++E SR+SPKWWDGNGIPNST+KYKEDQKVS
Sbjct  620  TSSGYGNNVHYGRTPGDRPILGLVAAHWKDDEDSRISPKWWDGNGIPNSTNKYKEDQKVS  679

Query  457  WHATPFEERLEKALSEESLVSQRKRMSGS-PISFNETEESDTALSQLH  317
            WHATPFEERLEKALSEES + QRK+ SG+ P +FN+ +E+DTA+SQ+H
Sbjct  680  WHATPFEERLEKALSEESSIPQRKQYSGTRPFAFNDMDETDTAISQVH  727



>gb|KHN11984.1| hypothetical protein glysoja_019957 [Glycine soja]
Length=443

 Score =   219 bits (559),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 162/408 (40%), Positives = 217/408 (53%), Gaps = 69/408 (17%)
 Frame = -3

Query  1462  LEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIE  1283
              E D + LKD+AKFLKACGT+  TP EIRK SEK + L A D + DP +FHSWL ++S+E
Sbjct  78    FEGDFQGLKDEAKFLKACGTLAGTPAEIRKASEKLKSL-APDKDSDPSRFHSWLPNTSVE  136

Query  1282  KQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMT-----------FEEKS-------  1157
             K  L  QP   P P   C+      DS  HTPSS ++           + EK+       
Sbjct  137   KLQLDVQPFDPPTPINLCQKLGNSMDSFEHTPSSRISKAQDTEDDSVDYMEKNWSGNLHT  196

Query  1156  --NsptvisaspttvppstTCRQRSVRFDCkstksdmssalsksSF-EVDSPNS----KA  998
                S    +     +   T  + +SVRF+ ++  +   S+       E  SPNS    K 
Sbjct  197   ADRSERNAALVSPLLATYTQRKNKSVRFESETDLATYGSSSDDWHMKENKSPNSQSAYKP  256

Query  997   SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
             SPYPTPLKL DEMQTPGTV+P  ++ L  G+  ++RSQ+VY    P +N    K +   D
Sbjct  257   SPYPTPLKLFDEMQTPGTVYPASLEELRTGK-AQVRSQFVYPTNKPGDNVFWCKILEERD  315

Query  817   sessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP--SLR  644
                 +DS      SD+ + V+ +     T E G ++ S EN+  V+++LS+ + P  +++
Sbjct  316   FNLEEDS------SDLSDLVEKAQNETPTPEKGSKKFSKENDDEVKSNLSARISPVSTIK  369

Query  643   QSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQK  464
             + S  PF                                 KWW  NGIPNST KYKEDQK
Sbjct  370   EHSPMPF---------------------------------KWWYDNGIPNSTTKYKEDQK  396

Query  463   VSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             V WHATPFEERL+KALS E+ +SQRK + G P+ F+E EESDT LSQL
Sbjct  397   VKWHATPFEERLDKALS-ENFISQRKLVCGKPVEFDEIEESDTTLSQL  443



>ref|NP_172151.2| protein JASON [Arabidopsis thaliana]
 gb|AEE28020.1| uncharacterized protein AT1G06660 [Arabidopsis thaliana]
Length=481

 Score =   220 bits (561),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 182/461 (39%), Positives = 240/461 (52%), Gaps = 82/461 (18%)
 Frame = -3

Query  1576  ASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIP  1397
             A  +++ LS+LF+SEE      S  S  ++K+      +  D K L+D+A+FLKACGTIP
Sbjct  59    AQDSQNDLSALFLSEEK-----SASSPCLDKERFDLDSIHID-KGLRDEARFLKACGTIP  112

Query  1396  ETPLEIRKLSEKCRDLS-AHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDW  1220
             ETP+EIRK S+K   LS  H G                   ++ S+  +S  P K CE+ 
Sbjct  113   ETPIEIRKASQK---LSPQHSGSSHFHS-------WISSSSSMGSRLAESSTPMKACEEV  162

Query  1219  VKESDSPVHTPSSCM----------------TFEEKSNsptvisaspttvppstTCRQRS  1088
              + S +   T SSC+                T  E   +        T  P  T  + +S
Sbjct  163   GRPSFTSEQTASSCVIDVRDNARISSASSDGTEVESVGTAIKGELDRTARPTFTAGKNKS  222

Query  1087  VRFDCkstksdmssalsksSFEVDSPNSK-----ASPYPTPLKLSDEMQTPGTVFPTHVD  923
             VRF+C   +S+ S++    S        K     +SP PTPLKLSDEMQTPGT++P +++
Sbjct  223   VRFECDLDQSNSSNSSENGSSRKPEMGGKICFTVSSPNPTPLKLSDEMQTPGTIYPANME  282

Query  922   NLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVD----  755
             +   GR PRIRSQ+V+S+ N +ENAS  K                 ++ D  E +D    
Sbjct  283   SGGRGR-PRIRSQFVHSVSNIMENASLYK-----------------VYKDSHEGLDYEEQ  324

Query  754   LSSEANATSEIG--LRESSTENNLNVEASLSSWLK------PSLRQSSTQPFGGSIHHGK  599
             + +E  ++   G  + ESS E     EAS S WL        +L + +  P  G I    
Sbjct  325   IEAETPSSETYGEKVEESSDEKLSKFEASFSPWLNQINENIAALNERT--PGVGVI----  378

Query  598   TLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKA  419
             T GDRPI+G+VAA W ENE + +SPK WDGNGIPNST KYKEDQKVSWHATPFE RLEKA
Sbjct  379   TPGDRPIIGLVAAQWIENEQTEISPKMWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKA  438

Query  418   LSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             LSEE   SL  QRK          E  E DT +SQLH+  Q
Sbjct  439   LSEEGGQSLFPQRKLE-----VMMEEVEGDTDISQLHHSVQ  474



>gb|KHN38345.1| hypothetical protein glysoja_004010 [Glycine soja]
Length=452

 Score =   219 bits (557),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 170/445 (38%), Positives = 232/445 (52%), Gaps = 77/445 (17%)
 Frame = -3

Query  1579  VASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTI  1400
             V S NR  LSSL   EE D+      S  ++         + D + LKD+AKFLKACGT+
Sbjct  60    VVSRNR--LSSLLFEEERDD------SARIDGVG-----FQGDFQGLKDEAKFLKACGTL  106

Query  1399  PETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDW  1220
               TP+EIRK SEK +   A D + +  +FH WL ++S+EK  L  QP   P P   C+  
Sbjct  107   TGTPVEIRKASEKLKASPAPDKDSEHSRFHCWLPNTSVEKLQLDVQPFDPPTPINLCQKL  166

Query  1219  VKESDSPVHTPSSCMT-----------FEEKS---------NsptvisaspttvppstTC  1100
                 DS  HTP S ++           + EKS          S   ++     +  +T  
Sbjct  167   GNSMDSFEHTPISFISKAQDTEEDSVDYMEKSWSGNLHTADRSERNVALVSALLATNTQR  226

Query  1099  RQRSVRFDCkstksdmssalsksSF-EVDSPNS----KASPYPTPLKLSDEMQTPGTVFP  935
             + +SVRF+ ++  +   S+       E  SPN+    K SPYPTPLKL DEMQTPGTV+P
Sbjct  227   KNKSVRFESETDLATYGSSSDNRHMKENKSPNNQSAYKPSPYPTPLKLFDEMQTPGTVYP  286

Query  934   THVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVD  755
               ++ L  GR  ++RSQ+VY    P +NA + K +   D    +DS      S++ + V+
Sbjct  287   ASLEELHTGR-AQVRSQFVYPTNKPGDNALRCKILEERDFNPEEDS------SELSDLVE  339

Query  754   LSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPIL  575
              +     T E G +  S EN+  ++++LSS + P                         +
Sbjct  340   KAQNGTPTPEKGSKRFSNEND-EIKSNLSSRISP-------------------------V  373

Query  574   GMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVS  395
               +  H      S +S KWW  NGIPNST KYKEDQKV WHATPFEERL+KALSEE+ +S
Sbjct  374   STIEEH------SPMSFKWWYDNGIPNSTTKYKEDQKVKWHATPFEERLDKALSEENFIS  427

Query  394   QRKRMSGSPISFNETEESDTALSQL  320
             QRK + G P+ F+E EESDTA SQL
Sbjct  428   QRKLVCGKPVEFDEIEESDTASSQL  452



>ref|XP_006304819.1| hypothetical protein CARUB_v10012445mg [Capsella rubella]
 gb|EOA37717.1| hypothetical protein CARUB_v10012445mg [Capsella rubella]
Length=479

 Score =   218 bits (555),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 179/467 (38%), Positives = 240/467 (51%), Gaps = 96/467 (21%)
 Frame = -3

Query  1576  ASSNRSPLSSLFVSEEN-----DEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKA  1412
             A  +++ LS+LF+++       D+E+  L S  ++K             +L+D+A+FLKA
Sbjct  59    AQDSQNDLSALFLAKAASSPCLDKERLDLDSIHIDK-------------DLRDEARFLKA  105

Query  1411  CGTIPETPLEIRKLSEKCRDLSA--HDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPT  1238
             CGTI ETP+EIRK S++   LS+  H G      FHSW+  SS    +L     +SP P 
Sbjct  106   CGTILETPIEIRKASQR---LSSPQHSGSS---HFHSWISSSSAMGSHLA----ESPTPM  155

Query  1237  KDCEDWVKESDSPVHTPSSCMTFE----------------EKSNsptvisaspttvppst  1106
             K CE+  + S +   T SSC+                   E   +        T  P  T
Sbjct  156   KSCEEVGRPSFTSEQTASSCVIDVRDSSRISSASSDSIEVESIGTAIKGELDKTGRPKLT  215

Query  1105  TCRQRSVRFDCkstksdmssals-----------ksSFEVDSPNSKASPYPTPLKLSDEM  959
               + +SVRF+C   +S  S++             K SF V SPN      PTPLKLSDEM
Sbjct  216   AGKTKSVRFECDLDQSHSSNSSENSSSRKPEMGGKYSFTVSSPN------PTPLKLSDEM  269

Query  958   QTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLF  779
             QTPGT++P ++++   GR PRIRSQ+V+S+ N +ENAS  K +                 
Sbjct  270   QTPGTIYPANIESAGRGR-PRIRSQFVHSVSNLMENASLYKSL-----------------  311

Query  778   SDMGESVDLS-SEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHG  602
              D  ES++ + + +++T E  + E+S E     EAS S WL   L   S +    S    
Sbjct  312   HDSHESLEQAETPSSSTYEEKVEETSDEKLSKFEASFSPWLN-QLNDDSDENIAISNDRT  370

Query  601   KTL-----GDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFE  437
               L     GDRPI+G+ AA W EN+ + +SPK WDGNGIPNST KYKEDQKVSWHATPFE
Sbjct  371   PGLAAITPGDRPIIGLAAAQWIENDQTEISPKLWDGNGIPNSTTKYKEDQKVSWHATPFE  430

Query  436   ERLEKALSEES---LVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
              RLEKAL+EE    L   RK          E  E DT LSQL +  Q
Sbjct  431   VRLEKALTEEGCQILFPPRKLE-----VMMEEVEGDTDLSQLQHSVQ  472



>ref|XP_003519537.1| PREDICTED: uncharacterized protein LOC100818713 isoform X1 [Glycine 
max]
Length=452

 Score =   217 bits (552),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 169/445 (38%), Positives = 230/445 (52%), Gaps = 77/445 (17%)
 Frame = -3

Query  1579  VASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTI  1400
             V S NR  LSSL   EE D+      S  ++         + D + LKD+AKFLKACGT+
Sbjct  60    VVSRNR--LSSLLSEEERDD------SARIDGVG-----FQGDFQGLKDEAKFLKACGTL  106

Query  1399  PETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDW  1220
               TP+EIRK SEK +   A D + +  +FH WL ++S+EK  L  QP   P P   C+  
Sbjct  107   TGTPVEIRKASEKLKASPAPDKDSEHSRFHCWLPNTSVEKLQLDVQPFDPPTPINLCQKL  166

Query  1219  VKESDSPVHTPSSCMT-----------FEEKS---------NsptvisaspttvppstTC  1100
                 DS  HTP S ++           + EKS          S    +     +  +T  
Sbjct  167   GNSMDSFEHTPISFISKAQDTEEDSVDYMEKSWSGNLHTADRSERNAALVSALLATNTQR  226

Query  1099  RQRSVRFDCkstksdmssalsksSF-EVDSPNS----KASPYPTPLKLSDEMQTPGTVFP  935
             + +SVRF+ ++  +   S+       E  SPN+    K SPYPTPLKL DEMQTPGTV+P
Sbjct  227   KNKSVRFESETDLATYGSSSDNRHMKENKSPNNQSAYKPSPYPTPLKLFDEMQTPGTVYP  286

Query  934   THVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVD  755
               ++ L  GR  ++RSQ+VY    P +N  + K +   D    +DS      S++ + V+
Sbjct  287   ASLEELHTGR-AQVRSQFVYPTNKPGDNVLRCKILKERDFNPEEDS------SELSDLVE  339

Query  754   LSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPIL  575
              +     T E G +  S EN+  ++++LSS + P                         +
Sbjct  340   KAQNGTPTPEKGSKRFSNEND-EIKSNLSSRISP-------------------------V  373

Query  574   GMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVS  395
               +  H      S +S KWW  NGIPNST KYKEDQKV WHATPFEERL+KALSEE+ +S
Sbjct  374   STIEEH------SPMSFKWWYDNGIPNSTTKYKEDQKVKWHATPFEERLDKALSEENFIS  427

Query  394   QRKRMSGSPISFNETEESDTALSQL  320
             QRK + G P+ F+E EESDTA SQL
Sbjct  428   QRKLVCGKPVEFDEIEESDTASSQL  452



>ref|NP_001239769.1| uncharacterized protein LOC100799259 [Glycine max]
 gb|ACU19641.1| unknown [Glycine max]
Length=443

 Score =   216 bits (549),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 160/408 (39%), Positives = 216/408 (53%), Gaps = 69/408 (17%)
 Frame = -3

Query  1462  LEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIE  1283
              E D + LKD+A FLKACGT+  TP EIRK SEK + L A D + DP +FHSWL ++S+E
Sbjct  78    FEGDFQGLKDEAMFLKACGTLAGTPAEIRKASEKLKSL-APDKDSDPSRFHSWLPNTSVE  136

Query  1282  KQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMT-----------FEEKS-------  1157
             K  L  QP   P P   C+      DS  HTPSS ++           + EK+       
Sbjct  137   KLQLDVQPFDPPTPINLCQKLGNSMDSFEHTPSSRISKAQDTEDDSVDYMEKNWSGNLHT  196

Query  1156  --NsptvisaspttvppstTCRQRSVRFDCkstksdmssalsksSF-EVDSPNS----KA  998
                S    +     +   T  + +SVRF+ ++  +   S+       E  SPNS    K 
Sbjct  197   ADRSERNAALVSPLLATYTQRKNKSVRFESETDLATYGSSSDDWHMKENKSPNSQSAYKP  256

Query  997   SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
             SPYPTPLKL DEMQTPGTV+P  ++ L  G+  ++RSQ+VY    P +N    K +   D
Sbjct  257   SPYPTPLKLFDEMQTPGTVYPASLEELRTGK-AQVRSQFVYPTNKPGDNVFWCKILEERD  315

Query  817   sessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKP--SLR  644
                 +DS      S++ + V+ +     T E G ++ S EN+  V+++LS+ + P  +++
Sbjct  316   FNLEEDS------SELSDLVEKAQNETPTPEKGSKKFSKENDDEVKSNLSARISPVSTIK  369

Query  643   QSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQK  464
             + S  PF                                 KWW  NGIPNST KYKEDQK
Sbjct  370   EHSPMPF---------------------------------KWWYDNGIPNSTTKYKEDQK  396

Query  463   VSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             V WHATPFEERL+KALS E+ +SQRK + G P+ F+E EESDT LSQL
Sbjct  397   VKWHATPFEERLDKALS-ENFISQRKLVCGKPVEFDEIEESDTTLSQL  443



>ref|XP_006575641.1| PREDICTED: uncharacterized protein LOC100818713 isoform X2 [Glycine 
max]
Length=451

 Score =   215 bits (548),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 157/403 (39%), Positives = 214/403 (53%), Gaps = 64/403 (16%)
 Frame = -3

Query  1453  DVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQN  1274
             D + LKD+AKFLKACGT+  TP+EIRK SEK +   A D + +  +FH WL ++S+EK  
Sbjct  88    DFQGLKDEAKFLKACGTLTGTPVEIRKASEKLKASPAPDKDSEHSRFHCWLPNTSVEKLQ  147

Query  1273  LVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMT-----------FEEKS---------N  1154
             L  QP   P P   C+      DS  HTP S ++           + EKS          
Sbjct  148   LDVQPFDPPTPINLCQKLGNSMDSFEHTPISFISKAQDTEEDSVDYMEKSWSGNLHTADR  207

Query  1153  sptvisaspttvppstTCRQRSVRFDCkstksdmssalsksSF-EVDSPNS----KASPY  989
             S    +     +  +T  + +SVRF+ ++  +   S+       E  SPN+    K SPY
Sbjct  208   SERNAALVSALLATNTQRKNKSVRFESETDLATYGSSSDNRHMKENKSPNNQSAYKPSPY  267

Query  988   PTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedses  809
             PTPLKL DEMQTPGTV+P  ++ L  GR  ++RSQ+VY    P +N  + K +   D   
Sbjct  268   PTPLKLFDEMQTPGTVYPASLEELHTGR-AQVRSQFVYPTNKPGDNVLRCKILKERDFNP  326

Query  808   sqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQ  629
              +DS      S++ + V+ +     T E G +  S EN+  ++++LSS + P        
Sbjct  327   EEDS------SELSDLVEKAQNGTPTPEKGSKRFSNEND-EIKSNLSSRISP--------  371

Query  628   PFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHA  449
                              +  +  H      S +S KWW  NGIPNST KYKEDQKV WHA
Sbjct  372   -----------------VSTIEEH------SPMSFKWWYDNGIPNSTTKYKEDQKVKWHA  408

Query  448   TPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
             TPFEERL+KALSEE+ +SQRK + G P+ F+E EESDTA SQL
Sbjct  409   TPFEERLDKALSEENFISQRKLVCGKPVEFDEIEESDTASSQL  451



>ref|XP_006410181.1| hypothetical protein EUTSA_v10017740mg, partial [Eutrema salsugineum]
 gb|ESQ51634.1| hypothetical protein EUTSA_v10017740mg, partial [Eutrema salsugineum]
Length=417

 Score =   212 bits (540),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 178/450 (40%), Positives = 232/450 (52%), Gaps = 63/450 (14%)
 Frame = -3

Query  1573  SSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPE  1394
             S NR  LS+LF+SEE  +      S     +D    E     K LKD+A+FLK CGT   
Sbjct  5     SKNR--LSTLFLSEEKAD------SSPCHDRDGSRAEFMHIDKGLKDEAQFLKPCGTTVV  56

Query  1393  TPLEIRKLSEKCR--DLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDW  1220
             TP+EIRK SEK    + + H       + HSW   +S    +L  + D+       C + 
Sbjct  57    TPIEIRKASEKLETPERAKH---FTSSQLHSWTSSNSDAAFHLDEKTDEL------CGE-  106

Query  1219  VKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTCR-------------------  1097
             V E      TPSSCMT    S   +   +        TT R                   
Sbjct  107   VSE-----QTPSSCMTDARSSTIISTGYSDAGEESIGTTFRDGVDRTSEVPLTAGNITGK  161

Query  1096  QRSVRFDCkstksdmssalsksSFEVDSP--NSKASPYPTPLKLSDEMQTPGTVFPTHVD  923
             + SVRF+C   KS  SS+   S+     P  + K+    T LKLSDE+QTPGT+FP +++
Sbjct  162   RNSVRFECDFDKSYSSSSSQISTSYSKVPEKDGKSKFSATSLKLSDEIQTPGTIFPANME  221

Query  922   NLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSE  743
             +    +  +IRSQ+V+S  N IENAS     I +  E + +S          E  +  S 
Sbjct  222   SAVREKRTQIRSQFVHSASNLIENAS-----ICKLPEDADESLQPAKVQACKEKTENESP  276

Query  742   ANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVA  563
              +A SE  L ESS E     E ++S  +K S  +S+            TLGDRPI+GMVA
Sbjct  277   TSAISEGKLEESSDEKYQTCETNISPTVKQSHEKSNKNMAALPT---ITLGDRPIIGMVA  333

Query  562   AHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEE---SLVSQ  392
             AHWNE E S++SPKWWDGNGIPNST+KYKEDQKVSWHAT FEERLEKALSEE     +  
Sbjct  334   AHWNEKEQSQISPKWWDGNGIPNSTNKYKEDQKVSWHATSFEERLEKALSEEGGQGFIPS  393

Query  391   RKRMSGSPISFNETEESDTALSQLHNGNQS  302
             RK      I   +  E DTA+S++H+ +QS
Sbjct  394   RK------IGIIKEAERDTAISEMHHSSQS  417



>ref|XP_010942510.1| PREDICTED: uncharacterized protein LOC105060482 isoform X1 [Elaeis 
guineensis]
 ref|XP_010942518.1| PREDICTED: uncharacterized protein LOC105060482 isoform X1 [Elaeis 
guineensis]
Length=491

 Score =   213 bits (542),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 184/498 (37%), Positives = 253/498 (51%), Gaps = 86/498 (17%)
 Frame = -3

Query  1627  RPPFVSKSLTPT-AAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             R   +  S TP+ + E + S N+  L+S+F+ EE  EE S  +  +V  +D    +   +
Sbjct  16    RKAHIFSSSTPSMSTEKLPSKNQ--LASVFLREE--EEVSPHE--QVRHKDNVDKDSSLE  69

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
              ++LK +AKFLK+CG + ETP EIRK SE+          + P +F SWL  ++  K   
Sbjct  70    -RQLKHEAKFLKSCGALLETPAEIRKASERVIQQIPDQDCMLP-QFDSWLSGTAGRKLLW  127

Query  1270  VSQPDQSPKPTKDCEDWVKESDSP-VHTPSSCMTFEEKSNsptvisaspttvppstTCRQ  1094
               Q  Q PK  +  ED      SP V T        E  N+         +V P  + R 
Sbjct  128   DEQHGQLPKTPQTHEDSGFSEKSPEVFT-------SEGHNTLRHFENIMPSVSPIKSLRS  180

Query  1093  RSVRFDCkstksdmssalsksSFEVD--SP-NSKASPYPTPLKLSDEMQTPGTVFPTHVD  923
               V+ +        +      S +    SP  SK SP+PTPLKL+DEMQTP TV+P++++
Sbjct  181   EGVKHEAGVKSGKGAVTDMSPSRKESQFSPFASKCSPFPTPLKLTDEMQTPATVYPSNLE  240

Query  922   NLANGRFPRIRSQYVYSILNPI-----------------ENASQMKEVInedsessqdsn  794
                  +  RIR+QYV S+LNP+                 E+  Q ++   +  ++ + + 
Sbjct  241   KFRTEKSTRIRTQYVNSVLNPVENISQWKLLSEGCSHPGESHDQFEQRNGDSPDTKKKTE  300

Query  793   SKLLFSD--------------------------------MGES-VDLSSEANATSEIGLR  713
               LL SD                                 GES   L++  ++  ++  R
Sbjct  301   QALLTSDPKNSKLTSSSRPTMLNEKTSQNDGVIYKDKYVCGESSFSLATPLHSKEKVPFR  360

Query  712   ESSTENNLNVEASLSSWLKPSLRQSSTQPFGGS-------IHHGKTL-GDRPILGMVAAH  557
               S++    V  SLS WL+P     +T   GG+        H GK+  GDRPILGMVAAH
Sbjct  361   SDSSQI---VVTSLSQWLRPP----TTNNKGGNEIMTKERSHSGKSSDGDRPILGMVAAH  413

Query  556   WNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMS  377
             WNE E  R+SPK WDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E+ + QRK + 
Sbjct  414   WNEEEPDRISPKTWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSDENFLPQRKCLK  473

Query  376   GSPISF-NETEESDTALS  326
             G P+ F NE EESDTA S
Sbjct  474   GKPVRFENEGEESDTAAS  491



>ref|XP_007141439.1| hypothetical protein PHAVU_008G195700g [Phaseolus vulgaris]
 gb|ESW13433.1| hypothetical protein PHAVU_008G195700g [Phaseolus vulgaris]
Length=443

 Score =   209 bits (533),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 155/406 (38%), Positives = 217/406 (53%), Gaps = 68/406 (17%)
 Frame = -3

Query  1462  LEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIE  1283
              + D ++LKD+AKFLKACGT+  TP+EI K SEK +   + D   DP +FH+W  ++S+E
Sbjct  78    FQGDFQDLKDEAKFLKACGTLTGTPIEICKASEKLKTSPSPD---DPSRFHTWFPNTSVE  134

Query  1282  KQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMT--------------------FEE  1163
             K     QP   P P K C+ W    DS  HTPSSC++                       
Sbjct  135   KLQPDVQPFDQPTPIKLCQKWGNSMDSFEHTPSSCISKAQDTQDDSVDCIEKSYAGILHR  194

Query  1162  KSNsptvisaspttvppstTCRQRSVRFDCkstksdmssalsk-sSFEVDSPNS-----K  1001
             +  S    +     +P +T  + +SVRF+ ++  +   S+     + E  SPN+     +
Sbjct  195   EDRSERNAALVSPLLPANTQRKNKSVRFENETDLASYGSSSDDWHTKENKSPNNHQSAYR  254

Query  1000  ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIne  821
              SPYPTPLKL DEMQTPGTV+P  ++ L +G+  ++R Q+VY   NP +N  + K + + 
Sbjct  255   QSPYPTPLKLFDEMQTPGTVYPASLEQLQSGK-AQVRCQFVYPTNNPSDNIFRCKILEDG  313

Query  820   dsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQ  641
             DS   +DS      S++ + VD S     T E GL++ S       ++ LSS L P    
Sbjct  314   DSNPEEDS------SELSDLVDQSQNGTPTPEEGLKKISNGYENEEKSILSSRLTP----  363

Query  640   SSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKV  461
                                  L ++       E S +S KWW GNGIPNST KYKEDQKV
Sbjct  364   ---------------------LSVI------EENSPISLKWWYGNGIPNSTTKYKEDQKV  396

Query  460   SWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQ  323
              WHATPFEERL+KALS E+ +S+RK + G P+ F++ EE+DTA SQ
Sbjct  397   KWHATPFEERLDKALS-ENFISKRKLVRGKPVEFDDIEENDTASSQ  441



>ref|XP_007141440.1| hypothetical protein PHAVU_008G195700g [Phaseolus vulgaris]
 gb|ESW13434.1| hypothetical protein PHAVU_008G195700g [Phaseolus vulgaris]
Length=442

 Score =   209 bits (532),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 155/406 (38%), Positives = 217/406 (53%), Gaps = 68/406 (17%)
 Frame = -3

Query  1462  LEFDVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIE  1283
              + D ++LKD+AKFLKACGT+  TP+EI K SEK +   + D   DP +FH+W  ++S+E
Sbjct  77    FQGDFQDLKDEAKFLKACGTLTGTPIEICKASEKLKTSPSPD---DPSRFHTWFPNTSVE  133

Query  1282  KQNLVSQPDQSPKPTKDCEDWVKESDSPVHTPSSCMT--------------------FEE  1163
             K     QP   P P K C+ W    DS  HTPSSC++                       
Sbjct  134   KLQPDVQPFDQPTPIKLCQKWGNSMDSFEHTPSSCISKAQDTQDDSVDCIEKSYAGILHR  193

Query  1162  KSNsptvisaspttvppstTCRQRSVRFDCkstksdmssalsk-sSFEVDSPNS-----K  1001
             +  S    +     +P +T  + +SVRF+ ++  +   S+     + E  SPN+     +
Sbjct  194   EDRSERNAALVSPLLPANTQRKNKSVRFENETDLASYGSSSDDWHTKENKSPNNHQSAYR  253

Query  1000  ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIne  821
              SPYPTPLKL DEMQTPGTV+P  ++ L +G+  ++R Q+VY   NP +N  + K + + 
Sbjct  254   QSPYPTPLKLFDEMQTPGTVYPASLEQLQSGK-AQVRCQFVYPTNNPSDNIFRCKILEDG  312

Query  820   dsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQ  641
             DS   +DS      S++ + VD S     T E GL++ S       ++ LSS L P    
Sbjct  313   DSNPEEDS------SELSDLVDQSQNGTPTPEEGLKKISNGYENEEKSILSSRLTP----  362

Query  640   SSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKV  461
                                  L ++       E S +S KWW GNGIPNST KYKEDQKV
Sbjct  363   ---------------------LSVIE------ENSPISLKWWYGNGIPNSTTKYKEDQKV  395

Query  460   SWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQ  323
              WHATPFEERL+KALS E+ +S+RK + G P+ F++ EE+DTA SQ
Sbjct  396   KWHATPFEERLDKALS-ENFISKRKLVRGKPVEFDDIEENDTASSQ  440



>ref|XP_006853377.1| hypothetical protein AMTR_s00032p00131610 [Amborella trichopoda]
 gb|ERN14844.1| hypothetical protein AMTR_s00032p00131610 [Amborella trichopoda]
Length=529

 Score =   207 bits (526),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 199/529 (38%), Positives = 256/529 (48%), Gaps = 103/529 (19%)
 Frame = -3

Query  1639  DHASRPPFVSKSLTPTAAEPVASSNRSPLSSLFV-SEENDEEKSSLQSKEVEKQDCGTPE  1463
             D   R   +S++++  + + + S N  P+SS F+ S EN++   SL +KE +      P 
Sbjct  13    DDRPRGHLISEAVSSKSRDHLVSQN--PISSAFIYSSENNKVDLSL-AKEGKSSPGKDPV  69

Query  1462  LEF------------DVKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPL  1319
             +              D  EL+++ KFLK+CG + ETP+EIRK   K  +   H  E    
Sbjct  70    ISSGNSKGNNVAESDDDLELRNEVKFLKSCGALLETPMEIRKAYLKP-NAQPH-AEDAAN  127

Query  1318  KFHSWLLDSSIEKQNLVSQ-------------PDQSPKPTKDCEDWV--KESDSP-----  1199
             +FHSWL  SS  + +   Q             P  SPK T D +     K   SP     
Sbjct  128   EFHSWLPSSSCRQLHWDDQNDQFPTFHISDLSPSHSPKSTSDEQKLSERKLRGSPRGSGV  187

Query  1198  ------VHTPSSCMTFEEKSNsptvisasptt-vppstTCRQRSVRFDCkstksdmssal  1040
                   V       T   KS+S T  S SP      +   + RSVRF C      +S   
Sbjct  188   QSILDTVMPSREFSTINSKSDSLTNPSTSPIIPSVGAMQTKNRSVRFACDEVSPVLSDKG  247

