BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8310_g1_i2 len=1752 path=[1:0-784 786:785-1751]

Length=1752
                                                                      Score     E

ref|XP_009801437.1|  PREDICTED: protein ABIL1                           437   2e-146   
ref|XP_004229960.1|  PREDICTED: protein ABIL1                           436   6e-146   
ref|XP_009597505.1|  PREDICTED: protein ABIL1                           434   3e-145   
ref|XP_002511938.1|  Protein ABIL1, putative                            432   1e-144   Ricinus communis
ref|XP_006339648.1|  PREDICTED: protein ABIL1-like                      432   1e-144   
ref|XP_011093075.1|  PREDICTED: protein ABIL1-like isoform X1           431   4e-144   
gb|EYU38926.1|  hypothetical protein MIMGU_mgv1a010976mg                428   3e-143   
gb|KDP28544.1|  hypothetical protein JCGZ_14315                         417   2e-138   
ref|XP_003528820.1|  PREDICTED: protein ABIL1-like                      417   2e-138   
ref|XP_008437975.1|  PREDICTED: protein ABIL1                           414   3e-137   
ref|XP_004133838.1|  PREDICTED: protein ABIL1-like                      412   8e-137   
emb|CDP08740.1|  unnamed protein product                                411   1e-136   
ref|XP_002320167.2|  hypothetical protein POPTR_0014s08800g             410   4e-136   Populus trichocarpa [western balsam poplar]
ref|XP_007135156.1|  hypothetical protein PHAVU_010G105800g             410   8e-136   
ref|XP_003548613.1|  PREDICTED: protein ABIL1-like                      409   3e-135   
gb|KHN15983.1|  Protein ABIL1                                           408   5e-135   
ref|XP_008232956.1|  PREDICTED: protein ABIL1                           407   1e-134   
ref|XP_002301384.2|  hypothetical protein POPTR_0002s16750g             406   3e-134   Populus trichocarpa [western balsam poplar]
ref|XP_007051671.1|  ABI-1-like 1 isoform 1                             404   2e-133   
ref|XP_011023256.1|  PREDICTED: protein ABIL1-like isoform X2           402   1e-132   
ref|XP_011037292.1|  PREDICTED: protein ABIL1                           400   3e-132   
ref|XP_004510703.1|  PREDICTED: protein ABIL1-like                      400   4e-132   
ref|XP_004488717.1|  PREDICTED: protein ABIL1-like                      400   5e-132   
ref|XP_006444921.1|  hypothetical protein CICLE_v10021371mg             400   6e-132   
ref|XP_004306717.1|  PREDICTED: protein ABIL1-like                      399   2e-131   
gb|KEH18769.1|  ABIL1-like protein                                      399   2e-131   
ref|XP_010092890.1|  hypothetical protein L484_022485                   398   3e-131   
ref|XP_002279419.1|  PREDICTED: protein ABIL1                           396   1e-130   Vitis vinifera
ref|XP_007218725.1|  hypothetical protein PRUPE_ppa009050mg             395   3e-130   
ref|XP_009338792.1|  PREDICTED: protein ABIL1-like                      394   8e-130   
ref|XP_004155889.1|  PREDICTED: LOW QUALITY PROTEIN: protein ABIL...    394   1e-129   
ref|XP_008375925.1|  PREDICTED: protein ABIL1                           392   3e-129   
emb|CBI40454.3|  unnamed protein product                                391   9e-129   
gb|KCW78125.1|  hypothetical protein EUGRSUZ_D02333                     390   3e-128   
emb|CAN69308.1|  hypothetical protein VITISV_003083                     390   3e-128   Vitis vinifera
ref|XP_011023255.1|  PREDICTED: protein ABIL1-like isoform X1           389   4e-127   
gb|KHG11471.1|  Protein ABIL1 -like protein                             385   3e-126   
ref|XP_009377232.1|  PREDICTED: protein ABIL1-like                      384   6e-126   
ref|XP_010544778.1|  PREDICTED: protein ABIL1                           381   1e-124   
ref|XP_010251587.1|  PREDICTED: protein ABIL1-like isoform X1           372   5e-121   
gb|KFK37420.1|  hypothetical protein AALP_AA4G254700                    371   8e-121   
ref|XP_004494774.1|  PREDICTED: protein ABIL1-like isoform X2           370   2e-120   
ref|XP_011093141.1|  PREDICTED: protein ABIL1-like isoform X1           370   2e-120   
ref|XP_011093148.1|  PREDICTED: protein ABIL1-like isoform X2           369   4e-120   
ref|XP_004491966.1|  PREDICTED: protein ABIL1-like                      368   1e-119   
ref|XP_010669659.1|  PREDICTED: protein ABIL1                           367   3e-119   
ref|XP_004494773.1|  PREDICTED: protein ABIL1-like isoform X1           367   4e-119   
ref|XP_011093158.1|  PREDICTED: protein ABIL1-like isoform X3           365   8e-119   
ref|XP_010251588.1|  PREDICTED: protein ABIL1-like isoform X2           362   2e-117   
ref|XP_006397808.1|  hypothetical protein EUTSA_v10001562mg             362   6e-117   
ref|XP_010518288.1|  PREDICTED: protein ABIL1-like isoform X1           361   7e-117   
ref|XP_010506619.1|  PREDICTED: protein ABIL1 isoform X1                361   8e-117   
ref|XP_010261431.1|  PREDICTED: protein ABIL1 isoform X1                357   4e-115   
ref|XP_009142675.1|  PREDICTED: protein ABIL1                           355   1e-114   
ref|XP_002880226.1|  hypothetical protein ARALYDRAFT_483770             355   2e-114   
emb|CDX79998.1|  BnaA05g01580D                                          353   8e-114   
ref|XP_006294665.1|  hypothetical protein CARUB_v10023702mg             352   2e-113   
ref|NP_566067.1|  protein ABIL1                                         352   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508051.1|  PREDICTED: protein ABIL1-like isoform X1           352   3e-113   
emb|CDY42020.1|  BnaC04g00980D                                          352   3e-113   
dbj|BAC43461.1|  unknown protein                                        350   7e-113   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37419.1|  hypothetical protein AALP_AA4G254700                    350   8e-113   
gb|AFK45593.1|  unknown                                                 350   1e-112   
ref|XP_003554741.1|  PREDICTED: protein ABIL1-like                      347   1e-111   
ref|XP_010261432.1|  PREDICTED: protein ABIL1 isoform X2                347   2e-111   
ref|XP_003626514.1|  Protein ABIL1                                      346   4e-111   
ref|XP_006397807.1|  hypothetical protein EUTSA_v10001562mg             340   5e-109   
ref|XP_010924779.1|  PREDICTED: protein ABIL1-like isoform X1           340   9e-109   
ref|XP_010506621.1|  PREDICTED: protein ABIL1 isoform X2                340   9e-109   
ref|XP_010518289.1|  PREDICTED: protein ABIL1-like isoform X2           340   1e-108   
gb|EYU32190.1|  hypothetical protein MIMGU_mgv1a011425mg                338   2e-108   
ref|NP_001118534.1|  protein ABIL1                                      340   4e-108   Arabidopsis thaliana [mouse-ear cress]
gb|KEH18771.1|  ABIL1-like protein                                      337   9e-108   
ref|XP_011093076.1|  PREDICTED: protein ABIL1-like isoform X2           335   1e-107   
ref|XP_011093164.1|  PREDICTED: protein ABIL1-like isoform X4           335   3e-107   
emb|CDX83376.1|  BnaA03g21300D                                          337   3e-107   
ref|XP_007147254.1|  hypothetical protein PHAVU_006G108900g             335   6e-107   
ref|XP_007051672.1|  ABI-1-like 1 isoform 2                             330   6e-106   
ref|XP_006294664.1|  hypothetical protein CARUB_v10023702mg             332   1e-105   
gb|KCW78126.1|  hypothetical protein EUGRSUZ_D02333                     328   2e-105   
ref|XP_010508052.1|  PREDICTED: protein ABIL1-like isoform X2           331   2e-105   
ref|NP_001189756.1|  protein ABIL1                                      330   4e-105   
emb|CDY68381.1|  BnaC03g72740D                                          331   4e-105   
ref|XP_006577333.1|  PREDICTED: protein ABIL1-like                      330   7e-105   
ref|XP_009133767.1|  PREDICTED: protein ABIL1-like isoform X2           330   7e-105   
ref|XP_003626513.1|  Protein ABIL1                                      330   1e-104   
ref|XP_010053769.1|  PREDICTED: protein ABIL1                           325   3e-104   
ref|XP_008802046.1|  PREDICTED: probable protein ABIL1 isoform X4       327   1e-103   
ref|XP_008792392.1|  PREDICTED: protein ABIL1-like                      325   5e-103   
gb|KEH18770.1|  ABIL1-like protein                                      322   1e-102   
ref|XP_006842582.1|  hypothetical protein AMTR_s00077p00158760          321   4e-101   
ref|XP_010917115.1|  PREDICTED: protein ABIL1-like                      319   2e-100   
gb|KEH18772.1|  ABIL1-like protein                                      314   4e-100   
ref|XP_009133766.1|  PREDICTED: protein ABIL1-like isoform X1           316   7e-99    
ref|XP_008802044.1|  PREDICTED: probable protein ABIL1 isoform X2       310   2e-96    
gb|KHN43134.1|  Protein ABIL1                                           303   6e-95    
ref|XP_010924781.1|  PREDICTED: protein ABIL1-like isoform X2           297   3e-92    
ref|XP_008343407.1|  PREDICTED: protein ABIL1-like                      293   3e-91    
gb|KHN35348.1|  Protein ABIL1                                           285   4e-88    
ref|XP_009394149.1|  PREDICTED: probable protein ABIL1 isoform X1       285   1e-87    
ref|XP_009394150.1|  PREDICTED: probable protein ABIL1 isoform X2       285   2e-87    
ref|XP_003569387.1|  PREDICTED: probable protein ABIL1                  283   1e-86    
ref|XP_011093173.1|  PREDICTED: protein ABIL1-like isoform X5           279   4e-86    
ref|NP_001043613.1|  Os01g0622700                                       281   7e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008802045.1|  PREDICTED: protein ABIL1-like isoform X3           280   2e-85    
gb|EEE55009.1|  hypothetical protein OsJ_02653                          278   6e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392459.1|  PREDICTED: probable protein ABIL1                  275   1e-83    
gb|EMT08867.1|  hypothetical protein F775_26056                         275   1e-83    
ref|XP_006646118.1|  PREDICTED: probable protein ABIL1-like             273   2e-83    
gb|EPS71503.1|  hypothetical protein M569_03258                         268   1e-82    
emb|CDM82654.1|  unnamed protein product                                272   2e-82    
ref|XP_002458183.1|  hypothetical protein SORBIDRAFT_03g028350          268   5e-81    Sorghum bicolor [broomcorn]
ref|XP_009406792.1|  PREDICTED: probable protein ABIL1 isoform X1       268   1e-80    
ref|XP_004969207.1|  PREDICTED: probable protein ABIL1-like             267   1e-80    
ref|XP_009406793.1|  PREDICTED: protein ABIL1-like isoform X2           267   2e-80    
ref|XP_010230991.1|  PREDICTED: probable protein ABIL4 isoform X1       266   3e-80    
gb|EMS54348.1|  hypothetical protein TRIUR3_24588                       265   3e-80    
ref|XP_004961070.1|  PREDICTED: probable protein ABIL4-like             265   1e-79    
ref|XP_003567834.1|  PREDICTED: probable protein ABIL4 isoform X2       264   3e-79    
ref|XP_008802043.1|  PREDICTED: protein ABIL1-like isoform X1           262   4e-78    
ref|XP_009416405.1|  PREDICTED: probable protein ABIL1                  259   4e-78    
ref|XP_006655638.1|  PREDICTED: probable protein ABIL4-like             257   1e-76    
ref|NP_001056454.1|  Os05g0585400                                       256   2e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656080.1|  PREDICTED: probable protein ABIL4                  255   5e-76    
ref|NP_001149311.1|  LOC100282934                                       251   2e-74    Zea mays [maize]
ref|XP_002440340.1|  hypothetical protein SORBIDRAFT_09g029940          248   3e-73    Sorghum bicolor [broomcorn]
tpg|DAA58511.1|  TPA: hypothetical protein ZEAMMB73_369391              249   3e-72    
ref|XP_009410866.1|  PREDICTED: probable protein ABIL1                  245   3e-72    
gb|ACR34577.1|  unknown                                                 248   5e-72    Zea mays [maize]
ref|XP_004488722.1|  PREDICTED: protein ABIL1-like                      231   2e-66    
tpg|DAA58512.1|  TPA: hypothetical protein ZEAMMB73_369391              230   2e-65    
gb|EMT22024.1|  hypothetical protein F775_00995                         216   5e-62    
ref|XP_008369969.1|  PREDICTED: probable protein ABIL1                  196   3e-56    
ref|XP_002981240.1|  hypothetical protein SELMODRAFT_113760             188   7e-53    
ref|XP_002982709.1|  hypothetical protein SELMODRAFT_116820             187   2e-52    
ref|XP_001783354.1|  predicted protein                                  182   2e-50    
gb|EMS46505.1|  hypothetical protein TRIUR3_15295                       184   3e-48    
gb|ACN40612.1|  unknown                                                 171   5e-45    Picea sitchensis
emb|CDY26141.1|  BnaC06g10550D                                          164   2e-43    
emb|CDX86786.1|  BnaA09g21760D                                          163   1e-42    
emb|CBI23020.3|  unnamed protein product                                160   1e-40    
ref|XP_010662870.1|  PREDICTED: protein ABIL2 isoform X2                160   1e-40    
emb|CDY57047.1|  BnaC08g15010D                                          153   2e-40    
ref|XP_010662869.1|  PREDICTED: protein ABIL2 isoform X1                160   2e-40    
ref|XP_010426437.1|  PREDICTED: protein ABIL2                           158   4e-40    
ref|XP_010515274.1|  PREDICTED: protein ABIL2-like                      157   1e-39    
ref|NP_190498.1|  ABL interactor-like protein 2                         157   2e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291525.1|  hypothetical protein CARUB_v10017674mg             156   3e-39    
ref|XP_006288227.1|  hypothetical protein CARUB_v10001467mg             156   3e-39    
ref|NP_974829.1|  ABL interactor-like protein 3                         154   3e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266575.1|  PREDICTED: protein ABIL2 isoform X2                155   4e-39    
ref|XP_002875960.1|  hypothetical protein ARALYDRAFT_485287             155   4e-39    
ref|XP_010266572.1|  PREDICTED: protein ABIL2 isoform X1                155   4e-39    