Query  1039  sksSFEVDSPNSKA--------------------SPYPTPLKLSDEMQTPGTVFPTHVDN  920
             S SS    S N++                     SPYPTPLKLSDEMQTPGTVFP   +N
Sbjct  248   SISSENSPSKNNEVWTKNSYFEDHKQSQPQIANYSPYPTPLKLSDEMQTPGTVFPNSHNN  307

Query  919   LANGRFPRIRSQYVYSILNPIENASQMK------EVInedsessqdsnSKLLFSDMGE--  764
             L   +  RIRSQYVY +LNP+EN +Q        + +    E  + ++ K+     G   
Sbjct  308   LLISKNVRIRSQYVYPVLNPVENLTQWMTLKADPKYLVSQPEKERSNSEKMKIQSQGNKS  367

Query  763   -SVD---------------LSSEANATSE-----IGLRESSTENNLNVEASLSSWLKPSL  647
              SVD               +S+E  A++E      G+R    E   +VE+SLS WLKPS 
Sbjct  368   GSVDKQYVTEVERHDSIEKISAEKLASNEEFSIQNGMR--CAEARSSVESSLSDWLKPSQ  425

Query  646   RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENET--SRVSPKWWDGNGIPNSTHKYKE  473
                 T   G       +  DRPILG VAA WN+ +   + VSPK WDGNGIPNST+KYKE
Sbjct  426   NNGLTVGNGKPNSVKSSDSDRPILGTVAAFWNDCDEVPTSVSPKSWDGNGIPNSTNKYKE  485

Query  472   DQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALS  326
             DQKVSWHATPFEERLEKALS E+L  QRK M     +F E EE DTA S
Sbjct  486   DQKVSWHATPFEERLEKALSNENLYPQRKLM-----NFEEGEEYDTAAS  529



>ref|XP_007146237.1| hypothetical protein PHAVU_006G023700g [Phaseolus vulgaris]
 gb|ESW18231.1| hypothetical protein PHAVU_006G023700g [Phaseolus vulgaris]
Length=412

 Score =   198 bits (504),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 167/448 (37%), Positives = 210/448 (47%), Gaps = 108/448 (24%)
 Frame = -3

Query  1579  VASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKD--QAKFLKACG  1406
             V S NR  LS+LF+SEE             E  D      +FDV+  K   +AKFLKA G
Sbjct  35    VVSRNR--LSTLFLSEER------------EDSDVRDGVKDFDVRSQKGGTEAKFLKAGG  80

Query  1405  TIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCE  1226
             T    P E             H G                      S P     P K CE
Sbjct  81    TSARIPFE-----------KVHHG----------------------SPPFNPSTPIKCCE  107

Query  1225  DWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTC------------------  1100
             +  K +D    TPSSC++  + S   ++ S          +                   
Sbjct  108   EGGKRTDYFEQTPSSCISNAQSSQCASLDSTEGIRTRNHQSLDKNENTASVSPWPSITYT  167

Query  1099  -RQRSVRFDCkstksdmssalsksSF--EVDSPNS----KASPYPTPLKLSDEMQTPGTV  941
              R +SVRF C +  S    +        + DSPN+    K SPYPTP+KLS+EMQTPGTV
Sbjct  168   KRNKSVRFKCDADLSSCDLSDCGGRHMKKTDSPNNESAYKPSPYPTPMKLSEEMQTPGTV  227

Query  940   FPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGES  761
             +PT  ++  N R PR+RSQ+VY I NP +N S   E++ ED  +            + ES
Sbjct  228   YPTTKEDFPNVR-PRLRSQFVYPINNPDDNVSH--EILEEDGHTQDSRK-------LSES  277

Query  760   VDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRP  581
             V  S    +TS+ G +  S E+   VE SLSSWLKP+      +     I +  TLG   
Sbjct  278   VQHSEITASTSDKGSKNISCEDECKVEESLSSWLKPAAVILEERNRRMQIAYNHTLG---  334

Query  580   ILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESL  401
                                   DGNGIPNST+KY+EDQKV+WHATPFEERLEKALSEES+
Sbjct  335   ---------------------CDGNGIPNSTNKYQEDQKVNWHATPFEERLEKALSEESV  373

Query  400   VSQRKRMSGSPISFNETEESDTALSQLH  317
             +SQRK   G  I F+E EESDTALSQL 
Sbjct  374   ISQRKDACGKSIPFDENEESDTALSQLQ  401



>ref|XP_008806685.1| PREDICTED: uncharacterized protein LOC103719285 [Phoenix dactylifera]
Length=499

 Score =   199 bits (507),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 159/286 (56%), Gaps = 66/286 (23%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVI  827
             SK SP+PTPLKL++EMQTP TV+P++++     +  RIR+QYV S+LNP+EN SQ K + 
Sbjct  221   SKCSPFPTPLKLTEEMQTPATVYPSNLEKFRTEKSTRIRTQYVNSVLNPVENISQWKLLC  280

Query  826   nedse-----------------ssqdsnSKLLFSD-------------------------  773
                                   + + +  KLL SD                         
Sbjct  281   RGCGNPGESHDHFEQKNNDSPDTKEKTEQKLLISDPNNSKLTSSPRPTMLNDKTSQNDEV  340

Query  772   -------MGES-VDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGG  617
                     GES   L++      ++  R  S++    V  SLS WLKP     +T   GG
Sbjct  341   IYKDKYVCGESSFGLATPLRGKEKVPFRSDSSQI---VVTSLSQWLKPP----TTNNKGG  393

Query  616   S-------IHHGKTL-GDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKV  461
             +        H GK+  GDRPILGMVAAHWNE E   +SPK WDGNGIPNST+KYKEDQKV
Sbjct  394   NEIMTKERSHSGKSSDGDRPILGMVAAHWNEEEPDHISPKRWDGNGIPNSTNKYKEDQKV  453

Query  460   SWHATPFEERLEKALSEESLVSQRKRMSGSPISF-NETEESDTALS  326
             SWHATPFEERLEKALS+E+ + QRK + G P+ F NE EESDTA S
Sbjct  454   SWHATPFEERLEKALSDENFLPQRKCLKGKPVKFENEGEESDTAAS  499



>ref|XP_007146236.1| hypothetical protein PHAVU_006G023700g [Phaseolus vulgaris]
 gb|ESW18230.1| hypothetical protein PHAVU_006G023700g [Phaseolus vulgaris]
Length=372

 Score =   189 bits (480),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 151/399 (38%), Positives = 189/399 (47%), Gaps = 92/399 (23%)
 Frame = -3

Query  1438  KDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQP  1259
             K  AKFLKA GT    P E             H G                      S P
Sbjct  30    KPDAKFLKAGGTSARIPFE-----------KVHHG----------------------SPP  56

Query  1258  DQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTC-------  1100
                  P K CE+  K +D    TPSSC++  + S   ++ S          +        
Sbjct  57    FNPSTPIKCCEEGGKRTDYFEQTPSSCISNAQSSQCASLDSTEGIRTRNHQSLDKNENTA  116

Query  1099  ------------RQRSVRFDCkstksdmssalsksSF--EVDSPNS----KASPYPTPLK  974
                         R +SVRF C +  S    +        + DSPN+    K SPYPTP+K
Sbjct  117   SVSPWPSITYTKRNKSVRFKCDADLSSCDLSDCGGRHMKKTDSPNNESAYKPSPYPTPMK  176

Query  973   LSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsn  794
             LS+EMQTPGTV+PT  ++  N R PR+RSQ+VY I NP +N S   E++ ED  +     
Sbjct  177   LSEEMQTPGTVYPTTKEDFPNVR-PRLRSQFVYPINNPDDNVSH--EILEEDGHTQDSRK  233

Query  793   SKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGS  614
                    + ESV  S    +TS+ G +  S E+   VE SLSSWLKP+      +     
Sbjct  234   -------LSESVQHSEITASTSDKGSKNISCEDECKVEESLSSWLKPAAVILEERNRRMQ  286

Query  613   IHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEE  434
             I +  TLG                         DGNGIPNST+KY+EDQKV+WHATPFEE
Sbjct  287   IAYNHTLG------------------------CDGNGIPNSTNKYQEDQKVNWHATPFEE  322

Query  433   RLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLH  317
             RLEKALSEES++SQRK   G  I F+E EESDTALSQL 
Sbjct  323   RLEKALSEESVISQRKDACGKSIPFDENEESDTALSQLQ  361



>gb|AAM13918.1| unknown protein [Arabidopsis thaliana]
Length=337

 Score =   185 bits (469),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 149/256 (58%), Gaps = 50/256 (20%)
 Frame = -3

Query  1027  FEVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENA  848
             F V SPN      PTPLKLSDEMQTPGT++P ++++   GR PRIRSQ+V+S+ N +ENA
Sbjct  110   FTVSSPN------PTPLKLSDEMQTPGTIYPANMESGGRGR-PRIRSQFVHSVSNIMENA  162

Query  847   SQMKEVInedsessqdsnSKLLFSDMGESVD----LSSEANATSEIG--LRESSTENNLN  686
             S  K                 ++ D  E +D    + +E  ++   G  + ESS E    
Sbjct  163   SLYK-----------------VYKDSHEGLDYEEQIEAETPSSETYGEKVEESSDEKLSK  205

Query  685   VEASLSSWLK------PSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSP  524
              EAS S WL        +L + +  P  G I    T GDRPI+G+VAA W ENE + +SP
Sbjct  206   FEASFSPWLNQINENIAALNERT--PGVGVI----TPGDRPIIGLVAAQWIENEQTEISP  259

Query  523   KWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNE  353
             K WDGNGIPNST KYKEDQKVSWHATPFE RLEKALSEE   SL  QRK          E
Sbjct  260   KMWDGNGIPNSTTKYKEDQKVSWHATPFEVRLEKALSEEGGQSLFPQRKLE-----VMME  314

Query  352   TEESDTALSQLHNGNQ  305
               E DT +SQLH+  Q
Sbjct  315   EVEGDTDISQLHHSVQ  330



>ref|XP_008777000.1| PREDICTED: uncharacterized protein LOC103697018 [Phoenix dactylifera]
Length=503

 Score =   189 bits (480),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 153/427 (36%), Positives = 217/427 (51%), Gaps = 72/427 (17%)
 Frame = -3

Query  1447  KELKDQAKFLKACGTIPETPLEIRKLSEKCR-DLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
             ++L+ +AK+LK+CG++PETP EIR+ S K        DGE     FHSWL  +S +K   
Sbjct  92    RDLEHEAKYLKSCGSLPETPAEIRRASGKINVQTPKEDGEHP--DFHSWLPVASCKKL--  147

Query  1270  VSQPDQSPKPTKDCEDWV-KESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTCRQ  1094
               Q D+   P  D    V   SD P H    C + E ++ +  V       V    +  +
Sbjct  148   --QWDEQLNPISDAPIQVDNNSDFPEHKSGGCNSDEHQTLTKIVQCEEIKHVSTVESVVE  205

Query  1093  RSVRFDCkstksdmssalsksSFEVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLA  914
              ++  D   +K D          +V     K S + TPL L++EMQTPGTV+PT+ +NL 
Sbjct  206   SAI-LDISPSKGD----------KVPVLGFKDSTHSTPLTLTEEMQTPGTVYPTNQENLR  254

Query  913   NGRFPRIRSQYVYSILNP----------------IENASQMKEVInedsessqdsnSKLL  782
              GR   I++QYVY +L P                I +A+  ++     S  S+    ++ 
Sbjct  255   AGRNGGIQTQYVYPVLKPVENLPHLKALRQDACLIRSANHSEQEKETFSPDSRGRTQQIS  314

Query  781   F------SDMGESVDLSSEANATSE----IGLRES-------------STENNLN-----  686
             F      S + +S   SS  N  S+    I   ES             ++  +LN     
Sbjct  315   FTPAHEDSKLLDSPSFSSPNNKISQDQYTISREESVHCKSLSSLNPPFNSRKHLNSNADT  374

Query  685   ---VEASLSSWLKPSLRQSSTQPFGGSIHH-----GKTLGDRPILGMVAAHWNENETSRV  530
                V +SLS WLKP L +   +               +  DRPI+G+VA+HWN +E SR+
Sbjct  375   PKLVVSSLSQWLKPPLPKDEIRNIKNITKEQPCSEKSSDVDRPIIGIVASHWNPDELSRI  434

Query  529   SPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISF-NE  353
             SP+WWDGNGIPN+T KYKED+KVSWHATPFEERLEKALS+E L+ +R  ++G PI F ++
Sbjct  435   SPRWWDGNGIPNTTTKYKEDRKVSWHATPFEERLEKALSDEKLLPKRNLLNGRPIVFEDD  494

Query  352   TEESDTA  332
              EE + A
Sbjct  495   GEEKNKA  501



>ref|XP_008811132.1| PREDICTED: uncharacterized protein LOC103722372 [Phoenix dactylifera]
Length=406

 Score =   184 bits (466),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 138/385 (36%), Positives = 195/385 (51%), Gaps = 48/385 (12%)
 Frame = -3

Query  1429  AKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQS  1250
             AK+LK+CG + ETP EIR  S K    +  + +V  L FHSWL  +S +K     Q D+ 
Sbjct  38    AKYLKSCGALLETPAEIRTASGKIIIQTPQEDDVH-LDFHSWLPAASCKKL----QWDEQ  92

Query  1249  PKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTCRQRSVRFDCk  1070
               P  D    V  SD   H    C + E +  +  V       V    +  + ++  D  
Sbjct  93    VNPISDSPTHVDNSDYLEHISRGCNSDERQIVAKVVQCEEIKHVSAVESIVESAI-LDIS  151

Query  1069  stksdmssalsksSFEVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIR  890
              +K+D          +V    S  SPYPTPL L+DEMQTPGT+ PT+ +N+   +  RIR
Sbjct  152   PSKADS---------KVAVLGSNDSPYPTPLNLTDEMQTPGTLHPTNQENIRTWKNGRIR  202

Query  889   SQYVYSILNPIENASQ---MKEVInedsessqdsnSKLL-------------------FS  776
             +QYVY +L  +EN S    ++E  +    +      K                     +S
Sbjct  203   TQYVYPVLRHVENLSHWKALREEPSLIQSADHSEQEKKFPSPDFTGRAQPISFTPAPTYS  262

Query  775   DMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKT  596
              + ES   S      +++  R S  E     + SLSS   P+L   S      ++   + 
Sbjct  263   KLFESASFSCPNEMINQVQNRGSREEPVH--DKSLSS---PALLFKSVDQLTSNVDTPEL  317

Query  595   LGD------RPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEE  434
             +        +PI+G+VA+ WN +E S +SPKWWDGNGIPN+T KYKED+KVSWHATPFE+
Sbjct  318   VISSLSQQLKPIIGIVASQWNADELSCISPKWWDGNGIPNTTTKYKEDKKVSWHATPFED  377

Query  433   RLEKALSEESLVSQRKRMSGSPISF  359
             RLEKALS+E L+S+RK ++G P  F
Sbjct  378   RLEKALSDEKLLSKRKLLNGRPTEF  402



>gb|EYU42807.1| hypothetical protein MIMGU_mgv11b007351mg [Erythranthe guttata]
Length=358

 Score =   179 bits (455),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 112/153 (73%), Gaps = 8/153 (5%)
 Frame = -3

Query  751  SSEANATSEIGLRESSTEN-NLNVEASLSSWLKP------SLRQSSTQPFGGSIHHGKTL  593
            SS++N   E  L+ +  +N ++N E+SLSSW KP         + S   +G  +H GKT 
Sbjct  195  SSDSNHLREQPLKLNDEDNEDVNSESSLSSWFKPVSDKRDCSNEESGSVYGKKVHKGKTP  254

Query  592  GDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             DRPI+GMVAAHWN++ T+ +SPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS
Sbjct  255  KDRPIIGMVAAHWNDDVTTHISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALS  314

Query  412  EESLVSQRKRMSGS-PISFNETEESDTALSQLH  317
            EE+ +SQRK  SG  P+ F ETEE DTALS L 
Sbjct  315  EETFISQRKTTSGKPPLEFKETEECDTALSHLQ  347


 Score = 85.5 bits (210),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 69/117 (59%), Gaps = 8/117 (7%)
 Frame = -3

Query  1594  TAAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLK  1415
             T  E V SS+++ LSSLFV +++   K     K        TP    DV ELK +AKF+K
Sbjct  19    TPRENVTSSSKNALSSLFVCDDDSVRKGEEGRK--------TPAPVLDVSELKIEAKFVK  70

Query  1414  ACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPK  1244
              C T+PETP+EIRK  +K  D SA + E   ++F SWL DSSIEK  L  Q D SP+
Sbjct  71    TCETLPETPVEIRKTLDKWEDKSAQNKEEKSVEFDSWLPDSSIEKPKLEKQSDASPR  127



>emb|CDP08374.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   179 bits (454),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 143/427 (33%), Positives = 200/427 (47%), Gaps = 89/427 (21%)
 Frame = -3

Query  1423  FLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPK  1244
              ++AC T+ ETP    +  EK  +LSA  G  +  +  SW+ ++S+E+++L  + +Q   
Sbjct  1     MMQACRTLRETPANFCQAPEKWNNLSAQKGGSENSRCRSWITNTSVEERDLEVKFEQPLT  60

Query  1243  PTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTCR-----------  1097
             P K C  WVK S S  H  SSCMT  + +   +  S     +  + +             
Sbjct  61    PVKCCGRWVKVSGSLEHKSSSCMTNRQNAGRVSTSSTEGKEIEDAGSVELIASSRNGLTG  120

Query  1096  ---------------QRSVRFDCkstksdmssalsksSFEVDSPN----------SKASP  992
                             +SV FDC S  S ++S    S     S N          + +S 
Sbjct  121   SLATPRDISPFIIGENKSVEFDCYSDTSSVTSENYSSETSTQSLNQSGSASNLSTANSSC  180

Query  991   YPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedse  812
             YPTP+KLSD+MQT G VFP ++D     +  RI S Y+YS+LNP+EN SQ K++ NED+ 
Sbjct  181   YPTPIKLSDKMQTSGIVFPVYLDAFGQDKNTRITSLYLYSVLNPVENFSQWKQLKNEDTN  240

Query  811   ssqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWL---KPSLRQ  641
               Q+       S + E      +    S++G   +S    L VEAS SSW    +   R 
Sbjct  241   DHQN-------SHIKEPCVRVDKETPMSDVGTGGTSAGQELKVEASWSSWSSWPRALFRD  293

Query  640   SSTQP------FGGSIHHGKTLGDRPILGMVAAHWNENET--------------------  539
                 P       G + H  +   DR ILGM A+ W+++E+                    
Sbjct  294   PDGDPEHNEFAAGENSHCRRIQVDRSILGMDASDWDKDESHVSPKWWNGNGVPNSTDKYK  353

Query  538   -----------------SRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSE  410
                                VSPKWWDGNGIPN+THKY+ED+KV WH TPFEERLEKAL E
Sbjct  354   EVWAMCWIKFQGRIHKCKEVSPKWWDGNGIPNTTHKYREDRKVCWHETPFEERLEKALFE  413

Query  409   ESLVSQR  389
             E+ + QR
Sbjct  414   ETFIRQR  420



>ref|XP_010462500.1| PREDICTED: uncharacterized protein LOC104743076 [Camelina sativa]
Length=280

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 143/231 (62%), Gaps = 14/231 (6%)
 Frame = -3

Query  997  SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
            SP PTPL+LSDEMQTPGT++P+++++   GR PRIRSQ+V+S+ N +ENAS  K V+N+ 
Sbjct  51   SPNPTPLRLSDEMQTPGTIYPSNMESAGRGR-PRIRSQFVHSVSNVMENASLYK-VLNDA  108

Query  817  sessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQS  638
              S Q +  ++      E ++  + ++AT    + ESS E     EAS S WL       
Sbjct  109  HGSLQQAEPQVY----KEKIECETPSSATYGEKVEESSDEKLSKFEASFSPWLNQINENI  164

Query  637  STQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVS  458
            +            T GDRPI+G+V + W ENE + +SP+ WDGNGIPNST KYKEDQKVS
Sbjct  165  AVSNDRTPGLAAITPGDRPIIGLVPSQWIENEQTEISPRLWDGNGIPNSTTKYKEDQKVS  224

Query  457  WHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHN  314
            WHATPFE RLEKALS+E   SL  QRK          E  E DT +SQL +
Sbjct  225  WHATPFEVRLEKALSDENGQSLFPQRKLE-----VMMEEVEGDTNISQLQH  270



>ref|XP_006294380.1| hypothetical protein CARUB_v10023398mg [Capsella rubella]
 gb|EOA27278.1| hypothetical protein CARUB_v10023398mg [Capsella rubella]
Length=388

 Score =   176 bits (446),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 137/247 (55%), Gaps = 43/247 (17%)
 Frame = -3

Query  997  SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
            SP  T LKLS E+QTP T+FP  + +   GR  R+RSQ+VY   N IENAS  K      
Sbjct  164  SPNLTALKLSHEIQTPRTIFPEDMGSAGRGR-QRVRSQFVYPASNIIENASLCK------  216

Query  817  sessqdsnSKLLFSDMGESVDLS------------SEANATSEIGLRESSTENNLNVEAS  674
                       L  D+ E+++ +            S  +   E  L + S       E S
Sbjct  217  -----------LSQDLNENLEQAKVQGCKEKREDESPTSTICEEKLEDGSDGKYAITETS  265

Query  673  LSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPN  494
             S W+    ++S       SI    T GDRPI+GMVAAHWNEN+ S++SPKWWDGNGIPN
Sbjct  266  SSPWMNQGKKKSDKNMEAISI----TPGDRPIIGMVAAHWNENKQSQISPKWWDGNGIPN  321

Query  493  STHKYKEDQKVSWHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNETEESDTALSQ  323
            ST+KYKEDQKVSWHATPFEERLEKALSEE   S +  RK      +   E  E DTA+S 
Sbjct  322  STNKYKEDQKVSWHATPFEERLEKALSEEGGQSFIPSRK------LGIVEETERDTAISH  375

Query  322  LHNGNQS  302
            L +  QS
Sbjct  376  LRHSAQS  382



>ref|XP_009407083.1| PREDICTED: uncharacterized protein LOC103989862 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score =   177 bits (448),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 140/250 (56%), Gaps = 24/250 (10%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMK---  836
             SK  P+PTP++++DEM+T  TV+PT++ N    +  RI +QY++ ILNP+EN S+ K   
Sbjct  215   SKNLPFPTPVEVTDEMETSATVYPTNLGNTKYEKNTRIGTQYIFPILNPVENLSRQKLLN  274

Query  835   -EVInedsessqdsnSKLLFSDMGESV------------DLSSEANATSEIGLRESSTEN  695
              +            +      D GE +            +LS     TS   L     + 
Sbjct  275   EDSSEPLQSYDSSDHKTNNIPDAGEKIQQISLVTDPEEAELSGTPRYTSPSRLETPRDKT  334

Query  694   NLN------VEASLSSWLKPSLRQSSTQPFGGSIHHGKT-LGDRPILGMVAAHWNENETS  536
              L       V  SLS WLKP + +          H GK+   DRPILGMVAAHW E E  
Sbjct  335   LLRPEYPDLVTTSLSQWLKPPIAKDEHNEIKEKSHSGKSSYEDRPILGMVAAHWKEEEPG  394

Query  535   RVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFN  356
               SPK WDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E+ + +RK + G  + F 
Sbjct  395   HKSPKEWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSDENSLPKRKFVPGKRVEF-  453

Query  355   ETEESDTALS  326
             E E SDTA S
Sbjct  454   EDELSDTAAS  463



>ref|XP_010927116.1| PREDICTED: uncharacterized protein LOC105049236 [Elaeis guineensis]
Length=490

 Score =   176 bits (445),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 141/417 (34%), Positives = 201/417 (48%), Gaps = 71/417 (17%)
 Frame = -3

Query  1447  KELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLV  1268
             ++L+ +AK+LK+CG + ETP EI++ S K    +  +  V  L FHSWL     +K    
Sbjct  92    RDLEHEAKYLKSCGALLETPAEIQRASGKIVVQTPQEDGVH-LDFHSWLPVVPCKKL---  147

Query  1267  SQPDQSPKPTKDCEDWVKESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTCRQRS  1088
              Q D+   P  D    V  SD   H    C + +E+     V+         +      S
Sbjct  148   -QWDEQVNPISDSPAQVDNSDYLEHISRGCNS-DERQILAKVVQCEEIKHVSAVESIVES  205

Query  1087  VRFDCkstksdmssalsksSFEVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANG  908
             V  D   +K+           +V   +S  SPYPTPL L+DEMQTPGTV PT+ +N+   
Sbjct  206   VMLDISPSKAAT---------KVAVLDSNDSPYPTPLNLTDEMQTPGTVHPTNQENIRAR  256

Query  907   RFPRIRSQYVYSILNPIENASQMK----EVInedsessqdsnSKLLFSD-----------  773
             +  RIR+QYVY +L P+EN S  K    E     S    +   K+   D           
Sbjct  257   KNGRIRTQYVYPVLKPVENISHWKAPREETSLTQSADHSEKEKKIPSPDFWGRGQQISFT  316

Query  772   -------MGESVDLSSEANATSEIGLR----ESSTENNLNVEASL---------------  671
                    + +S   SS     S++  R    ES  +N+L+  A L               
Sbjct  317   PVPADSKLFDSSSFSSPNEKISQVQNRCSREESVHDNSLSSPALLFKNGKQQQNPNVDTP  376

Query  670   -------SSWLKPSLRQS---STQPFGGSIHHGKTLGD--RPILGMVAAHWNENETSRVS  527
                    S WLKP   +    +++       H +   D  RPI+G+VA+HWN ++ S +S
Sbjct  377   NLVISSLSPWLKPPFPEDEIRNSENIAKEKPHSEKSSDAGRPIIGIVASHWNADDLSHIS  436

Query  526   PKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFN  356
                WDGNGIPN+T KYKE+QKVSWHA P E+RLEKALS+E L+ +RK ++G P+ F+
Sbjct  437   ---WDGNGIPNTTTKYKENQKVSWHAAPLEDRLEKALSDEKLLPKRKLLNGRPVEFD  490



>gb|AAF24810.1|AC007592_3 F12K11.5 [Arabidopsis thaliana]
Length=363

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 149/282 (53%), Gaps = 76/282 (27%)
 Frame = -3

Query  1027  FEVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENA  848
             F V SPN      PTPLKLSDEMQTPGT++P ++++   GR PRIRSQ+V+S+ N +ENA
Sbjct  110   FTVSSPN------PTPLKLSDEMQTPGTIYPANMESGGRGR-PRIRSQFVHSVSNIMENA  162

Query  847   SQMKEVInedsessqdsnSKLLFSDMGESVD----LSSEANATSEIG--LRESSTENNLN  686
             S  K                 ++ D  E +D    + +E  ++   G  + ESS E    
Sbjct  163   SLYK-----------------VYKDSHEGLDYEEQIEAETPSSETYGEKVEESSDEKLSK  205

Query  685   VEASLSSWLK------PSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSP  524
              EAS S WL        +L + +  P  G I    T GDRPI+G+VAA W ENE + +SP
Sbjct  206   FEASFSPWLNQINENIAALNERT--PGVGVI----TPGDRPIIGLVAAQWIENEQTEISP  259

Query  523   KWWDGNGIPNSTHKYKE--------------------------DQKVSWHATPFEERLEK  422
             K WDGNGIPNST KYKE                          DQKVSWHATPFE RLEK
Sbjct  260   KMWDGNGIPNSTTKYKEVIFPAFHLCFLGSFSSSNIQKLNLMQDQKVSWHATPFEVRLEK  319

Query  421   ALSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQ  305
             ALSEE   SL  QRK          E  E DT +SQLH+  Q
Sbjct  320   ALSEEGGQSLFPQRKLE-----VMMEEVEGDTDISQLHHSVQ  356



>ref|NP_180640.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031449.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAS49046.1| At2g30820 [Arabidopsis thaliana]
 gb|AAU45205.1| At2g30820 [Arabidopsis thaliana]
 gb|AEC08444.1| uncharacterized protein AT2G30820 [Arabidopsis thaliana]
 gb|AEC08445.1| uncharacterized protein AT2G30820 [Arabidopsis thaliana]
Length=421

 Score =   170 bits (431),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 137/234 (59%), Gaps = 34/234 (15%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVI  827
             S  SPY T +KLSDE+QTPGT+FP ++++    R  RIRSQ+V+S  N I NAS  K   
Sbjct  214   SATSPYTTSMKLSDEIQTPGTIFPANMESAGRER-RRIRSQFVHSASNLIVNASLCK---  269

Query  826   nedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSL  647
                           L  D   +++  ++  A  E    ES T      +   SS  K  +
Sbjct  270   --------------LHEDSNANLE-QAKVQAYKEKTENESPTSTICGEKLEESSDGKKQI  314

Query  646   RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQ  467
              + S+ P   SI+     GDRPI+GMVAAHWNE E S++SPKWWDGNGIPNST+KYKEDQ
Sbjct  315   GEISSSPL--SIN----PGDRPIIGMVAAHWNEKEHSQISPKWWDGNGIPNSTNKYKEDQ  368

Query  466   KVSWHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHN  314
             KVSWHATPFEERLEKALSEE     +  R+      +   E  E DTA+S L +
Sbjct  369   KVSWHATPFEERLEKALSEEGGQGFIPPRR------LGTVEESERDTAISHLRH  416



>gb|AAC20717.1| unknown protein [Arabidopsis thaliana]
Length=419

 Score =   170 bits (430),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 137/234 (59%), Gaps = 34/234 (15%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVI  827
             S  SPY T +KLSDE+QTPGT+FP ++++    R  RIRSQ+V+S  N I NAS  K   
Sbjct  212   SATSPYTTSMKLSDEIQTPGTIFPANMESAGRER-RRIRSQFVHSASNLIVNASLCK---  267

Query  826   nedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSL  647
                           L  D   +++  ++  A  E    ES T      +   SS  K  +
Sbjct  268   --------------LHEDSNANLE-QAKVQAYKEKTENESPTSTICGEKLEESSDGKKQI  312

Query  646   RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQ  467
              + S+ P   SI+ G    DRPI+GMVAAHWNE E S++SPKWWDGNGIPNST+KYKEDQ
Sbjct  313   GEISSSPL--SINPG----DRPIIGMVAAHWNEKEHSQISPKWWDGNGIPNSTNKYKEDQ  366

Query  466   KVSWHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHN  314
             KVSWHATPFEERLEKALSEE     +  R+      +   E  E DTA+S L +
Sbjct  367   KVSWHATPFEERLEKALSEEGGQGFIPPRR------LGTVEESERDTAISHLRH  414



>ref|XP_010241859.1| PREDICTED: uncharacterized protein LOC104586356 [Nelumbo nucifera]
Length=256

 Score =   162 bits (410),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 99/139 (71%), Gaps = 7/139 (5%)
 Frame = -3

Query  715  RESSTENNLNVEASLSSWLKPSL-------RQSSTQPFGGSIHHGKTLGDRPILGMVAAH  557
            RE+       V+ASLS WLKPS        +     P G S     + GDRPILGMVAAH
Sbjct  106  RENMAVKESKVDASLSHWLKPSSPPKDDADQNCGVFPGGRSYSSKTSDGDRPILGMVAAH  165