gb|KHN23356.1|  Protein ABIL2                                           155   5e-39    
ref|XP_010912294.1|  PREDICTED: putative protein ABIL2 isoform X3       155   6e-39    
ref|XP_004307967.1|  PREDICTED: protein ABIL2-like                      155   7e-39    
ref|XP_010912262.1|  PREDICTED: putative protein ABIL2 isoform X1       155   7e-39    
ref|NP_197819.2|  ABL interactor-like protein 3                         155   7e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394685.1|  hypothetical protein EUTSA_v10004602mg             155   7e-39    
ref|XP_002516649.1|  Protein ABIL2, putative                            155   8e-39    Ricinus communis
ref|XP_010493575.1|  PREDICTED: protein ABIL3-like                      155   1e-38    
ref|XP_009623773.1|  PREDICTED: protein ABIL2-like isoform X1           155   1e-38    
dbj|BAB10397.1|  unnamed protein product                                155   1e-38    Arabidopsis thaliana [mouse-ear cress]
gb|EYU25243.1|  hypothetical protein MIMGU_mgv1a009919mg                155   1e-38    
ref|XP_009623775.1|  PREDICTED: protein ABIL2-like isoform X2           154   1e-38    
gb|KDP45550.1|  hypothetical protein JCGZ_18175                         154   1e-38    
ref|XP_010421253.1|  PREDICTED: protein ABIL3 isoform X1                154   1e-38    
ref|XP_010454735.1|  PREDICTED: protein ABIL3-like                      154   1e-38    
ref|XP_010267571.1|  PREDICTED: protein ABIL3-like                      154   1e-38    
ref|XP_011024852.1|  PREDICTED: protein ABIL2                           154   2e-38    
ref|XP_010421254.1|  PREDICTED: protein ABIL3 isoform X2                154   2e-38    
ref|XP_006441129.1|  hypothetical protein CICLE_v10021055mg             151   2e-38    
ref|XP_009784226.1|  PREDICTED: protein ABIL2-like isoform X1           154   2e-38    
ref|XP_011075964.1|  PREDICTED: protein ABIL2-like                      154   2e-38    
emb|CDP05046.1|  unnamed protein product                                154   2e-38    
ref|XP_007136512.1|  hypothetical protein PHAVU_009G051500g             154   2e-38    
ref|XP_009344687.1|  PREDICTED: protein ABIL2-like                      154   3e-38    
ref|XP_009784228.1|  PREDICTED: protein ABIL2-like isoform X2           153   3e-38    
ref|XP_006350530.1|  PREDICTED: protein ABIL3-like isoform X1           154   3e-38    
ref|XP_008376759.1|  PREDICTED: protein ABIL2-like                      153   3e-38    
ref|XP_010318026.1|  PREDICTED: protein ABIL3                           153   3e-38    
ref|XP_007039080.1|  ABL interactor-like protein 2 isoform 1            153   3e-38    
ref|XP_009348527.1|  PREDICTED: protein ABIL2-like isoform X2           153   4e-38    
ref|XP_009348526.1|  PREDICTED: protein ABIL2-like isoform X1           153   4e-38    
ref|XP_010671428.1|  PREDICTED: protein ABIL3                           154   4e-38    
ref|XP_003523358.1|  PREDICTED: protein ABIL2-like isoform X1           153   5e-38    
ref|XP_009351988.1|  PREDICTED: protein ABIL2-like                      153   5e-38    
ref|XP_008381232.1|  PREDICTED: protein ABIL2-like                      153   5e-38    
ref|XP_008810684.1|  PREDICTED: putative protein ABIL2                  152   6e-38    
ref|XP_004169136.1|  PREDICTED: protein ABIL2-like                      152   6e-38    
ref|XP_004146227.1|  PREDICTED: protein ABIL2-like                      152   6e-38    
ref|XP_008466838.1|  PREDICTED: protein ABIL2                           152   7e-38    
ref|XP_006404160.1|  hypothetical protein EUTSA_v10010561mg             152   7e-38    
ref|XP_007218279.1|  hypothetical protein PRUPE_ppa008359mg             152   1e-37    
ref|XP_006441130.1|  hypothetical protein CICLE_v10021055mg             152   1e-37    
ref|XP_008234720.1|  PREDICTED: protein ABIL2                           152   1e-37    
ref|XP_003526721.1|  PREDICTED: protein ABIL2-like isoform X1           152   1e-37    
ref|XP_002872104.1|  hypothetical protein ARALYDRAFT_489290             151   1e-37    
gb|KHN19504.1|  Protein ABIL2                                           151   2e-37    
gb|KGN57659.1|  hypothetical protein Csa_3G238740                       152   2e-37    
ref|XP_003588502.1|  Protein ABIL3                                      151   2e-37    
emb|CDY05919.1|  BnaC08g20960D                                          150   3e-37    
ref|XP_006595602.1|  PREDICTED: uncharacterized protein LOC100808...    150   5e-37    
gb|KEH39727.1|  ABIL1-like protein                                      150   5e-37    
ref|XP_009149749.1|  PREDICTED: protein ABIL2                           149   7e-37    
ref|XP_004498509.1|  PREDICTED: protein ABIL2-like isoform X2           149   8e-37    
ref|XP_010109248.1|  hypothetical protein L484_011870                   148   9e-37    
gb|KCW46573.1|  hypothetical protein EUGRSUZ_K00391                     148   1e-36    
ref|XP_004498510.1|  PREDICTED: protein ABIL2-like isoform X3           148   2e-36    
ref|XP_010035277.1|  PREDICTED: protein ABIL2                           148   2e-36    
ref|XP_006491995.1|  PREDICTED: protein ABIL2-like isoform X1           148   2e-36    
gb|KDO43393.1|  hypothetical protein CISIN_1g038307mg                   148   2e-36    
ref|XP_010915983.1|  PREDICTED: probable protein ABIL3                  148   2e-36    
ref|XP_004498508.1|  PREDICTED: protein ABIL2-like isoform X1           149   2e-36    
gb|KHG04211.1|  Protein ABIL3                                           145   4e-36    
gb|KEH35459.1|  ABIL1-like protein                                      145   5e-36    
ref|XP_008783161.1|  PREDICTED: probable protein ABIL3                  147   5e-36    
ref|XP_002317785.1|  hypothetical protein POPTR_0012s02400g             147   5e-36    Populus trichocarpa [western balsam poplar]
ref|NP_001242020.1|  uncharacterized protein LOC100808485               147   6e-36    
ref|XP_010541486.1|  PREDICTED: protein ABIL3-like                      146   7e-36    
gb|AFK46504.1|  unknown                                                 142   7e-36    
ref|XP_003602276.1|  Protein ABIL2                                      147   8e-36    
ref|XP_004502669.1|  PREDICTED: protein ABIL2-like                      144   7e-35    
ref|XP_009150953.1|  PREDICTED: protein ABIL3 isoform X2                143   1e-34    
ref|XP_010519446.1|  PREDICTED: protein ABIL2-like                      143   1e-34    
ref|XP_002518857.1|  Protein ABIL2, putative                            142   2e-34    Ricinus communis
ref|XP_009150952.1|  PREDICTED: protein ABIL3 isoform X1                142   2e-34    
gb|KHG04210.1|  Protein ABIL3                                           138   2e-34    
gb|KHG10845.1|  Protein ABIL2                                           142   3e-34    
ref|XP_002264080.2|  PREDICTED: protein ABIL2-like isoform X6           141   5e-34    Vitis vinifera
ref|XP_010659662.1|  PREDICTED: protein ABIL2-like isoform X5           141   5e-34    
emb|CDX80429.1|  BnaC07g30150D                                          141   6e-34    
ref|XP_010659665.1|  PREDICTED: protein ABIL2-like isoform X7           141   6e-34    
ref|XP_006852591.1|  hypothetical protein AMTR_s00021p00216340          140   1e-33    
emb|CBI34535.3|  unnamed protein product                                141   1e-33    
ref|XP_010659659.1|  PREDICTED: protein ABIL2-like isoform X4           140   2e-33    
ref|XP_010659654.1|  PREDICTED: protein ABIL2-like isoform X3           140   3e-33    
ref|XP_010659647.1|  PREDICTED: protein ABIL2-like isoform X2           140   3e-33    
ref|XP_010659643.1|  PREDICTED: protein ABIL2-like isoform X1           140   3e-33    
ref|XP_011022465.1|  PREDICTED: protein ABIL2-like                      137   7e-33    
gb|KDP25264.1|  hypothetical protein JCGZ_20420                         137   8e-33    
ref|XP_002299451.2|  hypothetical protein POPTR_0001s10950g             137   9e-33    Populus trichocarpa [western balsam poplar]
gb|AAZ74718.1|  At5g24310                                               130   2e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010107272.1|  hypothetical protein L484_007833                   135   2e-32    
ref|XP_009420789.1|  PREDICTED: putative protein ABIL2 isoform X3       136   2e-32    
ref|XP_009420773.1|  PREDICTED: putative protein ABIL2 isoform X1       137   3e-32    
gb|AAZ74719.1|  At5g24310                                               129   4e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420781.1|  PREDICTED: putative protein ABIL2 isoform X2       136   5e-32    
ref|XP_001767060.1|  predicted protein                                  129   1e-31    
ref|XP_008802047.1|  PREDICTED: protein ABIL1-like isoform X5           133   1e-31    
ref|XP_004968939.1|  PREDICTED: putative protein ABIL2-like isofo...    132   7e-31    
ref|XP_004968938.1|  PREDICTED: putative protein ABIL2-like isofo...    132   7e-31    
gb|KHG02930.1|  Protein ABIL2 -like protein                             132   8e-31    
ref|XP_002457993.1|  hypothetical protein SORBIDRAFT_03g025120          131   1e-30    Sorghum bicolor [broomcorn]
ref|XP_002303669.1|  hypothetical protein POPTR_0003s14280g             130   2e-30    Populus trichocarpa [western balsam poplar]
ref|XP_009629171.1|  PREDICTED: protein ABIL2-like isoform X2           131   2e-30    
emb|CDP12188.1|  unnamed protein product                                131   2e-30    
ref|XP_009629169.1|  PREDICTED: protein ABIL2-like isoform X1           131   2e-30    
ref|NP_001150525.1|  protein ABIL1                                      130   3e-30    Zea mays [maize]
ref|XP_011026838.1|  PREDICTED: protein ABIL2-like                      129   5e-30    
ref|XP_010325349.1|  PREDICTED: protein ABIL2-like isoform X2           129   6e-30    
gb|KCW72551.1|  hypothetical protein EUGRSUZ_E01020                     129   8e-30    
ref|XP_010055979.1|  PREDICTED: protein ABIL3-like isoform X3           129   1e-29    
ref|XP_009803885.1|  PREDICTED: protein ABIL2-like                      129   1e-29    
ref|XP_004245491.1|  PREDICTED: protein ABIL2-like isoform X1           129   1e-29    
gb|EMT19497.1|  hypothetical protein F775_01027                         129   2e-29    
ref|XP_010055978.1|  PREDICTED: protein ABIL2-like isoform X2           129   2e-29    
ref|XP_006343822.1|  PREDICTED: protein ABIL2-like                      129   2e-29    
ref|XP_006476345.1|  PREDICTED: protein ABIL2-like                      128   2e-29    
ref|XP_010055977.1|  PREDICTED: protein ABIL2-like isoform X1           129   2e-29    
ref|XP_010055743.1|  PREDICTED: protein ABIL2-like isoform X4           127   3e-29    
sp|Q5JKN2.1|ABIL2_ORYSJ  RecName: Full=Putative protein ABIL2; Al...    127   3e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008239164.1|  PREDICTED: protein ABIL2-like                      127   3e-29    
gb|KCW72267.1|  hypothetical protein EUGRSUZ_E00723                     127   4e-29    
ref|XP_006645995.1|  PREDICTED: putative protein ABIL2-like             124   5e-29    
ref|XP_008392261.1|  PREDICTED: protein ABIL2-like isoform X2           127   5e-29    
gb|EAZ12300.1|  hypothetical protein OsJ_02192                          127   5e-29    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010055740.1|  PREDICTED: protein ABIL2-like isoform X1           127   6e-29    
ref|XP_009419651.1|  PREDICTED: probable protein ABIL3 isoform X2       127   6e-29    
ref|XP_009419650.1|  PREDICTED: probable protein ABIL3 isoform X1       127   6e-29    
ref|XP_010231912.1|  PREDICTED: putative protein ABIL2 isoform X1       126   9e-29    
ref|XP_010231913.1|  PREDICTED: putative protein ABIL2 isoform X2       126   1e-28    
ref|XP_004300497.1|  PREDICTED: protein ABIL2-like                      125   1e-28    
ref|XP_009420797.1|  PREDICTED: putative protein ABIL2 isoform X4       126   1e-28    
ref|XP_010055742.1|  PREDICTED: protein ABIL3-like isoform X3           125   1e-28    
gb|EMT12714.1|  hypothetical protein F775_26273                         125   1e-28    
ref|XP_010055741.1|  PREDICTED: protein ABIL2-like isoform X2           125   2e-28    
ref|XP_011070348.1|  PREDICTED: protein ABIL2-like isoform X2           124   2e-28    
ref|XP_011070345.1|  PREDICTED: protein ABIL2-like isoform X1           124   3e-28    
gb|EAY74497.1|  hypothetical protein OsI_02389                          124   4e-28    
ref|XP_008392259.1|  PREDICTED: protein ABIL2-like isoform X1           124   4e-28    
ref|XP_007040588.1|  ABL interactor-like protein 2, putative            125   5e-28    
tpg|DAA59035.1|  TPA: hypothetical protein ZEAMMB73_813280              119   5e-28    
gb|KCW72548.1|  hypothetical protein EUGRSUZ_E01014                     120   3e-27    
ref|XP_009409710.1|  PREDICTED: protein ABIL2-like                      118   4e-27    
ref|XP_010545092.1|  PREDICTED: protein ABIL4 isoform X5                121   4e-27    
gb|KCW72447.1|  hypothetical protein EUGRSUZ_E00893                     119   5e-27    
ref|XP_010545054.1|  PREDICTED: protein ABIL4 isoform X1                121   5e-27    
ref|XP_010545073.1|  PREDICTED: protein ABIL4 isoform X2                120   6e-27    
ref|NP_199018.1|  ABL interactor-like protein 4                         120   7e-27    
ref|XP_010447029.1|  PREDICTED: protein ABIL4                           120   9e-27    
ref|XP_010545079.1|  PREDICTED: protein ABIL4 isoform X3                120   1e-26    
gb|KCW72460.1|  hypothetical protein EUGRSUZ_E00910                     119   1e-26    
gb|EYU45257.1|  hypothetical protein MIMGU_mgv1a012015mg                119   1e-26    
gb|AAM67279.1|  unknown                                                 119   1e-26    
ref|XP_010545086.1|  PREDICTED: protein ABIL4 isoform X4                120   1e-26    
ref|XP_002868565.1|  hypothetical protein ARALYDRAFT_493780             119   1e-26    
ref|XP_010058329.1|  PREDICTED: protein ABIL2-like                      120   2e-26    