Query  556  WNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMS  377
            WN+ E SR+S KWWDGNGIPNST+KYK DQKV WHATPFEERLEKALSEESL  +RK ++
Sbjct  166  WNDEEPSRISSKWWDGNGIPNSTNKYKGDQKVHWHATPFEERLEKALSEESLGYKRKLIN  225

Query  376  GSPISFNETEESDTALSQL  320
            G PI+F E EE+DTA+S+L
Sbjct  226  GRPINFEENEETDTAVSRL  244



>ref|XP_009141103.1| PREDICTED: uncharacterized protein LOC103865074 [Brassica rapa]
Length=429

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 155/404 (38%), Positives = 208/404 (51%), Gaps = 75/404 (19%)
 Frame = -3

Query  1441  LKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQ  1262
             +KD+A+ LKAC     TP+EIRK SEK  + S    ++   +FHSW+ D+       + +
Sbjct  71    IKDEAQLLKACDKTTATPVEIRKASEKL-ETSQRGQQLTSSQFHSWISDAVFH----LDE  125

Query  1261  PDQSPKPTKDCEDWVKESDSPVHTPSSCMT----------------FEEKSNsptvisas  1130
             P         CE+ V E      TPSSC+T                   +       S+ 
Sbjct  126   P---------CEE-VSE-----QTPSSCVTRISTGYSDAGEESQESIGTEFRDGVYRSSK  170

Query  1129  pttvppstTCRQRSVRFDCkstksdmssalsksSFEV-----DSPNSKASPYPTPLKLSD  965
              +    + T +++SV+ +C   +S  S++  KS+ +       S  S  S   T LKLSD
Sbjct  171   VSFAAGNITGKRKSVKLECDFDQSYSSTSSKKSTSKTPEKAGKSNFSTTSRNLTSLKLSD  230

Query  964   EMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKL  785
             E+QTP  +     ++   GR PRIRSQ ++S  +  ENAS  K  + EDS+ +++   K 
Sbjct  231   EIQTPAVM-----ESAVRGR-PRIRSQCLHSPSSLTENASICK--LPEDSDETKEHACK-  281

Query  784   LFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHH  605
                   E  +  S  + T E  L ESS        AS S W+K S  + S +    +I  
Sbjct  282   ------EKKEPESPLSVTCEGKLEESS--------ASPSPWVKQS-EEKSNKKMTATIS-  325

Query  604   GKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLE  425
               T GDRPI+G  AAHWNE E S++SPKWWDGNGIPNST+KYKEDQKVSWH T FEERLE
Sbjct  326   TVTYGDRPIIGTAAAHWNEKEQSQISPKWWDGNGIPNSTNKYKEDQKVSWHVTSFEERLE  385

Query  424   KALSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             KALSEE        RK      +   E  E DTA+SQLH+  QS
Sbjct  386   KALSEEGGQGFTPSRK------LEIMEEAERDTAISQLHHPAQS  423



>emb|CDY23981.1| BnaC03g17100D [Brassica napus]
Length=398

 Score =   159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 151/453 (33%), Positives = 208/453 (46%), Gaps = 120/453 (26%)
 Frame = -3

Query  1570  SNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIPET  1391
             S ++ LS LF+SEE     S              P +  D K+L ++A+FLKA GT P T
Sbjct  30    SKKNRLSDLFLSEEEKAPPS--------------PCIHTD-KDLNNKAQFLKASGTTPPT  74

Query  1390  PLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCEDWVKE  1211
             P++IRK SE   +      +    +F SW+  +S    +L    +++P+P  +  +    
Sbjct  75    PVKIRKASENL-ETPQRGKQFTSSQFDSWISSNSDAVFHL---DEKAPEPCGEVSE----  126

Query  1210  SDSPVHTPSSCMTFEEKSNsptvisaspttvppst----------------------TCR  1097
                   TPSSC+T    S   +  ++        +                        +
Sbjct  127   -----QTPSSCITDSHNSAKISTGTSDVGEESQGSIGTAFKDGVDRNSKVPLTAGNIMGK  181

Query  1096  QRSVRFDCkstksdmssalsksSFEV-----DSPNSKASPYPTPLKLSDEMQTPGTVFPT  932
              +SVRF+C   +   SS    ++ ++     +S     S   T LKLSDE+QT GT+FP 
Sbjct  182   IKSVRFECDYDQCYSSSYSKNTTPKIPEKAGESNLLATSHNLTSLKLSDEIQTHGTIFP-  240

Query  931   HVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDL  752
                  AN    R++             A ++K  I                         
Sbjct  241   -----ANKESTRVQ-------------ACKVKTEI-------------------------  257

Query  751   SSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILG  572
               E+  +   G  E S+       AS+S W+K S  +S+      S     T  DRPI+G
Sbjct  258   --ESPLSVTCGKLEDSS-------ASVSPWVKQSEEKSNNNMTALST---ITSRDRPIIG  305

Query  571   MVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEE---SL  401
             MVAAHWNE E S++SPKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEE     
Sbjct  306   MVAAHWNEKEQSQISPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEEGGQGF  365

Query  400   VSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             +  RK      +   E  E DTA+SQLH+  QS
Sbjct  366   IPSRK------LEVLEEAERDTAMSQLHHSAQS  392



>ref|XP_002879280.1| hypothetical protein ARALYDRAFT_481999 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55539.1| hypothetical protein ARALYDRAFT_481999 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   159 bits (401),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 133/238 (56%), Gaps = 37/238 (16%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVI  827
             S  SP  T LKL D   TPGT+ P ++++    R PRIRS +V+S  N IENAS  K   
Sbjct  228   SATSPNLTSLKLCD---TPGTILPANMESAGRER-PRIRSHFVHSASNLIENASLCK---  280

Query  826   nedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSL  647
                 + S  S  +       E ++  S  +   E  L ESS E  L              
Sbjct  281   --LPKDSNASLEQAKVQACKEKIENESPTSTICEGKLVESSDERYL--------------  324

Query  646   RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQ  467
              ++S+ P+  SI    T GDRPI+GMVAAHWNE E S++S KWWDGNGIPNST+KYKEDQ
Sbjct  325   -ETSSSPWAFSI----TPGDRPIIGMVAAHWNEKEQSQISAKWWDGNGIPNSTNKYKEDQ  379

Query  466   KVSWHATPFEERLEKALSEES---LVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             KVSWHATPFEERLE ALSEE     +  R+      +   E  E DTA+S L +  QS
Sbjct  380   KVSWHATPFEERLEMALSEEGGQDFIPPRR------LGTVEESERDTAISHLRHSAQS  431



>ref|XP_010510282.1| PREDICTED: uncharacterized protein LOC104786548 [Camelina sativa]
Length=410

 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 105/239 (44%), Positives = 123/239 (51%), Gaps = 65/239 (27%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVI  827
             S  SP PT LKLSDE+QTP T FP ++ +   GR  R++ +         EN S    + 
Sbjct  227   SATSPNPTALKLSDEIQTPRTTFPEYMGSAGKGR-QRVQEK--------TENESPTSTIC  277

Query  826   nedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSL  647
                                                   ES+ E    VE S S W+K   
Sbjct  278   --------------------------------------ESTDEKYPIVETSSSPWVK---  296

Query  646   RQSSTQPFGG-SIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKED  470
              QSS +     SI HG    DRPI+GMVAAHWNE E S +SPKWWDGNGIPNST+KYKED
Sbjct  297   -QSSGKNMEALSITHG----DRPIIGMVAAHWNEKEQSLISPKWWDGNGIPNSTNKYKED  351

Query  469   QKVSWHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
             QKVSWHAT FEERLEKALSEE     +S RK      +   E  E DTA+S L +  QS
Sbjct  352   QKVSWHATSFEERLEKALSEEGGHGFISPRK------LGIVEETERDTAISHLRHSAQS  404



>gb|KHM99653.1| hypothetical protein glysoja_006496 [Glycine soja]
Length=374

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 91/125 (73%), Gaps = 8/125 (6%)
 Frame = -3

Query  673  LSSWLKPSL-----RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSP-KWWD  512
            L+SWLKP+      R    Q     +   KT  DRPI+GMVAAHWN++  S+  P KWWD
Sbjct  241  LTSWLKPAAVILEERNKRMQTSYNQVR--KTPADRPIIGMVAAHWNKDGDSQAPPPKWWD  298

Query  511  GNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTA  332
            GNGIPNST+KYKEDQKV+WHAT FEERLEKALSEE+++SQRK   G  I F+E EESDTA
Sbjct  299  GNGIPNSTNKYKEDQKVNWHATSFEERLEKALSEETVISQRKDTCGKSIPFDENEESDTA  358

Query  331  LSQLH  317
            LSQL 
Sbjct  359  LSQLQ  363



>ref|XP_010469790.1| PREDICTED: uncharacterized protein LOC104749793 isoform X1 [Camelina 
sativa]
Length=416

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 117/232 (50%), Gaps = 56/232 (24%)
 Frame = -3

Query  997  SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
            SP PT LKLSDE+QTP T+FP ++ +   GR                             
Sbjct  235  SPNPTALKLSDEIQTPRTIFPDNIGSAVRGR-----------------------------  265

Query  817  sessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQS  638
                        F D  E+    S  +   E  L ES+ E    VE   +SW+K   + S
Sbjct  266  ----------QRFQDKTEN---ESPTSTICEGKLEESTDEKYPIVE---TSWVK---QGS  306

Query  637  STQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVS  458
                   SI HG    DRPI+GMVAAHWNE E S +SPKWWDGNGIPNST+KYKEDQKVS
Sbjct  307  DKNMEALSITHG----DRPIIGMVAAHWNEKEQSLISPKWWDGNGIPNSTNKYKEDQKVS  362

Query  457  WHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
            WHAT FEERLEKALSEE       R  G      E  E DTA+  L N  QS
Sbjct  363  WHATSFEERLEKALSEEGGRGFIPRKLG----IVEETERDTAIIHLRNSAQS  410



>ref|XP_010469791.1| PREDICTED: uncharacterized protein LOC104749793 isoform X2 [Camelina 
sativa]
Length=415

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 117/232 (50%), Gaps = 56/232 (24%)
 Frame = -3

Query  997  SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
            SP PT LKLSDE+QTP T+FP ++ +   GR                             
Sbjct  234  SPNPTALKLSDEIQTPRTIFPDNIGSAVRGR-----------------------------  264

Query  817  sessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQS  638
                        F D  E+    S  +   E  L ES+ E    VE   +SW+K   + S
Sbjct  265  ----------QRFQDKTEN---ESPTSTICEGKLEESTDEKYPIVE---TSWVK---QGS  305

Query  637  STQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVS  458
                   SI HG    DRPI+GMVAAHWNE E S +SPKWWDGNGIPNST+KYKEDQKVS
Sbjct  306  DKNMEALSITHG----DRPIIGMVAAHWNEKEQSLISPKWWDGNGIPNSTNKYKEDQKVS  361

Query  457  WHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
            WHAT FEERLEKALSEE       R  G      E  E DTA+  L N  QS
Sbjct  362  WHATSFEERLEKALSEEGGRGFIPRKLG----IVEETERDTAIIHLRNSAQS  409



>ref|NP_001051439.2| Os03g0777100 [Oryza sativa Japonica Group]
 dbj|BAF13353.2| Os03g0777100, partial [Oryza sativa Japonica Group]
Length=347

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 143/267 (54%), Gaps = 40/267 (15%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV-  830
             SK+ P  TP + + E+QTP T      + L N    R  S++ Y  ++ +E +   +++ 
Sbjct  70    SKSLPISTPSEATAEIQTPATTHAPDQEELRNENNTRTCSEHTYEAVSSVEASGSCEKLR  129

Query  829   InedsessqdsnSKLLFSDMGESVDLS----------SEANATSEIGLRE-SSTE-----  698
             +     +  D + K   +D   SV+LS          SE + +S    RE SSTE     
Sbjct  130   LESCQPNISDEDFKYAKNDSLVSVELSISNECSLFQSSEGSVSSCNKRRENSSTESVEKC  189

Query  697   -----------------NNLNVE-ASLSSWLKP-SLRQSSTQPFGGSIHHGKTLG--DRP  581
                              N+  VE  SLS WLKP + +    +P      H       DRP
Sbjct  190   LKSEPLVHSSRKKVLKGNDSEVEFPSLSQWLKPPNPKVFRDEPLTSDRSHSAKSSEEDRP  249

Query  580   ILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESL  401
             I+G+VAAHW + E    +PKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E L
Sbjct  250   IIGLVAAHWRDTEPDTFTPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSDEKL  309

Query  400   VSQRKRMSG--SPISFNETEESDTALS  326
             +SQRK  SG  S +S  E EE+DTA S
Sbjct  310   LSQRKCSSGNTSQLSGLEGEENDTAAS  336



>emb|CDX84817.1| BnaA03g14130D [Brassica napus]
Length=353

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 93/129 (72%), Gaps = 12/129 (9%)
 Frame = -3

Query  679  ASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGI  500
            AS+S W+K S  +S+     GS+    T  DRPI+GMVAAHWNE E S++SPKWWDGNGI
Sbjct  228  ASISHWVKQSEEKSNNNM--GSLST-ITYRDRPIIGMVAAHWNEKEQSQISPKWWDGNGI  284

Query  499  PNSTHKYKEDQKVSWHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNETEESDTAL  329
            PNST+KYKEDQKVSWHATPFEERLEKALSEE     +S RK      +   E +E DTA+
Sbjct  285  PNSTNKYKEDQKVSWHATPFEERLEKALSEEGGQGFISSRK------LEVMEDKERDTAI  338

Query  328  SQLHNGNQS  302
            SQLH+  QS
Sbjct  339  SQLHHSAQS  347



>gb|EEC76265.1| hypothetical protein OsI_13728 [Oryza sativa Indica Group]
Length=453

 Score =   147 bits (370),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 144/267 (54%), Gaps = 40/267 (15%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV-  830
             SK+SP  TP + + E+QTP T      + L N    R  S++ Y  ++ +E +   +++ 
Sbjct  176   SKSSPISTPSEATAEIQTPATTHAPDQEELRNENNTRTCSEHTYEAVSSVEASGSCEKLR  235

Query  829   InedsessqdsnSKLLFSDMGESVDLS----------SEANATSEIGLRE-SSTE-----  698
             +     +  D + K   +D   SV+LS          SE + +S    RE SSTE     
Sbjct  236   LESCQPNISDEDFKYAKNDSLVSVELSISNECSLFQSSEGSVSSCNKRRENSSTESVEKC  295

Query  697   -----------------NNLNVE-ASLSSWLKP-SLRQSSTQPFGGSIHHGKTLG--DRP  581
                              N+  VE  SLS WLKP + +    +P      H       DRP
Sbjct  296   LKSEPLVHSSRKKVLKGNDSEVEFPSLSQWLKPPNPKVFRDEPLTSDRSHSAKSSEEDRP  355

Query  580   ILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESL  401
             I+G+VAAHW + E    +PKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E L
Sbjct  356   IIGLVAAHWRDTEPDTFTPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSDEKL  415

Query  400   VSQRKRMSG--SPISFNETEESDTALS  326
             +SQRK  SG  S +S  E EE+DTA S
Sbjct  416   LSQRKCSSGNTSQLSGLEGEENDTAAS  442



>ref|XP_010414212.1| PREDICTED: uncharacterized protein LOC104700394 isoform X2 [Camelina 
sativa]
Length=418

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/236 (42%), Positives = 122/236 (52%), Gaps = 61/236 (26%)
 Frame = -3

Query  1000 ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIne  821
            ASP PT LK++DE+QTP T+FP ++ +   GR  R++ +                     
Sbjct  235  ASPNPTALKITDEIQTPRTIFPENMGSAGKGR-QRVQDK---------------------  272

Query  820  dsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQ  641
                                 ++ S  +   E  L ES+ E    VE   +SW+K   + 
Sbjct  273  --------------------TEIESPTSTICEGKLEESTDEKYPIVE---TSWVK---QG  306

Query  640  SSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKV  461
            S       SI HG    DRPI+GMVAAHWNE E S +SPKWWDGNGIPNST+KYKEDQKV
Sbjct  307  SDKNMEALSITHG----DRPIIGMVAAHWNEKEQSLISPKWWDGNGIPNSTNKYKEDQKV  362

Query  460  SWHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
            SWHAT FEERL+KALSEE     +  RK          E  E DTA+S L +  QS
Sbjct  363  SWHATSFEERLDKALSEEGGHGFIPPRK------FGMVEETERDTAISHLRHSAQS  412



>ref|XP_010414211.1| PREDICTED: uncharacterized protein LOC104700394 isoform X1 [Camelina 
sativa]
Length=419

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/236 (42%), Positives = 122/236 (52%), Gaps = 61/236 (26%)
 Frame = -3

Query  1000 ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIne  821
            ASP PT LK++DE+QTP T+FP ++ +   GR  R++                       
Sbjct  236  ASPNPTALKITDEIQTPRTIFPENMGSAGKGR-QRVQ-----------------------  271

Query  820  dsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQ  641
                              +  ++ S  +   E  L ES+ E    VE   +SW+K   + 
Sbjct  272  ------------------DKTEIESPTSTICEGKLEESTDEKYPIVE---TSWVK---QG  307

Query  640  SSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKV  461
            S       SI HG    DRPI+GMVAAHWNE E S +SPKWWDGNGIPNST+KYKEDQKV
Sbjct  308  SDKNMEALSITHG----DRPIIGMVAAHWNEKEQSLISPKWWDGNGIPNSTNKYKEDQKV  363

Query  460  SWHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
            SWHAT FEERL+KALSEE     +  RK          E  E DTA+S L +  QS
Sbjct  364  SWHATSFEERLDKALSEEGGHGFIPPRK------FGMVEETERDTAISHLRHSAQS  413



>ref|XP_010942527.1| PREDICTED: uncharacterized protein LOC105060482 isoform X2 [Elaeis 
guineensis]
 ref|XP_010942536.1| PREDICTED: uncharacterized protein LOC105060482 isoform X2 [Elaeis 
guineensis]
Length=451

 Score =   145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 148/449 (33%), Positives = 213/449 (47%), Gaps = 85/449 (19%)
 Frame = -3

Query  1627  RPPFVSKSLTPT-AAEPVASSNRSPLSSLFVSEENDEEKSSLQSKEVEKQDCGTPELEFD  1451
             R   +  S TP+ + E + S N+  L+S+F+ EE  EE S  +  +V  +D    +   +
Sbjct  16    RKAHIFSSSTPSMSTEKLPSKNQ--LASVFLREE--EEVSPHE--QVRHKDNVDKDSSLE  69

Query  1450  VKELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAHDGEVDPLKFHSWLLDSSIEKQNL  1271
              ++LK +AKFLK+CG + ETP EIRK SE+          + P +F SWL  ++  K   
Sbjct  70    -RQLKHEAKFLKSCGALLETPAEIRKASERVIQQIPDQDCMLP-QFDSWLSGTAGRKLLW  127

Query  1270  VSQPDQSPKPTKDCEDWVKESDSP-VHTPSSCMTFEEKSNsptvisaspttvppstTCRQ  1094
               Q  Q PK  +  ED      SP V T        E  N+         +V P  + R 
Sbjct  128   DEQHGQLPKTPQTHEDSGFSEKSPEVFT-------SEGHNTLRHFENIMPSVSPIKSLRS  180

Query  1093  RSVRFDCkstksdmssalsksSFEVD--SP-NSKASPYPTPLKLSDEMQTPGTVFPTHVD  923
               V+ +        +      S +    SP  SK SP+PTPLKL+DEMQTP TV+P++++
Sbjct  181   EGVKHEAGVKSGKGAVTDMSPSRKESQFSPFASKCSPFPTPLKLTDEMQTPATVYPSNLE  240

Query  922   NLANGRFPRIRSQYVYSILNPI-----------------ENASQMKEVInedsessqdsn  794
                  +  RIR+QYV S+LNP+                 E+  Q ++   +  ++ + + 
Sbjct  241   KFRTEKSTRIRTQYVNSVLNPVENISQWKLLSEGCSHPGESHDQFEQRNGDSPDTKKKTE  300

Query  793   SKLLFSD--------------------------------MGES-VDLSSEANATSEIGLR  713
               LL SD                                 GES   L++  ++  ++  R
Sbjct  301   QALLTSDPKNSKLTSSSRPTMLNEKTSQNDGVIYKDKYVCGESSFSLATPLHSKEKVPFR  360

Query  712   ESSTENNLNVEASLSSWLKPSLRQSSTQPFGGS-------IHHGKTL-GDRPILGMVAAH  557
               S++    V  SLS WL+P     +T   GG+        H GK+  GDRPILGMVAAH
Sbjct  361   SDSSQI---VVTSLSQWLRPP----TTNNKGGNEIMTKERSHSGKSSDGDRPILGMVAAH  413

Query  556   WNENETSRVSPKWWDGNGIPNSTHKYKED  470
             WNE E  R+SPK WDGNGIPNST+KYKE+
Sbjct  414   WNEEEPDRISPKTWDGNGIPNSTNKYKEE  442



>ref|XP_009132753.1| PREDICTED: uncharacterized protein LOC103857339 isoform X1 [Brassica 
rapa]
Length=350

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 92/129 (71%), Gaps = 15/129 (12%)
 Frame = -3

Query  679  ASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGI  500
            AS+S W+K S  +S+      +I    T  DRPI+GMVAAHWNE E S++SPKWWDGNGI
Sbjct  228  ASVSPWVKQSEEKSNNNI--STI----TSRDRPIIGMVAAHWNEKEQSQISPKWWDGNGI  281

Query  499  PNSTHKYKEDQKVSWHATPFEERLEKALSEE---SLVSQRKRMSGSPISFNETEESDTAL  329
            PNST+KYKEDQKVSWHATPFEERLEKALSEE     +S RK      +   E +E DTA+
Sbjct  282  PNSTNKYKEDQKVSWHATPFEERLEKALSEEGGQGFISSRK------LEVMEDKERDTAI  335

Query  328  SQLHNGNQS  302
            SQLH+  QS
Sbjct  336  SQLHHSAQS  344



>ref|XP_003559372.1| PREDICTED: uncharacterized protein LOC100833527 [Brachypodium 
distachyon]
Length=476

 Score =   145 bits (367),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 147/262 (56%), Gaps = 43/262 (16%)
 Frame = -3

Query  985  TPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsess  806
            TP +++ E+Q P T    +++ + N    R  SQ++Y  LNP+E+  +  EV+ ED    
Sbjct  207  TPSEVNAEIQLPATTHAPNLEEVRNENSTRASSQHLYEALNPVEDF-KNSEVLKEDPCQP  265

Query  805  qdsnSKLLFSDMGE--SVDLS----------SEANATSEIGLRES----STENNLNVEA-  677
              S+  L  ++ G   S++LS          S+ +A+S   + +S    S +N +  EA 
Sbjct  266  DISDENLKCANNGSLISIELSMSDECSLFQNSDGSASSCNKISDSMNTASADNCVASEAT  325

Query  676  -------------------SLSSWLKP-SLRQSSTQPFGGS--IHHGKTLG-DRPILGMV  566
                               SLS WLKP + R+        S  +H  K+   DRPI+GMV
Sbjct  326  VLDSRKKVTTNSGSDVELPSLSQWLKPPNPRKVIMDGTDTSDRVHSAKSSEEDRPIIGMV  385

Query  565  AAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRK  386
            AAHW + E    +PKW+DGNGIPNST+KYKEDQKVSWHA PFEERLEKALSEE L+SQRK
Sbjct  386  AAHWKDGEPENFTPKWFDGNGIPNSTNKYKEDQKVSWHAMPFEERLEKALSEEKLLSQRK  445

Query  385  RMSGSPISFN--ETEESDTALS  326
              SG+   F+  E EESDTA S
Sbjct  446  CSSGNTSQFSGVEGEESDTAAS  467



>gb|AAM19018.1|AC084748_8 hypothetical protein [Oryza sativa Japonica Group]
 gb|AAN65039.1| dentin sialophosphoprotein precursor-like protein [Oryza sativa 
Japonica Group]
 gb|ABF99145.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ28767.1| hypothetical protein OsJ_12787 [Oryza sativa Japonica Group]
Length=494

 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 143/267 (54%), Gaps = 40/267 (15%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV-  830
             SK+ P  TP + + E+QTP T      + L N    R  S++ Y  ++ +E +   +++ 
Sbjct  217   SKSLPISTPSEATAEIQTPATTHAPDQEELRNENNTRTCSEHTYEAVSSVEASGSCEKLR  276

Query  829   InedsessqdsnSKLLFSDMGESVDLS----------SEANATSEIGLRE-SSTE-----  698
             +     +  D + K   +D   SV+LS          SE + +S    RE SSTE     
Sbjct  277   LESCQPNISDEDFKYAKNDSLVSVELSISNECSLFQSSEGSVSSCNKRRENSSTESVEKC  336

Query  697   -----------------NNLNVE-ASLSSWLKP-SLRQSSTQPFGGSIHHGKTLG--DRP  581
                              N+  VE  SLS WLKP + +    +P      H       DRP
Sbjct  337   LKSEPLVHSSRKKVLKGNDSEVEFPSLSQWLKPPNPKVFRDEPLTSDRSHSAKSSEEDRP  396

Query  580   ILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESL  401
             I+G+VAAHW + E    +PKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E L
Sbjct  397   IIGLVAAHWRDTEPDTFTPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSDEKL  456

Query  400   VSQRKRMSG--SPISFNETEESDTALS  326
             +SQRK  SG  S +S  E EE+DTA S
Sbjct  457   LSQRKCSSGNTSQLSGLEGEENDTAAS  483



>dbj|BAH01513.1| unnamed protein product [Oryza sativa Japonica Group]
Length=495

 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 143/267 (54%), Gaps = 40/267 (15%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV-  830
             SK+ P  TP + + E+QTP T      + L N    R  S++ Y  ++ +E +   +++ 
Sbjct  218   SKSLPISTPSEATAEIQTPATTHAPDQEELRNENNTRTCSEHTYEAVSSVEASGSCEKLR  277

Query  829   InedsessqdsnSKLLFSDMGESVDLS----------SEANATSEIGLRE-SSTE-----  698
             +     +  D + K   +D   SV+LS          SE + +S    RE SSTE     
Sbjct  278   LESCQPNISDEDFKYAKNDSLVSVELSISNECSLFQSSEGSVSSCNKRRENSSTESVEKC  337

Query  697   -----------------NNLNVE-ASLSSWLKP-SLRQSSTQPFGGSIHHGKTLG--DRP  581
                              N+  VE  SLS WLKP + +    +P      H       DRP
Sbjct  338   LKSEPLVHSSRKKVLKGNDSEVEFPSLSQWLKPPNPKVFRDEPLTSDRSHSAKSSEEDRP  397

Query  580   ILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESL  401
             I+G+VAAHW + E    +PKWWDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E L
Sbjct  398   IIGLVAAHWRDTEPDTFTPKWWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSDEKL  457

Query  400   VSQRKRMSG--SPISFNETEESDTALS  326
             +SQRK  SG  S +S  E EE+DTA S
Sbjct  458   LSQRKCSSGNTSQLSGLEGEENDTAAS  484



>emb|CDY29642.1| BnaA04g17850D [Brassica napus]
Length=406

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 124/212 (58%), Gaps = 29/212 (14%)
 Frame = -3

Query  928  VDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLS  749
            +++   GR PRIRSQ ++S  +  ENAS  K  + EDS+ +++   K       E  +  
Sbjct  215  MESAVRGR-PRIRSQCLHSPSSLTENASICK--LPEDSDETKEHACK-------EKKEPE  264

Query  748  SEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGM  569
            S  + T E  L ESS        AS S W+K S  + S +    +I    T GDRPI+G 
Sbjct  265  SPLSVTCEGKLEESS--------ASPSPWVKQS-EEKSNKKMTATIS-TVTYGDRPIIGT  314

Query  568  VAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEE---SLV  398
             AAHWNE E S++SPKWWDGNGIPNST+KYKEDQKVSWH T FEERLEKALSEE      
Sbjct  315  AAAHWNEKEQSQISPKWWDGNGIPNSTNKYKEDQKVSWHVTSFEERLEKALSEEGGQGFT  374

Query  397  SQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
              RK      +   E  E DTA+SQLH+  QS
Sbjct  375  PSRK------LEIMEEAERDTAISQLHHPAQS  400



>ref|XP_010941823.1| PREDICTED: uncharacterized protein LOC105059978 [Elaeis guineensis]
Length=503

 Score =   137 bits (344),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = -3

Query  685  VEASLSSWLKPSLRQSSTQPFGGSIHH-----GKTLGDRPILGMVAAHWNENETSRVSPK  521
            V +SLS WLKP L +   +               +  DRPI+G+VA+HWN +E S +SPK
Sbjct  378  VVSSLSQWLKPPLPKDEIRDINNITEEQPCSEKSSDADRPIIGIVASHWNPDELSHISPK  437

Query  520  WWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISF--NETE  347
            WWDGNGIPN+T KYKEDQKVSWHATPFEERLEKALS++ L+ +R  ++G PI F  N  E
Sbjct  438  WWDGNGIPNTTTKYKEDQKVSWHATPFEERLEKALSDDKLLPKRNLLNGRPIEFEHNGEE  497

Query  346  ESDTAL  329
            ++ TA 
Sbjct  498  KNKTAF  503


 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 110/208 (53%), Gaps = 19/208 (9%)
 Frame = -3

Query  1447  KELKDQAKFLKACGTIPETPLEIRKLSEKCRDLSAH-DGEVDPLKFHSWLLDSSIEKQNL  1271
             + L+ + K+LK+CG++ ETP +I++++ K    +   DGE +P  FHSWL  +S +K   
Sbjct  92    RGLEHEVKYLKSCGSLLETPADIQRVAGKIIVQTPKVDGE-NP-DFHSWLPAASCKKLEW  149

Query  1270  VSQPDQSPKPTKDCEDWV-KESDSPVHTPSSCMTFEEKSNsptvisaspttvppstTCRQ  1094
                 D+   P  D    V   S+ P H    C + E  + +  V       V    +  +
Sbjct  150   ----DEQLSPISDTPTQVDNNSNFPEHKSGGCNSDEHLTLTKIVQCEEIKHVSTVESGVE  205

Query  1093  RSVRFDCkstksdmssalsksSFEVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLA  914
              ++  D   +++D          +V    SK SPYPTPL L+ EMQTPGTV+PT+ +NL 
Sbjct  206   SAI-LDISPSEAD----------KVPVLGSKDSPYPTPLNLTTEMQTPGTVYPTNQENLR  254

Query  913   NGRFPRIRSQYVYSILNPIENASQMKEV  830
               R   I++QYVY +L P+E+ S ++E+
Sbjct  255   ARRNGGIQTQYVYPVLKPVEHLSHLEEL  282



>gb|ACU16764.1| unknown [Glycine max]
Length=105

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 76/98 (78%), Gaps = 4/98 (4%)
 Frame = -3

Query  676  SLSSWLKPS---LRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSP-KWWDG  509
            +LSSWLKP+   L + + +         KT  DRPI+GMVAAHWNE+E S+  P KWWDG
Sbjct  8    ALSSWLKPAAVILEERNKRMQTAYNQVRKTPADRPIIGMVAAHWNEDEDSQAPPPKWWDG  67

Query  508  NGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVS  395
            NGIPNST+KYKEDQKV WHATPFEERLEKALSEE+++S
Sbjct  68   NGIPNSTNKYKEDQKVKWHATPFEERLEKALSEETVIS  105



>ref|XP_002463801.1| hypothetical protein SORBIDRAFT_01g006400 [Sorghum bicolor]
 gb|EER90799.1| hypothetical protein SORBIDRAFT_01g006400 [Sorghum bicolor]
Length=430

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 84/125 (67%), Gaps = 10/125 (8%)
 Frame = -3

Query  676  SLSSWLKP-----SLRQSSTQPFGGSIHHGKTLG-DRPILGMVAAHWNENETSRVSPKWW  515
            SL+ WLKP     + R  +    G   H  K+   DRPI+GMVAAHW + E    + KWW
Sbjct  299  SLAQWLKPPNPKKAFRDDAV--IGDRSHSAKSSNEDRPIIGMVAAHWKDKEPENFNSKWW  356

Query  514  DGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISF--NETEES  341
            DGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEE L+S+R   SG    F   E EES
Sbjct  357  DGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEEKLLSERSCSSGKTSQFLGVEGEES  416

Query  340  DTALS  326
            DTA S
Sbjct  417  DTAGS  421



>gb|EMT06993.1| hypothetical protein F775_30635 [Aegilops tauschii]
Length=486

 Score =   134 bits (338),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = -3

Query  676  SLSSWLKPSLRQSSTQPFGGSIHHGKTLG-------DRPILGMVAAHWNENETSRVSPKW  518
            SLS WLKP    SS++      +   T         DRPI+GMVAAHW   E    +PKW
Sbjct  355  SLSQWLKP---PSSSKAIRDESYTSDTFNSAKSSDEDRPIIGMVAAHWKSEEPDNFTPKW  411

Query  517  WDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFN--ETEE  344
            WDGNGIPNST+KYKEDQKVSWHA  FEERLEKALSEE L+SQRK  +G+   F+  E EE
Sbjct  412  WDGNGIPNSTNKYKEDQKVSWHAMSFEERLEKALSEEKLLSQRKCSTGNTSHFSGVEGEE  471

Query  343  SDTALS  326
            SDTA S
Sbjct  472  SDTAAS  477



>gb|ACG36204.1| hypothetical protein [Zea mays]
Length=246

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 128/248 (52%), Gaps = 34/248 (14%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             +S  SP+PTPL L D+MQTPGT + +H     +G+  R R Q++Y +L  IEN  Q  E+
Sbjct  7     DSGGSPFPTPLVLRDDMQTPGTAYASHRGTSISGKRVRTRKQFIYPVLRSIENRLQQIEL  66

Query  829   InedsessqdsnSKLLFSDMG-ESVDLSSEANATSEI-------------------GLRE  710
               + S  +     K    D+G +S    ++A++TS +                   G+ E
Sbjct  67    TEDSSPLASSDPLK--ERDLGADSTKDPTQASSTSVVKSGLSETPSYSAPDPNASYGVEE  124

Query  709   SSTENN---LNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWN---E  548
             S +++N    N   SLS WLK S   +  Q           L ++P+  MVA   N    
Sbjct  125   SLSKSNSDEKNAALSLSRWLKSSSADAENQ----DDEDCSFLTEKPVF-MVAPDLNLDTS  179

Query  547   NETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSP  368
             N T R+ PK WDGNGIPN+T +Y+EDQ+VSWH TPFE+RL K LS+E     RK + G  
Sbjct  180   NPTPRL-PKAWDGNGIPNTTTRYREDQRVSWHTTPFEQRLLKVLSDEDRCPPRKVVRGKL  238

Query  367   ISFNETEE  344
                 ET E
Sbjct  239   FHLEETAE  246



>gb|EMS46169.1| hypothetical protein TRIUR3_23955 [Triticum urartu]
Length=500

 Score =   133 bits (335),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = -3

Query  676  SLSSWLKPSLRQSSTQPFGGSIHHGKTLG-------DRPILGMVAAHWNENETSRVSPKW  518
            SLS WLKP    SS++      +   T         DRPI+GMVAAHW   E    +PKW
Sbjct  369  SLSQWLKP---PSSSKAIRDESYTSDTFNSAKSSDEDRPIIGMVAAHWKSEEPDNFTPKW  425

Query  517  WDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFN--ETEE  344
            WDGNGIPNST+KYKEDQKVSWHA  FEERLEKALSEE L+SQRK  +G+   F+  E EE
Sbjct  426  WDGNGIPNSTNKYKEDQKVSWHAMSFEERLEKALSEEKLLSQRKCSTGNTSHFSGVEGEE  485

Query  343  SDTALS  326
            SDTA S
Sbjct  486  SDTAAS  491



>ref|XP_006650673.1| PREDICTED: uncharacterized protein LOC102719472 [Oryza brachyantha]
Length=451

 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = -3

Query  676  SLSSWLKP-----SLRQSSTQPFGGSIHHGKTLG--DRPILGMVAAHWNENETSRVSPKW  518
            SLS WLKP      LR    +P      H       DRPI+G VAAHW + E    +PKW
Sbjct  318  SLSQWLKPPNPKKVLRD---EPLTSDRSHSAKSSEEDRPIIGSVAAHWRDKEPDTFTPKW  374

Query  517  WDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSG--SPISFNETEE  344
            WDGNGIPNST+KYKEDQKVSWHAT FEERLEKALS+E L+SQRK  +G  S +S  E EE
Sbjct  375  WDGNGIPNSTNKYKEDQKVSWHATSFEERLEKALSDEKLLSQRKCSTGNTSQLSGLEGEE  434

Query  343  SDTALS  326
            +DTA S
Sbjct  435  NDTAAS  440



>ref|NP_001130438.1| uncharacterized protein LOC100191535 [Zea mays]
 gb|ACF78643.1| unknown [Zea mays]
Length=432

 Score =   131 bits (330),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 84/125 (67%), Gaps = 10/125 (8%)
 Frame = -3

Query  676  SLSSWLKP-----SLRQSSTQPFGGSIHHGKTLG-DRPILGMVAAHWNENETSRVSPKWW  515
            SL+ WLKP     + R  +    G   H  K+   DRPI+GMVAAHW + E +  + KWW
Sbjct  301  SLAQWLKPPNPKKAFRDEAVT--GDRSHSAKSSDEDRPIIGMVAAHWKDKEPANFTSKWW  358

Query  514  DGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISF--NETEES  341
            DGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEE  +S+R   SG    F   E EES
Sbjct  359  DGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEEKSLSERNCSSGKTSQFLGVEGEES  418

Query  340  DTALS  326
            DTA S
Sbjct  419  DTAGS  423



>gb|ACN36363.1| unknown [Zea mays]
Length=293

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 128/248 (52%), Gaps = 34/248 (14%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             +S  SP+PTPL L D+MQTPGT + +H     +G+  R R Q++Y +L  IEN  Q  E+
Sbjct  54    DSGGSPFPTPLVLRDDMQTPGTAYASHRGTSISGKRVRTRKQFIYPVLRSIENRLQQIEL  113

Query  829   InedsessqdsnSKLLFSDMG-ESVDLSSEANATSEI-------------------GLRE  710
               + S  +     K    D+G +S    ++A++TS +                   G+ E
Sbjct  114   TEDSSPLASSDPLKE--RDLGADSTKDPTQASSTSVVKSGLSETPSYSAPDPNASYGVEE  171

Query  709   SSTENN---LNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWN---E  548
             S +++N    N   SLS WLK S   +  Q           L ++P+  MVA   N    
Sbjct  172   SLSKSNSDEKNAALSLSRWLKSSSADAENQ----DDEDCSFLTEKPVF-MVAPDLNLDTS  226

Query  547   NETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSP  368
             N T R+ PK WDGNGIPN+T +Y+EDQ+VSWH TPFE+RL K LS+E     RK + G  
Sbjct  227   NPTPRL-PKAWDGNGIPNTTTRYREDQRVSWHTTPFEQRLLKVLSDEDRCPPRKVVRGKL  285

Query  367   ISFNETEE  344
                 ET E
Sbjct  286   FHLEETAE  293



>gb|ACR34418.1| unknown [Zea mays]
Length=426

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 84/125 (67%), Gaps = 10/125 (8%)
 Frame = -3

Query  676  SLSSWLKP-----SLRQSSTQPFGGSIHHGKTLG-DRPILGMVAAHWNENETSRVSPKWW  515
            SL+ WLKP     + R  +    G   H  K+   DRPI+GMVAAHW + E +  + KWW
Sbjct  295  SLAQWLKPPNPKKAFRDEAVT--GDRSHSAKSSDEDRPIIGMVAAHWKDKEPANFTSKWW  352

Query  514  DGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISF--NETEES  341
            DGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEE  +S+R   SG    F   E EES
Sbjct  353  DGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEEKSLSERNCSSGKTSQFLGVEGEES  412

Query  340  DTALS  326
            DTA S
Sbjct  413  DTAGS  417



>emb|CDX97792.1| BnaC04g41470D [Brassica napus]
Length=394

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 73/102 (72%), Gaps = 9/102 (9%)
 Frame = -3

Query  598  TLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKA  419
            T GDRPI+G  AAHWNE E S++SPKWWDGNGIPNST+KYKEDQKVSWH T FEERLEKA
Sbjct  293  TYGDRPIIGTAAAHWNEKEQSQISPKWWDGNGIPNSTNKYKEDQKVSWHVTSFEERLEKA  352

Query  418  LSEE---SLVSQRKRMSGSPISFNETEESDTALSQLHNGNQS  302
            LSEE        RK      +   E  + DTA+SQLH+  QS
Sbjct  353  LSEEGGQGFTPSRK------LELMEEAQRDTAISQLHHPAQS  388



>ref|XP_009132754.1| PREDICTED: uncharacterized protein LOC103857339 isoform X2 [Brassica 
rapa]
Length=328

 Score =   129 bits (324),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 71/91 (78%), Gaps = 6/91 (7%)
 Frame = -3

Query  679  ASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGI  500
            AS+S W+K S  +S+            T  DRPI+GMVAAHWNE E S++SPKWWDGNGI
Sbjct  228  ASVSPWVKQSEEKSNNN------ISTITSRDRPIIGMVAAHWNEKEQSQISPKWWDGNGI  281

Query  499  PNSTHKYKEDQKVSWHATPFEERLEKALSEE  407
            PNST+KYKEDQKVSWHATPFEERLEKALSEE
Sbjct  282  PNSTNKYKEDQKVSWHATPFEERLEKALSEE  312



>gb|ABR18181.1| unknown [Picea sitchensis]
Length=711

 Score =   133 bits (335),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 75/94 (80%), Gaps = 5/94 (5%)
 Frame = -3

Query  601  KTLGD--RPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERL  428
            KT GD  RPILGMVAAHWN+ +++  SPKWWDG GIPNST+KYKEDQKVSWH TPFEERL
Sbjct  621  KTSGDDDRPILGMVAAHWNDKQST--SPKWWDGKGIPNSTNKYKEDQKVSWHTTPFEERL  678

Query  427  EKALSEESLVSQRKRMSGSPISFNETEESDTALS  326
            EKALS E    +RK  SG PI+F E EESDTA S
Sbjct  679  EKALSNEGGF-ERKTFSGKPINFEECEESDTAAS  711


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             S  SP  TPL+L+D M TP       ++N    +  RIRSQYVY +LNP+EN SQ KE+
Sbjct  350   STYSPQSTPLRLTDNMNTPWAGCAKTLENAGVNKNARIRSQYVYPVLNPVENLSQWKEL  408



>gb|EMT06888.1| hypothetical protein F775_12167 [Aegilops tauschii]
Length=475

 Score =   130 bits (327),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 127/264 (48%), Gaps = 47/264 (18%)
 Frame = -3

Query  1015  SPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMK  836
             +P+   SP+PTPL L D++QTPG  F TH  N   G+  R   Q+VY +L PIEN  Q  
Sbjct  203   NPDPSDSPFPTPLVLRDDIQTPG--FTTHQGNFKPGKRGRASKQFVYPVLRPIENKLQWT  260

Query  835   EVInedsessqdsnSKLLF---------------SDMGESVDLSSE-ANATSEIGLRES-  707
             E+ +E S        K  +                 + ES +LSSE A      G +E  
Sbjct  261   ELRDESSPMVASHPPKRRYLSADSTEKPQQHTLPGSVNESTELSSESAPFLFHSGRKEQQ  320

Query  706   ------------------------STENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGK  599
                                     S+EN  +  ASLS WLK S      +  G  +  G 
Sbjct  321   AQEDENVNQQQLVGGGGVGELLNKSSENGKHGVASLSCWLKTSCADGEGE-TGRQLGFGS  379

Query  598   T-LGDRPILGMVAAHW-NENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLE  425
               L D PI      +W NEN  + + PK WDGNGIPN+T KYKEDQ+V+WHATPFEERL 
Sbjct  380   VDLSDVPIFVASGLNWDNENNPTPMLPKAWDGNGIPNTTTKYKEDQRVNWHATPFEERLM  439

Query  424   KALSEESLVSQRKRMSGSPISFNE  353
             K LS+E    QRK +SG  I   E
Sbjct  440   KVLSDEKPHHQRK-ISGKLIHLEE  462



>ref|XP_008647301.1| PREDICTED: uncharacterized protein LOC100191773 isoform X3 [Zea 
mays]
 gb|AFW76068.1| hypothetical protein ZEAMMB73_706544 [Zea mays]
Length=421

 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 128/248 (52%), Gaps = 34/248 (14%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             +S  SP+PTPL L D+MQTPGT + +H     +G+  R R Q++Y +L  IEN  Q  E+
Sbjct  182   DSGGSPFPTPLVLRDDMQTPGTAYASHRGTSISGKRVRTRKQFIYPVLRSIENRLQQIEL  241

Query  829   InedsessqdsnSKLLFSDMG-ESVDLSSEANATSEI-------------------GLRE  710
               + S  +     K    D+G +S    ++A++TS +                   G+ E
Sbjct  242   TEDSSPLASSDPLKE--RDLGADSTKDPTQASSTSVVKSGLSETPSYSAPDPNASYGVEE  299

Query  709   SSTENN---LNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWN---E  548
             S +++N    N   SLS WLK S   +  Q           L ++P+  MVA   N    
Sbjct  300   SLSKSNSDEKNAALSLSRWLKSSSADAENQ----DDEDCSFLTEKPVF-MVAPDLNLDTS  354

Query  547   NETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSP  368
             N T R+ PK WDGNGIPN+T +Y+EDQ+VSWH TPFE+RL K LS+E     RK + G  
Sbjct  355   NPTPRL-PKAWDGNGIPNTTTRYREDQRVSWHTTPFEQRLLKVLSDEDRCPPRKVVRGKL  413

Query  367   ISFNETEE  344
                 ET E
Sbjct  414   FHLEETAE  421



>ref|XP_008647299.1| PREDICTED: uncharacterized protein LOC100191773 isoform X1 [Zea 
mays]
 gb|ACL54094.1| unknown [Zea mays]
 gb|AFW76067.1| hypothetical protein ZEAMMB73_706544 [Zea mays]
Length=426

 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 128/248 (52%), Gaps = 34/248 (14%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             +S  SP+PTPL L D+MQTPGT + +H     +G+  R R Q++Y +L  IEN  Q  E+
Sbjct  187   DSGGSPFPTPLVLRDDMQTPGTAYASHRGTSISGKRVRTRKQFIYPVLRSIENRLQQIEL  246

Query  829   InedsessqdsnSKLLFSDMG-ESVDLSSEANATSEI-------------------GLRE  710
               + S  +     K    D+G +S    ++A++TS +                   G+ E
Sbjct  247   TEDSSPLASSDPLKE--RDLGADSTKDPTQASSTSVVKSGLSETPSYSAPDPNASYGVEE  304

Query  709   SSTENN---LNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWN---E  548
             S +++N    N   SLS WLK S   +  Q           L ++P+  MVA   N    
Sbjct  305   SLSKSNSDEKNAALSLSRWLKSSSADAENQ----DDEDCSFLTEKPVF-MVAPDLNLDTS  359

Query  547   NETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSP  368
             N T R+ PK WDGNGIPN+T +Y+EDQ+VSWH TPFE+RL K LS+E     RK + G  
Sbjct  360   NPTPRL-PKAWDGNGIPNTTTRYREDQRVSWHTTPFEQRLLKVLSDEDRCPPRKVVRGKL  418

Query  367   ISFNETEE  344
                 ET E
Sbjct  419   FHLEETAE  426



>ref|NP_001130670.1| uncharacterized protein LOC100191773 [Zea mays]
 gb|ACF78979.1| unknown [Zea mays]
 gb|AFW76069.1| hypothetical protein ZEAMMB73_706544 [Zea mays]
Length=453

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 128/248 (52%), Gaps = 34/248 (14%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             +S  SP+PTPL L D+MQTPGT + +H     +G+  R R Q++Y +L  IEN  Q  E+
Sbjct  214   DSGGSPFPTPLVLRDDMQTPGTAYASHRGTSISGKRVRTRKQFIYPVLRSIENRLQQIEL  273

Query  829   InedsessqdsnSKLLFSDMG-ESVDLSSEANATSEI-------------------GLRE  710
               + S  +     K    D+G +S    ++A++TS +                   G+ E
Sbjct  274   TEDSSPLASSDPLKE--RDLGADSTKDPTQASSTSVVKSGLSETPSYSAPDPNASYGVEE  331

Query  709   SSTENN---LNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWN---E  548
             S +++N    N   SLS WLK S   +  Q           L ++P+  MVA   N    
Sbjct  332   SLSKSNSDEKNAALSLSRWLKSSSADAENQ----DDEDCSFLTEKPVF-MVAPDLNLDTS  386

Query  547   NETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSP  368
             N T R+ PK WDGNGIPN+T +Y+EDQ+VSWH TPFE+RL K LS+E     RK + G  
Sbjct  387   NPTPRL-PKAWDGNGIPNTTTRYREDQRVSWHTTPFEQRLLKVLSDEDRCPPRKVVRGKL  445

Query  367   ISFNETEE  344
                 ET E
Sbjct  446   FHLEETAE  453



>ref|XP_004951783.1| PREDICTED: uncharacterized protein LOC101762196 [Setaria italica]
Length=431

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 92/274 (34%), Positives = 130/274 (47%), Gaps = 56/274 (20%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             +S  SPYPTPL L  ++QTPGTV+   +    +G+  R   Q++Y +L PIEN  Q  E+
Sbjct  162   DSSDSPYPTPLVLRGDIQTPGTVYTACMGTSKHGKRARASRQFIYPVLRPIENKLQWMEL  221

Query  829   InedsessqdsnSKL--LFSDMGESVDLSSEANATSEIG---------------------  719
                +S     +  K   + SD  E    +  ++  ++ G                     
Sbjct  222   KAAESPVLASNPPKRRNMSSDFSEKPQQTFASSMAAQTGSPNSEPFPFHDYCAEQDEVIS  281

Query  718   -------------------LRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH----  608
                                L E  +E+  +  +SL+ WLKPS   S+     G  +    
Sbjct  282   PDELKAQNVKQQLFEGGEELPEQGSEDGKHGVSSLAYWLKPS---SADDESHGDTNTEDN  338

Query  607   ------HGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHAT  446
                   + K++ D PI    A +W+ +  + V PK WDGNGIPN+T KYKEDQKVSWHAT
Sbjct  339   VEKEPCYEKSVFDVPIFPASAFNWDIDNPTPVLPKAWDGNGIPNTTTKYKEDQKVSWHAT  398

Query  445   PFEERLEKALSEESLVSQRKRMSGSPISFNETEE  344
             PFEERL K LS+E  + +RK +SG  I   E  E
Sbjct  399   PFEERLMKVLSDEKPLHERK-ISGKLIHLEENAE  431



>ref|XP_009406745.1| PREDICTED: uncharacterized protein LOC103989588 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=492

 Score =   125 bits (314),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 79/126 (63%), Gaps = 9/126 (7%)
 Frame = -3

Query  685  VEASLSSWLKPSLRQSSTQPFGGSIHHGKTLG-----DRPILGMVAAHWNENETSRVSPK  521
            V  SLS WLKP +++         +H     G     DRPILGMVAAHW + E      K
Sbjct  370  VVTSLSQWLKPPIKKDG---LHNELHEKSCSGKSSDADRPILGMVAAHWKDEEPEPKLSK  426

Query  520  WWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISF-NETEE  344
             WDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E+ + QR    G  I    E E 
Sbjct  427  RWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSDENFIPQRNLHHGKLIELEGEGEL  486

Query  343  SDTALS  326
            SDTA S
Sbjct  487  SDTAAS  492


 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMK  836
             SK SP+PTPLK+++EM+TP TV+P + +N+  GR   I++QYV  ++N +EN S+ K
Sbjct  216   SKCSPFPTPLKVTNEMETPATVYPANRENVRTGRNTTIQTQYVCPVINGVENLSRWK  272



>ref|XP_009406746.1| PREDICTED: uncharacterized protein LOC103989588 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=490

 Score =   125 bits (314),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 79/126 (63%), Gaps = 9/126 (7%)
 Frame = -3

Query  685  VEASLSSWLKPSLRQSSTQPFGGSIHHGKTLG-----DRPILGMVAAHWNENETSRVSPK  521
            V  SLS WLKP +++         +H     G     DRPILGMVAAHW + E      K
Sbjct  368  VVTSLSQWLKPPIKKDG---LHNELHEKSCSGKSSDADRPILGMVAAHWKDEEPEPKLSK  424

Query  520  WWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISF-NETEE  344
             WDGNGIPNST+KYKEDQKVSWHATPFEERLEKALS+E+ + QR    G  I    E E 
Sbjct  425  RWDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSDENFIPQRNLHHGKLIELEGEGEL  484

Query  343  SDTALS  326
            SDTA S
Sbjct  485  SDTAAS  490


 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMK  836
             SK SP+PTPLK+++EM+TP TV+P + +N+  GR   I++QYV  ++N +EN S+ K
Sbjct  214   SKCSPFPTPLKVTNEMETPATVYPANRENVRTGRNTTIQTQYVCPVINGVENLSRWK  270



>ref|XP_010240600.1| PREDICTED: uncharacterized protein LOC100845039 isoform X1 [Brachypodium 
distachyon]
Length=386

 Score =   123 bits (308),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 112/228 (49%), Gaps = 31/228 (14%)
 Frame = -3

Query  997  SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
            SP PTPL L D+MQTPGT++ +H  + A+ +  R R Q+VY +L PIEN  Q  E+  + 
Sbjct  179  SPIPTPLVLRDDMQTPGTIYTSHTGSSASRKRLRTRKQFVYPVLRPIENKLQQMELTEDA  238

Query  817  sessqdsnSKLLFSDMGESVDLSSEANATSEI----------GLRESSTENNLNVEASLS  668
            S     +  K +  ++G     SS     S+           G    S  +  +   SL 
Sbjct  239  SPVLPSNTPKRI--NLGADYIKSSVDKEESKCRISSPNLLDGGALSKSNSDESDAALSLC  296

Query  667  SWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNST  488
             WLKPS      Q  G +       GD            EN T R+ PK WDGNGIPN+ 
Sbjct  297  HWLKPSSSDIENQASGMN-------GDV-----------ENPTPRL-PKAWDGNGIPNTI  337

Query  487  HKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEE  344
             KYKEDQKVSWHATPFEERL K LS++     RK   G+     E  E
Sbjct  338  SKYKEDQKVSWHATPFEERLMKVLSDDKPNPPRKLTRGNLFHVEEMSE  385



>ref|XP_010240601.1| PREDICTED: uncharacterized protein LOC100845039 isoform X2 [Brachypodium 
distachyon]
Length=393

 Score =   123 bits (308),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 114/228 (50%), Gaps = 24/228 (11%)
 Frame = -3

Query  997  SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIned  818
            SP PTPL L D+MQTPGT++ +H  + A+ +  R R Q+VY +L PIEN  Q  E+  + 
Sbjct  179  SPIPTPLVLRDDMQTPGTIYTSHTGSSASRKRLRTRKQFVYPVLRPIENKLQQMELTEDA  238

Query  817  sessqdsnSKLLFSDMGESVDLSSEANATSEI----------GLRESSTENNLNVEASLS  668
            S     +  K +  ++G     SS     S+           G    S  +  +   SL 
Sbjct  239  SPVLPSNTPKRI--NLGADYIKSSVDKEESKCRISSPNLLDGGALSKSNSDESDAALSLC  296

Query  667  SWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNST  488
             WLKPS            I + ++   R   GM      EN T R+ PK WDGNGIPN+ 
Sbjct  297  HWLKPS---------SSDIENQESPVFRAASGMNGDV--ENPTPRL-PKAWDGNGIPNTI  344

Query  487  HKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNETEE  344
             KYKEDQKVSWHATPFEERL K LS++     RK   G+     E  E
Sbjct  345  SKYKEDQKVSWHATPFEERLMKVLSDDKPNPPRKLTRGNLFHVEEMSE  392



>gb|KHM99684.1| hypothetical protein glysoja_006527 [Glycine soja]
Length=321

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 74/100 (74%), Gaps = 8/100 (8%)
 Frame = -3

Query  673  LSSWLKPSL-----RQSSTQPFGGSIHHGKTLGDRPILGMVAAHWNENETSRVSP-KWWD  512
            L+SWLKP+      R    Q     +   KT  DRPI+GMVAAHW E+E S+  P KWWD
Sbjct  211  LTSWLKPAAVILEERNKRMQTSYNQVR--KTPADRPIIGMVAAHWIEDEDSQAPPPKWWD  268

Query  511  GNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQ  392
            GNGIPNST+KYK+DQKV+WHAT FEERLEKALSEE+++SQ
Sbjct  269  GNGIPNSTNKYKKDQKVNWHATSFEERLEKALSEETVISQ  308



>ref|XP_004981563.1| PREDICTED: uncharacterized protein LOC101785358 isoform X1 [Setaria 
italica]
Length=411

 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 88/134 (66%), Gaps = 16/134 (12%)
 Frame = -3

Query  697  NNLNVEA-SLSSWLKPSLRQSSTQPF------GGSIHHGKTLG-DRPILGMVAAHWNENE  542
            N+L +E  SLS WLKP    +  +PF      G   +  K+   DRPI+GMVAAHW + E
Sbjct  275  NDLELELPSLSHWLKPP---NPKKPFRDEALTGDRSNSAKSSDEDRPIIGMVAAHWKDKE  331

Query  541  TSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPIS  362
                +PKW+DGNGIPNST+KYKE   VSWHATPFEERLEKALSEE L+S+R   SG    
Sbjct  332  PENFTPKWFDGNGIPNSTNKYKE---VSWHATPFEERLEKALSEEKLLSERNCSSGKTSQ  388

Query  361  F--NETEESDTALS  326
            F   E EESDTA S
Sbjct  389  FLGVEGEESDTAES  402



>ref|XP_008647300.1| PREDICTED: uncharacterized protein LOC100191773 isoform X2 [Zea 
mays]
Length=424

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 126/248 (51%), Gaps = 36/248 (15%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             +S  SP+PTPL L D+MQTPGT + +H     +G+  R R Q++Y +L  IEN  Q  E+
Sbjct  187   DSGGSPFPTPLVLRDDMQTPGTAYASHRGTSISGKRVRTRKQFIYPVLRSIENRLQQIEL  246

Query  829   InedsessqdsnSKLLFSDMG-ESVDLSSEANATSEI-------------------GLRE  710
               + S  +     K    D+G +S    ++A++TS +                   G+ E
Sbjct  247   TEDSSPLASSDPLKE--RDLGADSTKDPTQASSTSVVKSGLSETPSYSAPDPNASYGVEE  304

Query  709   SSTENN---LNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWN---E  548
             S +++N    N   SLS WLK S   +  Q           L ++P+  MVA   N    
Sbjct  305   SLSKSNSDEKNAALSLSRWLKSSSADAENQ----DDEDCSFLTEKPVF-MVAPDLNLDTS  359

Query  547   NETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSP  368
             N T R+ PK WDGNGIPN+T +Y+E  +VSWH TPFE+RL K LS+E     RK + G  
Sbjct  360   NPTPRL-PKAWDGNGIPNTTTRYRE--RVSWHTTPFEQRLLKVLSDEDRCPPRKVVRGKL  416

Query  367   ISFNETEE  344
                 ET E
Sbjct  417   FHLEETAE  424



>gb|EMT21537.1| hypothetical protein F775_15618 [Aegilops tauschii]
Length=507

 Score =   119 bits (298),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 126/261 (48%), Gaps = 56/261 (21%)
 Frame = -3

Query  1000 ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIne  821
             SP+PTPL L D+MQTPGT++ +H  +  + +  R R Q+VY +L PIEN  Q  E  ++
Sbjct  242  GSPFPTPLVLRDDMQTPGTMYASHTGSTMSRKRVRTRKQFVYPVLRPIENKLQQVEPSDD  301

Query  820  dsessqdsnSKL--LFSDMGESVDLSSEANATSEIGLRES--------------------  707
             S     S+ K   L +D  + +  +S +N+ +++G  +S                    
Sbjct  302  SSPMLPSSSPKRANLGADHIKKLQQTS-SNSVAKVGFSKSLPFSFPSENASYQEKGSPPS  360

Query  706  --------------------STENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGK----  599
                                S  +      SL+ WLKPS R +  Q    S    +    
Sbjct  361  EESKCQTRSPDLLDGGALSKSNSDEKRAAMSLTHWLKPSSRDNENQGVVTSSASDQPRDE  420

Query  598  --TLGDRPIL----GMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFE  437
                 + P+     GM A    EN T R  PK WDGNGIPN+T KYKEDQKVSWHATPFE
Sbjct  421  NTLFTESPVFTAASGMDADV--ENPTPRF-PKAWDGNGIPNTTTKYKEDQKVSWHATPFE  477

Query  436  ERLEKALSEESLVSQRKRMSG  374
            ERL + LS+E  ++ RK + G
Sbjct  478  ERLLRVLSDEQPIAPRKLIRG  498



>ref|XP_002438836.1| hypothetical protein SORBIDRAFT_10g026920 [Sorghum bicolor]
 gb|EER90203.1| hypothetical protein SORBIDRAFT_10g026920 [Sorghum bicolor]
Length=442

 Score =   118 bits (295),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 128/259 (49%), Gaps = 42/259 (16%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             +S  SP+PTPL L D+MQTPGT + +H     +G+  R R Q++Y +L  IEN  Q  E+
Sbjct  185   DSSGSPFPTPLVLRDDMQTPGTAYASHRGTSVSGKRVRTRKQFIYPVLRSIENRLQQTEL  244