ref|XP_006643968.1|  PREDICTED: probable protein ABIL3-like             119   2e-26    
gb|KCW72483.1|  hypothetical protein EUGRSUZ_E00938                     117   3e-26    
ref|XP_006285711.1|  hypothetical protein CARUB_v10007182mg             119   4e-26    
ref|XP_002457050.1|  hypothetical protein SORBIDRAFT_03g000510          118   5e-26    
gb|KCW72452.1|  hypothetical protein EUGRSUZ_E00897                     117   6e-26    
ref|XP_010055756.1|  PREDICTED: protein ABIL3-like isoform X3           118   7e-26    
ref|XP_010055757.1|  PREDICTED: protein ABIL3-like isoform X4           117   8e-26    
ref|XP_010055759.1|  PREDICTED: protein ABIL3-like isoform X6           117   8e-26    
ref|XP_009413808.1|  PREDICTED: probable protein ABIL3                  117   8e-26    
ref|XP_010055758.1|  PREDICTED: protein ABIL3-like isoform X5           117   9e-26    
gb|EEC70261.1|  hypothetical protein OsI_01066                          118   9e-26    
ref|NP_001042529.2|  Os01g0236400                                       117   9e-26    
ref|XP_010436162.1|  PREDICTED: protein ABIL4-like                      117   1e-25    
ref|XP_010055755.1|  PREDICTED: uncharacterized protein LOC104443...    117   1e-25    
ref|XP_010055753.1|  PREDICTED: protein ABIL2-like isoform X1           117   2e-25    
gb|EMS58659.1|  hypothetical protein TRIUR3_01529                       117   2e-25    
ref|XP_010058335.1|  PREDICTED: protein ABIL2-like                      117   2e-25    
gb|KCW72494.1|  hypothetical protein EUGRSUZ_E00955                     114   2e-25    
gb|KCW72295.1|  hypothetical protein EUGRSUZ_E00761                     114   3e-25    
gb|KCW72286.1|  hypothetical protein EUGRSUZ_E00746                     115   3e-25    
ref|XP_009140142.1|  PREDICTED: protein ABIL4-like isoform X4           115   3e-25    
ref|XP_009140141.1|  PREDICTED: protein ABIL4-like isoform X3           115   4e-25    
ref|XP_009140140.1|  PREDICTED: protein ABIL4-like isoform X2           115   4e-25    
ref|XP_009140139.1|  PREDICTED: protein ABIL4-like isoform X1           115   5e-25    
ref|XP_004967360.1|  PREDICTED: probable protein ABIL3-like             115   6e-25    
dbj|BAJ99926.1|  predicted protein                                      116   9e-25    
ref|XP_010230669.1|  PREDICTED: probable protein ABIL3                  115   1e-24    
ref|NP_001148582.1|  protein ABIL1                                      114   1e-24    
gb|ACF86655.1|  unknown                                                 114   1e-24    
tpg|DAA52710.1|  TPA: hypothetical protein ZEAMMB73_198209              110   2e-24    
ref|XP_010254080.1|  PREDICTED: probable protein ABIL5                  112   3e-24    
ref|XP_006405281.1|  hypothetical protein EUTSA_v10027878mg             113   3e-24    
dbj|BAJ91626.1|  predicted protein                                      114   3e-24    
emb|CDY69736.1|  BnaCnng65090D                                          112   3e-24    
gb|KCW72499.1|  hypothetical protein EUGRSUZ_E00962                     110   5e-24    
ref|XP_011081455.1|  PREDICTED: protein ABIL4-like                      112   8e-24    
gb|EPS61815.1|  hypothetical protein M569_12976                         107   8e-24    
ref|XP_010058324.1|  PREDICTED: protein ABIL2-like                      109   1e-23    
gb|KCW72490.1|  hypothetical protein EUGRSUZ_E00951                     109   1e-23    
ref|XP_009400658.1|  PREDICTED: protein ABIL2-like                      108   1e-23    
ref|XP_010058344.1|  PREDICTED: protein ABIL2-like                      107   3e-23    
emb|CDX67526.1|  BnaA07g15660D                                          109   5e-23    
ref|XP_009406228.1|  PREDICTED: probable protein ABIL5 isoform X1       108   7e-23    
gb|KHG10844.1|  Protein ABIL2                                           108   8e-23    
ref|XP_009406230.1|  PREDICTED: probable protein ABIL5 isoform X3       107   9e-23    
gb|KHG20322.1|  hypothetical protein F383_09130                         107   1e-22    
ref|XP_007013135.1|  ABI-1-like 1, putative isoform 1                   107   2e-22    
ref|XP_009125215.1|  PREDICTED: protein ABIL4-like                      108   2e-22    
gb|KFK32975.1|  hypothetical protein AALP_AA6G313500                    107   2e-22    
gb|KFK32976.1|  hypothetical protein AALP_AA6G313500                    107   2e-22    
ref|XP_009374038.1|  PREDICTED: probable protein ABIL5                  107   2e-22    
ref|XP_008242670.1|  PREDICTED: probable protein ABIL5                  107   2e-22    
ref|XP_007202421.1|  hypothetical protein PRUPE_ppa009726mg             107   4e-22    
gb|KDP33690.1|  hypothetical protein JCGZ_07261                         106   4e-22    
ref|XP_011043497.1|  PREDICTED: probable protein ABIL5 isoform X2       105   6e-22    
ref|XP_011043498.1|  PREDICTED: probable protein ABIL5 isoform X3       105   6e-22    
ref|XP_008802049.1|  PREDICTED: protein ABIL1-like isoform X6           105   6e-22    
ref|XP_003620605.1|  Protein ABIL1                                      105   6e-22    
ref|XP_011043496.1|  PREDICTED: probable protein ABIL5 isoform X1       105   7e-22    
ref|XP_009406229.1|  PREDICTED: probable protein ABIL5 isoform X2       105   1e-21    
ref|XP_008462689.1|  PREDICTED: probable protein ABIL5 isoform X2       105   1e-21    
ref|XP_010249692.1|  PREDICTED: probable protein ABIL5 isoform X3       103   1e-21    
ref|XP_008462688.1|  PREDICTED: probable protein ABIL5 isoform X1       105   1e-21    
ref|XP_006439297.1|  hypothetical protein CICLE_v10021975mg             104   1e-21    
ref|XP_009371444.1|  PREDICTED: probable protein ABIL5                  104   2e-21    
ref|XP_004162800.1|  PREDICTED: probable protein ABIL5-like             103   2e-21    
ref|XP_008337372.1|  PREDICTED: probable protein ABIL5                  104   2e-21    
ref|NP_001241017.1|  uncharacterized protein LOC100798609               103   3e-21    
ref|XP_010249690.1|  PREDICTED: probable protein ABIL5 isoform X1       103   3e-21    
ref|XP_004150382.1|  PREDICTED: probable protein ABIL5-like             103   3e-21    
emb|CDY13370.1|  BnaC06g13870D                                          103   3e-21    
ref|XP_010047900.1|  PREDICTED: probable protein ABIL5                  103   3e-21    
gb|KHN45634.1|  Hypothetical protein glysoja_031505                     103   4e-21    
ref|XP_010249691.1|  PREDICTED: probable protein ABIL5 isoform X2       102   5e-21    
ref|XP_008462690.1|  PREDICTED: probable protein ABIL5 isoform X3       103   5e-21    
ref|XP_004287396.1|  PREDICTED: probable protein ABIL5-like             102   6e-21    
ref|XP_007013136.1|  ABI-1-like 1, putative isoform 2                   102   7e-21    
ref|XP_002284308.1|  PREDICTED: probable protein ABIL5                  101   3e-20    
ref|XP_008793051.1|  PREDICTED: probable protein ABIL5 isoform X1       101   4e-20    
emb|CBI28051.3|  unnamed protein product                                100   4e-20    
ref|XP_003528929.1|  PREDICTED: probable protein ABIL5-like             100   4e-20    
ref|XP_007013137.1|  ABI-1-like 1, putative isoform 3                   100   4e-20    
ref|XP_007152847.1|  hypothetical protein PHAVU_004G164900g             100   5e-20    
ref|XP_010920435.1|  PREDICTED: probable protein ABIL5                  100   5e-20    
ref|XP_010058112.1|  PREDICTED: uncharacterized protein LOC104445868    100   6e-20    
ref|XP_009416729.1|  PREDICTED: probable protein ABIL5                99.8    7e-20    
ref|XP_002324998.2|  hypothetical protein POPTR_0018s08920g           99.8    7e-20    
ref|XP_010688230.1|  PREDICTED: probable protein ABIL5 isoform X1     99.4    1e-19    
ref|XP_006451185.1|  hypothetical protein CICLE_v10009168mg           99.4    1e-19    
ref|XP_010912302.1|  PREDICTED: putative protein ABIL2 isoform X4     99.8    2e-19    
ref|XP_010912285.1|  PREDICTED: putative protein ABIL2 isoform X2     99.8    2e-19    
gb|ABS87386.1|  ABIL3-like protein                                    99.0    2e-19    
gb|KDO48874.1|  hypothetical protein CISIN_1g024146mg                 97.8    2e-19    
ref|XP_010924589.1|  PREDICTED: probable protein ABIL5                98.2    4e-19    
ref|XP_004512986.1|  PREDICTED: probable protein ABIL5-like           97.4    4e-19    
ref|XP_003525272.1|  PREDICTED: probable protein ABIL5-like           97.4    4e-19    
ref|XP_002514282.1|  conserved hypothetical protein                   97.4    5e-19    
ref|XP_010055770.1|  PREDICTED: protein ABIL3-like isoform X2         92.8    1e-18    
gb|KCW79917.1|  hypothetical protein EUGRSUZ_C01259                   96.3    1e-18    
ref|XP_010055745.1|  PREDICTED: protein ABIL3-like                    93.6    1e-18    
ref|XP_003530545.2|  PREDICTED: probable protein ABIL5-like           94.4    4e-18    
ref|XP_004252057.2|  PREDICTED: probable protein ABIL5                93.6    8e-18    
ref|XP_004970039.1|  PREDICTED: probable protein ABIL5-like           93.2    1e-17    
ref|XP_006353464.1|  PREDICTED: protein ABIL2-like                    93.2    1e-17    
ref|XP_010445754.1|  PREDICTED: protein ABIL4-like                    90.1    1e-17    
ref|XP_009803579.1|  PREDICTED: probable protein ABIL5 isoform X2     92.4    2e-17    
gb|KDO76610.1|  hypothetical protein CISIN_1g045801mg                 92.4    2e-17    
ref|XP_009803578.1|  PREDICTED: probable protein ABIL5 isoform X1     92.0    3e-17    
ref|XP_006644744.1|  PREDICTED: probable protein ABIL5-like           91.7    4e-17    
ref|XP_002458527.1|  hypothetical protein SORBIDRAFT_03g035230        92.0    6e-17    
gb|EMS49799.1|  hypothetical protein TRIUR3_14475                     89.4    9e-17    
gb|EPS71015.1|  hypothetical protein M569_03744                       90.1    1e-16    
ref|XP_010089225.1|  hypothetical protein L484_002500                 93.6    2e-16    
emb|CDY61083.1|  BnaC06g41120D                                        87.0    4e-16    
gb|AFW85013.1|  hypothetical protein ZEAMMB73_307874                  88.2    6e-16    
gb|EMS66396.1|  hypothetical protein TRIUR3_28294                     86.3    1e-15    
ref|NP_001044319.1|  Os01g0760900                                     87.0    1e-15    
emb|CDX99519.1|  BnaC09g24730D                                        85.9    2e-15    
ref|XP_003569864.1|  PREDICTED: probable protein ABIL5                86.7    2e-15    
dbj|BAK06995.1|  predicted protein                                    86.3    2e-15    
emb|CDY39460.1|  BnaC03g60700D                                        84.3    3e-15    
emb|CDY32903.1|  BnaC02g11870D                                        84.0    5e-15    
gb|EMT25191.1|  hypothetical protein F775_06300                       85.9    5e-15    
emb|CDM84273.1|  unnamed protein product                              85.5    5e-15    
gb|EYU32935.1|  hypothetical protein MIMGU_mgv1a012340mg              84.7    8e-15    
gb|EEE55412.1|  hypothetical protein OsJ_03532                        82.0    5e-14    
gb|EEC71522.1|  hypothetical protein OsI_03823                        81.6    6e-14    
emb|CDX79218.1|  BnaC06g20850D                                        78.2    1e-13    
ref|XP_007160329.1|  hypothetical protein PHAVU_002G312400g           80.5    2e-13    
emb|CDP03315.1|  unnamed protein product                              80.1    2e-13    
gb|EMS51646.1|  hypothetical protein TRIUR3_35335                     79.7    3e-13    
emb|CDY00780.1|  BnaC03g37640D                                        78.2    1e-12    
ref|XP_006833331.1|  hypothetical protein AMTR_s00109p00075250        77.0    1e-12    
ref|XP_011078310.1|  PREDICTED: probable protein ABIL5 isoform X1     77.0    3e-12    
ref|XP_011078311.1|  PREDICTED: probable protein ABIL5 isoform X2     76.6    3e-12    
gb|ACF82248.1|  unknown                                               74.7    6e-12    
ref|NP_001144157.1|  uncharacterized protein LOC100277011             74.3    6e-12    
ref|XP_011093598.1|  PREDICTED: protein ABIL4-like                    75.5    7e-12    
ref|XP_008789392.1|  PREDICTED: probable protein ABIL5                73.2    1e-11    
gb|EPS63873.1|  hypothetical protein M569_10913                       75.9    2e-11    
ref|XP_010053768.1|  PREDICTED: protein ABIL1-like                    69.7    1e-10    
dbj|BAB61213.1|  P0460E08.23                                          66.6    3e-09    
ref|XP_006405280.1|  hypothetical protein EUTSA_v10027878mg           66.6    5e-09    
ref|XP_008793052.1|  PREDICTED: probable protein ABIL5 isoform X2     66.2    8e-09    
ref|XP_006372056.1|  hypothetical protein POPTR_0018s08920g           62.0    1e-07    
ref|XP_002447284.1|  hypothetical protein SORBIDRAFT_06g032025        57.4    1e-06    
ref|XP_006441118.1|  hypothetical protein CICLE_v10023724mg           57.4    2e-06    
ref|XP_007211203.1|  hypothetical protein PRUPE_ppa009754mg           59.7    2e-06    
gb|EMS47129.1|  Zinc finger protein 2                                 57.4    4e-06    
gb|KGN65140.1|  hypothetical protein Csa_1G240080                     57.0    5e-06    
ref|XP_010519709.1|  PREDICTED: probable protein ABIL5 isoform X2     55.1    3e-05    
ref|XP_010519707.1|  PREDICTED: probable protein ABIL5 isoform X1     54.3    6e-05    
ref|XP_010519710.1|  PREDICTED: probable protein ABIL5 isoform X3     53.9    6e-05    
gb|KFM69380.1|  Abl interactor 1                                      55.1    1e-04    
ref|XP_009610592.1|  PREDICTED: probable protein ABIL5 isoform X1     53.1    1e-04    
ref|XP_009610593.1|  PREDICTED: probable protein ABIL5 isoform X2     53.1    1e-04    
ref|XP_001946649.1|  PREDICTED: abl interactor 2                      54.3    3e-04    
ref|XP_004924030.1|  PREDICTED: abl interactor 2-like                 53.5    3e-04    
ref|XP_010688231.1|  PREDICTED: uncharacterized protein LOC104902...  52.0    4e-04    
ref|XP_006003329.1|  PREDICTED: abl interactor 1-like                 51.6    5e-04    
gb|EHJ65693.1|  hypothetical protein KGM_16362                        50.8    7e-04    



>ref|XP_009801437.1| PREDICTED: protein ABIL1 [Nicotiana sylvestris]
Length=305

 Score =   437 bits (1124),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/304 (71%), Positives = 246/304 (81%), Gaps = 6/304 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVEQ K     AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYL +EQKQM
Sbjct  1     MEVEQLKLENTPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLQNEQKQM  60

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYA+RALVNAVDHLGTVAYKLTDLV QQ LDV++MELK+TC++Q+LLTC+ YTE
Sbjct  61    VLDNLKDYAIRALVNAVDHLGTVAYKLTDLVEQQTLDVTSMELKVTCLDQRLLTCKTYTE  120

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQQQLLAIIPRHHKHY LPNS  KKVHFSP +++D RQH Q+R RL+PSG  AAKT
Sbjct  121   KEGLRQQQLLAIIPRHHKHYILPNSAGKKVHFSPQVKVDSRQHSQARPRLYPSGTPAAKT  180

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV  1075
             LSWHLA+ET STLKG S  F+S ++ K S + S AFNLLD  E   R K+  A  + P+V
Sbjct  181   LSWHLATETKSTLKGTSRTFMSPEEAKGSEKASAAFNLLD--EENTRKKSYAARPQSPNV  238

Query  1076  GPGSSIATHTLGVMRDA-LDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
             GP SS+A  TLGV R   L+GSKP+TPYRSFDN   PRR+      RS+SMLSAFFVK K
Sbjct  239   GPASSLAMQTLGVTRQGTLEGSKPLTPYRSFDN---PRRDIIRAHNRSRSMLSAFFVKHK  295

Query  1253  TPKV  1264
             TPK+
Sbjct  296   TPKL  299



>ref|XP_004229960.1| PREDICTED: protein ABIL1 [Solanum lycopersicum]
Length=305

 Score =   436 bits (1121),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 218/304 (72%), Positives = 247/304 (81%), Gaps = 6/304 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVEQ K   + AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYL +EQKQM
Sbjct  1     MEVEQLKFGNSPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLQNEQKQM  60

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDV+T+ELK+TC++Q+LLTC+ YTE
Sbjct  61    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLDVTTLELKVTCLDQRLLTCKTYTE  120

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQQQLLAIIPRHHKHY LPNS  KKVHFSP ++MD RQH+Q+R RL+PSG  AAKT
Sbjct  121   KEGLRQQQLLAIIPRHHKHYILPNSAGKKVHFSPQVKMDSRQHLQARPRLYPSGTPAAKT  180

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV  1075
             LSWHLA+ET STLKG S  F+S ++ K S + S AFNLLD  E   R K+  A    P+V
Sbjct  181   LSWHLATETKSTLKGNSRTFMSPEEAKVSEKASAAFNLLD--EENTRKKSYVARPPSPNV  238

Query  1076  GPGSSIATHTLGVMRDA-LDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
             GP SS+A  TLGV R   L+GSKP+TP+RSFDN   PRR+    P RSKSMLSAFFVK K
Sbjct  239   GPASSLAMQTLGVTRQGTLEGSKPLTPFRSFDN---PRRDIIRAPNRSKSMLSAFFVKHK  295

Query  1253  TPKV  1264
             T K+
Sbjct  296   TTKL  299



>ref|XP_009597505.1| PREDICTED: protein ABIL1 [Nicotiana tomentosiformis]
Length=305

 Score =   434 bits (1116),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 216/304 (71%), Positives = 246/304 (81%), Gaps = 6/304 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVEQ K   + AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYL +EQKQM
Sbjct  1     MEVEQLKLQNSPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLQNEQKQM  60

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDV++MELK+TC++Q+LLTC+ YT+
Sbjct  61    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLDVTSMELKVTCLDQRLLTCKTYTK  120

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQQQLLAIIPRHHKHY LPNS  KKVHFSP ++MD RQH Q+R RL+PSG  AAKT
Sbjct  121   KEGLRQQQLLAIIPRHHKHYILPNSAGKKVHFSPQVKMDSRQHSQARPRLYPSGTPAAKT  180

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV  1075
             LSWHLA+ET STLKG S  F+S ++ K S + S AFNLLD  E   R K+  A  + P+V
Sbjct  181   LSWHLATETKSTLKGTSRTFMSPEEAKGSEKASAAFNLLD--EENTRKKSYAARPQSPNV  238

Query  1076  GPGSSIATHTLGVMRDA-LDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
             GP S++A  TLGV R   L+GSKP+TPYRSFDN   PRRE      RS+SMLSAFFVK K
Sbjct  239   GPASNLAMQTLGVTRQGTLEGSKPLTPYRSFDN---PRREIIRAHNRSRSMLSAFFVKHK  295

Query  1253  TPKV  1264
             T K+
Sbjct  296   TSKL  299



>ref|XP_002511938.1| Protein ABIL1, putative [Ricinus communis]
 gb|EEF50607.1| Protein ABIL1, putative [Ricinus communis]
Length=307

 Score =   432 bits (1112),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 221/303 (73%), Positives = 241/303 (80%), Gaps = 7/303 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+EQ KP  N  MT+DEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MEMEQSKPE-NPHMTYDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDVSTMELK++CINQQLLTCQ YT 
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLIEQQTLDVSTMELKVSCINQQLLTCQTYTH  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ D RQ   Q+R RL PSG  A+K
Sbjct  120   KEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQTDARQIPFQARSRLQPSGSPASK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG S    SA+D K SG++S  F L D  E G +T++S A+++  S
Sbjct  180   TLSWHLASETKSTLKGTSHALTSAEDTKHSGKSSAVFQLFD-KEDGTQTRSSGAFTQLSS  238

Query  1073  VGPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
               P S     T GV  R+ALD SKP+T +RSFDN   PRRE    P RSKSMLSAFFVK 
Sbjct  239   GAPASGAIMQTFGVARREALDSSKPLTAFRSFDN---PRREIVRAPARSKSMLSAFFVKH  295

Query  1250  KTP  1258
             KTP
Sbjct  296   KTP  298



>ref|XP_006339648.1| PREDICTED: protein ABIL1-like [Solanum tuberosum]
Length=305

 Score =   432 bits (1111),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 216/304 (71%), Positives = 245/304 (81%), Gaps = 6/304 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVE  K   + AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYL +EQKQM
Sbjct  1     MEVEHLKLGNSPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLQNEQKQM  60

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDV+ MELK+TC++Q+LLTC+ YTE
Sbjct  61    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLDVTAMELKVTCLDQRLLTCKTYTE  120

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQQQLLAIIPRHHKHY LPNS  KKVHFSP ++MD RQH+Q+R RL+PSG  AAKT
Sbjct  121   KEGLRQQQLLAIIPRHHKHYILPNSAGKKVHFSPQVKMDSRQHLQARPRLYPSGTPAAKT  180

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV  1075
             LSWHLA+ET STLKG S  F+S ++ K S + S AFNLLD  E   R K+  A    P+V
Sbjct  181   LSWHLATETKSTLKGNSRTFMSPEEAKVSEKASAAFNLLD--EENTRKKSYVARPPSPNV  238

Query  1076  GPGSSIATHTLGVMRDA-LDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
             GP SS+A  TLGV R   L+GSKP+TP+RSFDN   PRR+    P RS+SMLSAFFVK K
Sbjct  239   GPASSLAMQTLGVTRQGTLEGSKPLTPFRSFDN---PRRDIIRAPNRSRSMLSAFFVKHK  295

Query  1253  TPKV  1264
             T K+
Sbjct  296   TTKL  299



>ref|XP_011093075.1| PREDICTED: protein ABIL1-like isoform X1 [Sesamum indicum]
Length=294

 Score =   431 bits (1107),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 217/304 (71%), Positives = 250/304 (82%), Gaps = 15/304 (5%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVE+ +   N +MTFDEVSMERSKSFV ALQELKNLRPQLYSAAEYCEKSYL+SEQKQM
Sbjct  1     MEVEKGRRE-NRSMTFDEVSMERSKSFVSALQELKNLRPQLYSAAEYCEKSYLNSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNA+DHLGTVAYKLTD++ QQ LD+S+M+LK+TC+NQQLLTCQ YT+
Sbjct  60    VLDNLKDYAVRALVNAIDHLGTVAYKLTDILEQQTLDISSMDLKVTCLNQQLLTCQTYTD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQQQ+LAIIP+HHKHY LPN+VNKKVHFSPHIQ D RQ IQ+RGRL+PSG +AAKT
Sbjct  120   KEGLRQQQVLAIIPKHHKHYLLPNNVNKKVHFSPHIQTDPRQPIQARGRLYPSGASAAKT  179

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV  1075
             LSWHLASET STLKG+S G +S +D KS G+T GAFNLLD  E   + K+ PA       
Sbjct  180   LSWHLASETKSTLKGSSRGILSTEDSKSHGKTPGAFNLLDLEE-NTQMKSIPA-------  231

Query  1076  GPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
                SS+A  TLGV  RD+ DG +P+TP+RSFDNP    RE    P RSKS+LSAFFVKQK
Sbjct  232   ---SSVAMQTLGVTRRDSSDGLRPLTPHRSFDNP--TLREIVRPPVRSKSVLSAFFVKQK  286

Query  1253  TPKV  1264
             TPK+
Sbjct  287   TPKL  290



>gb|EYU38926.1| hypothetical protein MIMGU_mgv1a010976mg [Erythranthe guttata]
Length=295

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/305 (71%), Positives = 248/305 (81%), Gaps = 16/305 (5%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVE+ +   N +  FDEVSMERSK+FV ALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MEVEKARTA-NRSTRFDEVSMERSKNFVTALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNA+DHLGTVAYKL+D++ QQ LD+S++ELK+TC+NQQLLTCQ YTE
Sbjct  60    VLDNLKDYAVRALVNAIDHLGTVAYKLSDILEQQTLDISSVELKVTCLNQQLLTCQTYTE  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQQQLLAIIP+HHKHY LPNSVNKKVHFSP IQ D RQ IQ+R RLFPSG +AAKT
Sbjct  120   KEGLRQQQLLAIIPKHHKHYILPNSVNKKVHFSPLIQTDPRQTIQARSRLFPSGASAAKT  179

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSS-GRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             LSWHLASET STLKG+  G +S +D K+  G++SGAFNLLD  E   R K++PA      
Sbjct  180   LSWHLASETKSTLKGSPRGIISTEDSKTMYGKSSGAFNLLDVEE-NARMKSAPA------  232

Query  1073  VGPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
                 SS+A  TLGV  R++ +GSKPMTPYRSFDNP   +RE    P RSKSMLSAFFVKQ
Sbjct  233   ----SSVAMQTLGVARRESSEGSKPMTPYRSFDNP--GQREIIRPPVRSKSMLSAFFVKQ  286

Query  1250  KTPKV  1264
             KT K+
Sbjct  287   KTQKL  291



>gb|KDP28544.1| hypothetical protein JCGZ_14315 [Jatropha curcas]
Length=306

 Score =   417 bits (1071),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/305 (69%), Positives = 241/305 (79%), Gaps = 7/305 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME++QP+     AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MEMDQPRLE-TPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ +DVSTMELK++C+NQQLLTCQ YT 
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTVDVSTMELKVSCMNQQLLTCQTYTV  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IPRHHKHY LPN+VNKKV FSPHIQ D RQ+  Q+R RL PSG  A+K
Sbjct  120   KEGLRQQQLLAFIPRHHKHYILPNAVNKKVQFSPHIQTDARQNPFQARSRLQPSGSPASK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG S      +D K+SG ++ AF LLD  E   R ++S A ++  S
Sbjct  180   TLSWHLASETKSTLKGTSNALTGTEDTKTSGISAAAFQLLDKEE-STRMRSSGALAQLSS  238

Query  1073  VGPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
               P S +   TLGV  R+ L+ SKP+T +RSF+N   P+RE    P RSKS+LS+FFVKQ
Sbjct  239   GSPASGVVMQTLGVTRREPLESSKPLTAFRSFEN---PKREMVRAPARSKSVLSSFFVKQ  295

Query  1250  KTPKV  1264
             KT K+
Sbjct  296   KTAKL  300



>ref|XP_003528820.1| PREDICTED: protein ABIL1-like [Glycine max]
 gb|KHN24590.1| Protein ABIL1 [Glycine soja]
Length=311

 Score =   417 bits (1071),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 222/308 (72%), Positives = 242/308 (79%), Gaps = 8/308 (3%)
 Frame = +2

Query  356   MEVEQPKPPP-NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  532
             ME E P   P NSAMT+DE SMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQKQ
Sbjct  1     MEFEHPTATPLNSAMTYDEASMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  60

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDVSTM+LK+  INQ+LLTCQ YT
Sbjct  61    MVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLDVSTMDLKVATINQKLLTCQIYT  120

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAA  889
             +KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ+D RQ+  Q+R R   SG  AA
Sbjct  121   DKEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQIDARQNPFQTRTRFQSSGTPAA  180

Query  890   KTLSWHLASETTSTLKGASCGFVS--ADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSK  1063
             KTLSWHLASET STLKG+S    S   ++ K SG+ SG F+LLD  E     K+SPA   
Sbjct  181   KTLSWHLASETKSTLKGSSHASPSPNIENPKFSGKASGVFHLLDNEE-NTWMKSSPAQIH  239

Query  1064  PPSVGPGSSIATHTLGVMR-DALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFF  1240
              P+    SS   HTLG  R DAL+GSKP T +RSFDN    RRET  VPTRSKSMLSAFF
Sbjct  240   FPNGVSTSSTPMHTLGGTRKDALEGSKPFTTFRSFDN--QNRRETVQVPTRSKSMLSAFF  297

Query  1241  VKQKTPKV  1264
             VKQKTPK+
Sbjct  298   VKQKTPKL  305



>ref|XP_008437975.1| PREDICTED: protein ABIL1 [Cucumis melo]
Length=309

 Score =   414 bits (1063),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/306 (69%), Positives = 244/306 (80%), Gaps = 6/306 (2%)
 Frame = +2

Query  356   MEVEQPKPPPN-SAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  532
             ME++    P N +AMTFDE SMERSKSFVKALQELKNLRPQLYSAAEYCEK+YLHSEQKQ
Sbjct  1     MELDHQLRPDNPAAMTFDEASMERSKSFVKALQELKNLRPQLYSAAEYCEKTYLHSEQKQ  60

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MV++NLKDYAVRALVNAVDHLGTVAYKLT+L+ QQ  DVSTMELK++C+NQQLLTCQ YT
Sbjct  61    MVVDNLKDYAVRALVNAVDHLGTVAYKLTELLEQQTSDVSTMELKVSCLNQQLLTCQTYT  120

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAA  889
             +KEG RQQQLLA+IPRHHKHY LPNSV+KKVHFSPHIQ D RQ   Q+RGRL PSG AA+
Sbjct  121   DKEGLRQQQLLALIPRHHKHYILPNSVSKKVHFSPHIQTDARQQPFQARGRLQPSGIAAS  180

Query  890   KTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPP  1069
             KTLSWHLASET STLKG S    S +D K + +TSG F+L+D  +   R + S   S+P 
Sbjct  181   KTLSWHLASETKSTLKGGSHSLNSNEDQKIAEKTSGTFHLID-NDAAIRPRYSAGHSQPS  239

Query  1070  SVGPGSSIATHTL-GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVK  1246
             +  P SS    +L G  R+A +GSK +T +RSFD P   R E  HVPTRSKS+LSAFFVK
Sbjct  240   NGFPASSAILQSLGGAHREAFEGSKHLTAFRSFDAP--SRHERVHVPTRSKSVLSAFFVK  297

Query  1247  QKTPKV  1264
             QKTPK+
Sbjct  298   QKTPKL  303



>ref|XP_004133838.1| PREDICTED: protein ABIL1-like [Cucumis sativus]
 gb|KGN56470.1| hypothetical protein Csa_3G120490 [Cucumis sativus]
Length=309

 Score =   412 bits (1060),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 212/306 (69%), Positives = 243/306 (79%), Gaps = 6/306 (2%)
 Frame = +2

Query  356   MEVEQPKPPPN-SAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  532
             ME++    P N +AMTFDE SMERSKSFVKALQELKNLRPQLYSAAEYCEK+YLHSEQKQ
Sbjct  1     MELDHQLRPDNPAAMTFDEASMERSKSFVKALQELKNLRPQLYSAAEYCEKTYLHSEQKQ  60