Query  829   InedsessqdsnSK-------------------LLFSDMGES--VDLSSEANATSEI---  722
               + S  +  +  K                   ++ S + E+    L+ +ANA+  +   
Sbjct  245   TEDSSPLASSNPLKGRNLEADSIKDPTQISSTSVVKSGLSETPPSYLAPDANASYSVKEA  304

Query  721   ----------GLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIH--HGKTLGDRPI  578
                       GL +S+++   N   SLS WLK S   +  Q   G +         ++P+
Sbjct  305   QSPDELLDGKGLPKSNSDEK-NAALSLSRWLKSSSTDAENQ---GDVKCPAKDQSNEKPV  360

Query  577   LGMVAAHWN-ENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESL  401
                   + + +N T R+ PK WDGNGIPN+T +YKEDQ+V+WH TPFE+RL K LS+E  
Sbjct  361   FMTSDLNLDTDNPTPRL-PKAWDGNGIPNTTTRYKEDQRVNWHTTPFEQRLLKVLSDEDR  419

Query  400   VSQRKRMSGSPISFNETEE  344
                RK + G      E  E
Sbjct  420   CPPRKVVRGKLFQLEEKAE  438



>ref|XP_006657237.1| PREDICTED: uncharacterized protein LOC102706111 [Oryza brachyantha]
Length=429

 Score =   117 bits (294),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 90/237 (38%), Positives = 125/237 (53%), Gaps = 29/237 (12%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
              S  SP+PTPL L D+MQTPGTV  +H     +G+  R R Q+VY I+ PIEN  +  E+
Sbjct  188   GSGDSPFPTPLVLRDDMQTPGTVCTSHKG--PSGKPVRTRKQFVYPIVRPIENKLRQMEL  245

Query  829   Ineds--------essqdsnSKLLFSD---MGESVDLSSEANATSEIGLR--------ES  707
               E S         +      +L  SD    GES D      +  ++G++        +S
Sbjct  246   TEESSKPSKRRNLSADSIKKPQLTSSDSVEKGESPDSLPLPKSKCQLGIQRQLGDEIPKS  305

Query  706   STENNLNVEASLSSWLKPSLRQSSTQ-----PFGGSIHHGKTLGDRPILGMVAAHWNE-N  545
              ++ NL V  SLS+WLKPS   +  +       G   +  K L +  +     + W+E N
Sbjct  306   ISDENLEV-CSLSNWLKPSAAGNENEGPVECSVGSRSYDEKNLLEGHVFMATESKWDEEN  364

Query  544   ETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSG  374
              T R+S K  D +GIPN+T KY+EDQK+ WH+TPFEERL K LSEE +   RK + G
Sbjct  365   PTPRLS-KPLDFHGIPNTTKKYQEDQKIKWHSTPFEERLLKVLSEEEVPPTRKLVRG  420



>ref|NP_001143671.1| uncharacterized protein LOC100276394 [Zea mays]
 gb|ACG33928.1| hypothetical protein [Zea mays]
Length=451

 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 82/127 (65%), Gaps = 12/127 (9%)
 Frame = -3

Query  676  SLSSWLKP-----SLRQSSTQPFGGSIHHGKTLG-DRPILGMVAAHWNENET--SRVSPK  521
            SL+ WLKP     + R  +    G   H GK+   DRPI+GMVAAHW +     +  + K
Sbjct  303  SLAQWLKPPNPKKTFRDEAMA--GDRSHSGKSSDEDRPIIGMVAAHWKDKVPLPANFTSK  360

Query  520  WWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISF--NETE  347
              DGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEE L+S+R   SG    F   E E
Sbjct  361  LRDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEEKLLSERSCSSGKTSQFLGVEGE  420

Query  346  ESDTALS  326
            ESD A S
Sbjct  421  ESDMAES  427



>gb|ACN25562.1| unknown [Zea mays]
 tpg|DAA51704.1| TPA: hypothetical protein ZEAMMB73_745172 [Zea mays]
Length=451

 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 82/127 (65%), Gaps = 12/127 (9%)
 Frame = -3

Query  676  SLSSWLKP-----SLRQSSTQPFGGSIHHGKTLG-DRPILGMVAAHWNENET--SRVSPK  521
            SL+ WLKP     + R  +    G   H GK+   DRPI+GMVAAHW +     +  + K
Sbjct  303  SLAQWLKPPNPKKTFRDEAMA--GDRSHSGKSSDEDRPIIGMVAAHWKDKVPLPANFTSK  360

Query  520  WWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISF--NETE  347
              DGNGIPNST+KYKEDQKVSWHATPFEERLEKALSEE L+S+R   SG    F   E E
Sbjct  361  LRDGNGIPNSTNKYKEDQKVSWHATPFEERLEKALSEEKLLSERSCSSGKTSQFLGVEGE  420

Query  346  ESDTALS  326
            ESD A S
Sbjct  421  ESDMAES  427



>dbj|BAJ87049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 93/253 (37%), Positives = 125/253 (49%), Gaps = 47/253 (19%)
 Frame = -3

Query  1000 ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV---  830
             SP+PTPL L DEMQTPGT++ +H  +  + +  R R Q+VY +L PIEN  Q  E+   
Sbjct  191  GSPFPTPLVLRDEMQTPGTIYTSHTGSTMSRKRVRTRKQFVYPVLRPIENKLQQTELPED  250

Query  829  ------------InedsessqdsnSK------LLFSDMGESVDLSSEANATSEIGLRESS  704
                        I +  ++S +S +K      L FS   E+     + +  SE    ++ 
Sbjct  251  SSSMLPSSSPKHIRKLQQTSSNSVAKVGFLKSLPFSYPTENSSHKEKGSPPSEESKCQTR  310

Query  703  TENNLNVEA-------------SLSSWLKPSLRQSSTQPFGGSIHHGK------TLGDRP  581
            + N L+  A             SL+ WLKP    S  Q    S    +         + P
Sbjct  311  SPNLLDGGALSKSISDEKHAAMSLTHWLKPLSTVSEDQGVVSSSASDQPRDENTLFTESP  370

Query  580  IL----GMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
            +     GM A    EN T R  PK WDGNGIPN+T+KYKEDQKVSWH TPFEERL + LS
Sbjct  371  VFTAASGMDAD--VENHTPRF-PKAWDGNGIPNTTNKYKEDQKVSWHTTPFEERLLRVLS  427

Query  412  EESLVSQRKRMSG  374
            +E   + RK + G
Sbjct  428  DEQPNAPRKLIRG  440



>ref|XP_009408258.1| PREDICTED: uncharacterized protein LOC103990737 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   110 bits (275),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 73/113 (65%), Gaps = 6/113 (5%)
 Frame = -3

Query  685  VEASLSSWLKPSLRQSSTQPFGGSIHHGKTL------GDRPILGMVAAHWNENETSRVSP  524
            + +SLS WLKP   ++        I + ++        +RPI+G VAAHW +++    S 
Sbjct  370  IISSLSRWLKPKPLKNRNFDVTAFISNEQSCPVMNFDAERPIIGTVAAHWTDDDACSNSH  429

Query  523  KWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPI  365
              W+GNGIPNST KYKEDQ+VSWHATPFEERL+K LS+E L+ QRK +   PI
Sbjct  430  GHWNGNGIPNSTTKYKEDQRVSWHATPFEERLDKVLSDEKLLPQRKLLYREPI  482


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQ  842
             +S  SPYPTPL L++EMQTPGTV+P ++D+L  G+  RIR+QYVY +L P+EN  Q
Sbjct  216   DSSDSPYPTPLNLTNEMQTPGTVYPVNLDSLRTGKHTRIRTQYVYPVLKPVENLPQ  271



>gb|KDO40900.1| hypothetical protein CISIN_1g029349mg [Citrus sinensis]
Length=194

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 109/175 (62%), Gaps = 24/175 (14%)
 Frame = -3

Query  1102  CRQRSVRFDCkstksdmssalsksSFEV----DSPN----SKASPYPTPLKLSDEMQTPG  947
             CR +SVRF+  S  S    + S +  ++    +SP+    SK SP PTPLKLSD+MQTPG
Sbjct  24    CRNKSVRFEFDSDASSSKDSSSGNISQICRKYESPDNENVSKNSPNPTPLKLSDDMQTPG  83

Query  946   TVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMG  767
             TV+PT++ +LA+G   RIRSQYVYS+ NP+E+ SQ+K +        +  +S  L  ++ 
Sbjct  84    TVYPTNLKSLADGN-TRIRSQYVYSVWNPVESVSQLKAL------EEEGFDSHELSGELK  136

Query  766   ESVDLSSEANATSEI--GLRESSTENNLNVEASLSSWLKPSLRQS--STQPFGGS  614
             ES++     NAT E+  G+  SS   +L VEASLS+WLKP+   S  +++  GGS
Sbjct  137   ESIE-----NATPELDTGVEGSSVGKDLKVEASLSAWLKPAASTSDDNSKSTGGS  186



>ref|XP_004967263.1| PREDICTED: uncharacterized protein LOC101766103 [Setaria italica]
Length=420

 Score =   106 bits (265),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 123/249 (49%), Gaps = 49/249 (20%)
 Frame = -3

Query  1000 ASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVIne  821
             SP+ TPL L D+MQTPGTV+ +H     +G+  + R Q++Y +L PIEN  +  E+   
Sbjct  171  GSPFVTPLVLRDDMQTPGTVYTSHRGASMSGKRVQTRKQFIYPVLRPIENRVKQMEL---  227

Query  820  dsessqdsnSKLLFSDMGESVDL---------SSEANATSEIGLRES-------------  707
                  + +S LL S+  +  +L          + +N+ ++ GL ++             
Sbjct  228  -----AEDSSPLLSSNPPKKRNLEEDHVMKPKQTSSNSVAKSGLSKTPPISRQVKEALSP  282

Query  706  -----------STENNLNVEASLSSWLKPSLR----QSSTQPFGGSIHHGKTL--GDRPI  578
                       +  +  N   SLS W+K S +    Q   +   G   + +     +RP+
Sbjct  283  EELLDGGELSKTKSDERNAALSLSHWVKSSSKDVENQGDVKVVAGDQSYDECSFPAERPV  342

Query  577  LGMVAAHWN-ENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESL  401
                  +W+ EN T ++  K ++GNGIPN+T +YKED++VSWH TPFEERL K LS+E  
Sbjct  343  FMASDFNWDIENPTPKLH-KTFNGNGIPNTTTRYKEDRRVSWHTTPFEERLLKVLSDEKH  401

Query  400  VSQRKRMSG  374
             + RK   G
Sbjct  402  CAPRKVFRG  410



>ref|XP_007137175.1| hypothetical protein PHAVU_009G106000g [Phaseolus vulgaris]
 gb|ESW09169.1| hypothetical protein PHAVU_009G106000g [Phaseolus vulgaris]
Length=100

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 62/98 (63%), Gaps = 17/98 (17%)
 Frame = -3

Query  610  HHGKTLGDRPILGMVAAHWNENETSRVSP-KWWDGNGIPNSTHKYKEDQKVSWHATPFEE  434
            H  K+   RPI+GMVAAHWN+NE S+V P KWWD                V+WHA P EE
Sbjct  7    HGRKSPVHRPIIGMVAAHWNKNEDSQVPPPKWWD----------------VNWHARPIEE  50

Query  433  RLEKALSEESLVSQRKRMSGSPISFNETEESDTALSQL  320
            RLEK LSE S++SQRK   G  I F E EESDT+LSQL
Sbjct  51   RLEKTLSEASVISQRKDACGKSIPFEENEESDTSLSQL  88



>ref|XP_002451610.1| hypothetical protein SORBIDRAFT_04g004570 [Sorghum bicolor]
 gb|EES04586.1| hypothetical protein SORBIDRAFT_04g004570 [Sorghum bicolor]
Length=370

 Score = 99.4 bits (246),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 75/131 (57%), Gaps = 7/131 (5%)
 Frame = -3

Query  718  LRESSTENNLNVEASLSSWLKPSLR--QSSTQPFGGSIH----HGKTLGDRPILGMVAAH  557
            L E S+E       SLS WLKPS    +S   P  G++     +  ++ D PI      +
Sbjct  241  LLEQSSEYGKRGVTSLSHWLKPSSADDESKCSPDDGNVGKETWYETSVSDVPIFPAFGFN  300

Query  556  WNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMS  377
            W  +  + V PK WDGNGIPN+T KYKEDQKVSWHATPFEERL K LS+E    +RK +S
Sbjct  301  WETDNPTPVLPKAWDGNGIPNTTTKYKEDQKVSWHATPFEERLLKVLSDEKPRHERK-IS  359

Query  376  GSPISFNETEE  344
            G  I   E  E
Sbjct  360  GKLIHLEENAE  370



>ref|NP_001046012.1| Os02g0168300 [Oryza sativa Japonica Group]
 dbj|BAD26250.1| dentin sialophosphoprotein precursor-like [Oryza sativa Japonica 
Group]
 dbj|BAD25712.1| dentin sialophosphoprotein precursor-like [Oryza sativa Japonica 
Group]
 dbj|BAF07926.1| Os02g0168300 [Oryza sativa Japonica Group]
 dbj|BAG96004.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72568.1| hypothetical protein OsI_06006 [Oryza sativa Indica Group]
 gb|EEE56388.1| hypothetical protein OsJ_05534 [Oryza sativa Japonica Group]
Length=389

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = -3

Query  679  ASLSSWLKP--SLRQSSTQPFGGSI----HHGKTLGDRPILGMVAAHWNENETSRVSPKW  518
            ASLS WLKP  S   S +   G  +    +      D PI      +W+ ++ + V PK 
Sbjct  273  ASLSCWLKPPSSAGGSQSDTEGKVVKQRCYENSVFTDLPIFTASGLNWDNDKPTPVLPKV  332

Query  517  WDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNE  353
            WDGNGIPN+T KYKEDQKVSWHATPFEERL K LS+E    QRK +SG  I  +E
Sbjct  333  WDGNGIPNTTTKYKEDQKVSWHATPFEERLMKVLSDEKPHHQRK-ISGKLIQLDE  386


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -3

Query  997  SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
            SP+PTPL L  +MQTPGT+   + ++L +G+  R   Q++Y +L PIEN  Q  E+
Sbjct  125  SPHPTPLVLRGDMQTPGTLNTAYKESLRSGKRARTNKQFIYPVLRPIENKLQWMEL  180



>dbj|BAJ87364.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 73/131 (56%), Gaps = 14/131 (11%)
 Frame = -3

Query  718  LRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLG-------DRPILGMVAA  560
            L   S+EN  +  ASLS WLK S          G    G+ LG       D PI      
Sbjct  325  LLNKSSENGKHGVASLSCWLKASCADGGH----GEGQTGRQLGFEGVDLSDVPIFVASGL  380

Query  559  HWN--ENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRK  386
            +W+  EN  + + PK WDGNGIPN+T KYKEDQ+V+WHATPFEERL K LS+E    QRK
Sbjct  381  NWDDGENHPTPMLPKAWDGNGIPNTTTKYKEDQRVNWHATPFEERLMKVLSDEKPHHQRK  440

Query  385  RMSGSPISFNE  353
             +SG  I   E
Sbjct  441  -ISGKLIHLEE  450


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (61%), Gaps = 2/56 (4%)
 Frame = -3

Query  997  SPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
            SP+PTPL L D++QTPG  F T   N   G+  R   Q++Y +L PIEN  Q  E+
Sbjct  181  SPFPTPLALRDDIQTPG--FTTLQGNFKPGKRGRASKQFLYPVLRPIENKLQWTEL  234



>gb|ACG31592.1| hypothetical protein [Zea mays]
Length=437

 Score = 93.6 bits (231),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 70/126 (56%), Gaps = 16/126 (13%)
 Frame = -3

Query  679  ASLSSWLKPSLRQSS-TQPFGGSIHH----------GKTLGDRPILGMVAAHWNENETSR  533
            ASLS WLKPS   +    P  GS +           G  + D P        W E ET +
Sbjct  314  ASLSHWLKPSSSSADDGSPDDGSSNFVGTEEEKTRCGANVSDVPFFPAFGLDW-EGETDK  372

Query  532  ---VSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPIS  362
               V PK WDGNGIPN+T KYKEDQKVSWHATPFEERL K LS+E    +R R+SG  I 
Sbjct  373  PTPVLPKAWDGNGIPNTTTKYKEDQKVSWHATPFEERLLKVLSDEKPRHER-RISGKLIH  431

Query  361  FNETEE  344
             +E  E
Sbjct  432  LDENAE  437



>ref|NP_001132267.1| uncharacterized protein LOC100193703 [Zea mays]
 gb|ACF81044.1| unknown [Zea mays]
 gb|AFW66378.1| hypothetical protein ZEAMMB73_852353 [Zea mays]
Length=437

 Score = 93.6 bits (231),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 70/126 (56%), Gaps = 16/126 (13%)
 Frame = -3

Query  679  ASLSSWLKPSLRQSS-TQPFGGSIHH----------GKTLGDRPILGMVAAHWNENETSR  533
            ASLS WLKPS   +    P  GS +           G  + D P        W E ET +
Sbjct  314  ASLSHWLKPSSSSADDGSPDDGSSNFVGTEEEKTRCGANVSDVPFFPAFGLDW-EGETDK  372

Query  532  ---VSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPIS  362
               V PK WDGNGIPN+T KYKEDQKVSWHATPFEERL K LS+E    +R R+SG  I 
Sbjct  373  PTPVLPKAWDGNGIPNTTTKYKEDQKVSWHATPFEERLLKVLSDEKPRHER-RISGKLIH  431

Query  361  FNETEE  344
             +E  E
Sbjct  432  LDENAE  437



>ref|NP_001058327.1| Os06g0670100 [Oryza sativa Japonica Group]
 dbj|BAD45452.1| dentin sialophosphoprotein precursor-like [Oryza sativa Japonica 
Group]
 dbj|BAF20241.1| Os06g0670100 [Oryza sativa Japonica Group]
 dbj|BAG95624.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score = 93.2 bits (230),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 117/233 (50%), Gaps = 29/233 (12%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVI  827
             S  SP+ TPL L D+MQTP TV+ +H    ++G+  R R Q+ Y I  P EN  Q  ++ 
Sbjct  193   SSDSPFHTPLVLRDDMQTPRTVYTSHKG--SSGKRVRTRKQFAYPIFRPTENKLQKMQLS  250

Query  826   nedsessqdsnSKLLFSDMGESVDLSSEANATSEIGL---------RESSTENNLNVEA-  677
             +    + Q S+  ++    GES++ S      S+  L           S + ++ N+E  
Sbjct  251   DSAKMTQQISSDSVV---KGESLNSSHFPLEVSKYQLDRQRLLDAGERSKSNSDENIEVC  307

Query  676   SLSSWLKPSLRQSSTQPF--GGSIHHGKTLGDRPILGMVAAHWN---ENETSRVSPKWWD  512
             SLS WLK S   ++ Q +     I  G           + +  N   +N T R+S K  D
Sbjct  308   SLSRWLKSSPAGNTNQMYDENNLIEEGHAF--------MTSEDNVDVDNHTPRLS-KARD  358

Query  511   GNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPISFNE  353
              + IPN++ KY EDQ VSWH+TPFEERL K LS+E +   RK + G  +   E
Sbjct  359   CHCIPNTSRKYGEDQHVSWHSTPFEERLIKVLSDEEVPPTRKLVPGRLLYLEE  411



>ref|XP_003570036.1| PREDICTED: uncharacterized protein LOC100826550 [Brachypodium 
distachyon]
 ref|XP_010233868.1| PREDICTED: uncharacterized protein LOC100826550 [Brachypodium 
distachyon]
 ref|XP_010233869.1| PREDICTED: uncharacterized protein LOC100826550 [Brachypodium 
distachyon]
 ref|XP_010233871.1| PREDICTED: uncharacterized protein LOC100826550 [Brachypodium 
distachyon]
 ref|XP_010233872.1| PREDICTED: uncharacterized protein LOC100826550 [Brachypodium 
distachyon]
 ref|XP_010233873.1| PREDICTED: uncharacterized protein LOC100826550 [Brachypodium 
distachyon]
Length=453

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 75/129 (58%), Gaps = 11/129 (9%)
 Frame = -3

Query  718  LRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLG--------DRPILGMVA  563
            L ++S++N  +  ASLS W+K S      Q   GS + GK  G        D PI     
Sbjct  312  LLKNSSDNGKHGVASLSCWIKTSSADGEFQNGNGS-NMGKQPGFEGIGATMDVPIFVASG  370

Query  562  AHWNENETSRVSPKW-WDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRK  386
             +W+ +  + + PK  WDGNGIPN+T KYKEDQ+VSWHATPFEERL K LS+E    QRK
Sbjct  371  LNWDIDNPTPLLPKAAWDGNGIPNTTTKYKEDQRVSWHATPFEERLLKVLSDEKPHHQRK  430

Query  385  RMSGSPISF  359
             +SG  I  
Sbjct  431  -LSGKLIHL  438


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             +S  SP+PTPL +  ++QTPGTV+  H  N  +G+  R   Q++Y +L P+EN  Q  E+
Sbjct  172   DSIDSPFPTPLVIRGDIQTPGTVYTAHQGNFKSGKRGRTNRQFIYPVLRPVENKLQWLEL  231



>gb|EAZ02028.1| hypothetical protein OsI_24060 [Oryza sativa Indica Group]
 gb|EAZ37967.1| hypothetical protein OsJ_22314 [Oryza sativa Japonica Group]
Length=404

 Score = 89.7 bits (221),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 110/215 (51%), Gaps = 29/215 (13%)
 Frame = -3

Query  1006  SKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVI  827
             S  SP+ TPL L D+MQTP TV+ +H    ++G+  R R Q+ Y I  P EN  Q  ++ 
Sbjct  193   SSDSPFHTPLVLRDDMQTPRTVYTSHKG--SSGKRVRTRKQFAYPIFRPTENKLQKMQLS  250

Query  826   nedsessqdsnSKLLFSDMGESVDLSSEANATSEIGL---------RESSTENNLNVEA-  677
             +    + Q S+  ++    GES++ S      S+  L           S + ++ N+E  
Sbjct  251   DSAKMTQQISSDSVV---KGESLNSSHFPLEVSKYQLDRQRLLDAGERSKSNSDENIEVC  307

Query  676   SLSSWLKPSLRQSSTQPF--GGSIHHGKTLGDRPILGMVAAHWN---ENETSRVSPKWWD  512
             SLS WLK S   ++ Q +     I  G           + +  N   +N T R+S K  D
Sbjct  308   SLSRWLKSSPAGNTNQMYDENNLIEEGHAF--------MTSEDNVDVDNHTPRLS-KARD  358

Query  511   GNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEE  407
              + IPN++ KY EDQ VSWH+TPFEERL K LS+E
Sbjct  359   CHCIPNTSRKYGEDQHVSWHSTPFEERLIKVLSDE  393



>gb|AFW66379.1| hypothetical protein ZEAMMB73_852353 [Zea mays]
Length=459

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 61/111 (55%), Gaps = 15/111 (14%)
 Frame = -3

Query  679  ASLSSWLKPSLRQSS-TQPFGGS----------IHHGKTLGDRPILGMVAAHWNENETSR  533
            ASLS WLKPS   +    P  GS             G  + D P        W E ET +
Sbjct  314  ASLSHWLKPSSSSADDGSPDDGSSNFVGTEEEKTRCGANVSDVPFFPAFGLDW-EGETDK  372

Query  532  ---VSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQR  389
               V PK WDGNGIPN+T KYKEDQKVSWHATPFEERL K LS+E    +R
Sbjct  373  PTPVLPKAWDGNGIPNTTTKYKEDQKVSWHATPFEERLLKVLSDEKPRHER  423



>gb|KEH42481.1| hypothetical protein MTR_1g069610 [Medicago truncatula]
Length=449

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/244 (32%), Positives = 111/244 (45%), Gaps = 67/244 (27%)
 Frame = -3

Query  973  LSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsn  794
             ++E+ +P   +   V+++      R RS YV+S+LNP+EN +Q K V  + +  S+   
Sbjct  207  FTEEVDSPIPTYERDVESIGVNFNARDRSVYVHSVLNPVENMAQWKVVKAKRTPRSRPQK  266

Query  793  SKLLFSDMGESVDLSSEANATSEIGLRESSTENNLN----VEASLSSWLKPSLRQSSTQP  626
               + S+    V    +        + E+ T   LN    V+ASLS+WL  S    +T P
Sbjct  267  ENFVSSNHESEVSFGVKE-------ILEAGTPKKLNQEIPVDASLSNWLGSS---GTTTP  316

Query  625  F-------GGSI--------HHGK----TLGDRPILGM----------------------  569
                    GG I          G     +L DRPILG                       
Sbjct  317  VNKACLYAGGGIGTPDRSISQQGSNSVISLEDRPILGALTMEEIKQFSATSSPRKSPCKS  376

Query  568  ---------VAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
                     V ++WN NE S  SP  +   GIPN+T KY+ED+KV+WHATPFE RLEKAL
Sbjct  377  PDEMPIIGTVGSYWNANEGSG-SPSSF--KGIPNTTSKYREDKKVNWHATPFETRLEKAL  433

Query  415  SEES  404
            + ++
Sbjct  434  NRDA  437



>ref|XP_001757272.1| predicted protein [Physcomitrella patens]
 gb|EDQ77757.1| predicted protein [Physcomitrella patens]
Length=765

 Score = 85.9 bits (211),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = -3

Query  589  DRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS-  413
            +RPILG +A HW    T++ S   WDG GIPNSTHKY+EDQKV WH+  FEERL +AL+ 
Sbjct  677  ERPILGSLADHWEAALTTKKSA--WDGKGIPNSTHKYREDQKVMWHSASFEERLVQALAT  734

Query  412  EESLVSQRKRMSGSPISFNETEESDTALSQLH  317
            +E+ V QR+  S   ++      SDT L Q H
Sbjct  735  QEASVPQRRSRSRGLVNRLAAGRSDTGL-QAH  765



>gb|AFW66380.1| hypothetical protein ZEAMMB73_852353 [Zea mays]
Length=435

 Score = 84.3 bits (207),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 68/126 (54%), Gaps = 18/126 (14%)
 Frame = -3

Query  679  ASLSSWLKPSLRQSST-QPFGGSIHH----------GKTLGDRPILGMVAAHWNENETSR  533
            ASLS WLKPS   +    P  GS +           G  + D P        W E ET +
Sbjct  314  ASLSHWLKPSSSSADDGSPDDGSSNFVGTEEEKTRCGANVSDVPFFPAFGLDW-EGETDK  372

Query  532  ---VSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRKRMSGSPIS  362
               V PK WDGNGIPN+T KYKE  KVSWHATPFEERL K LS+E    +R R+SG  I 
Sbjct  373  PTPVLPKAWDGNGIPNTTTKYKE--KVSWHATPFEERLLKVLSDEKPRHER-RISGKLIH  429

Query  361  FNETEE  344
             +E  E
Sbjct  430  LDENAE  435



>ref|XP_001755894.1| predicted protein [Physcomitrella patens]
 gb|EDQ79179.1| predicted protein [Physcomitrella patens]
Length=675

 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -3

Query  589  DRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL-S  413
            +RPI G +A HW     ++ S   WDG GIPNSTHKY+EDQKV WHAT FEERL +AL S
Sbjct  588  ERPIFGSLADHWEAAWATKRSA--WDGKGIPNSTHKYREDQKVMWHATSFEERLAQALAS  645

Query  412  EESLVSQRKRMSG  374
            +E++  +R R  G
Sbjct  646  QEAIPERRNRFRG  658



>ref|XP_004495071.1| PREDICTED: uncharacterized protein LOC101492521 [Cicer arietinum]
Length=428

 Score = 81.6 bits (200),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 108/241 (45%), Gaps = 65/241 (27%)
 Frame = -3

Query  973  LSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsn  794
             ++E+++P  +    V ++      R RS YV+ +LNP+EN SQ K V          + 
Sbjct  182  FTEEVESPIPICERDVKSIGFNSNARDRSVYVHPVLNPVENLSQWKVV---------KAK  232

Query  793  SKLLFSDMGESVDLSSEANATSEI--GLRESS---TENNLN----VEASLSSWLKPSL--  647
              +    + E+ ++ S +N  S++  G++E S   T   LN    V+ASLS+WL  S   
Sbjct  233  RTIPLRPLKEN-NVCSNSNHESQVAFGVKEVSETETPKKLNREIAVDASLSNWLASSETT  291

Query  646  -----------------RQSSTQPFGGSIHHGK--TLG----------------------  590
                             R +S Q     I H     LG                      
Sbjct  292  PVNKACLYGGGVAATPDRSASQQGSNSVISHEDRPILGALTLDEIKQFSATSSPRKSPCR  351

Query  589  ---DRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKA  419
               + PI+G V ++WN   ++  S       GIPN+T KY+ED+KV+WHATPFE RLEKA
Sbjct  352  SPDEMPIIGTVGSYWNFTGSAEDSASVSSFKGIPNTTSKYREDKKVTWHATPFETRLEKA  411

Query  418  L  416
            L
Sbjct  412  L  412



>tpg|DAA36944.1| TPA: hypothetical protein ZEAMMB73_678513 [Zea mays]
Length=517

 Score = 81.6 bits (200),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 101/202 (50%), Gaps = 43/202 (21%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLL-------FSDMGESVDLSSEA  740
            R R QYV+ +LNP++N SQ KEV    S  +Q  + K+L        +D+G S D +S +
Sbjct  321  RDRCQYVHPVLNPVQNLSQWKEV---KSLKAQPVHGKMLDKENVNSVADVGPSHDCNSAS  377

Query  739  NATSEIGLRESSTENNLNVEASLSSWLKPSLR------QSSTQPFGGSIHHGKTLGD---  587
            +      L  S  EN+L  +ASLS+WL  S        QS +     S+H G    D   
Sbjct  378  HTRMNPSL-SSKKENSL--DASLSTWLVSSENSAVDNVQSKSPCSISSVHRGALTVDDLK  434

Query  586  ------------------RPILGMVAAHW--NENETSRVSPKWWDGN-GIPNSTHKYKED  470
                               P+LG V ++W   E++    S +   G  GIPNST KY+ED
Sbjct  435  QSSTPPSPQRSPRTNREGSPMLGTVGSYWYCTEHDNEYCSSRSNSGTTGIPNSTSKYRED  494

Query  469  QKVSWHATPFEERLEKALSEES  404
            ++V+WH+TPF  RL++AL + S
Sbjct  495  KRVNWHSTPFTIRLDRALKKTS  516



>ref|XP_009781302.1| PREDICTED: uncharacterized protein LOC104230241 [Nicotiana sylvestris]
Length=449

 Score = 81.3 bits (199),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 98/204 (48%), Gaps = 39/204 (19%)
 Frame = -3

Query  904  FPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGE----SVDLSSEAN  737
            + R RS Y++ +LNP+EN SQ K + ++ +E  +    K  F    E    S  L     
Sbjct  243  YVRDRSAYIHPVLNPVENLSQWKTIKSKAAEPLKMLPQKENFIAEVEGPLASFSLEPTFK  302