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MV++NLKDYAVRALVNAVDHLGTVAYKLT+L+ QQ  DVSTMELK++C+NQQLLTCQ YT
Sbjct  61    MVVDNLKDYAVRALVNAVDHLGTVAYKLTELLEQQTSDVSTMELKVSCLNQQLLTCQTYT  120

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAA  889
             +KEG RQQQLLA+IPRHHKHY LPNSV+KKVHFSPHIQ D RQ   Q+RGRL PSG AA+
Sbjct  121   DKEGLRQQQLLALIPRHHKHYILPNSVSKKVHFSPHIQTDARQQPFQARGRLQPSGIAAS  180

Query  890   KTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPP  1069
             KTLSWHLASET STLKG S    S +D K + +TSG F+L+D  +   R K     S+P 
Sbjct  181   KTLSWHLASETKSTLKGGSNSLNSNEDQKIAEKTSGTFHLID-NDAAIRPKYLAGHSQPS  239

Query  1070  SVGPGSSIATHTL-GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVK  1246
             +  P SS    +L G  R+A +GSK +T +RSFD P   R E  HVPTRSKS+LSAFFVK
Sbjct  240   NGFPASSAILQSLGGTHREAFEGSKHLTAFRSFDAP--SRHERVHVPTRSKSVLSAFFVK  297

Query  1247  QKTPKV  1264
             QKTPK+
Sbjct  298   QKTPKL  303



>emb|CDP08740.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   411 bits (1057),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 212/291 (73%), Positives = 242/291 (83%), Gaps = 4/291 (1%)
 Frame = +2

Query  395   MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRAL  574
             MT+DE SMERSKSFVKALQELKNLRPQLYSAAEYCEKSY HSEQKQMVL+NLKDYAVRAL
Sbjct  1     MTYDEASMERSKSFVKALQELKNLRPQLYSAAEYCEKSYFHSEQKQMVLDNLKDYAVRAL  60

Query  575   VNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAII  754
             VNAVDHLGTVAYKLTDL+ Q  +D+S+MELKITCINQQLLTCQ +TEKEG RQQQLLAII
Sbjct  61    VNAVDHLGTVAYKLTDLLDQHAMDISSMELKITCINQQLLTCQTFTEKEGLRQQQLLAII  120

Query  755   PRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTL  934
             PRHHKHYTLPN+VNKKVHFSP IQMD RQ +  +  L+PSG  AAKTLSWHLASET S+L
Sbjct  121   PRHHKHYTLPNAVNKKVHFSPQIQMDPRQQVHVKPHLYPSGTPAAKTLSWHLASETKSSL  180

Query  935   KGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGV  1114
             KG     +S++D KSSG++S  FNLLD  + G R K+    S+ PSVGP S++A  TLG+
Sbjct  181   KGTHRASLSSEDSKSSGKSSIGFNLLDAEQSG-RIKSPKPHSQLPSVGPASTVAIKTLGI  239

Query  1115  MR-DALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             +R DA++GSKPMTP+RSF N    R+E   VP RSKS+LSAFFVKQKT K+
Sbjct  240   LRLDAVEGSKPMTPFRSFGNT--TRQEIVRVPARSKSVLSAFFVKQKTQKL  288



>ref|XP_002320167.2| hypothetical protein POPTR_0014s08800g [Populus trichocarpa]
 gb|EEE98482.2| hypothetical protein POPTR_0014s08800g [Populus trichocarpa]
Length=306

 Score =   410 bits (1055),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 238/305 (78%), Gaps = 8/305 (3%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+EQ +P  N AMTFDEVSMERSKSF+KALQELKNLRPQLYSAAEYCEKSYLHSEQKQ 
Sbjct  2     MELEQTRPE-NPAMTFDEVSMERSKSFIKALQELKNLRPQLYSAAEYCEKSYLHSEQKQT  60

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ L+VSTME+K++C+NQQ LTCQ YT+
Sbjct  61    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQALEVSTMEVKVSCMNQQYLTCQTYTD  120

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IPRHHKHY L NSVNKKVHFSP IQ D RQ H Q+R RL PSG  A+K
Sbjct  121   KEGLRQQQLLAFIPRHHKHYVLQNSVNKKVHFSPQIQTDARQNHFQARSRLQPSGSPASK  180

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG      S +D K+SG+ S  F LLD  E   +T++S A ++  S
Sbjct  181   TLSWHLASETKSTLKGTHV-MTSNEDTKTSGKPSVVFQLLDKEESA-KTRSSGAPAQLSS  238

Query  1073  VGPGSSIATHTLGVMRDAL-DGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
              GP +       GV R  L DGSKP+TP+RSFDNP H   E    P RSKSMLSAFFVKQ
Sbjct  239   GGPAAGAIMQKFGVPRRELSDGSKPLTPFRSFDNPRH---EIVRAPVRSKSMLSAFFVKQ  295

Query  1250  KTPKV  1264
             KT K+
Sbjct  296   KTLKL  300



>ref|XP_007135156.1| hypothetical protein PHAVU_010G105800g [Phaseolus vulgaris]
 gb|ESW07150.1| hypothetical protein PHAVU_010G105800g [Phaseolus vulgaris]
Length=309

 Score =   410 bits (1054),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 241/306 (79%), Gaps = 6/306 (2%)
 Frame = +2

Query  356   MEVEQPKPPP-NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  532
             ME E+    P NSAMT+DE SMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQKQ
Sbjct  1     MEFERAAAAPLNSAMTYDEASMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  60

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDVSTM+LK+  INQ+LLTCQ Y 
Sbjct  61    MVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLDVSTMDLKVATINQKLLTCQIYA  120

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHI-QSRGRLFPSGPAAA  889
             +KEG RQQQLLA IPRHHKHY LPNS+NKKVHFSPHIQ+D RQ++ Q+R RL  SG  AA
Sbjct  121   DKEGLRQQQLLAFIPRHHKHYILPNSINKKVHFSPHIQIDARQNLFQTRTRLQTSGTPAA  180

Query  890   KTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPP  1069
             KTLSWHLASET STLKG+S    + ++ K S + SG F+LLD  E     K+SPA     
Sbjct  181   KTLSWHLASETKSTLKGSSHASPNIENPKFSAKASGVFHLLDNEE-NTWMKSSPAQIHFT  239

Query  1070  SVGPGSSIATHTLGVMR-DALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVK  1246
             +  P SS   HTLG  R D+L+GSK +T +RSFDNP   RRE   VPTRSKS+LSAFF K
Sbjct  240   NGVPPSSTPLHTLGGTRKDSLEGSKQLTAFRSFDNP--KRREAVQVPTRSKSVLSAFFAK  297

Query  1247  QKTPKV  1264
             QKTPK+
Sbjct  298   QKTPKL  303



>ref|XP_003548613.1| PREDICTED: protein ABIL1-like [Glycine max]
Length=311

 Score =   409 bits (1050),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 217/308 (70%), Positives = 241/308 (78%), Gaps = 8/308 (3%)
 Frame = +2

Query  356   MEVEQPKPPP-NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  532
             ME+E P   P NSAMT+DE SMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQKQ
Sbjct  1     MELEHPTATPLNSAMTYDEASMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  60

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  DVSTM+LK+  INQ+LLTCQ YT
Sbjct  61    MVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTFDVSTMDLKVATINQKLLTCQIYT  120

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAA  889
             +KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSP IQ+D RQ+  Q+R R   SG  AA
Sbjct  121   DKEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPQIQIDARQNPFQTRTRFQSSGTPAA  180

Query  890   KTLSWHLASETTSTLKGASCGFVS--ADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSK  1063
             KTLSWHLASET STLKG+S    S   ++ K S + SG F+LLD  E     K+SPA   
Sbjct  181   KTLSWHLASETKSTLKGSSHASPSPNTENPKFSAKASGVFHLLDNEE-NTWMKSSPAQIY  239

Query  1064  PPSVGPGSSIATHTL-GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFF  1240
              P+  P SS   HTL G  +DAL+GSKP+T +RSFD     RRET  VPTRSKS+LSAFF
Sbjct  240   FPNGVPTSSTPMHTLGGTGKDALEGSKPLTAFRSFDY--QNRRETVQVPTRSKSVLSAFF  297

Query  1241  VKQKTPKV  1264
             VKQKTPK+
Sbjct  298   VKQKTPKL  305



>gb|KHN15983.1| Protein ABIL1 [Glycine soja]
Length=311

 Score =   408 bits (1048),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 217/308 (70%), Positives = 240/308 (78%), Gaps = 8/308 (3%)
 Frame = +2

Query  356   MEVEQPKPPP-NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  532
             ME E P   P NSAMT+DE SMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQKQ
Sbjct  1     MEFEHPTATPLNSAMTYDEASMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  60

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  DVSTM+LK+  INQ+LLTCQ YT
Sbjct  61    MVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTFDVSTMDLKVATINQKLLTCQIYT  120

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAA  889
             +KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSP IQ+D RQ+  Q+R R   SG  AA
Sbjct  121   DKEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPQIQIDARQNPFQTRTRFQSSGTPAA  180

Query  890   KTLSWHLASETTSTLKGASCGFVS--ADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSK  1063
             KTLSWHLASET STLKG+S    S   ++ K S + SG F+LLD  E     K+SPA   
Sbjct  181   KTLSWHLASETKSTLKGSSHASPSPNTENPKFSAKASGVFHLLDNEE-NTWMKSSPAQIY  239

Query  1064  PPSVGPGSSIATHTL-GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFF  1240
              P+  P SS   HTL G  +DAL+GSKP+T +RSFD     RRET  VPTRSKS+LSAFF
Sbjct  240   FPNGVPTSSTPMHTLGGTGKDALEGSKPLTAFRSFDY--QNRRETVQVPTRSKSVLSAFF  297

Query  1241  VKQKTPKV  1264
             VKQKTPK+
Sbjct  298   VKQKTPKL  305



>ref|XP_008232956.1| PREDICTED: protein ABIL1 [Prunus mume]
Length=307

 Score =   407 bits (1046),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 236/305 (77%), Gaps = 6/305 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+EQ  P  N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MELEQSGPF-NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDVSTM+LK+TC+NQ+LLTC+ Y +
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTLDVSTMDLKVTCLNQKLLTCKTYMD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAK  892
             KEG RQQQLL+ IPRHHKHY LPNSVNKKVHFSPH+Q D RQH  Q+R  +  S  AA+K
Sbjct  120   KEGSRQQQLLSFIPRHHKHYVLPNSVNKKVHFSPHVQTDTRQHPYQARAHVQSSSAAASK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG      S  D K S  TSG F+LL+  E  N TK+S    +  S
Sbjct  180   TLSWHLASETKSTLKGTPQAMTSTGDTKISANTSGVFHLLE-NEGSNPTKSSATHLQLTS  238

Query  1073  VGPGSSIATHTLGV-MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
               P    A  TLG   R+A+DG +PMT +RSFDNP   RRE   VP RSKS+LSAFF KQ
Sbjct  239   GVPACGGAMQTLGAGHREAVDGQRPMTTFRSFDNP--NRREIVRVPVRSKSVLSAFFAKQ  296

Query  1250  KTPKV  1264
             KT K+
Sbjct  297   KTMKL  301



>ref|XP_002301384.2| hypothetical protein POPTR_0002s16750g [Populus trichocarpa]
 gb|EEE80657.2| hypothetical protein POPTR_0002s16750g [Populus trichocarpa]
Length=307

 Score =   406 bits (1043),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 207/305 (68%), Positives = 233/305 (76%), Gaps = 7/305 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME++Q +P  N AMTFDEVSMERSKSF+KALQELKNLRPQLYSAAEYCEKSYLHSEQKQ 
Sbjct  2     MELDQTRPE-NPAMTFDEVSMERSKSFIKALQELKNLRPQLYSAAEYCEKSYLHSEQKQT  60

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  DVSTME+K++C+NQQ LTCQ YT 
Sbjct  61    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTFDVSTMEVKVSCLNQQFLTCQTYTV  120

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             K G RQQQLLA IPRHHKHY LPNS NKKVHFSP IQ D RQ H Q+R RL  SG  A+K
Sbjct  121   KGGLRQQQLLAFIPRHHKHYILPNSFNKKVHFSPQIQTDARQNHFQARSRLQLSGSPASK  180

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHL SET STLKG      S +D K+SG++S  F LLD  E   +T++S   ++  S
Sbjct  181   TLSWHLVSETKSTLKGTLHAMTSNEDAKASGKSSAVFQLLDEEE-SRKTRSSGGLAQLSS  239

Query  1073  VGPGSSIATHTLGV-MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
              GP +     T  V  R+ LD SKP+T +RSFDNP H   E    P RSKSMLSAFFVKQ
Sbjct  240   RGPAAGAIMPTFDVPRRELLDTSKPLTAFRSFDNPRH---EIVRAPVRSKSMLSAFFVKQ  296

Query  1250  KTPKV  1264
             KTPK+
Sbjct  297   KTPKL  301



>ref|XP_007051671.1| ABI-1-like 1 isoform 1 [Theobroma cacao]
 gb|EOX95828.1| ABI-1-like 1 isoform 1 [Theobroma cacao]
Length=299

 Score =   404 bits (1037),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 209/304 (69%), Positives = 235/304 (77%), Gaps = 12/304 (4%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVE P+P  N AMTFDEVSMERSK+FVKALQELKNLRPQLYSAAEYCEKSYL SEQKQM
Sbjct  1     MEVEFPRPE-NPAMTFDEVSMERSKNFVKALQELKNLRPQLYSAAEYCEKSYLQSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ L+VSTMELK +C+NQQLL CQ YT+
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLEVSTMELKASCLNQQLLMCQTYTD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ D RQ + Q++ RL PSG  A+K
Sbjct  120   KEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQTDPRQNYFQAKSRLQPSGTPASK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG S    S +  K SG +S  F LL+ G+    TKA+ + +    
Sbjct  180   TLSWHLASETKSTLKGTSQPLASNEISKPSGSSSEVFQLLENGD---NTKANSSAAP---  233

Query  1073  VGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
               P S+    TLG+    L+GSKP+T +RSFDNP H   E    P RS+SMLSAFF KQK
Sbjct  234   -FPASNAFVPTLGITHRELEGSKPLTAFRSFDNPKH---EIIRAPVRSRSMLSAFFAKQK  289

Query  1253  TPKV  1264
              PK+
Sbjct  290   APKL  293



>ref|XP_011023256.1| PREDICTED: protein ABIL1-like isoform X2 [Populus euphratica]
 ref|XP_011016288.1| PREDICTED: protein ABIL1-like isoform X2 [Populus euphratica]
Length=307

 Score =   402 bits (1032),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 234/305 (77%), Gaps = 7/305 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME++Q +P  N AMTFDEVSMERSKSF+KALQELK+LRPQLYSAAEYCEKSYLHSEQKQ 
Sbjct  2     MELDQTRPE-NPAMTFDEVSMERSKSFIKALQELKSLRPQLYSAAEYCEKSYLHSEQKQT  60

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LD+STME+ ++C+NQQ LTCQ YT+
Sbjct  61    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLDISTMEVTVSCLNQQFLTCQTYTD  120

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             K G RQQQL+A IPRHHKHY LPNSVNKKVHFSP IQ D RQ H Q+R RL  +G  A+K
Sbjct  121   KGGLRQQQLVAFIPRHHKHYILPNSVNKKVHFSPQIQTDARQNHFQARSRLQLAGSPASK  180

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHL SET STLKG      S +D K+SG++S  F LLD  E   +T++S   ++  S
Sbjct  181   TLSWHLVSETKSTLKGTLHAMTSNEDAKTSGKSSAVFQLLDEEE-SRKTRSSGGLAQLSS  239

Query  1073  VGPGSSIATHTLGV-MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
               P +     T  V  R+ LD SKP+T +RSFDNP H   E    P RSKSMLSAFF+KQ
Sbjct  240   RSPAAGAIMPTFDVPRRELLDASKPLTAFRSFDNPRH---EIVRAPVRSKSMLSAFFLKQ  296

Query  1250  KTPKV  1264
             KTPK+
Sbjct  297   KTPKL  301



>ref|XP_011037292.1| PREDICTED: protein ABIL1 [Populus euphratica]
Length=306

 Score =   400 bits (1029),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 236/305 (77%), Gaps = 8/305 (3%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+EQ +P  N AMTFDEVSMERSKSF+KALQELKNLRPQLYSAAEYCEKSYLHSEQKQ 
Sbjct  2     MELEQTRPE-NPAMTFDEVSMERSKSFIKALQELKNLRPQLYSAAEYCEKSYLHSEQKQT  60

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ L+VSTME+K++C+NQQ LTCQ YT+
Sbjct  61    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQALEVSTMEVKVSCLNQQYLTCQTYTD  120

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IP+HHKHY L +SVNKKVHFSP IQ D RQ H Q+R RL PSG  A+K
Sbjct  121   KEGLRQQQLLAFIPKHHKHYVLQSSVNKKVHFSPQIQTDARQNHFQARSRLQPSGSPASK  180

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG +    S +D K+ G+ S  F LLD  E   + ++S A ++  S
Sbjct  181   TLSWHLASETKSTLKGTNV-VTSNEDTKTYGKPSVVFQLLDKEESA-KARSSGAPAQLSS  238

Query  1073  VGPGSSIATHTLGVMRDAL-DGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
              GP +       GV R  L DGSKP+T +RSFDNP H   E    P RSKSMLSAFFVKQ
Sbjct  239   GGPAAGAIMQKFGVPRRELSDGSKPLTAFRSFDNPRH---EIVRAPVRSKSMLSAFFVKQ  295

Query  1250  KTPKV  1264
             KT K+
Sbjct  296   KTLKL  300



>ref|XP_004510703.1| PREDICTED: protein ABIL1-like [Cicer arietinum]
Length=309

 Score =   400 bits (1029),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 236/305 (77%), Gaps = 6/305 (2%)
 Frame = +2

Query  356   MEVEQPKPP-PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  532
             ME+E P     NS+MTFDEVSMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQKQ
Sbjct  1     MELEHPTTAFHNSSMTFDEVSMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  60

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ Q  LDVSTM+LK++ INQ+LLTCQ YT
Sbjct  61    MVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQHTLDVSTMDLKVSTINQKLLTCQIYT  120

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAA  889
              KEG  QQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ+D +Q+  Q+R R   SG   A
Sbjct  121   HKEGLWQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQIDAKQNSFQTRTRFQSSGAPPA  180

Query  890   KTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPP  1069
             KTLSWHLASET STLKG      + ++ K S + SG F+LLD  E     K+SPA     
Sbjct  181   KTLSWHLASETKSTLKGTPHASPNIENPKFSAKASGFFHLLDNEE-STWMKSSPAQIHLT  239

Query  1070  SVGPGSSIATHTL-GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVK  1246
             +  P SSI   TL G  RDALDGSKP+T +RSFDN    RRE+   PTRS+S+LSAFFVK
Sbjct  240   NGVPTSSIPVQTLGGTRRDALDGSKPLTAFRSFDNA--NRRESAQTPTRSRSVLSAFFVK  297

Query  1247  QKTPK  1261
             QKTPK
Sbjct  298   QKTPK  302



>ref|XP_004488717.1| PREDICTED: protein ABIL1-like [Cicer arietinum]
Length=309

 Score =   400 bits (1028),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 236/305 (77%), Gaps = 6/305 (2%)
 Frame = +2

Query  356   MEVEQPKPP-PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  532
             ME+E P     NS+MTFDEVSMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQKQ
Sbjct  1     MELEHPTTAFHNSSMTFDEVSMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  60

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ Q  LDVSTM+LK++ INQ+LLTCQ YT
Sbjct  61    MVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQHTLDVSTMDLKVSTINQKLLTCQIYT  120

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAA  889
              KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ+D +Q+  Q+R R   SG   A
Sbjct  121   HKEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQIDAKQNSFQTRTRFQSSGAPPA  180

Query  890   KTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPP  1069
             KTLSWHLASET STLKG      + ++ K S + SG F+LLD  E     K+SPA     
Sbjct  181   KTLSWHLASETKSTLKGTPHASPNIENPKFSAKASGFFHLLDNEE-STWMKSSPAQIHLT  239

Query  1070  SVGPGSSIATHTL-GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVK  1246
             +  P SSI   TL G  RDALDGSKP+T +RSFDN    RRE+   PTRS+S+ SAFFVK
Sbjct  240   NGVPTSSIPVQTLGGTRRDALDGSKPLTAFRSFDNA--NRRESDQTPTRSRSVPSAFFVK  297

Query  1247  QKTPK  1261
             QKTPK
Sbjct  298   QKTPK  302



>ref|XP_006444921.1| hypothetical protein CICLE_v10021371mg [Citrus clementina]
 ref|XP_006444922.1| hypothetical protein CICLE_v10021371mg [Citrus clementina]
 ref|XP_006444923.1| hypothetical protein CICLE_v10021371mg [Citrus clementina]
 ref|XP_006491208.1| PREDICTED: protein ABIL1-like [Citrus sinensis]
 gb|ESR58161.1| hypothetical protein CICLE_v10021371mg [Citrus clementina]
 gb|ESR58162.1| hypothetical protein CICLE_v10021371mg [Citrus clementina]
 gb|ESR58163.1| hypothetical protein CICLE_v10021371mg [Citrus clementina]
 gb|KDO86345.1| hypothetical protein CISIN_1g022270mg [Citrus sinensis]
 gb|KDO86346.1| hypothetical protein CISIN_1g022270mg [Citrus sinensis]
 gb|KDO86347.1| hypothetical protein CISIN_1g022270mg [Citrus sinensis]
Length=300

 Score =   400 bits (1027),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 209/305 (69%), Positives = 235/305 (77%), Gaps = 13/305 (4%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVE P+   N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MEVELPRLG-NRAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  DVSTMEL+++C+NQ+LLTCQ Y+ 
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTSDVSTMELRVSCMNQKLLTCQTYSN  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSP +  D RQ H  S  RL P+G  A+K
Sbjct  120   KEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPRVPTDARQNHFSS--RLQPTGIPASK  177

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET ST KG      S++D K    TSG F+LLD  E    TK+S   ++  S
Sbjct  178   TLSWHLASETKSTSKGTQQALTSSEDRK----TSGVFHLLDNEE-NKLTKSSAVSAQLSS  232

Query  1073  VGPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
              GP SS    + GV  RDA++G+K + P+RSFDN   PRRE    P RSKS+LSAFFVKQ
Sbjct  233   GGPASSALVQSFGVARRDAMEGNKTLAPFRSFDN---PRREIVRAPVRSKSVLSAFFVKQ  289

Query  1250  KTPKV  1264
             KT K+
Sbjct  290   KTSKL  294



>ref|XP_004306717.1| PREDICTED: protein ABIL1-like [Fragaria vesca subsp. vesca]
Length=299

 Score =   399 bits (1024),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 235/306 (77%), Gaps = 16/306 (5%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+EQ +P    AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MELEQSRP----AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  56

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDVSTM+LK+TC+NQ+L TC+ + +
Sbjct  57    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTLDVSTMDLKVTCLNQKLFTCKTFMD  116

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAK  892
             KEG RQQQLL  IPRHHKHY LPNSVNKKVHFSPH+Q D RQH  Q+R  + PS  AA+K
Sbjct  117   KEGARQQQLLPFIPRHHKHYILPNSVNKKVHFSPHVQTDTRQHAYQARPHVQPSSAAASK  176

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG S    S+ D K S  TSG F LLD  E    TK+S A  + PS
Sbjct  177   TLSWHLASETKSTLKGTSQALASSADTKISVNTSGVFQLLD-NEGTATTKSSGAHLQLPS  235

Query  1073  VGPGSS--IATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVK  1246
               PGS   +A H     RDA+DG +P+   RSFDN     R+   VP RSKS+LSAFFVK
Sbjct  236   RVPGSESFVAGH-----RDAVDGYRPLGAARSFDN---QNRQIVRVPVRSKSLLSAFFVK  287

Query  1247  QKTPKV  1264
             QK+ K+
Sbjct  288   QKSTKL  293



>gb|KEH18769.1| ABIL1-like protein [Medicago truncatula]
Length=310

 Score =   399 bits (1024),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 210/307 (68%), Positives = 240/307 (78%), Gaps = 7/307 (2%)
 Frame = +2

Query  356   MEVEQPKPP--PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQK  529
             ME+E+P      +SAMTFDEVSMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQK
Sbjct  1     MELERPTTTFHNSSAMTFDEVSMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQK  60

Query  530   QMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAY  709
             QMVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ Q  LDVSTM LK++ INQ+L TCQ Y
Sbjct  61    QMVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQHTLDVSTMGLKVSTINQKLHTCQIY  120

Query  710   TEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAA  886
             T+KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ+D +Q+  Q+R R   SG   
Sbjct  121   TDKEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQIDAKQNSFQTRTRFQSSGTPP  180

Query  887   AKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKP  1066
             AKTLSWHLASET STLKG      + ++ K + + SG F+LLD  E     K+SPA +  
Sbjct  181   AKTLSWHLASETKSTLKGTPQASPNIENPKFAAKASGYFHLLDNEE-STWMKSSPAHTHL  239

Query  1067  PSVGPGSSIATHTL-GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFV  1243
             P+  P S+I   TL G  RDALDGSKP+  +RSFDN    RRE++  PTRS+S+LSAFFV
Sbjct  240   PNGVPTSTIPVQTLGGTRRDALDGSKPIAGFRSFDNA--YRRESSQTPTRSRSVLSAFFV  297

Query  1244  KQKTPKV  1264
             KQKTPK+
Sbjct  298   KQKTPKL  304



>ref|XP_010092890.1| hypothetical protein L484_022485 [Morus notabilis]
 gb|EXB52708.1| hypothetical protein L484_022485 [Morus notabilis]
Length=299

 Score =   398 bits (1022),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 207/304 (68%), Positives = 234/304 (77%), Gaps = 19/304 (6%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME E P+P    AMTFDEVSMERSK FVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MEFEHPRPV-GPAMTFDEVSMERSKDFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  +VSTMELK+TC+NQQLLTC+ YT+
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQASEVSTMELKVTCVNQQLLTCRTYTD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IPRHHKHY LPNS NKKVHFSP +Q D RQ + Q+R RL PS   A+K
Sbjct  120   KEGLRQQQLLAFIPRHHKHYVLPNSANKKVHFSPLVQTDARQNNFQARARLQPSSSPASK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLAS+T  TLKGAS    + +D+K+SG+TSG F+LLD  E              P+
Sbjct  180   TLSWHLASDTKPTLKGASQVSTNTEDVKNSGKTSGLFHLLDDEEC------------IPT  227

Query  1073  VGPGSSIATHTLGVMR-DALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
              G  +S+    LG  R D ++GSKP+T +RSFDN    RRE   VP RSKS+LSAFFVKQ
Sbjct  228   SGTPASM--QILGATRKDGMEGSKPLTAFRSFDN--QNRREIVRVPVRSKSVLSAFFVKQ  283

Query  1250  KTPK  1261
             KT K
Sbjct  284   KTLK  287



>ref|XP_002279419.1| PREDICTED: protein ABIL1 [Vitis vinifera]
Length=302

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/310 (67%), Positives = 242/310 (78%), Gaps = 10/310 (3%)
 Frame = +2

Query  341   LELSEMEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHS  520
             +EL E   E P      AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHS
Sbjct  1     MELQESRAEHP------AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHS  54

Query  521   EQKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTC  700
             EQKQMVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDVSTMELK++C+NQ+LLTC
Sbjct  55    EQKQMVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTLDVSTMELKVSCVNQKLLTC  114

Query  701   QAYTEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSG  877
             Q Y +KEG RQQQLLA IPRHHKHY LPNSVNKKVHFS  +Q D  Q HIQ+R R++P+G
Sbjct  115   QTYMDKEGIRQQQLLAFIPRHHKHYILPNSVNKKVHFSLQVQRDASQNHIQARPRIYPTG  174

Query  878   PAAAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAW  1057
              A +KTLSWHLASET STLKG++  F+S ++ ++SG+TS  F+LLD  E   RT   PA 
Sbjct  175   NATSKTLSWHLASETKSTLKGSANAFLSTNEPETSGKTSRVFHLLDSEETI-RTSGGPAG  233

Query  1058  SKPPSVGPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSA  1234
               P S    S++ T +LGV+ RD+ +G+KP+ P+RSFDN         H   RSKS+LSA
Sbjct  234   GGPSSGPASSAV-TQSLGVVWRDSSEGTKPVMPFRSFDNRNRRPMALAHPAARSKSVLSA  292

Query  1235  FFVKQKTPKV  1264
             FF KQKTP++
Sbjct  293   FFAKQKTPRI  302



>ref|XP_007218725.1| hypothetical protein PRUPE_ppa009050mg [Prunus persica]
 gb|EMJ19924.1| hypothetical protein PRUPE_ppa009050mg [Prunus persica]
Length=308

 Score =   395 bits (1016),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 212/306 (69%), Positives = 237/306 (77%), Gaps = 7/306 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+EQ     N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MELEQSGSF-NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDVSTM+L +TC+NQ+LLTC+ Y +
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTLDVSTMDLTVTCLNQKLLTCKTYMD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRL-FPSGPAAA  889
             KEG RQQQLL+ IPRHHKHY LPNSVNKKVHFSPH+Q D RQH  Q+R  L   S  A++
Sbjct  120   KEGSRQQQLLSFIPRHHKHYILPNSVNKKVHFSPHVQTDTRQHPYQARAHLQSSSAAASS  179

Query  890   KTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPP  1069
             KTLSWHLASET STLKG      SA D K S  TSG F+LL+  E  N TK+S    + P
Sbjct  180   KTLSWHLASETKSTLKGTPQAMTSAGDTKISVNTSGIFHLLE-NEGSNPTKSSATHLQLP  238

Query  1070  SVGPGSSIATHTLGV-MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVK  1246
             S  P S  A  TLG   R+A+DG +PMT +RSFDNP   RR+   VP RSKS+LSAFF K
Sbjct  239   SGVPASGGAMQTLGAGHREAVDGQRPMTAFRSFDNP--NRRQIVRVPVRSKSVLSAFFAK  296

Query  1247  QKTPKV  1264
             QKT K+
Sbjct  297   QKTMKL  302



>ref|XP_009338792.1| PREDICTED: protein ABIL1-like [Pyrus x bretschneideri]
 ref|XP_009350122.1| PREDICTED: protein ABIL1-like [Pyrus x bretschneideri]
Length=302

 Score =   394 bits (1013),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 205/305 (67%), Positives = 234/305 (77%), Gaps = 11/305 (4%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+EQ +P    AMTFDE+SMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MELEQHRP----AMTFDELSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  56