Query  736  ATSEIGLRESSTENNLNVEASLSSWL------------KPSLRQSST-------QPFGGS  614
             +S    R  S +  + V+ASLS+WL            + S+ Q S        +P  G+
Sbjct  303  QSSSSSFRPKSKDQEIGVDASLSNWLVTTPDNTKKAGSEKSMSQGSNSMMSFEDRPILGA  362

Query  613  I----------------HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHK  482
            +                   ++  D PI+G V  +WN + +++ S       GIPNST K
Sbjct  363  LTVEELKQMSASSSPRKSPSRSPDDMPIIGSVGTYWNPSGSTKDSGSVSSFKGIPNSTSK  422

Query  481  YKEDQKVSWHATPFEERLEKALSE  410
            Y+ED++V+WH+TPFE RL++AL +
Sbjct  423  YREDKRVNWHSTPFETRLDRALKQ  446



>ref|XP_008780393.1| PREDICTED: uncharacterized protein LOC103700210 [Phoenix dactylifera]
Length=246

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 101/209 (48%), Gaps = 47/209 (22%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R RSQYV+S+LNP+EN +Q KEV    +   ++   + + SD+   +  + E+    E  
Sbjct  35   RDRSQYVHSVLNPVENLTQWKEV-KVRAAPMKNPKKENINSDIENKMTFTPESTFKIEKF  93

Query  718  LRESST--------ENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKT---LGDRPILG  572
             + +S+        + ++ V+ASLS+WL  S   +   P   + H   +     DRPILG
Sbjct  94   EKLASSNPSPNCPAKQDVAVDASLSNWLVSSDNSTKEGPQKSNSHFSNSSVSREDRPILG  153

Query  571  M-------------------------------VAAHWN-ENETSRVSPKWWDGN---GIP  497
                                            V ++W+  N+ S        G+   GIP
Sbjct  154  ALTVEDLKQSSVTSSPRRSPSRSPDEIPIVGTVGSYWSCMNQRSDSGSSCQSGSEIKGIP  213

Query  496  NSTHKYKEDQKVSWHATPFEERLEKALSE  410
            N+T KYKED++V+WHATPFE RLE+AL++
Sbjct  214  NTTSKYKEDKRVNWHATPFEVRLERALNK  242



>ref|NP_001144995.1| uncharacterized protein LOC100278155 [Zea mays]
 gb|ACG44328.1| hypothetical protein [Zea mays]
Length=517

 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 100/203 (49%), Gaps = 45/203 (22%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLL-------FSDMGESVDLSSEA  740
            R R QYV+ +LNP++N SQ KEV    S  +Q  + K+L        +D+G S D +S +
Sbjct  321  RDRCQYVHPVLNPVQNLSQWKEV---KSLKAQPVHGKMLDKENVNSVADVGPSHDCNSAS  377

Query  739  NATSEIGLRESSTENNLNVEASLSSWLKPS----------------------------LR  644
            +      L  S  EN+L  +ASLS+WL  S                            L+
Sbjct  378  HTRMNPSL-SSKKENSL--DASLSTWLVSSENSAVDNVQSKSPCSISSVNRGALTVDDLK  434

Query  643  QSSTQPFGGSIHHGKTLGDRPILGMVAAHW--NENETSRVSPKWWDGN-GIPNSTHKYKE  473
            QSST P           G  P+LG V ++W   E +    S +   G  GIPNST KY+E
Sbjct  435  QSSTPPSPQRSPRTNREGS-PMLGTVGSYWYCTEYDNECCSSRSNSGTTGIPNSTSKYRE  493

Query  472  DQKVSWHATPFEERLEKALSEES  404
            D++V+WH+TPF  RL++AL + S
Sbjct  494  DKRVNWHSTPFTIRLDRALKKTS  516



>ref|XP_004292231.1| PREDICTED: uncharacterized protein LOC101308152 [Fragaria vesca 
subsp. vesca]
Length=478

 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 96/215 (45%), Gaps = 56/215 (26%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSS-----EANA  734
            R RS YV+++LNP+EN +Q K V  + +   +         D    +  SS     E ++
Sbjct  249  RDRSGYVHAVLNPVENITQWKAVKAKKTTVMKPQKENFTLDDEPR-ISFSSEPSIKEVSS  307

Query  733  TSEIGLRESSTENNLN----VEASLSSWLKPS----LRQSSTQPFG----------GSIH  608
            + +   R+S    N N    V+ASLS+WL  S    ++++ST   G          GS H
Sbjct  308  SFKSCKRQSGQARNSNHEMAVDASLSNWLGSSEATPVKKTSTS-LGASTPEKSMSYGSPH  366

Query  607  HGKTLGDRPIL-------------------------------GMVAAHWNENETSRVSPK  521
               +  DRPIL                               G V ++WN+         
Sbjct  367  SATSHEDRPILGALTVEELRQFSASSSPRKSPSRSPDEMAIIGTVGSYWNDQTDPAKGSG  426

Query  520  WWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
                 GIPN+T KY+ED++V+WH+TPFE RLE+AL
Sbjct  427  ASSYKGIPNTTSKYREDRRVNWHSTPFETRLERAL  461



>ref|XP_004247502.1| PREDICTED: uncharacterized protein LOC101246864 [Solanum lycopersicum]
Length=438

 Score = 78.2 bits (191),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 76/255 (30%), Positives = 112/255 (44%), Gaps = 72/255 (28%)
 Frame = -3

Query  1024  EVDSPNSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENAS  845
             EVDSPN     +  P K + + +T G V              R RS Y++ +LNP+EN S
Sbjct  198   EVDSPNLM---FGVPEKETRKGETKGYV--------------RDRSAYIHPVLNPVENLS  240

Query  844   QMKEVInedsessqdsnSKLLFSDMGESVDLSS-EANATSEIGLRESS-------TENNL  689
             Q K V     +S      KLL      + ++    A+ + E   ++SS        +  +
Sbjct  241   QWKSV-----KSKAAEPMKLLPQKENCTAEVEGPHASFSLEPTFKQSSFSFKTKPKDQEI  295

Query  688   NVEASLSSWL-------------------KPSLRQSST-------QPFGGSI------HH  605
              V+ASLS+WL                   + S+ Q S        +P  G +       H
Sbjct  296   GVDASLSNWLVTPDTTKKAGSNALETVTSEKSMSQGSNSMMSFEDRPILGVLTVEQLKQH  355

Query  604   GKTLGDR----------PILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSW  455
               T   R          PI+G V  +WN   +++ S       GIPNST KY+ED++V+W
Sbjct  356   SATSSPRKSPCRSPDEMPIIGTVGTYWNPLGSAKDSGSVSSFKGIPNSTSKYREDKRVNW  415

Query  454   HATPFEERLEKALSE  410
             H+TPFE RL++AL E
Sbjct  416   HSTPFEARLDRALKE  430



>ref|XP_006358415.1| PREDICTED: uncharacterized protein LOC102596931 [Solanum tuberosum]
Length=438

 Score = 77.8 bits (190),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 106/238 (45%), Gaps = 58/238 (24%)
 Frame = -3

Query  964  EMQTPGTVFPTHVDNLANGR---FPRIRSQYVYSILNPIENASQMKEVInedsessqdsn  794
            E+ +P  +F      +  G    + R RS Y++ +LNP+EN SQ K V     +S     
Sbjct  198  EVDSPTLMFGVPEKEMRKGETKGYVRDRSAYIHPVLNPVENLSQWKSV-----KSKAAEP  252

Query  793  SKLLFSDMGESVDLSS-EANATSEIGLRESS-------TENNLNVEASLSSWL-------  659
             KLL      + ++    A+ + E   ++SS        +  + V+ASLS+WL       
Sbjct  253  MKLLPQKENCTAEVEGPRASFSLEPTFKQSSFSFKTKPKDQEIGVDASLSNWLVTPDTTK  312

Query  658  ------------KPSLRQSST-------QPFGGSI------HHGKTLGDR----------  584
                        + S+ Q S        +P  G +       H  T   R          
Sbjct  313  KAGSSALETVTSEKSMSQGSNSMMSFEDRPILGVLTVEQLKQHSATSSPRKSPCRSPDEM  372

Query  583  PILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSE  410
            PI+G V  +WN   +++ S       GIPNST KY+ED++V+WH+TPFE RL++AL E
Sbjct  373  PIIGTVGTYWNPLGSAKDSGSVSSFKGIPNSTSKYREDKRVNWHSTPFEARLDRALKE  430



>ref|XP_011080095.1| PREDICTED: uncharacterized protein LOC105163450 [Sesamum indicum]
Length=453

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 97/210 (46%), Gaps = 51/210 (24%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSS-----EANA  734
            R RS Y+ S+LNP+EN +Q K   ++ +   +     L  +     +  SS     +A  
Sbjct  239  RDRSDYINSVLNPVENITQWKAAKSKGTHVLKPQKENLTANFEAPRISFSSDPPLVQAPF  298

Query  733  TSEIGLRESSTENNLNVEASLSSWLK----------------------------PSLRQS  638
            + +  L+ S+ E  + V+ASLS+WL                             PS+R  
Sbjct  299  SFKTQLKNSNQE--IPVDASLSNWLVSPEITPPKKTSFSALETITSGRTMSEGCPSVRSF  356

Query  637  STQPFGGSI----------------HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGN  506
              +P  G++                   ++  D PI+G V  +WN + +++ S       
Sbjct  357  EDRPILGALTVEELRQISPSPSPRKSPSRSPDDMPIIGTVGTYWNHSGSAKRSNSASSFK  416

Query  505  GIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
            GIPN+T KY+ED++V+WH+TPFE RL++AL
Sbjct  417  GIPNTTSKYREDKRVNWHSTPFETRLDRAL  446



>ref|XP_009388297.1| PREDICTED: uncharacterized protein LOC103975115 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 95/209 (45%), Gaps = 42/209 (20%)
 Frame = -3

Query  919  LANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEA  740
            L  G   R RSQ+V+ +LNP+EN SQ K V              ++ ++   +V   SE 
Sbjct  208  LVAGGSTRDRSQFVHPVLNPVENLSQWKVVKARAMPVKNPKKENVVGTEQENNVAFISEP  267

Query  739  NATSEIGLRES-STENNLNVEASLSSWLKPSLRQSSTQPFGGSIHH--------------  605
               ++     + S +  ++++ASLS+WL PS   S+ +    S  H              
Sbjct  268  VIKAKKSQAPNRSAKQEISMDASLSTWL-PSSENSTAEGSQASNSHRSNSSFSREERPIL  326

Query  604  ----------------------GKTLGDRPILGMVAAHWN----ENETSRVSPKWWDGNG  503
                                   ++  + PILG V  +WN     ++++   P   +  G
Sbjct  327  GALTMEDIKQSSVTSSPVKRSPSRSPDEIPILGTVGGYWNCKNHGDDSASSRPPSNEFKG  386

Query  502  IPNSTHKYKEDQKVSWHATPFEERLEKAL  416
            IPN+T KY+ED+ V+WH+TPFE RLE+AL
Sbjct  387  IPNTTSKYREDKTVNWHSTPFEVRLERAL  415



>ref|XP_010454631.1| PREDICTED: uncharacterized protein LOC104736362 [Camelina sativa]
Length=141

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 75/136 (55%), Gaps = 32/136 (24%)
 Frame = -3

Query  1555  LSSLFVSEEN-------DEEKSSLQSKEVEKQDCGTPELEFDVKELKDQAKFLKACGTIP  1397
             LS+LF+S+E        D+E+  L S  ++K              L+D+A FLKACGTIP
Sbjct  18    LSALFLSKEKAASSPCLDKERFDLDSIHIDKG-------------LRDEAWFLKACGTIP  64

Query  1396  ETPLEIRKLSEKCRDLSA--HDGEVDPLKFHSWLLDSSIEKQNLVSQPDQSPKPTKDCED  1223
             ETP+EIRK S+   +LS+  H G      FHSW+  SS    +L     +SP PTK CE+
Sbjct  65    ETPIEIRKASQ---NLSSPQHSGSS---HFHSWISSSSAMGSHLA----ESPTPTKACEE  114

Query  1222  WVKESDSPVHTPSSCM  1175
               + S +   TPSSC+
Sbjct  115   VGRPSFTSEQTPSSCV  130



>gb|EMS58738.1| hypothetical protein TRIUR3_23723 [Triticum urartu]
Length=477

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 103/219 (47%), Gaps = 60/219 (27%)
 Frame = -3

Query  919  LANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESV-----D  755
            L  G   R RSQYV  +LNP++N  Q KEV       +Q    K L+ +   SV      
Sbjct  271  LIQGNNHRDRSQYVRPVLNPVQNREQWKEV------KAQAGPVKKLYKENVNSVPNVGAT  324

Query  754  LSSEANATSEIGLRESSTENNLNVEASLSSWLKPS-------------------------  650
            L+ +    ++IG   SS +  ++V+ASLS+WL  S                         
Sbjct  325  LTCKVANQTKIGPSNSS-KGEVSVDASLSTWLVSSDNSTVDKAQSKSPRSVSSVCRQERP  383

Query  649  ---------LRQSS--TQPFGGSIHHGKTLGDRPILGMVAAHW------NENETSRVSPK  521
                     L+QSS  + P     H+ + +   PILG V ++W      NE  +SR    
Sbjct  384  VLGALTVDDLKQSSATSSPRRSPSHNHEEV---PILGTVGSYWSSTKQGNEYCSSRSDSG  440

Query  520  WWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEES  404
                NGIPNST KY+ED++V+WH+TPF  RL+KA+ + S
Sbjct  441  ---TNGIPNSTSKYREDRRVNWHSTPFNVRLDKAMKKSS  476



>gb|KDP26485.1| hypothetical protein JCGZ_17643 [Jatropha curcas]
Length=444

 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 97/226 (43%), Gaps = 61/226 (27%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSD-----------MGESVDL  752
            R RS YV S+LNP+EN +Q K V  + + + +                      GE +  
Sbjct  225  RDRSAYVNSVLNPVENLTQWKAVKAKGTPTLRQQKENFTLGQEPRNSFSSELSFGE-LSF  283

Query  751  SSEANATSEIGLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGGSI-----HHGKTLG-  590
            S +AN+      ++S+ E  + V+ASLS+WL  S R    +P    +         +LG 
Sbjct  284  SFKANSNQS---KKSNQE--MAVDASLSNWLGSSDRTPVNKPSKIGLDTITPEKDMSLGS  338

Query  589  -------DRPIL-------------------------------GMVAAHWNENETSRVSP  524
                   DRPIL                               G V  +WN N + + S 
Sbjct  339  NSPASFEDRPILGALTLEELKQFSASSSPRKSPSRSPDEMPIIGTVGTYWNNNGSGKDSG  398

Query  523  KWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVSQRK  386
                  GIPN+T KY+ED++V+WH+TPFE RLE+AL   +  S  K
Sbjct  399  SASSFKGIPNTTSKYREDKRVNWHSTPFETRLERALGGGACASNDK  444



>ref|XP_002526564.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35842.1| conserved hypothetical protein [Ricinus communis]
Length=451

 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 97/215 (45%), Gaps = 57/215 (27%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnS--------KLLFSDMGESVDLSSE  743
            R RS YV+S+LNP+EN +Q K V  + +   +            +  FS      +LS  
Sbjct  231  RDRSGYVHSVLNPVENLTQWKAVKAKGTPLLKQQKENHTLGQEPRTSFSSEPSFRELSFS  290

Query  742  ANATSEIGLRESSTENNLNVEASLSSWLKPS----LRQSSTQPFG----------GSIHH  605
              A SE   +       + V+ASLS+WL  S    + + ST  F           GS + 
Sbjct  291  FKAKSE---QSKKANQEVAVDASLSNWLGSSESTPISKPSTNGFDTFTPEKSTTVGS-NS  346

Query  604  GKTLGDRPIL-------------------------------GMVAAHWNENETSRVSPKW  518
             K+  DRPIL                               G V  +WN++ TS+ S   
Sbjct  347  PKSFEDRPILGALTMEEIKQFSASSSPRKSPSRSPDEMPIIGTVGTYWNDSVTSKHSDSA  406

Query  517  WDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
                GIPN+T KY+ED++V+W++TPFE RLE+AL+
Sbjct  407  SSFKGIPNTTSKYREDKRVNWYSTPFETRLERALN  441



>emb|CBI37166.3| unnamed protein product [Vitis vinifera]
Length=446

 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 99/224 (44%), Gaps = 62/224 (28%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R RS YV+ +LNP+EN +Q K V  + +   +     L        +  S E N      
Sbjct  212  RDRSTYVHPVLNPVENLTQWKAVKGKGTPPLKLQKENLTSDKEPPRLSFSMEPN------  265

Query  718  LRESSTEN--------NLN----VEASLSSWLKPS--LRQSSTQPFG--GSIHHGKTLG-  590
             ++SS  N        NLN    V ASLS+WL  S     + T P G   +I + K    
Sbjct  266  FKQSSFSNKSKINEPENLNQEIAVNASLSTWLVSSETTPTNKTSPIGVVDTISYQKGASY  325

Query  589  ---------DRPILGMVAA----HWNENETSRVSP--------------KWWDGN-----  506
                     DRPILG +       ++ + + R SP               +W        
Sbjct  326  TSNSPRSQEDRPILGALTLEEIRQFSASNSPRRSPTRSPDDMPILGTVGTYWSHTGPAKD  385

Query  505  -------GIPNSTHKYKEDQKVSWHATPFEERLEKALSEESLVS  395
                   GIPN+T KY+ED++V+WH+TPFE RLEKALS+E + S
Sbjct  386  SDSASYKGIPNTTSKYREDKRVNWHSTPFEARLEKALSKEHIYS  429



>ref|XP_006653594.1| PREDICTED: histone H3.v1-like [Oryza brachyantha]
Length=476

 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 100/204 (49%), Gaps = 56/204 (27%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R RSQYV  +LNP++N SQ KEV     ++      KL   ++    ++S+         
Sbjct  289  RDRSQYVRPVLNPVQNMSQWKEV-----KAQAAPAKKLDKENVNSVPNISATP-------  336

Query  718  LRESSTENNLNVEASLSSWLKPS----------------------------------LRQ  641
              E+S++  ++V+ASLS+WL  S                                  L+Q
Sbjct  337  --ETSSKREVSVDASLSTWLVSSDNSTVDKAQSRSPRSISTVNRDERPVLGALTVDDLKQ  394

Query  640  SS--TQPFGGSIHHGKTLGDRPILGMVAAHWN--ENETSRVSPKWWDG-NGIPNSTHKYK  476
            SS  + P     H+ +   + PI G V ++W+  + + +  S K   G NGIPN+T KY+
Sbjct  395  SSATSSPRRSPSHNRE---EAPIFGTVGSYWSSTKQDNAHCSSKSDSGTNGIPNTTSKYR  451

Query  475  EDQKVSWHATPFEERLEKALSEES  404
            ED++V+WH+TPF  RL++AL + S
Sbjct  452  EDKRVNWHSTPFNVRLDRALKKSS  475



>ref|XP_008235614.1| PREDICTED: suppressor protein SRP40 [Prunus mume]
Length=428

 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 67/234 (29%), Positives = 107/234 (46%), Gaps = 55/234 (24%)
 Frame = -3

Query  970  SDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnS  791
            +++  +P  + PT +++ A     R RS YV+S+LNP+EN +Q K V  + +   +    
Sbjct  193  TEDFDSPMPIKPTGLNHNA-----RDRSGYVHSVLNPVENLTQWKAVKAKGTSLMKPQKE  247

Query  790  KLLFSDMGESVDLSSEANAT--SEIGLRESSTEN---NLNVEASLSSWLKPS----LRQS  638
                 D    +  SSE + +  S+    +  ++N    + V+ASLS+WL  S    + ++
Sbjct  248  NFTL-DQEPRISFSSEPSLSFKSKADQHKKHSKNPHQEVAVDASLSNWLVSSEHIPVNKT  306

Query  637  STQPFGG-----SIHHG----KTLGDRPIL------------------------------  575
            ST          S+ HG    ++  DRPIL                              
Sbjct  307  STIALDTGTPEKSMSHGSNSVRSQEDRPILGALTVEELRQFSASSSPRKSPTRSPDEMPI  366

Query  574  -GMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
             G V  +WN +             GIPN+T KY+ED++V+WH+TPFE RLE+AL
Sbjct  367  IGTVGTYWNHSAPPAKGSSGASYKGIPNTTSKYREDKRVNWHSTPFETRLERAL  420



>emb|CDP03781.1| unnamed protein product [Coffea canephora]
Length=455

 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 105/228 (46%), Gaps = 61/228 (27%)
 Frame = -3

Query  928  VDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLS  749
            V  L   R  R RS YV+ +LNP+EN +Q K V  +   +SQ    K  FS   E   +S
Sbjct  227  VKTLGLNRNARSRSAYVHPVLNPVENLTQWKTV--KSRGTSQWKPQKENFSAELEVPRMS  284

Query  748  SEANATSE---IGLRESSTENN-----LNVEASLSSWL--------KPSL---------R  644
              +  T +    GL++ S   N     + V+ASLS+WL        K SL         +
Sbjct  285  FSSQPTFKQPSSGLKQKSDSFNTLSQDIAVDASLSTWLVGRESTPAKTSLSSLETVTCEK  344

Query  643  QSSTQPFGGSIHHGKTLGDRPIL-------------------------------GMVAAH  557
             SST P   S+   ++  DRPIL                               G V  +
Sbjct  345  VSSTSPGSNSV---RSFEDRPILGALTVEELKQLSAASSPRRSPSWSPDEMPIIGTVGTY  401

Query  556  WNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
            WN++ +S+ S       GIPN+T KY+ED++++WH TPFE RLE+AL+
Sbjct  402  WNDSVSSKDSRSASSYKGIPNTTSKYREDKRINWHNTPFETRLERALN  449



>ref|XP_007144862.1| hypothetical protein PHAVU_007G190400g [Phaseolus vulgaris]
 gb|ESW16856.1| hypothetical protein PHAVU_007G190400g [Phaseolus vulgaris]
Length=403

 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 92/207 (44%), Gaps = 54/207 (26%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGES-VDLSSEANATSEI  722
            R RS YV+ +LNP+EN +Q K V    +       ++  F  + ES   L SE++   ++
Sbjct  195  RDRSVYVHPVLNPVENLTQWKVVKANKTPLRPQKENE--FGGVKESPFSLKSESDTPKKL  252

Query  721  GLRESSTENNLNVEASLSSWL-----KPSLRQSSTQPFGGS-------------------  614
                      + V+ASLS+WL      P  + SS   F G+                   
Sbjct  253  -------NQEIPVDASLSNWLVSPETTPVNKASSVALFAGTPDRSTPQSPYSVFSHEDRP  305

Query  613  IHHGKTL--------------------GDRPILGMVAAHWNENETSRVSPKWWDGNGIPN  494
            I    TL                     + PI+G V  +WN   ++  S       GIPN
Sbjct  306  ILGALTLEEIKQFSATSSPRKSPSRSPDEMPIIGTVGTYWNVAGSAEGSGSVSSFKGIPN  365

Query  493  STHKYKEDQKVSWHATPFEERLEKALS  413
            ST KY+ED++V+WH+TPFE RLEKAL+
Sbjct  366  STSKYREDKRVNWHSTPFETRLEKALN  392



>ref|XP_007199872.1| hypothetical protein PRUPE_ppa006055mg [Prunus persica]
 gb|EMJ01071.1| hypothetical protein PRUPE_ppa006055mg [Prunus persica]
Length=429

 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 68/236 (29%), Positives = 115/236 (49%), Gaps = 56/236 (24%)
 Frame = -3

Query  970  SDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnS  791
            +++  +P  + PT +++ A     R RS YV+S+LNP+EN +Q K V  + +   +    
Sbjct  193  TEDFDSPMPIKPTGLNHNA-----RDRSGYVHSVLNPVENLTQWKAVKAKGTSLMKPQKE  247

Query  790  KLLFSDMGESVDLSSEANAT--SEIGLRESSTEN---NLNVEASLSSWLKPS----LRQS  638
                 D    +  SSE + +  S+    +  ++N    + V+ASLS+WL  S    + ++
Sbjct  248  NFTL-DQEPRISFSSEPSLSFKSKADQHKKHSKNPHQEVAVDASLSNWLVSSEHTPVNKT  306

Query  637  STQPFGG-----SIHHG----KTLGDRPILGMVAA----HWNENETSRVSP---------  524
            ST          S+ HG    ++  DRPILG +       ++ + + R SP         
Sbjct  307  STIALDTGTPEKSMSHGSNSARSQEDRPILGALTVEELRQFSASSSPRKSPTRSPNEMPI  366

Query  523  -----KWWDGN--------------GIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
                  +W+ +              GIPN+T KY+ED++V+WH+TPFE RLE+AL+
Sbjct  367  IGTVGTYWNHSAPPAKGSSGASSYKGIPNTTSKYREDKRVNWHSTPFETRLERALN  422



>ref|XP_002963453.1| hypothetical protein SELMODRAFT_438603 [Selaginella moellendorffii]
 gb|EFJ35324.1| hypothetical protein SELMODRAFT_438603 [Selaginella moellendorffii]
Length=267

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -3

Query  598  TLGDRPILGMVAAHWNENETSRV-SPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            +  ++PI+G+VAA W E +TS V S K WDG GIPNS  KYKEDQ +++    FE RLE+
Sbjct  198  SFDEKPIMGLVAADWLEPDTSEVKSYKAWDGKGIPNSPSKYKEDQTINFQTISFEARLER  257

Query  421  ALSEESLV  398
            AL+ +S++
Sbjct  258  ALAAQSVM  265



>ref|XP_010264923.1| PREDICTED: rRNA biogenesis protein rrp36 [Nelumbo nucifera]
Length=470

 Score = 75.5 bits (184),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 97/214 (45%), Gaps = 55/214 (26%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSK--LLFSDMGESVDLSSEANATSE  725
            R RSQYV S+LNP+EN +Q K V    +   +   +K  + F    E +  SSE      
Sbjct  243  RDRSQYVNSVLNPVENLTQWKAVKARTAPPLKQHQTKENINFEKEPE-IPFSSEPTF-KP  300

Query  724  IGLRESSTENN-------LNVEASLSSWL---------------------KPSLRQSSTQ  629
            + L+ +S  N+       + V+ASLS+WL                     + S+ Q S  
Sbjct  301  LPLKPNSNFNHSKPPKHEIAVDASLSNWLGSSGTTPITKTSNDVVRSEQSEKSISQRSNS  360

Query  628  P--------FGG-SIHHGKTLG--------------DRPILGMVAAHWNENETSRVSPKW  518
            P         G  ++   K L               D PILG V ++WN    +  S   
Sbjct  361  PRSYEDRPILGALTMEELKQLSASSSPRRSPSRSPEDMPILGTVGSYWNHTGQAMDSSSG  420

Query  517  WDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
                GIPN+T KY+ED++V+WH+TPFE RLE+AL
Sbjct  421  SSCKGIPNTTSKYREDKRVNWHSTPFETRLERAL  454



>ref|XP_002988166.1| hypothetical protein SELMODRAFT_426892 [Selaginella moellendorffii]
 gb|EFJ10585.1| hypothetical protein SELMODRAFT_426892 [Selaginella moellendorffii]
Length=249

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = -3

Query  598  TLGDRPILGMVAAHWNENETSRV-SPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            +  ++PI+G+VA  W E +TS V S K WDG GIPNS  KYKEDQ +++    FE RLE+
Sbjct  180  SFDEKPIMGLVATDWLEPDTSEVKSYKAWDGKGIPNSPSKYKEDQTINFQTMSFEARLER  239

Query  421  ALSEESLV  398
            AL+ +S++
Sbjct  240  ALAAQSVM  247



>gb|AFK34817.1| unknown [Medicago truncatula]
Length=202

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = -3

Query  601  KTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            K+  + PI+G V ++WN NE S  SP  +   GIPN+T KY+ED+KV+WHATPFE RLEK
Sbjct  128  KSPDEMPIIGTVGSYWNANEGSG-SPSSF--KGIPNTTSKYREDKKVNWHATPFETRLEK  184

Query  421  ALSEES  404
            AL+ ++
Sbjct  185  ALNRDA  190



>ref|XP_010093087.1| hypothetical protein L484_005945 [Morus notabilis]
 gb|EXB53515.1| hypothetical protein L484_005945 [Morus notabilis]
Length=424

 Score = 74.7 bits (182),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 95/215 (44%), Gaps = 54/215 (25%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFS-DMGE-SVDLSSEANATSE  725
            R RS YV+S+LNP+EN +Q K V       ++    K  F+ D  E  +  +SE  A  +
Sbjct  205  RDRSAYVHSVLNPVENLTQWKAVKARGKPKTRPQIQKENFTLDQEEPRISFNSEP-AFKD  263

Query  724  IGLRESSTENN-------LNVEASLSSWL----------------------------KPS  650
            + L   S  +        + V+ASLS+WL                              S
Sbjct  264  LSLSSKSKTDQPVKPKQEMAVDASLSNWLVSPESTPVNKTSTFAFDNLSPGRCTSQGSNS  323

Query  649  LRQSSTQPFGGSI----------------HHGKTLGDRPILGMVAAHWNENETSRVSPKW  518
            +R    +P  G++                   ++  + PI+G V  +WN    ++ S   
Sbjct  324  VRSQEDRPILGALTVEEIRQFSASSSPRKSPSRSPDEMPIIGTVGTYWNNTGPAKDSGSA  383

Query  517  WDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
                GIPN+T KY+ED++V+WH TPFE RLE+AL+
Sbjct  384  TSLKGIPNTTSKYREDKRVNWHTTPFETRLERALN  418



>ref|XP_006594039.1| PREDICTED: uncharacterized protein LOC100793067 isoform X5 [Glycine 
max]
 ref|XP_006594040.1| PREDICTED: uncharacterized protein LOC100793067 isoform X6 [Glycine 
max]
Length=389

 Score = 74.3 bits (181),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 96/224 (43%), Gaps = 54/224 (24%)
 Frame = -3

Query  943  VFPTHVDNLANGRFPRIR--SQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDM  770
            VF   VD  + G  P +R  S YV+ +LNP+EN +Q K +  + +       +       
Sbjct  161  VFVEEVDVKSIGSNPNVRDRSAYVHPVLNPVENLTQWKVLKAKRTPIRPQKENDFGVGVK  220

Query  769  GESVDLSSEANATSEIGLRESSTENNLNVEASLSSWL-----KPSLRQSSTQPFGGS---  614
            G    L+S+++   ++  RE      + V+ASLS+WL      P  +  S   F GS   
Sbjct  221  GSPFSLNSKSDLPKKLN-RE------IRVDASLSNWLVSPETTPVCKAGSVASFAGSTPD  273

Query  613  ----------IHHGK--TLG-------------------------DRPILGMVAAHWNEN  545
                      I H     LG                         + PI+G V  +WN  
Sbjct  274  RITSQGSYSVISHEDRPILGALTLEEIKQFSATSSSRKSPSRSPDEMPIIGTVGTYWNVA  333