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  DVSTM+LK+TC+NQ+LLTC+ Y +
Sbjct  57    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTSDVSTMDLKVTCLNQKLLTCKTYMD  116

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPH+Q D RQH  Q+R  L PS  AA+K
Sbjct  117   KEGSRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHVQTDTRQHPYQTRAHLQPSSAAASK  176

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG      S  D K S  T+G F L++     +  K+S    + PS
Sbjct  177   TLSWHLASETKSTLKGTPQVRTSTGDTKISVNTAGVFQLVENER--STPKSSATQLQQPS  234

Query  1073  VGPGSSIATHTLGV-MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
               P S     T G   ++A+DGS+PMT +RSF+N   PRRE   VP RSKS+LSAFF KQ
Sbjct  235   GFPASGGVKQTSGAGHKEAVDGSRPMTAFRSFEN---PRREIVRVPVRSKSVLSAFFAKQ  291

Query  1250  KTPKV  1264
             K+ K+
Sbjct  292   KSNKL  296



>ref|XP_004155889.1| PREDICTED: LOW QUALITY PROTEIN: protein ABIL1-like [Cucumis sativus]
Length=309

 Score =   394 bits (1012),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 236/306 (77%), Gaps = 6/306 (2%)
 Frame = +2

Query  356   MEVEQPKPPPN-SAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQ  532
             ME++    P N +AMTFDE SMERSKSFVKALQELKNLRPQLYSAAEYCEK+YLHSEQKQ
Sbjct  1     MELDHQLRPDNPAAMTFDEASMERSKSFVKALQELKNLRPQLYSAAEYCEKTYLHSEQKQ  60

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MV++NLKDYAVRALVNAVDHLGTVAYKLT+L+ QQ  DVSTMELK++C+NQQLLTCQ YT
Sbjct  61    MVVDNLKDYAVRALVNAVDHLGTVAYKLTELLEQQTSDVSTMELKVSCLNQQLLTCQTYT  120

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAA  889
             +KEG RQQQLLA+IPRH     LPNSV+KKVHFSPHIQ D RQ   Q+RGRL PSG AA+
Sbjct  121   DKEGLRQQQLLALIPRHQXALYLPNSVSKKVHFSPHIQTDARQQPFQARGRLQPSGIAAS  180

Query  890   KTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPP  1069
             KTLSWHLASET STLKG S         K+  +TSG F+L+D  +   R K     S+P 
Sbjct  181   KTLSWHLASETKSTLKGGSNSLNRQRGSKNCRKTSGTFHLID-NDAAIRPKYLAGHSQPS  239

Query  1070  SVGPGSSIATHTL-GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVK  1246
             +  P SS    +L G  R+A +GSK +T +RSFD P   R E  HVPTRSKS+LSAFFVK
Sbjct  240   NGFPASSAILQSLGGTHREAFEGSKHLTAFRSFDAP--SRHERVHVPTRSKSVLSAFFVK  297

Query  1247  QKTPKV  1264
             QKTPK+
Sbjct  298   QKTPKL  303



>ref|XP_008375925.1| PREDICTED: protein ABIL1 [Malus domestica]
Length=293

 Score =   392 bits (1008),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/304 (67%), Positives = 232/304 (76%), Gaps = 18/304 (6%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+EQ +P    AMTFDEVSMERSKSFVKALQELKNLRPQLYSA EYCEKSYLHSEQKQM
Sbjct  1     MELEQHRP----AMTFDEVSMERSKSFVKALQELKNLRPQLYSAXEYCEKSYLHSEQKQM  56

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  DVSTM+LK+TC+NQ+LLTC+ Y +
Sbjct  57    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTSDVSTMDLKVTCLNQKLLTCKTYMD  116

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPH+Q D RQH  Q+R  L PS  AA+K
Sbjct  117   KEGSRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHVQTDTRQHPYQARAHLQPSSAAASK  176

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG      S  D K S  T+G F L++    G+  K+S    + PS
Sbjct  177   TLSWHLASETKSTLKGTPQVRTSTGDTKISVNTAGVFQLVENE--GSTPKSSATQLQQPS  234

Query  1073  VGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
               P +          ++A+DGS+PMT +RSF+N   PRRE   VP RSKS+LSAFF KQK
Sbjct  235   GFPAAG--------XKEAVDGSRPMTAFRSFEN---PRREIVRVPVRSKSVLSAFFAKQK  283

Query  1253  TPKV  1264
             + K+
Sbjct  284   SNKL  287



>emb|CBI40454.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   391 bits (1005),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 201/292 (69%), Positives = 235/292 (80%), Gaps = 4/292 (1%)
 Frame = +2

Query  395   MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRAL  574
             MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVL+NLKDYAVRAL
Sbjct  1     MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDNLKDYAVRAL  60

Query  575   VNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAII  754
             VNAVDHLGTVAYKLTDL+ QQ LDVSTMELK++C+NQ+LLTCQ Y +KEG RQQQLLA I
Sbjct  61    VNAVDHLGTVAYKLTDLLDQQTLDVSTMELKVSCVNQKLLTCQTYMDKEGIRQQQLLAFI  120

Query  755   PRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASETTST  931
             PRHHKHY LPNSVNKKVHFS  +Q D  Q HIQ+R R++P+G A +KTLSWHLASET ST
Sbjct  121   PRHHKHYILPNSVNKKVHFSLQVQRDASQNHIQARPRIYPTGNATSKTLSWHLASETKST  180

Query  932   LKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLG  1111
             LKG++  F+S ++ ++SG+TS  F+LLD  E   RT   PA   P S    S++ T +LG
Sbjct  181   LKGSANAFLSTNEPETSGKTSRVFHLLDSEETI-RTSGGPAGGGPSSGPASSAV-TQSLG  238

Query  1112  VM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             V+ RD+ +G+KP+ P+RSFDN         H   RSKS+LSAFF KQKTP++
Sbjct  239   VVWRDSSEGTKPVMPFRSFDNRNRRPMALAHPAARSKSVLSAFFAKQKTPRI  290



>gb|KCW78125.1| hypothetical protein EUGRSUZ_D02333 [Eucalyptus grandis]
Length=304

 Score =   390 bits (1003),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 206/308 (67%), Positives = 233/308 (76%), Gaps = 15/308 (5%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+E+ +   N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYL+SEQKQM
Sbjct  1     MEMERLRSA-NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLNSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ+LD++ MELK+T  NQQLLTC+ Y++
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLIEQQSLDITVMELKVTGFNQQLLTCKTYSD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             KEG RQQQLLAIIPRHHKHY LPNSVNKKVHFSP IQ D RQ H Q+R RL PS   AAK
Sbjct  120   KEGLRQQQLLAIIPRHHKHYMLPNSVNKKVHFSPQIQKDVRQNHFQARSRLQPSATPAAK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG      S +D   S +    F+LLD GE    TK+S      P 
Sbjct  180   TLSWHLASETKSTLKGTQNASASTED---SAKKPELFHLLDDGE-NALTKSSVGH---PQ  232

Query  1073  VGPGSS----IATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFF  1240
             V  G S    + +      RD+ +G+KP++ +RSFDNP   RRE    P RSKSMLSAFF
Sbjct  233   VLTGGSTYGAVPSSVAAARRDSWEGTKPLSTFRSFDNP--DRREIVRAPARSKSMLSAFF  290

Query  1241  VKQKTPKV  1264
             VK KTPK+
Sbjct  291   VKAKTPKM  298



>emb|CAN69308.1| hypothetical protein VITISV_003083 [Vitis vinifera]
Length=302

 Score =   390 bits (1002),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 240/310 (77%), Gaps = 10/310 (3%)
 Frame = +2

Query  341   LELSEMEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHS  520
             +EL E   E P      AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHS
Sbjct  1     MELQESRXEHP------AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHS  54

Query  521   EQKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTC  700
             EQKQMVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LDVSTMELK++C+NQ+LLTC
Sbjct  55    EQKQMVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTLDVSTMELKVSCVNQKLLTC  114

Query  701   QAYTEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSG  877
             Q Y +KEG RQQQLLA IPRHHKHY LPNSVNKKVHFS  +Q D  Q+  Q+R R++P+G
Sbjct  115   QTYMDKEGIRQQQLLAFIPRHHKHYILPNSVNKKVHFSXQVQRDASQNXXQARPRIYPTG  174

Query  878   PAAAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAW  1057
              A +KTLSWHLASET STLKG++  F+S ++ ++SG+TS  F+LLD  E   RT   PA 
Sbjct  175   NATSKTLSWHLASETKSTLKGSANAFLSTNEPETSGKTSRVFHLLDSEEXI-RTSGGPAG  233

Query  1058  SKPPSVGPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSA  1234
               P S    S++ T +LGV+ RD  +G+KP+ P+RSFDN         H   RSKS+LSA
Sbjct  234   GGPSSGPASSAV-TQSLGVVWRDXSEGTKPVMPFRSFDNRNRRPMALAHPAARSKSVLSA  292

Query  1235  FFVKQKTPKV  1264
             FF KQKTP++
Sbjct  293   FFAKQKTPRI  302



>ref|XP_011023255.1| PREDICTED: protein ABIL1-like isoform X1 [Populus euphratica]
 ref|XP_011016287.1| PREDICTED: protein ABIL1-like isoform X1 [Populus euphratica]
Length=334

 Score =   389 bits (998),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 201/331 (61%), Positives = 233/331 (70%), Gaps = 32/331 (10%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME++Q +P  N AMTFDEVSMERSKSF+KALQELK+LRPQLYSAAEYCEKSYLHSEQKQ 
Sbjct  2     MELDQTRPE-NPAMTFDEVSMERSKSFIKALQELKSLRPQLYSAAEYCEKSYLHSEQKQT  60

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ LD+STME+ ++C+NQQ LTCQ YT+
Sbjct  61    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLDISTMEVTVSCLNQQFLTCQTYTD  120

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             K G RQQQL+A IPRHHKHY LPNSVNKKVHFSP IQ D RQ H Q+R RL  +G  A+K
Sbjct  121   KGGLRQQQLVAFIPRHHKHYILPNSVNKKVHFSPQIQTDARQNHFQARSRLQLAGSPASK  180

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLD-------------------  1015
             TLSWHL SET STLKG      S +D K+SG++S  F LL                    
Sbjct  181   TLSWHLVSETKSTLKGTLHAMTSNEDAKTSGKSSAVFQLLGMYKSRMLQLQISLEILMCY  240

Query  1016  -------GGEVGNRTKASPAWSKPPSVGPGSSIATHTLGV-MRDALDGSKPMTPYRSFDN  1171
                      E   +T++S   ++  S  P +     T  V  R+ LD SKP+T +RSFDN
Sbjct  241   ALDSMHADEEESRKTRSSGGLAQLSSRSPAAGAIMPTFDVPRRELLDASKPLTAFRSFDN  300

Query  1172  PPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             P H   E    P RSKSMLSAFF+KQKTPK+
Sbjct  301   PRH---EIVRAPVRSKSMLSAFFLKQKTPKL  328



>gb|KHG11471.1| Protein ABIL1 -like protein [Gossypium arboreum]
Length=299

 Score =   385 bits (989),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/304 (65%), Positives = 233/304 (77%), Gaps = 12/304 (4%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVE P+P  N AMTFDEVSMERSK+FVKALQELKNLRPQLYSAAEYCEKSYLH+EQKQM
Sbjct  1     MEVELPRPD-NPAMTFDEVSMERSKNFVKALQELKNLRPQLYSAAEYCEKSYLHNEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ L+VST+ELK +C+NQ+LLTCQ YT+
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLEVSTIELKASCLNQKLLTCQTYTD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             KEG RQQQLLA IPRHHKHY LPNSV+KKVHFSP +Q D RQ ++ ++ RL PS   A+K
Sbjct  120   KEGIRQQQLLAFIPRHHKHYILPNSVSKKVHFSPQVQTDPRQTYLHAKARLQPSDTPASK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHL+SET STLKG S    S +  K     S  F LL+ G+   R K+S A      
Sbjct  180   TLSWHLSSETKSTLKGTSQTSASNEISKPPASASEVFQLLENGD-NARAKSSAA------  232

Query  1073  VGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
             + P S+    +LG+    L+GSKP+T +RSFDN   P+R+    P RSKS+LS+FFVKQK
Sbjct  233   LFPASNALVPSLGITHRELEGSKPLTAFRSFDN---PKRDIIRAPVRSKSVLSSFFVKQK  289

Query  1253  TPKV  1264
               K+
Sbjct  290   QMKL  293



>ref|XP_009377232.1| PREDICTED: protein ABIL1-like [Pyrus x bretschneideri]
Length=298

 Score =   384 bits (987),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 204/304 (67%), Positives = 231/304 (76%), Gaps = 13/304 (4%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+EQ +P  N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1     MELEQHQPG-NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  DVSTM+LK+TC+NQ+LLTCQ Y +
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTSDVSTMDLKVTCLNQKLLTCQTYMD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQ QLLA IPRHHKHY LPNS+NKKVHFS H         Q+R  L  S  AA+KT
Sbjct  120   KEGSRQHQLLAFIPRHHKHYILPNSMNKKVHFSQHP-------YQARAHLQFSSAAASKT  172

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV  1075
             LSWHLASET STLKG      S +D K S  T+G F L++  E G+  K+     + PS 
Sbjct  173   LSWHLASETKSTLKGTPQAQTSIEDTKISVNTAGVFQLVENEE-GSAPKSLAIQLQQPSG  231

Query  1076  GPGSSIATHTLGV-MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
              P S     TLG   R+A+DGSKPMT +RSF+N   PRR+T  VP RSKS+LSAFFVKQK
Sbjct  232   LPNSGGVKQTLGAGHREAVDGSKPMTAFRSFEN---PRRDTVRVPVRSKSVLSAFFVKQK  288

Query  1253  TPKV  1264
             + K+
Sbjct  289   SNKL  292



>ref|XP_010544778.1| PREDICTED: protein ABIL1 [Tarenaya hassleriana]
Length=303

 Score =   381 bits (979),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 195/304 (64%), Positives = 233/304 (77%), Gaps = 8/304 (3%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+++ +P  N AMTFDEVSMERSK+FVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQM
Sbjct  1     MELDKSEPN-NPAMTFDEVSMERSKNFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAV+ALVNAVDHLGTVA KLTDL  QQN D+STMEL+++C+NQQLLTC+ Y +
Sbjct  60    VLDNLKDYAVKALVNAVDHLGTVASKLTDLFEQQNSDISTMELRVSCVNQQLLTCRVYND  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             KEG RQQQLLA+IPRHHKHY LPNSVNK+VHFSP  + D  Q H Q+  RL PS   A+K
Sbjct  120   KEGLRQQQLLALIPRHHKHYILPNSVNKRVHFSPLRRSDTIQNHYQAISRLQPSDAPASK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             +LSWHL S+T STLKG +    S  D K+  +TSG F+LLD  E  N+    P+     S
Sbjct  180   SLSWHLGSDTKSTLKGTAATAPSPKDPKAFAKTSGVFHLLDDEESINK---KPSAGSQLS  236

Query  1073  VGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
              GP  +    T GV    ++ +KP+T ++SFDN   PR+ET H P RSKS+LSAFFVKQK
Sbjct  237   GGPAPTSMMQTYGVAPKDMEVAKPLTAHKSFDN---PRQETIHAPVRSKSVLSAFFVKQK  293

Query  1253  TPKV  1264
             TPK+
Sbjct  294   TPKL  297



>ref|XP_010251587.1| PREDICTED: protein ABIL1-like isoform X1 [Nelumbo nucifera]
Length=299