Query  544  ETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             ++          GIPNST KY+ED+ V+W +TPFE RLEKAL+
Sbjct  334  GSAEDPGSVSSFKGIPNSTSKYREDKSVNWRSTPFETRLEKALN  377



>ref|XP_004981564.1| PREDICTED: uncharacterized protein LOC101785358 isoform X2 [Setaria 
italica]
Length=372

 Score = 74.3 bits (181),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 11/84 (13%)
 Frame = -3

Query  697  NNLNVEA-SLSSWLKPSLRQSSTQPF------GGSIHHGKTLG-DRPILGMVAAHWNENE  542
            N+L +E  SLS WLKP    +  +PF      G   +  K+   DRPI+GMVAAHW + E
Sbjct  275  NDLELELPSLSHWLKPP---NPKKPFRDEALTGDRSNSAKSSDEDRPIIGMVAAHWKDKE  331

Query  541  TSRVSPKWWDGNGIPNSTHKYKED  470
                +PKW+DGNGIPNST+KYKE+
Sbjct  332  PENFTPKWFDGNGIPNSTNKYKEE  355



>ref|XP_003542435.1| PREDICTED: uncharacterized protein LOC100793067 isoform X1 [Glycine 
max]
Length=408

 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 96/224 (43%), Gaps = 54/224 (24%)
 Frame = -3

Query  943  VFPTHVDNLANGRFPRIR--SQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDM  770
            VF   VD  + G  P +R  S YV+ +LNP+EN +Q K +  + +       +       
Sbjct  180  VFVEEVDVKSIGSNPNVRDRSAYVHPVLNPVENLTQWKVLKAKRTPIRPQKENDFGVGVK  239

Query  769  GESVDLSSEANATSEIGLRESSTENNLNVEASLSSWL-----KPSLRQSSTQPFGGS---  614
            G    L+S+++   ++  RE      + V+ASLS+WL      P  +  S   F GS   
Sbjct  240  GSPFSLNSKSDLPKKLN-RE------IRVDASLSNWLVSPETTPVCKAGSVASFAGSTPD  292

Query  613  ----------IHHGK--TLG-------------------------DRPILGMVAAHWNEN  545
                      I H     LG                         + PI+G V  +WN  
Sbjct  293  RITSQGSYSVISHEDRPILGALTLEEIKQFSATSSSRKSPSRSPDEMPIIGTVGTYWNVA  352

Query  544  ETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             ++          GIPNST KY+ED+ V+W +TPFE RLEKAL+
Sbjct  353  GSAEDPGSVSSFKGIPNSTSKYREDKSVNWRSTPFETRLEKALN  396



>ref|XP_006594036.1| PREDICTED: uncharacterized protein LOC100793067 isoform X2 [Glycine 
max]
Length=409

 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 96/224 (43%), Gaps = 54/224 (24%)
 Frame = -3

Query  943  VFPTHVDNLANGRFPRIR--SQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDM  770
            VF   VD  + G  P +R  S YV+ +LNP+EN +Q K +  + +       +       
Sbjct  181  VFVEEVDVKSIGSNPNVRDRSAYVHPVLNPVENLTQWKVLKAKRTPIRPQKENDFGVGVK  240

Query  769  GESVDLSSEANATSEIGLRESSTENNLNVEASLSSWL-----KPSLRQSSTQPFGGS---  614
            G    L+S+++   ++  RE      + V+ASLS+WL      P  +  S   F GS   
Sbjct  241  GSPFSLNSKSDLPKKLN-RE------IRVDASLSNWLVSPETTPVCKAGSVASFAGSTPD  293

Query  613  ----------IHHGK--TLG-------------------------DRPILGMVAAHWNEN  545
                      I H     LG                         + PI+G V  +WN  
Sbjct  294  RITSQGSYSVISHEDRPILGALTLEEIKQFSATSSSRKSPSRSPDEMPIIGTVGTYWNVA  353

Query  544  ETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             ++          GIPNST KY+ED+ V+W +TPFE RLEKAL+
Sbjct  354  GSAEDPGSVSSFKGIPNSTSKYREDKSVNWRSTPFETRLEKALN  397



>ref|XP_006594038.1| PREDICTED: uncharacterized protein LOC100793067 isoform X4 [Glycine 
max]
Length=406

 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 96/224 (43%), Gaps = 54/224 (24%)
 Frame = -3

Query  943  VFPTHVDNLANGRFPRIR--SQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDM  770
            VF   VD  + G  P +R  S YV+ +LNP+EN +Q K +  + +       +       
Sbjct  178  VFVEEVDVKSIGSNPNVRDRSAYVHPVLNPVENLTQWKVLKAKRTPIRPQKENDFGVGVK  237

Query  769  GESVDLSSEANATSEIGLRESSTENNLNVEASLSSWL-----KPSLRQSSTQPFGGS---  614
            G    L+S+++   ++  RE      + V+ASLS+WL      P  +  S   F GS   
Sbjct  238  GSPFSLNSKSDLPKKLN-RE------IRVDASLSNWLVSPETTPVCKAGSVASFAGSTPD  290

Query  613  ----------IHHGK--TLG-------------------------DRPILGMVAAHWNEN  545
                      I H     LG                         + PI+G V  +WN  
Sbjct  291  RITSQGSYSVISHEDRPILGALTLEEIKQFSATSSSRKSPSRSPDEMPIIGTVGTYWNVA  350

Query  544  ETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             ++          GIPNST KY+ED+ V+W +TPFE RLEKAL+
Sbjct  351  GSAEDPGSVSSFKGIPNSTSKYREDKSVNWRSTPFETRLEKALN  394



>gb|EAZ31321.1| hypothetical protein OsJ_15438 [Oryza sativa Japonica Group]
Length=480

 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/238 (28%), Positives = 106/238 (45%), Gaps = 61/238 (26%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             N  +SP P     S E Q+P      H D          R QYV  +LNP++N SQ KEV
Sbjct  267   NEVSSPAPKSSSTSVEEQSPLIQRNNHRD----------RGQYVRPVLNPVQNMSQWKEV  316

Query  829   InedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLR-ESSTENNLNVEASLSSWLKP  653
               + + + + +   +               N+  ++G   E+S +  ++V+ASLS+WL  
Sbjct  317   KAQAAPAKKSNKENV---------------NSVPKVGATPENSIKKEVSVDASLSTWLVS  361

Query  652   SLRQSSTQPFGGSIHHGKTLG--DRPILGMVAAHWNENETSRVSPK--------------  521
             S   +  +   GS     T+   +RP+LG +     +  ++  SP+              
Sbjct  362   SDNSTVDKVQSGSPCSISTVNRDERPVLGALTVDDLKQSSATSSPRRSPSHNREEAILGT  421

Query  520   ---WWDG----------------NGIPNSTHKYKEDQKVSWHATPFEERLEKALSEES  404
                +W                  NGIPN+T KY+ED++V+WH+TPF  RL++AL + S
Sbjct  422   VGSYWSSTKQDNAHCSSRSDSGTNGIPNTTSKYREDKRVNWHSTPFNVRLDRALKKSS  479



>ref|XP_006594037.1| PREDICTED: uncharacterized protein LOC100793067 isoform X3 [Glycine 
max]
Length=407

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 96/224 (43%), Gaps = 54/224 (24%)
 Frame = -3

Query  943  VFPTHVDNLANGRFPRIR--SQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDM  770
            VF   VD  + G  P +R  S YV+ +LNP+EN +Q K +  + +       +       
Sbjct  179  VFVEEVDVKSIGSNPNVRDRSAYVHPVLNPVENLTQWKVLKAKRTPIRPQKENDFGVGVK  238

Query  769  GESVDLSSEANATSEIGLRESSTENNLNVEASLSSWL-----KPSLRQSSTQPFGGS---  614
            G    L+S+++   ++  RE      + V+ASLS+WL      P  +  S   F GS   
Sbjct  239  GSPFSLNSKSDLPKKLN-RE------IRVDASLSNWLVSPETTPVCKAGSVASFAGSTPD  291

Query  613  ----------IHHGK--TLG-------------------------DRPILGMVAAHWNEN  545
                      I H     LG                         + PI+G V  +WN  
Sbjct  292  RITSQGSYSVISHEDRPILGALTLEEIKQFSATSSSRKSPSRSPDEMPIIGTVGTYWNVA  351

Query  544  ETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             ++          GIPNST KY+ED+ V+W +TPFE RLEKAL+
Sbjct  352  GSAEDPGSVSSFKGIPNSTSKYREDKSVNWRSTPFETRLEKALN  395



>gb|EAY94824.1| hypothetical protein OsI_16614 [Oryza sativa Indica Group]
Length=476

 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/238 (28%), Positives = 106/238 (45%), Gaps = 61/238 (26%)
 Frame = -3

Query  1009  NSKASPYPTPLKLSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEV  830
             N  +SP P     S E Q+P      H          R R QYV  +LNP++N SQ KEV
Sbjct  263   NEVSSPAPKSSSTSVEEQSPLIQRNNH----------RDRGQYVRPVLNPVQNMSQWKEV  312

Query  829   InedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLR-ESSTENNLNVEASLSSWLKP  653
               + + + + +   +               N+  ++G   E+S +  ++V+ASLS+WL  
Sbjct  313   KAQAAPAKKSNKENV---------------NSVPKVGATPENSIKKEVSVDASLSTWLVS  357

Query  652   SLRQSSTQPFGGSIHHGKTLG--DRPILGMVAAHWNENETSRVSPK--------------  521
             S   +  +   GS     T+   +RP+LG +     +  ++  SP+              
Sbjct  358   SDNSTVDKVQSGSPCSISTVNRDERPVLGALTVDDLKQSSATSSPRRSPSHNREEAILGT  417

Query  520   ---WWDG----------------NGIPNSTHKYKEDQKVSWHATPFEERLEKALSEES  404
                +W                  NGIPN+T KY+ED++V+WH+TPF  RL++AL + S
Sbjct  418   VGSYWSSTKQDNAHCSSRSDSGTNGIPNTTSKYREDKRVNWHSTPFNVRLDRALKKSS  475



>ref|XP_010920313.1| PREDICTED: eisosome protein SEG2-like [Elaeis guineensis]
Length=438

 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 98/207 (47%), Gaps = 47/207 (23%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R RSQYV+S+LNP+EN +Q KEV    +  +++   + + SD+   +  + E     +  
Sbjct  228  RDRSQYVHSVLNPVENLTQWKEV-KVRAAPTKNPKKENINSDIDNQMTFTPEPTFKIDEF  286

Query  718  LRESST--------ENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLGDR-------  584
             + +S+        + ++ V+ASLS+WL  S   +   P   + H   +   R       
Sbjct  287  QKPASSNPSPNFPAKQDIAVDASLSNWLVSSDNSAKEGPQQSNSHFSNSSVSREERPILG  346

Query  583  ---------------------------PILGMVAAHWN-ENETSRVSPKWWDGN---GIP  497
                                       PI+G V ++W+  N+ S        G+   GIP
Sbjct  347  ALTVEDLKQSSVTSSPRRSPSRSPDEIPIVGTVGSYWSCLNQRSDSGSSCQSGSEIKGIP  406

Query  496  NSTHKYKEDQKVSWHATPFEERLEKAL  416
            N+T KY+ED++V+WHATPF+ R+E+AL
Sbjct  407  NTTSKYREDKRVNWHATPFDVRVERAL  433



>gb|KHN48935.1| hypothetical protein glysoja_025312 [Glycine soja]
Length=409

 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 96/224 (43%), Gaps = 54/224 (24%)
 Frame = -3

Query  943  VFPTHVDNLANGRFPRIR--SQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDM  770
            VF   VD  + G  P +R  S YV+ +LNP+EN +Q K +  + +       +       
Sbjct  181  VFVEEVDVKSIGSNPNVRDRSAYVHPVLNPVENLTQWKVLKAKRTPIRPQKENDFGVGVK  240

Query  769  GESVDLSSEANATSEIGLRESSTENNLNVEASLSSWL-----KPSLRQSSTQPFGGS---  614
            G    L+S+++   ++  RE      + V+ASLS+WL      P  +  S   F GS   
Sbjct  241  GSPFSLNSKSDLPKKLN-RE------IRVDASLSNWLVSPETTPVSKAGSVASFAGSTPD  293

Query  613  ----------IHHGK--TLG-------------------------DRPILGMVAAHWNEN  545
                      I H     LG                         + PI+G V  +WN  
Sbjct  294  RITSQGSFSVISHEDRPILGALTLEEIKQFSATSSSRKSPSRSPDEMPIIGTVGTYWNVA  353

Query  544  ETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             ++          GIPNST KY+ED+ V+W +TPFE RLEKAL+
Sbjct  354  GSAEDPGSVSSFKGIPNSTSKYREDKSVNWRSTPFETRLEKALN  397



>ref|XP_003581420.1| PREDICTED: uncharacterized protein LOC100842208 isoform X1 [Brachypodium 
distachyon]
Length=521

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 105/212 (50%), Gaps = 46/212 (22%)
 Frame = -3

Query  919  LANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEA  740
            L  G   R RS+YV+ +LNP++N SQ KEV  +    ++     +   + G     S  +
Sbjct  315  LIQGNSHRDRSKYVHPVLNPVQNLSQWKEVKAQVGPVNKLYKENV---NSGPDAGASPSS  371

Query  739  NATSEIGLRES-STENNLNVEASLSSWL------------KPSLRQSST-----QPFGGS  614
               ++  +  S +++ +++V+ASLS+WL              S R  S+     +P  G+
Sbjct  372  KVANQTKMSPSNASKGDVSVDASLSTWLVSSGNSTVDKAQSKSPRSVSSICREERPVLGA  431

Query  613  I-------------------HHGKTLGDRPILGMVAAHWN--ENETSRVSPKWWDG-NGI  500
            +                   H+ + +   PILG V ++W+  E +    S +   G NGI
Sbjct  432  LTVDGLKKSSTTSSPRRSPSHNRQEV---PILGTVGSYWSCTEPDNECCSSRSDSGTNGI  488

Query  499  PNSTHKYKEDQKVSWHATPFEERLEKALSEES  404
            PN+T KY+ED++V+WH+TPF  RL+KAL + S
Sbjct  489  PNTTSKYREDRRVNWHSTPFNVRLDKALKKSS  520



>ref|XP_010695523.1| PREDICTED: uncharacterized protein LOC104908140 [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 99/195 (51%), Gaps = 31/195 (16%)
 Frame = -3

Query  907  RFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATS  728
            R  R RS YV+S+LNP+EN +Q K V ++ +   +        +D G +  L+ + + ++
Sbjct  254  RGARDRSGYVHSVLNPVENTTQWKTVKSKQTPQLRQQKENSQINDPGNNHPLAVDTSLST  313

Query  727  EI--------GLRESSTENNLNVEASLSSWLKPSLRQSSTQPFGG--SIHHGKTL-----  593
             +           + S  + ++   S SS+   S+     +P  G  ++   K L     
Sbjct  314  WLISSQKTPPSKDKPSDLDPISCWTSASSYGSNSVTSHQERPIFGALTVEELKQLSASSP  373

Query  592  ---------GDRPILGMVAAHWNENETSRVSPKWWDGN-----GIPNSTHKYKEDQKVSW  455
                      ++P++G V  HWN N + R +P    G+     GIPN+T KY+ED++V+W
Sbjct  374  PRRSPCRGPNEKPLVGTVGVHWN-NGSDR-TPVESSGSASSFKGIPNTTSKYREDKRVNW  431

Query  454  HATPFEERLEKALSE  410
            H+TPFE RLE+AL++
Sbjct  432  HSTPFETRLERALNK  446



>ref|XP_010652403.1| PREDICTED: uncharacterized protein LOC100256663 [Vitis vinifera]
Length=429

 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 96/219 (44%), Gaps = 62/219 (28%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R RS YV+ +LNP+EN +Q K V  + +   +     L        +  S E N      
Sbjct  212  RDRSTYVHPVLNPVENLTQWKAVKGKGTPPLKLQKENLTSDKEPPRLSFSMEPN------  265

Query  718  LRESSTEN--------NLN----VEASLSSWLKPS--LRQSSTQPFG--GSIHHGKTLG-  590
             ++SS  N        NLN    V ASLS+WL  S     + T P G   +I + K    
Sbjct  266  FKQSSFSNKSKINEPENLNQEIAVNASLSTWLVSSETTPTNKTSPIGVVDTISYQKGASY  325

Query  589  ---------DRPILGMVAA----HWNENETSRVSP--------------KWWDGN-----  506
                     DRPILG +       ++ + + R SP               +W        
Sbjct  326  TSNSPRSQEDRPILGALTLEEIRQFSASNSPRRSPTRSPDDMPILGTVGTYWSHTGPAKD  385

Query  505  -------GIPNSTHKYKEDQKVSWHATPFEERLEKALSE  410
                   GIPN+T KY+ED++V+WH+TPFE RLEKALS+
Sbjct  386  SDSASYKGIPNTTSKYREDKRVNWHSTPFEARLEKALSK  424



>ref|XP_006588692.1| PREDICTED: uncharacterized protein LOC100805024 isoform X2 [Glycine 
max]
Length=404

 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 88/207 (43%), Gaps = 51/207 (25%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R RS YV+ +LNP+EN +Q K +  + +       +       G    L+   + T +  
Sbjct  192  RDRSAYVHPVLNPVENLTQWKVLKAKRTPIRPQKENDFGVGVKGSPFSLNYSESDTPKKL  251

Query  718  LRESSTENNLNVEASLSSWL-----KPSL-RQSSTQPFGGSIHHGKTLG--------DRP  581
             RE      + V+ASLS+WL      P + +  S   F G+     + G        DRP
Sbjct  252  NRE------IRVDASLSNWLVSPETTPVISKAGSVASFAGTPDRSTSQGSYSVISHEDRP  305

Query  580  ILGM-------------------------------VAAHWNENETSRVSPKWWDGNGIPN  494
            ILG                                V  +WN   ++          GIPN
Sbjct  306  ILGALTLEEIKQFSATSSPRKSPSRSPDEMPIIGTVGTYWNAAGSAEDPGSVSSFKGIPN  365

Query  493  STHKYKEDQKVSWHATPFEERLEKALS  413
            ST KY+ED++V+WH+TPFE RLEKAL+
Sbjct  366  STSKYREDKRVNWHSTPFETRLEKALN  392



>ref|XP_006588691.1| PREDICTED: uncharacterized protein LOC100805024 isoform X1 [Glycine 
max]
Length=406

 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 88/207 (43%), Gaps = 51/207 (25%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R RS YV+ +LNP+EN +Q K +  + +       +       G    L+   + T +  
Sbjct  194  RDRSAYVHPVLNPVENLTQWKVLKAKRTPIRPQKENDFGVGVKGSPFSLNYSESDTPKKL  253

Query  718  LRESSTENNLNVEASLSSWL-----KPSL-RQSSTQPFGGSIHHGKTLG--------DRP  581
             RE      + V+ASLS+WL      P + +  S   F G+     + G        DRP
Sbjct  254  NRE------IRVDASLSNWLVSPETTPVISKAGSVASFAGTPDRSTSQGSYSVISHEDRP  307

Query  580  ILGM-------------------------------VAAHWNENETSRVSPKWWDGNGIPN  494
            ILG                                V  +WN   ++          GIPN
Sbjct  308  ILGALTLEEIKQFSATSSPRKSPSRSPDEMPIIGTVGTYWNAAGSAEDPGSVSSFKGIPN  367

Query  493  STHKYKEDQKVSWHATPFEERLEKALS  413
            ST KY+ED++V+WH+TPFE RLEKAL+
Sbjct  368  STSKYREDKRVNWHSTPFETRLEKALN  394



>ref|XP_001770125.1| predicted protein [Physcomitrella patens]
 gb|EDQ65107.1| predicted protein [Physcomitrella patens]
Length=662

 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 50/86 (58%), Gaps = 17/86 (20%)
 Frame = -3

Query  589  DRPILGMVAAHWNEN-ETSRVSPKWWDGNGIPNSTHKYKE------------DQKVSWHA  449
            +RPI G +A HW     T R +   WDG GIPNSTHKY+E            DQKV WHA
Sbjct  576  ERPIFGSLADHWEAAWATKRPA---WDGKGIPNSTHKYREASINFSCLLVHDDQKVMWHA  632

Query  448  TPFEERLEKALSEESLVSQR-KRMSG  374
            T FEERL +AL+ +  V QR  R +G
Sbjct  633  TSFEERLAQALASQEAVPQRPNRFTG  658



>ref|XP_009411395.1| PREDICTED: helicase swr-1 [Musa acuminata subsp. malaccensis]
Length=440

 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 97/215 (45%), Gaps = 48/215 (22%)
 Frame = -3

Query  919  LANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEA  740
            LA G   R RSQYV+ +LNP++N +Q KEV    + +              + +  S   
Sbjct  222  LAGGGNKRDRSQYVHPVLNPVQNLTQWKEVKVHSARAKNAKVENAGTEKENQMMFCSEAM  281

Query  739  NATSE-----IGLRES---STENNLNVEASLSSWLKPS----------------------  650
            N  ++     IGL  +   ST+  ++V+ASLS+WL  S                      
Sbjct  282  NNKAKKPQGSIGLDRTPNCSTKQEISVDASLSNWLLSSENSTVEGPEASNSPRSNSAFSR  341

Query  649  -------------LRQSSTQPFGGSIHHGKTLGDRPILGMVAAHWN---ENETSRVSPKW  518
                         L+Q+S            T  ++PILG V  +WN   + + S  S + 
Sbjct  342  EDRPILGALTVEDLKQASVTSSPRRSPSRST-DEKPILGTVGRYWNSRNQGDDSASSRQP  400

Query  517  WDG-NGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
              G NG PN+T KY+ED+ V+W++TPFE  LE+AL
Sbjct  401  SSGHNGSPNTTIKYREDKPVNWNSTPFEVMLERAL  435



>ref|XP_009627215.1| PREDICTED: uncharacterized protein LOC104117810 [Nicotiana tomentosiformis]
Length=459

 Score = 72.4 bits (176),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/213 (29%), Positives = 96/213 (45%), Gaps = 49/213 (23%)
 Frame = -3

Query  904  FPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGE----SVDLSSEAN  737
            + R RS Y++ +LNP+EN SQ K V ++ +E  +    K  F+   E    S  L     
Sbjct  244  YVRDRSAYIHPVLNPVENLSQWKTVKSKAAEPLKLLPQKENFAAEVEGPRASFSLEPTFK  303

Query  736  ATSEIGLRESSTENNLNVEASLSSWL-------------------KPSLRQSST------  632
             +S    R    +    V+ASLS+WL                   + S+ Q S       
Sbjct  304  QSSSSSFRPKLKDQETGVDASLSNWLVTPDTTKKAGSGMLEAVTSEKSISQGSNSVMSFE  363

Query  631  -QPFGGSI----------------HHGKTLGDRPILGMVAAHWNENETSRVSPKWWDGNG  503
             +P  G++                   ++  + PI+G V  +WN +     +  +    G
Sbjct  364  DRPILGALTVEELKQMSAYSSPRKSPSRSPDEMPIIGTVGTYWNPSTNFGSASSF---KG  420

Query  502  IPNSTHKYKEDQKVSWHATPFEERLEKALSEES  404
            IPNST KY+ED++V+WH+TPFE RL++AL + S
Sbjct  421  IPNSTSKYREDKRVNWHSTPFETRLDRALKQGS  453



>ref|XP_006857471.1| hypothetical protein AMTR_s00067p00189180 [Amborella trichopoda]
 gb|ERN18938.1| hypothetical protein AMTR_s00067p00189180 [Amborella trichopoda]
Length=458

 Score = 72.0 bits (175),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 62/232 (27%), Positives = 100/232 (43%), Gaps = 79/232 (34%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEA-------  740
            R RS+YV+ +LNP+EN S+ K +  ++++ +       LF    E+  L +E        
Sbjct  219  RDRSRYVHPVLNPVENLSEWKTLKAKETKKAP------LFKQSKENAKLDNEEVFIPFSS  272

Query  739  -------------NATSEIGLRESSTENNLNVEASLSSWLKP------------------  653
                         N+ +   L++ +    + V+ SLS+WL P                  
Sbjct  273  EPTFKLPKPQIQLNSETSFKLQKQTPRQEMAVDTSLSNWLNPLETLNPRKPGNGESKLSD  332

Query  652  ---------------SLRQSSTQPFGGSI-------------HHGKTLGDRPILGMVAAH  557
                           S+R +  +P  G++                ++  + PILG V  +
Sbjct  333  IKPTQEVKSSPSSVKSVRYTDERPILGALTVENIKQASSPRKSPSRSPDEMPILGTVGTY  392

Query  556  WNE-----NETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
            WN+     N  SR+        GIPN+T KYKED++V+WH+TPFE RLE+AL
Sbjct  393  WNQETLEKNLRSRIP--ISSTEGIPNTTSKYKEDKRVNWHSTPFEVRLERAL  442



>ref|XP_004976193.1| PREDICTED: altered inheritance of mitochondria protein 44-like 
[Setaria italica]
Length=549

 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 98/204 (48%), Gaps = 51/204 (25%)
 Frame = -3

Query  892  RSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLR  713
            RSQYV+ +LNP++N SQ KEV ++ +++           ++  +V +S    + S  G +
Sbjct  355  RSQYVHPVLNPVQNLSQWKEVKSQKTQAVPGKKLDKENVNLVPNVGVSQTRMSPSISGKK  414

Query  712  ESSTENNLNVEASLSSWLKPSLRQSSTQ------------------PFGGSIHHGKTLGD  587
            E      ++V+ASLS+WL  S   ++ +                  P  G++    T+ D
Sbjct  415  E------VSVDASLSTWLNSSENSTAGKGQSSKSPCSISSVSRAERPVLGAL----TVDD  464

Query  586  --------------------RPILGMVAAHW--NENETSRVSPKWWDG-NGIPNSTHKYK  476
                                 PILG + ++W   + +    S +   G NGIPN+T KY+
Sbjct  465  LKQPSSASSPRRSPRNDSEGAPILGTIGSYWQCTDQDNGYCSSRSDSGTNGIPNTTSKYR  524

Query  475  EDQKVSWHATPFEERLEKALSEES  404
            ED++V WH+TPF  RL++AL + S
Sbjct  525  EDKRVKWHSTPFNVRLDRALKKTS  548



>gb|EMT07277.1| hypothetical protein F775_03470 [Aegilops tauschii]
Length=498

 Score = 71.6 bits (174),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 100/212 (47%), Gaps = 60/212 (28%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESV-----DLSSEANA  734
            R RSQYV  +LNP++N  Q KEV       +Q    K L+ +   SV      L+ +   
Sbjct  299  RDRSQYVRPVLNPVQNREQWKEV------KAQAGPVKKLYKENVNSVPNVGATLACKVAN  352

Query  733  TSEIGLRESSTENNLNVEASLSSWLKPS--------------------------------  650
             +++G   SS +  ++V+ASLS+WL  S                                
Sbjct  353  QTKMGPSNSS-KGEVSVDASLSTWLISSDNSTVDKAQSKSPRSVSSVCRQERPVLGALTV  411

Query  649  --LRQSS--TQPFGGSIHHGKTLGDRPILGMVAAHW------NENETSRVSPKWWDGNGI  500
              L+QSS  + P     H+ + +   PIL  V ++W      NE  +SR        NGI
Sbjct  412  DDLKQSSATSSPRRSPSHNREEV---PILSTVGSYWSSTKQGNEYCSSRSD---SGTNGI  465

Query  499  PNSTHKYKEDQKVSWHATPFEERLEKALSEES  404
            PNST KY+ED++V+WH+TPF  RL+KA+ + S
Sbjct  466  PNSTSKYREDRRVNWHSTPFNVRLDKAMKKSS  497



>ref|XP_008459951.1| PREDICTED: uncharacterized protein LOC103498917 isoform X1 [Cucumis 
melo]
Length=360

 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 91/188 (48%), Gaps = 33/188 (18%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSD--MGESVDLSSEANATSE  725
            R R+ YVYS+LNP+EN SQ   V            SK  FS     E+V+L  E++    
Sbjct  186  RHRTAYVYSVLNPVENLSQWNAV-----------KSKKEFSPKLQKENVELEQESSVDGF  234

Query  724  IGLRESSTENNLNVEASLSSWL-----KPSLRQSSTQPFGGSI---HHGKTLGDRPILGM  569
                E S E    V+ASLS+WL      P  + + T     +I     G   G   + G 
Sbjct  235  PYSSEPSREPC--VDASLSNWLPSSQATPVSKITPTMALEATITPLKSGNLQGSSSLKGS  292

Query  568  VAAHWNENETSR------VSPKWWDG----NGIPNSTHKYKEDQKVSWHATPFEERLEKA  419
              +  +E  T+R      VS K  D      GIPN+T KY+ED+ V+WH+TPFE RLE+A
Sbjct  293  GDSKMSEVGTARMYRRQGVSHKDRDSASSFKGIPNTTSKYREDKTVNWHSTPFETRLERA  352

Query  418  LSEESLVS  395
            L+   + +
Sbjct  353  LNSRGVAA  360



>ref|XP_008459952.1| PREDICTED: uncharacterized protein LOC103498917 isoform X2 [Cucumis 
melo]
Length=358

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 91/188 (48%), Gaps = 33/188 (18%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSD--MGESVDLSSEANATSE  725
            R R+ YVYS+LNP+EN SQ   V            SK  FS     E+V+L  E++    
Sbjct  184  RHRTAYVYSVLNPVENLSQWNAV-----------KSKKEFSPKLQKENVELEQESSVDGF  232

Query  724  IGLRESSTENNLNVEASLSSWL-----KPSLRQSSTQPFGGSI---HHGKTLGDRPILGM  569
                E S E    V+ASLS+WL      P  + + T     +I     G   G   + G 
Sbjct  233  PYSSEPSREPC--VDASLSNWLPSSQATPVSKITPTMALEATITPLKSGNLQGSSSLKGS  290

Query  568  VAAHWNENETSR------VSPKWWDG----NGIPNSTHKYKEDQKVSWHATPFEERLEKA  419
              +  +E  T+R      VS K  D      GIPN+T KY+ED+ V+WH+TPFE RLE+A
Sbjct  291  GDSKMSEVGTARMYRRQGVSHKDRDSASSFKGIPNTTSKYREDKTVNWHSTPFETRLERA  350

Query  418  LSEESLVS  395
            L+   + +
Sbjct  351  LNSRGVAA  358



>ref|XP_010048173.1| PREDICTED: uncharacterized protein LOC104437008 isoform X2 [Eucalyptus 
grandis]
 gb|KCW89030.1| hypothetical protein EUGRSUZ_A01357 [Eucalyptus grandis]
Length=464

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 94/215 (44%), Gaps = 55/215 (26%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R RS Y++S+LNP+EN +Q K V  + +   +     L F D    +   + A A  E+ 
Sbjct  246  RDRSVYIHSVLNPVENLTQWKAVKAKGTPLPKHRKENLSF-DQEARMSFDT-APALKEVS  303

Query  718  LRESSTEN-------NLNVEASLSSWLKPSLR--------------QSSTQPFGGSIHHG  602
                +  N        + V+ASLS+WL  S+               Q  T    G +   
Sbjct  304  FSFKAKPNETKKSTQEVPVDASLSNWLPSSVTTPIEKKSATTLDSVQVETSLVKGYMSSP  363

Query  601  KTLGDRPIL-------------------------------GMVAAHWNENETSRVSPKWW  515
            ++  DRPIL                               G V  +W+++++   S    
Sbjct  364  RSQEDRPILGALTVEELRQFSAKSSPRKSPSRSPDEMPIIGTVGTYWSQSDSVGNSCSTA  423

Query  514  DG-NGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
                GIPN+T KY+ED+KV+WH+TPFE RLE+AL+
Sbjct  424  SSFKGIPNTTSKYREDKKVNWHSTPFETRLERALN  458



>ref|XP_010048165.1| PREDICTED: uncharacterized protein LOC104437008 isoform X1 [Eucalyptus 
grandis]
Length=477

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 94/215 (44%), Gaps = 55/215 (26%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R RS Y++S+LNP+EN +Q K V  + +   +     L F D    +   + A A  E+ 
Sbjct  259  RDRSVYIHSVLNPVENLTQWKAVKAKGTPLPKHRKENLSF-DQEARMSFDT-APALKEVS  316

Query  718  LRESSTEN-------NLNVEASLSSWLKPSLR--------------QSSTQPFGGSIHHG  602
                +  N        + V+ASLS+WL  S+               Q  T    G +   
Sbjct  317  FSFKAKPNETKKSTQEVPVDASLSNWLPSSVTTPIEKKSATTLDSVQVETSLVKGYMSSP  376

Query  601  KTLGDRPIL-------------------------------GMVAAHWNENETSRVSPKWW  515
            ++  DRPIL                               G V  +W+++++   S    
Sbjct  377  RSQEDRPILGALTVEELRQFSAKSSPRKSPSRSPDEMPIIGTVGTYWSQSDSVGNSCSTA  436

Query  514  DG-NGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
                GIPN+T KY+ED+KV+WH+TPFE RLE+AL+
Sbjct  437  SSFKGIPNTTSKYREDKKVNWHSTPFETRLERALN  471



>ref|XP_006479470.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Citrus 
sinensis]
Length=446

 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 97/226 (43%), Gaps = 71/226 (31%)
 Frame = -3

Query  907  RFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATS  728
            R  R RS YV+S+LNP+EN +Q K +          +  K  F    E+  +  E+   S
Sbjct  215  RAARDRSAYVHSVLNPVENLTQWKAL---------KAKGKPQFKQQKENSTVDQESQRAS  265

Query  727  --------EIGLRESSTENN--------LNVEASLSSWLK-----PSLRQSSTQPFG---  620
                    E+ L   S  +         + V+ASLS+WL      P  + S+T       
Sbjct  266  FNLEPSFQELSLSFKSKSDKPSKRANQEIAVDASLSNWLSSSETTPINKGSNTVSISTTP  325

Query  619  ------GSIHHGKTLGDRPILGMVA----AHWNENETSRVSPK--------------WWD  512
                  GS +  ++  DRPILG +       ++ + + R SP               +W 
Sbjct  326  EKIISQGSSNSVRSQDDRPILGALTLEEIKQFSASNSPRKSPSRSPDEMPIIGTVGTYWS  385

Query  511  GN--------------GIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
                            GIPN+T KY+ED+KVSWH+TPFE RLE+AL
Sbjct  386  PTSSSAKDSSSASSYKGIPNTTSKYREDKKVSWHSTPFETRLERAL  431



>ref|XP_006443769.1| hypothetical protein CICLE_v10020148mg [Citrus clementina]
 ref|XP_006479471.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Citrus 
sinensis]
 gb|ESR57009.1| hypothetical protein CICLE_v10020148mg [Citrus clementina]
Length=445

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 97/226 (43%), Gaps = 71/226 (31%)
 Frame = -3

Query  907  RFPRIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATS  728
            R  R RS YV+S+LNP+EN +Q K +          +  K  F    E+  +  E+   S
Sbjct  214  RAARDRSAYVHSVLNPVENLTQWKAL---------KAKGKPQFKQQKENSTVDQESQRAS  264

Query  727  --------EIGLRESSTENN--------LNVEASLSSWLK-----PSLRQSSTQPFG---  620
                    E+ L   S  +         + V+ASLS+WL      P  + S+T       
Sbjct  265  FNLEPSFQELSLSFKSKSDKPSKRANQEIAVDASLSNWLSSSETTPINKGSNTVSISTTP  324

Query  619  ------GSIHHGKTLGDRPILGMVA----AHWNENETSRVSPK--------------WWD  512
                  GS +  ++  DRPILG +       ++ + + R SP               +W 
Sbjct  325  EKIISQGSSNSVRSQDDRPILGALTLEEIKQFSASNSPRKSPSRSPDEMPIIGTVGTYWS  384

Query  511  GN--------------GIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
                            GIPN+T KY+ED+KVSWH+TPFE RLE+AL
Sbjct  385  PTSSSAKDSSSASSYKGIPNTTSKYREDKKVSWHSTPFETRLERAL  430



>ref|XP_002989115.1| hypothetical protein SELMODRAFT_427719 [Selaginella moellendorffii]
 gb|EFJ09909.1| hypothetical protein SELMODRAFT_427719 [Selaginella moellendorffii]
Length=427

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  526  PKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
            PK WDG GIPN+T KYKEDQ+V+WH+TPFE R++KALS
Sbjct  335  PKLWDGQGIPNTTRKYKEDQRVTWHSTPFEVRIDKALS  372



>gb|EYU46411.1| hypothetical protein MIMGU_mgv1a006566mg [Erythranthe guttata]
Length=403

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 89/197 (45%), Gaps = 37/197 (19%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSE-------A  740
            R RS Y+ S LNP++N +Q K   ++ +   +     L  +     +  S E       +
Sbjct  201  RDRSDYINSALNPVDNITQWKVAKSKVTTVCKPQKENLTANFESPRISFSPEPTFGPSPS  260

Query  739  NATSEIGLRESSTENNLNVEASLSSWLK-------PS---------------------LR  644
            +  S+ G  + +    + V+ASLS+WL        PS                     LR
Sbjct  261  SFKSKSGRSKDANNQEIAVDASLSNWLASPEITTTPSKKTGFSGFEDRPILGALTVEELR  320

Query  643  QSSTQPFGGSIHHGKTLGDRPILGMVAAHWNE-NETSRVSPKWWDGNGIPNSTHKYKEDQ  467
            Q S  P        ++  + PI+G V  +WN  N   R         GIPN+T KY+ED+
Sbjct  321  QISATP-SPRKSPSRSPDEIPIIGSVGTYWNHSNSAKRSDSSASSFKGIPNTTSKYREDK  379

Query  466  KVSWHATPFEERLEKAL  416
            +V+WH+TPFE RL++AL
Sbjct  380  RVNWHSTPFETRLDRAL  396



>gb|EYU46410.1| hypothetical protein MIMGU_mgv1a006566mg [Erythranthe guttata]
Length=439

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 89/197 (45%), Gaps = 37/197 (19%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSE-------A  740
            R RS Y+ S LNP++N +Q K   ++ +   +     L  +     +  S E       +
Sbjct  237  RDRSDYINSALNPVDNITQWKVAKSKVTTVCKPQKENLTANFESPRISFSPEPTFGPSPS  296

Query  739  NATSEIGLRESSTENNLNVEASLSSWLK-------PS---------------------LR  644
            +  S+ G  + +    + V+ASLS+WL        PS                     LR
Sbjct  297  SFKSKSGRSKDANNQEIAVDASLSNWLASPEITTTPSKKTGFSGFEDRPILGALTVEELR  356

Query  643  QSSTQPFGGSIHHGKTLGDRPILGMVAAHWNE-NETSRVSPKWWDGNGIPNSTHKYKEDQ  467
            Q S  P        ++  + PI+G V  +WN  N   R         GIPN+T KY+ED+
Sbjct  357  QISATP-SPRKSPSRSPDEIPIIGSVGTYWNHSNSAKRSDSSASSFKGIPNTTSKYREDK  415

Query  466  KVSWHATPFEERLEKAL  416
            +V+WH+TPFE RL++AL
Sbjct  416  RVNWHSTPFETRLDRAL  432



>ref|XP_009336097.1| PREDICTED: uncharacterized protein LOC103928740 [Pyrus x bretschneideri]
Length=433

 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 94/213 (44%), Gaps = 52/213 (24%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSE--ANATSE  725
            R RS YV+S+LNP+EN +Q K  +            +    D    +  SSE   N  S+
Sbjct  215  RDRSGYVHSVLNPVENLTQWK-ALKAKGTPLMKPQKENFTQDQEPRISFSSEPSLNFKSK  273

Query  724  IGLRESSTENN---LNVEASLSSWLKPS----LRQSSTQPFGG-----SIHHG----KTL  593
                +  ++N+   + V+ASLS+WL  S    + ++ST          S  HG    ++ 
Sbjct  274  ADHDKKHSKNSDQEMAVDASLSNWLFSSENTPVNKASTTALDTFTPEKSTSHGSNSARSH  333

Query  592  GDRPIL-------------------------------GMVAAHWNENE--TSRVSPKWWD  512
             DRPIL                               G V  +WN      +  S     
Sbjct  334  EDRPILGALTVEELRQFSASSSPRKSPSRSPDEMAIMGTVGTYWNHMAPPPAAKSSGASS  393

Query  511  GNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
              GIPN+T KY+ED++V+WH+TPFE RLE+AL+
Sbjct  394  YKGIPNTTSKYREDKRVNWHSTPFETRLERALN  426



>ref|XP_011024450.1| PREDICTED: uncharacterized protein LOC105125623 [Populus euphratica]
Length=248

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -3

Query  583  PILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
            PI+G V  +WN + + + S       GIPN+T KY+ED++V+WH+TPFE RLE+AL
Sbjct  176  PIIGTVGTYWNHSGSGKDSGSASSYKGIPNTTSKYREDKRVNWHSTPFETRLERAL  231



>gb|KHN05877.1| hypothetical protein glysoja_026465 [Glycine soja]
Length=1246

 Score = 69.3 bits (168),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 88/211 (42%), Gaps = 59/211 (28%)
 Frame = -3

Query  898   RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
             R RS YV+ +LNP+EN  Q K +  + +            +D G  V       +   + 
Sbjct  1034  RDRSAYVHPVLNPVENLPQWKVLKAKRTPIRPQKE-----NDFGVGVK-----GSPFSLN  1083

Query  718   LRESSTENNLN----VEASLSSWL-----KPSL-RQSSTQPFGGSIHHGKTLG-------  590
               ES T   LN    V+ASLS+WL      P + +  S   F G+     + G       
Sbjct  1084  YSESDTPKKLNREIRVDASLSNWLVSPETTPVISKAGSVASFAGTPDRSTSQGSYSVISH  1143

Query  589   -DRPIL-------------------------------GMVAAHWNENETSRVSPKWWDGN  506
              DRPIL                               G V  +WN   ++          
Sbjct  1144  EDRPILGALTLEEIKQFSATSSPRKSPSRSPDEMPIIGTVGTYWNAAGSAEDPGSVSSFK  1203

Query  505   GIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
             GIPNST KY+ED++V+WH+TPFE RLEKAL+
Sbjct  1204  GIPNSTSKYREDKRVNWHSTPFETRLEKALN  1234



>ref|XP_010522560.1| PREDICTED: eisosome protein SEG2 [Tarenaya hassleriana]
Length=443

 Score = 65.9 bits (159),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  589  DRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
            D PI+G V  +WN ++  + S       GIPN+T KY+ED++V+W +TPFE RLE+AL
Sbjct  381  DTPIIGSVGGYWNHSDAVKDSGSASSFKGIPNTTSKYREDKRVNWRSTPFEARLERAL  438



>ref|XP_008802393.1| PREDICTED: uncharacterized protein LOC103716248 [Phoenix dactylifera]
Length=183

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = -3

Query  583  PILGMVAAHWN-ENETSRVSPKWWDGN---GIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
            PI+G V ++W+  N+ S        G+   GIPN+T KYKED++V+WHATPFE RLE+AL
Sbjct  118  PIVGTVGSYWSCINQRSDSGSSCQSGSEIKGIPNTTSKYKEDKRVNWHATPFEVRLERAL  177

Query  415  SE  410
            ++
Sbjct  178  NK  179



>ref|XP_006386917.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa]
 gb|ERP64714.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa]
Length=442

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 88/205 (43%), Gaps = 52/205 (25%)
 Frame = -3

Query  874  SILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEAN-------ATSEIGL  716
            ++LNP+EN SQ K ++    + S     + L  D    +  SSE           ++ G 
Sbjct  224  AVLNPVENLSQWK-IVKAKGKPSLRQQKENLTLDQEPRMSFSSEPGFKELAFSFKAKAGQ  282

Query  715  RESSTENNLNVEASLSSWL---------KP------------SLRQSSTQP--------F  623
                 +  + V+ SLS+WL         KP            S+ Q S  P         
Sbjct  283  CNKKPDQEIAVDTSLSNWLGSSECTPVNKPGSIGLDAIAPEKSMSQGSNSPRSFDDRPIL  342

Query  622  GG-SIHHGKTLG--------------DRPILGMVAAHWNENETSRVSPKWWDGNGIPNST  488
            G  ++   K L               + PI+G V  +WN   + + S       GIPN+T
Sbjct  343  GALTVEELKHLSATSSSRRSPSRSPDEMPIIGTVGTYWNHGGSGKDSGSASSYKGIPNTT  402

Query  487  HKYKEDQKVSWHATPFEERLEKALS  413
             KY+ED++V+WH+TPFE RLE+AL+
Sbjct  403  SKYREDKRVNWHSTPFETRLERALN  427



>ref|XP_008372373.1| PREDICTED: lisH domain-containing protein C1711.05-like [Malus 
domestica]
Length=433

 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 105/238 (44%), Gaps = 57/238 (24%)
 Frame = -3

Query  973  LSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsn  794
            ++++  +P  + P  +D+       R RS YV+S+LNP+EN +Q K  +           
Sbjct  195  MTEDFDSPMPMKPAGLDHNV-----RDRSGYVHSVLNPVENLTQWK-ALKAKGTPLMKPQ  248

Query  793  SKLLFSDMGESVDLSSEANATSEIGL---RESSTENN--LNVEASLSSWLKPS----LRQ  641
             +    D    +  SS  + + ++     ++ S ++N  + V+ASLS+WL  S    + +
Sbjct  249  KENFTQDQEPRISFSSXPSLSFKLKTDQDKKHSXDSNQEMAVDASLSNWLFSSENTPVNK  308

Query  640  SSTQPFGG-----SIHHG----KTLGDRPIL-----------------------------  575
             ST          S  HG    ++  DRPIL                             
Sbjct  309  VSTTALDTFTPEKSTSHGSNSARSHEDRPILGALTVEELRQFSASSSPRKSPSRSPDEMA  368

Query  574  --GMVAAHWNENE--TSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
              G V  +WN      +  S       GIPN+T KY+ED++V+WH+TPFE RLE+AL+
Sbjct  369  IMGTVGTYWNHMAPPPAXKSSGASSYKGIPNTTSKYREDKRVNWHSTPFETRLERALN  426



>ref|XP_008356212.1| PREDICTED: lisH domain-containing protein C1711.05-like [Malus 
domestica]
Length=433

 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 105/238 (44%), Gaps = 57/238 (24%)
 Frame = -3

Query  973  LSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsn  794
            ++++  +P  + P  +D+       R RS YV+S+LNP+EN +Q K  +           
Sbjct  195  MTEDFDSPMPMKPAGLDHNV-----RDRSGYVHSVLNPVENLTQWK-ALKAKGTPLMKPQ  248

Query  793  SKLLFSDMGESVDLSSEANATSEIGL---RESSTENN--LNVEASLSSWLKPS----LRQ  641
             +    D    +  SS  + + ++     ++ S ++N  + V+ASLS+WL  S    + +
Sbjct  249  KENFTQDQEPRISFSSXPSLSFKLKTDQDKKHSXDSNQEMAVDASLSNWLFSSENTPVNK  308

Query  640  SSTQPFGG-----SIHHG----KTLGDRPIL-----------------------------  575
             ST          S  HG    ++  DRPIL                             
Sbjct  309  VSTTALDTFTPEKSTSHGSNSARSHEDRPILGALTVEELRQFSASSSPRKSPSRSPDEMA  368

Query  574  --GMVAAHWNENE--TSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
              G V  +WN      +  S       GIPN+T KY+ED++V+WH+TPFE RLE+AL+
Sbjct  369  IMGTVGTYWNHMAPPPAAKSSGASSYKGIPNTTSKYREDKRVNWHSTPFETRLERALN  426



>ref|XP_008364322.1| PREDICTED: lisH domain-containing protein C1711.05-like [Malus 
domestica]
Length=433

 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 105/238 (44%), Gaps = 57/238 (24%)
 Frame = -3

Query  973  LSDEMQTPGTVFPTHVDNLANGRFPRIRSQYVYSILNPIENASQMKEVInedsessqdsn  794
            ++++  +P  + P  +D+       R RS YV+S+LNP+EN +Q K  +           
Sbjct  195  MTEDFDSPMPMKPAGLDHNV-----RDRSGYVHSVLNPVENLTQWK-ALKAKGTPLMKPQ  248

Query  793  SKLLFSDMGESVDLSSEANATSEIGL---RESSTENN--LNVEASLSSWLKPS----LRQ  641
             +    D    +  SS  + + ++     ++ S ++N  + V+ASLS+WL  S    + +
Sbjct  249  KENFTQDQEPRISFSSXPSLSFKLKTDQDKKHSKDSNQEMAVDASLSNWLFSSENTPVNK  308

Query  640  SSTQPFGG-----SIHHG----KTLGDRPIL-----------------------------  575
             ST          S  HG    ++  DRPIL                             
Sbjct  309  VSTTALDTFTPEKSTSHGSNSARSHEDRPILGALTVEELRQFSASSSPRKSPSRSPDEMA  368

Query  574  --GMVAAHWNENE--TSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
              G V  +WN      +  S       GIPN+T KY+ED++V+WH+TPFE RLE+AL+
Sbjct  369  IMGTVGTYWNHMAPPPAAKSSGASSYKGIPNTTSKYREDKRVNWHSTPFETRLERALN  426



>ref|XP_007050196.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007050197.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94353.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94354.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=442

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = -3

Query  583  PILGMVAAHWNEN-ETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
            PI+G V  +W+ +  T++ S       GIPN+T KY+ED+ VSWH+TPFE RLE+AL
Sbjct  372  PIIGTVGTYWSHHVSTTKDSGSATSFKGIPNTTSKYREDKNVSWHSTPFETRLERAL  428



>ref|XP_006304427.1| hypothetical protein CARUB_v10011017mg [Capsella rubella]
 gb|EOA37325.1| hypothetical protein CARUB_v10011017mg [Capsella rubella]
Length=436

 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -3

Query  601  KTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            K+  + PI+G V  +W  +  +          GIPN+T KY+ED+ V+WH+TPFE RLEK
Sbjct  371  KSPDETPIIGTVGGYWGNHSKAMGCGSVSSFKGIPNTTSKYREDKSVNWHSTPFEARLEK  430

Query  421  ALSEE  407
            AL+ +
Sbjct  431  ALNRD  435



>ref|XP_010457430.1| PREDICTED: uncharacterized protein LOC104738916 [Camelina sativa]
 ref|XP_010457431.1| PREDICTED: uncharacterized protein LOC104738916 [Camelina sativa]
 ref|XP_010457432.1| PREDICTED: uncharacterized protein LOC104738916 [Camelina sativa]
Length=426

 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -3

Query  601  KTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            K+  + PI+G V  +W  +  +          GIPN+T KY+ED+ VSWH+TPFE RLEK
Sbjct  361  KSPDETPIIGTVGGYWGNHSKTIDCGSETAFKGIPNTTSKYREDKSVSWHSTPFEARLEK  420

Query  421  ALSEE  407
            AL+ +
Sbjct  421  ALNRD  425



>ref|XP_010482990.1| PREDICTED: uncharacterized protein LOC104761579 [Camelina sativa]
 ref|XP_010482997.1| PREDICTED: uncharacterized protein LOC104761579 [Camelina sativa]
Length=426

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -3

Query  601  KTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            K+  + PI+G V  +W  +  +          GIPN+T KY+ED+ V+WH+TPFE RLEK
Sbjct  361  KSPDETPIIGTVGGYWGNHSKTIDCGSETAFKGIPNTTSKYREDKSVNWHSTPFEARLEK  420

Query  421  ALSEE  407
            AL+ E
Sbjct  421  ALNRE  425



>gb|KFK42748.1| hypothetical protein AALP_AA1G034400 [Arabis alpina]
Length=393

 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -3

Query  601  KTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            K+  + PI+G V  +W  +  +          GIPN+T KY+ED KV+WH+TPFE RLEK
Sbjct  327  KSPDETPIIGTVGGYWGNHIKAIDCGSASSFKGIPNTTSKYREDNKVNWHSTPFEARLEK  386

Query  421  AL  416
            AL
Sbjct  387  AL  388



>ref|XP_002303119.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa]
 gb|EEE82392.1| hypothetical protein POPTR_0002s26020g [Populus trichocarpa]
Length=983

 Score = 63.2 bits (152),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 91/211 (43%), Gaps = 64/211 (30%)
 Frame = -3

Query  874  SILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIGLRESST--  701
            ++LNP+EN SQ K V  +   S +     L       ++D     + +SE G +E +   
Sbjct  224  AVLNPVENLSQWKIVKAKGKPSLRQQKENL-------TLDQEPRMSFSSEPGFKELAFSF  276

Query  700  -----------ENNLNVEASLSSWL---------KP------------SLRQSST-----  632
                       +  + V+ SLS+WL         KP            S+ Q S      
Sbjct  277  KAKAGQCNKKPDQEIAVDTSLSNWLGSSECTPVNKPGSIGLDAIAPEKSMSQGSNSPRSF  336

Query  631  --QPFGGSI------HHGKTLG----------DRPILGMVAAHWNENETSRVSPKWWDGN  506
              +P  G++      H   T            + PI+G V  +WN   + + S       
Sbjct  337  DDRPILGALTVEELKHLSATSSSRRSPSRSPDEMPIIGTVGTYWNHGGSGKDSGSASSYK  396

Query  505  GIPNSTHKYKEDQKVSWHATPFEERLEKALS  413
            GIPN+T KY+ED++V+WH+TPFE RLE+AL+
Sbjct  397  GIPNTTSKYREDKRVNWHSTPFETRLERALN  427



>ref|XP_006418174.1| hypothetical protein EUTSA_v10007735mg [Eutrema salsugineum]
 gb|ESQ36527.1| hypothetical protein EUTSA_v10007735mg [Eutrema salsugineum]
Length=419

 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -3

Query  601  KTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            K+  + PI+G V  +W  +  +          GIPN+T KY+ED+ V WH+TPFE RLEK
Sbjct  353  KSPDETPIIGTVGGYWGTHSKATDCGSVSSFKGIPNTTSKYREDKSVKWHSTPFEARLEK  412

Query  421  AL  416
            AL
Sbjct  413  AL  414



>emb|CDY32524.1| BnaA09g50720D [Brassica napus]
Length=1094

 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 86/199 (43%), Gaps = 44/199 (22%)
 Frame = -3

Query  871   ILNPIENASQMKEVInedsessqdsnSKL--LFSDMGESVDLSSEANATSEIGLRESSTE  698
             +LNP+EN +Q K   +      + S  +   L SD  +  D  S     S+    + +  
Sbjct  895   VLNPVENLTQWKAAKSNGKTIQKQSQKENSNLISDQQDKKDSFSFGCGDSQTDEAKKAGN  954

Query  697   NNLNVEASLSSWLKPSLRQS----------STQPFGGSIHHGKTLGDRPILGMVAA----  560
               L V+ASLS+WL  S   S           ++P   S     +  +RP+L  + +    
Sbjct  955   KELTVDASLSTWLSTSETGSECNSVSNTPEKSKPASYSKRVINSHDERPVLCALTSEEIK  1014

Query  559   HWNENETSRVSPK---------------WWDGN-------------GIPNSTHKYKEDQK  464
              ++   T R SP+               W D +             GIPN+T KY+ED+ 
Sbjct  1015  QFSAASTPRKSPRKSHDETPIIGTVGGYWGDHSKAVDSGGSVSSFKGIPNTTSKYREDKS  1074

Query  463   VSWHATPFEERLEKALSEE  407
             V+WH+TPFE RLEKAL  +
Sbjct  1075  VNWHSTPFEARLEKALKRD  1093



>ref|XP_009118674.1| PREDICTED: uncharacterized protein LOC103843673 [Brassica rapa]
Length=402

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -3

Query  601  KTLGDRPILGMVAAHWNENETSRVSPKWWDG-NGIPNSTHKYKEDQKVSWHATPFEERLE  425
            K+  + PI+G V  +W ++  +  S        GIPN+T KY+ED+ V+WH+TPFE RLE
Sbjct  336  KSHDETPIIGTVGGYWGDHSKAVDSGGSVSSFKGIPNTTSKYREDKSVNWHSTPFEARLE  395

Query  424  KAL  416
            KAL
Sbjct  396  KAL  398



>ref|XP_002889489.1| hypothetical protein ARALYDRAFT_333726 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65748.1| hypothetical protein ARALYDRAFT_333726 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  583  PILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
            PI+G V  +W     +          GIPN+T KY+ED+ V+WH+TPFE RLEKAL
Sbjct  374  PIIGTVGGYWGNYSKAIDCGSASSFKGIPNTTSKYREDKSVNWHSTPFEARLEKAL  429



>emb|CDY10083.1| BnaC08g43680D [Brassica napus]
Length=408

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 89/210 (42%), Gaps = 54/210 (26%)
 Frame = -3

Query  886  QYVYSILNPIENASQMK------EVInedsessqdsnSKLLFSDMGESVDLSSEANATSE  725
             Y   +LNP+EN +Q K      + I + S+    +N      D  +S    +++  T E
Sbjct  196  HYAQGVLNPVENLTQWKSAKSNGKTIQKQSQKENSNNLISGQEDKKDSFSFGADSQ-TDE  254

Query  724  IGLRES-----STENNLNVEASLSSWLKPSLRQSSTQPFGGSIHHGKTLG----------  590
              L+ +     +    L V+ASLS+WL  S   S       +    K+            
Sbjct  255  TALQTTVEFKKAGNKELTVDASLSTWLSTSETGSECNSVSNTPEKNKSASYAKRVINSHD  314

Query  589  DRPILGMVAA----HWNENETSRVSPK---------------WWDGN-------------  506
            DRP+L  + +     ++   T R SP+               W D +             
Sbjct  315  DRPVLCALTSEEIKQFSAASTPRKSPRKSHDETPIIGTVGGYWGDHSKAVDSGGSVSSFK  374

Query  505  GIPNSTHKYKEDQKVSWHATPFEERLEKAL  416
            GIPN+T KY+ED+ V+WH+TPFE RLEKAL
Sbjct  375  GIPNTTSKYREDKSVNWHSTPFEARLEKAL  404



>ref|NP_171899.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE27648.1| uncharacterized protein AT1G04030 [Arabidopsis thaliana]
Length=434

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -3

Query  601  KTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            K+  + PI+G V  +W     +          GIPN++ KY+ED+ V+WH+TPFE RLEK
Sbjct  368  KSPDETPIIGTVGGYWGNRSKAIDCGSASSFKGIPNTSSKYREDKSVNWHSTPFEARLEK  427

Query  421  AL  416
            AL
Sbjct  428  AL  429



>ref|XP_004140573.1| PREDICTED: uncharacterized protein LOC101205962 [Cucumis sativus]
 ref|XP_004157587.1| PREDICTED: uncharacterized LOC101205962 [Cucumis sativus]
Length=359

 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 89/185 (48%), Gaps = 28/185 (15%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R R+ YV S+LNP+EN SQ   V     +S ++   KL      E+  L  E++      
Sbjct  186  RHRTAYVSSVLNPVENLSQWNAV-----KSKKEFPPKL----QKENAKLEQESSVDGFPY  236

Query  718  LRESSTENNLNVEASLSSWLKPS----LRQSSTQPFGGS---IHHGKTLGDRPILGMVAA  560
              E S E    V+ASLS+WL  S    ++ + T     +   +  G   G   + G   +
Sbjct  237  SSEPSGEPC--VDASLSNWLPSSQATPVKITPTMALEATMTPLKSGTLQGSSSLKGSGHS  294

Query  559  HWNENETSR------VSPKWWDG----NGIPNSTHKYKEDQKVSWHATPFEERLEKALSE  410
              +E  T+       VS K  D      GIPN+T KY+ED+ V WH+TPFE RLE+AL+ 
Sbjct  295  KMSEVGTAGMYHRQGVSHKDCDSASSFKGIPNTTSKYREDKTVKWHSTPFETRLERALNS  354

Query  409  ESLVS  395
              + +
Sbjct  355  RGVAA  359



>gb|AAD10667.1| Unknown protein [Arabidopsis thaliana]
Length=418

 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -3

Query  601  KTLGDRPILGMVAAHWNENETSRVSPKWWDGNGIPNSTHKYKEDQKVSWHATPFEERLEK  422
            K+  + PI+G V  +W     +          GIPN++ KY+ED+ V+WH+TPFE RLEK
Sbjct  352  KSPDETPIIGTVGGYWGNRSKAIDCGSASSFKGIPNTSSKYREDKSVNWHSTPFEARLEK  411

Query  421  AL  416
            AL
Sbjct  412  AL  413



>gb|KGN46381.1| hypothetical protein Csa_6G088090 [Cucumis sativus]
Length=369

 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 89/185 (48%), Gaps = 28/185 (15%)
 Frame = -3

Query  898  RIRSQYVYSILNPIENASQMKEVInedsessqdsnSKLLFSDMGESVDLSSEANATSEIG  719
            R R+ YV S+LNP+EN SQ   V     +S ++   KL      E+  L  E++      
Sbjct  196  RHRTAYVSSVLNPVENLSQWNAV-----KSKKEFPPKL----QKENAKLEQESSVDGFPY  246

Query  718  LRESSTENNLNVEASLSSWLKPS----LRQSSTQPFGGS---IHHGKTLGDRPILGMVAA  560
              E S E    V+ASLS+WL  S    ++ + T     +   +  G   G   + G   +
Sbjct  247  SSEPSGE--PCVDASLSNWLPSSQATPVKITPTMALEATMTPLKSGTLQGSSSLKGSGHS  304

Query  559  HWNENETSR------VSPKWWDG----NGIPNSTHKYKEDQKVSWHATPFEERLEKALSE  410
              +E  T+       VS K  D      GIPN+T KY+ED+ V WH+TPFE RLE+AL+ 
Sbjct  305  KMSEVGTAGMYHRQGVSHKDCDSASSFKGIPNTTSKYREDKTVKWHSTPFETRLERALNS  364

Query  409  ESLVS  395
              + +
Sbjct  365  RGVAA  369



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5881052329368