 Score =   372 bits (954),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 218/296 (74%), Gaps = 5/296 (2%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P +SAMTFDE+SMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLH+E KQMVL+NLKDY
Sbjct  6     PESSAMTFDEISMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHTEHKQMVLDNLKDY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
             AVRALVNAVDHLGTV YKLTDL  Q  LDVSTMELK++ +NQQLLTCQ YT+KEG RQQQ
Sbjct  66    AVRALVNAVDHLGTVTYKLTDLFEQHKLDVSTMELKVSSLNQQLLTCQIYTDKEGLRQQQ  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLAS  916
             L  +IP HHKHY LPNSVNKKV FSP IQ+D RQ HIQ+R R  PSG   ++TLSWHLAS
Sbjct  126   LFTVIPGHHKHYILPNSVNKKVQFSPQIQIDARQMHIQARPRFHPSGNPPSQTLSWHLAS  185

Query  917   ETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIA  1096
             ET STL  +   F+  +D K+SG TSG F LL G E    +K++ A     S GP  +  
Sbjct  186   ETKSTLNRSEHTFIGMEDTKASGATSGVFQLL-GSEEAVSSKSTAACLHSASGGPSYNTV  244

Query  1097  THTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPK  1261
               T  V  RD  +GSK +  +RS DN    R E      RSKSMLSAFFVK K+ K
Sbjct  245   LQTFCVTERDTSEGSKSLMAFRSLDN--MGRHEIIRPTVRSKSMLSAFFVKPKSSK  298



>gb|KFK37420.1| hypothetical protein AALP_AA4G254700 [Arabis alpina]
Length=302

 Score =   371 bits (953),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 191/294 (65%), Positives = 222/294 (76%), Gaps = 8/294 (3%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDEVSME SKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NQAMTFDEVSMEHSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQN D+STMEL+ +C+NQQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQNSDISTMELRASCVNQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHYTLPNSVNK+VHFSP  + D RQ H Q+  RL PS   A+K+LSWHL SET
Sbjct  130   AVIPMHHKHYTLPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSET  189

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG FNLL     G+      A S+  SV   S++   
Sbjct  190   KSTLKGTSAVAPSSRDSKAFTKTSGVFNLL-----GDEENKPLAGSQVSSVPATSTVTKQ  244

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             T GV+   L+  KP+T ++S DN  +PRRE    P R+KS+LSAFFVKQKT K+
Sbjct  245   TYGVVHKDLEVPKPLTVHKSLDN--NPRREIIRAPVRTKSVLSAFFVKQKTQKL  296



>ref|XP_004494774.1| PREDICTED: protein ABIL1-like isoform X2 [Cicer arietinum]
Length=295

 Score =   370 bits (950),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 224/292 (77%), Gaps = 5/292 (2%)
 Frame = +2

Query  395   MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRAL  574
             MTFDE SMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHS+QKQM+L+NLKDYA RAL
Sbjct  1     MTFDEFSMERSKSFVFALQELKNLRPQLYSAAEYCEKSYLHSDQKQMLLDNLKDYAARAL  60

Query  575   VNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAII  754
             VNAVDHLGTVAYKLTDL+ QQ LD+STM+LKI+ +NQ+LLTCQ YT+KEG RQQ+LL+ I
Sbjct  61    VNAVDHLGTVAYKLTDLLDQQTLDISTMDLKISTLNQRLLTCQTYTDKEGLRQQKLLSFI  120

Query  755   PRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLASETTST  931
             PRHHKHY LPNS NKKVHF P+ Q D +Q+  ++R R  PSG   +KTLSWHLASET ST
Sbjct  121   PRHHKHYILPNSANKKVHFRPYKQSDGKQNSFKTRTRFRPSGTPVSKTLSWHLASETKST  180

Query  932   LKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLG  1111
             LK  S       D K S +T+G F+L+D  E+    K S + S  P+  P SS AT TLG
Sbjct  181   LKRRSSHASKKKDPKFSAKTTGVFHLIDNEEI-TWLKPSASKSHAPNGVPTSSAATQTLG  239

Query  1112  VM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             V  RDALDG +P+  + SFDN      ET HVP+RSKS+LS+FFVKQ+  K+
Sbjct  240   VSGRDALDGFRPLKTFGSFDNL--NLHETVHVPSRSKSVLSSFFVKQRAAKL  289



>ref|XP_011093141.1| PREDICTED: protein ABIL1-like isoform X1 [Sesamum indicum]
Length=288

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 229/302 (76%), Gaps = 21/302 (7%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             M++E+ +    S MTFDE+SMERS SFV ALQELKNLRPQLYSAAEYCEKSYL+SEQKQM
Sbjct  1     MKMEKARTEKQS-MTFDELSMERSMSFVTALQELKNLRPQLYSAAEYCEKSYLNSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNA+DHLGTVAYKL+D++ QQ  ++S+++LK+TC+NQQLLTCQ YT+
Sbjct  60    VLDNLKDYAVRALVNAIDHLGTVAYKLSDILEQQASEISSIDLKLTCLNQQLLTCQTYTD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQQQLLAIIPRHHKHYTLP+SVNKKVH SPH Q D RQ IQ R      G + AKT
Sbjct  120   KEGLRQQQLLAIIPRHHKHYTLPSSVNKKVHLSPHTQPDPRQAIQLR------GASVAKT  173

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV  1075
             L WHLASET STLKG+  G +S +D K +G+ SG F  LD  +   R K++PA       
Sbjct  174   LCWHLASETKSTLKGSPRGIMSIEDSKLTGKVSGVFKSLD-AQGKTRMKSTPA-------  225

Query  1076  GPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
                + +A  TLGV  RD+L+GSK   P++S +NP   ++ET   P RSKSMLSA FVKQK
Sbjct  226   ---TRVAMQTLGVTRRDSLEGSKSSIPHKSLENP--TKKETVPPPVRSKSMLSALFVKQK  280

Query  1253  TP  1258
              P
Sbjct  281   AP  282



>ref|XP_011093148.1| PREDICTED: protein ABIL1-like isoform X2 [Sesamum indicum]
Length=286

 Score =   369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 188/290 (65%), Positives = 223/290 (77%), Gaps = 20/290 (7%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             +MTFDE+SMERS SFV ALQELKNLRPQLYSAAEYCEKSYL+SEQKQMVL+NLKDYAVRA
Sbjct  10    SMTFDELSMERSMSFVTALQELKNLRPQLYSAAEYCEKSYLNSEQKQMVLDNLKDYAVRA  69

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNA+DHLGTVAYKL+D++ QQ  ++S+++LK+TC+NQQLLTCQ YT+KEG RQQQLLAI
Sbjct  70    LVNAIDHLGTVAYKLSDILEQQASEISSIDLKLTCLNQQLLTCQTYTDKEGLRQQQLLAI  129

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTST  931
             IPRHHKHYTLP+SVNKKVH SPH Q D RQ IQ R      G + AKTL WHLASET ST
Sbjct  130   IPRHHKHYTLPSSVNKKVHLSPHTQPDPRQAIQLR------GASVAKTLCWHLASETKST  183

Query  932   LKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLG  1111
             LKG+  G +S +D K +G+ SG F  LD  +   R K++PA          + +A  TLG
Sbjct  184   LKGSPRGIMSIEDSKLTGKVSGVFKSLD-AQGKTRMKSTPA----------TRVAMQTLG  232

Query  1112  VM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTP  1258
             V  RD+L+GSK   P++S +NP   ++ET   P RSKSMLSA FVKQK P
Sbjct  233   VTRRDSLEGSKSSIPHKSLENP--TKKETVPPPVRSKSMLSALFVKQKAP  280



>ref|XP_004491966.1| PREDICTED: protein ABIL1-like [Cicer arietinum]
Length=292

 Score =   368 bits (944),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 219/284 (77%), Gaps = 5/284 (2%)
 Frame = +2

Query  416   MERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDHL  595
             M   ++FV ALQELKNLRPQLYSAAEYCEKSYLHSEQKQ+VL+NLKDYAVRALVNAVDHL
Sbjct  5     MHHYQTFVNALQELKNLRPQLYSAAEYCEKSYLHSEQKQIVLDNLKDYAVRALVNAVDHL  64

Query  596   GTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHHKHY  775
             GTVAYKLTDL+ Q  LDVSTM+LK++ INQ+LLTCQ YT+KEG RQQQLLA IPRHHKHY
Sbjct  65    GTVAYKLTDLLEQHTLDVSTMDLKVSTINQKLLTCQIYTQKEGLRQQQLLAFIPRHHKHY  124

Query  776   TLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLASETTSTLKGASCG  952
              LPNSVNKKVHFSPHIQ+D +Q+  Q+R R   SG   AKTLSWHLASET STLKG    
Sbjct  125   ILPNSVNKKVHFSPHIQIDAKQNSFQTRTRFQSSGAPPAKTLSWHLASETKSTLKGTPHA  184

Query  953   FVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL-GVMRDAL  1129
               + ++ K S + SG F+LLD  E     K+SPA     +  P SSI   TL G  RDAL
Sbjct  185   SPNIENPKFSAKASGFFHLLDNEE-STWMKSSPAQIHLTNGVPTSSIPVQTLGGTRRDAL  243

Query  1130  DGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPK  1261
             DGSKP+T +RSFDN    RRE+   PTRS+S+ SAFFVKQKTPK
Sbjct  244   DGSKPLTAFRSFDNA--NRRESDQTPTRSRSVPSAFFVKQKTPK  285



>ref|XP_010669659.1| PREDICTED: protein ABIL1 [Beta vulgaris subsp. vulgaris]
Length=305

 Score =   367 bits (943),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 194/305 (64%), Positives = 226/305 (74%), Gaps = 8/305 (3%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             MEVEQ K  PN  MTFDE SMERSK+FVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQM
Sbjct  1     MEVEQIKALPN-PMTFDEASMERSKNFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDY VRALVNAVDHLGTVAYKLTDL+ QQ+ ++ST ELK+TC+NQ++LTC  Y E
Sbjct  60    VLDNLKDYTVRALVNAVDHLGTVAYKLTDLLEQQSSELSTTELKVTCLNQKVLTCHTYME  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
              EG RQQQLLAIIPRHHK Y LPNSVNKKVHFSP  Q D RQ H+Q+R R+ P G   +K
Sbjct  120   MEGLRQQQLLAIIPRHHKRYVLPNSVNKKVHFSPAAQTDLRQMHVQARPRVHPPGSPGSK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHL SET S LKG+     S  +++ +      F LLD  E G R K+    ++P S
Sbjct  180   TLSWHLGSETKSPLKGSHKTVFSGSEVQKASPRPAVFQLLD-DEDGIRAKSMGIHAQPSS  238

Query  1073  VGP-GSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
               P G+S+  +   V +D + GSK +TP+RSFDN    R+     P R KSMLSAFFVKQ
Sbjct  239   ANPVGASLQPYG-AVPKDPVTGSKVVTPFRSFDN---SRQAIIKAPVRHKSMLSAFFVKQ  294

Query  1250  KTPKV  1264
             KTPK+
Sbjct  295   KTPKL  299



>ref|XP_004494773.1| PREDICTED: protein ABIL1-like isoform X1 [Cicer arietinum]
Length=296

 Score =   367 bits (941),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/293 (65%), Positives = 226/293 (77%), Gaps = 6/293 (2%)
 Frame = +2

Query  395   MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRAL  574
             MTFDE SMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHS+QKQM+L+NLKDYA RAL
Sbjct  1     MTFDEFSMERSKSFVFALQELKNLRPQLYSAAEYCEKSYLHSDQKQMLLDNLKDYAARAL  60

Query  575   VNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAII  754
             VNAVDHLGTVAYKLTDL+ QQ LD+STM+LKI+ +NQ+LLTCQ YT+KEG RQQ+LL+ I
Sbjct  61    VNAVDHLGTVAYKLTDLLDQQTLDISTMDLKISTLNQRLLTCQTYTDKEGLRQQKLLSFI  120

Query  755   PRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLASETTST  931
             PRHHKHY LPNS NKKVHF P+ Q D +Q+  ++R R  PSG   +KTLSWHLASET ST
Sbjct  121   PRHHKHYILPNSANKKVHFRPYKQSDGKQNSFKTRTRFRPSGTPVSKTLSWHLASETKST  180

Query  932   LK-GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL  1108
             LK  +S    +  D K S +T+G F+L+D  E+    K S + S  P+  P SS AT TL
Sbjct  181   LKRRSSHASKNRKDPKFSAKTTGVFHLIDNEEI-TWLKPSASKSHAPNGVPTSSAATQTL  239

Query  1109  GVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             GV  RDALDG +P+  + SFDN      ET HVP+RSKS+LS+FFVKQ+  K+
Sbjct  240   GVSGRDALDGFRPLKTFGSFDNL--NLHETVHVPSRSKSVLSSFFVKQRAAKL  290



>ref|XP_011093158.1| PREDICTED: protein ABIL1-like isoform X3 [Sesamum indicum]
Length=285

 Score =   365 bits (938),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 227/302 (75%), Gaps = 24/302 (8%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             M++E+ +    S MTFDE+SMERS SFV ALQELKNLRPQLYSAAEYCEKSYL+SEQKQM
Sbjct  1     MKMEKARTEKQS-MTFDELSMERSMSFVTALQELKNLRPQLYSAAEYCEKSYLNSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNA+DHLGTVAYKL+D++ QQ  ++S+++LK+TC+NQQLLTCQ YT+
Sbjct  60    VLDNLKDYAVRALVNAIDHLGTVAYKLSDILEQQASEISSIDLKLTCLNQQLLTCQTYTD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQQQLLAIIPRHHKHYTLP+SVNKKVH SPH Q D RQ IQ R          AKT
Sbjct  120   KEGLRQQQLLAIIPRHHKHYTLPSSVNKKVHLSPHTQPDPRQAIQLR---------VAKT  170

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV  1075
             L WHLASET STLKG+  G +S +D K +G+ SG F  LD  +   R K++PA       
Sbjct  171   LCWHLASETKSTLKGSPRGIMSIEDSKLTGKVSGVFKSLD-AQGKTRMKSTPA-------  222

Query  1076  GPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
                + +A  TLGV  RD+L+GSK   P++S +NP   ++ET   P RSKSMLSA FVKQK
Sbjct  223   ---TRVAMQTLGVTRRDSLEGSKSSIPHKSLENP--TKKETVPPPVRSKSMLSALFVKQK  277

Query  1253  TP  1258
              P
Sbjct  278   AP  279



>ref|XP_010251588.1| PREDICTED: protein ABIL1-like isoform X2 [Nelumbo nucifera]
Length=297

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 216/296 (73%), Gaps = 7/296 (2%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P +SAMTFDE+SMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLH+E KQMVL+NLKDY
Sbjct  6     PESSAMTFDEISMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHTEHKQMVLDNLKDY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
             AVRALVNAVDHLGTV YKLTDL  Q  LDVSTMELK++ +NQQLLTCQ YT+KEG RQQQ
Sbjct  66    AVRALVNAVDHLGTVTYKLTDLFEQHKLDVSTMELKVSSLNQQLLTCQIYTDKEGLRQQQ  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLAS  916
             L  +IP HHKHY LP  +NKKV FSP IQ+D RQ HIQ+R R  PSG   ++TLSWHLAS
Sbjct  126   LFTVIPGHHKHYILP--INKKVQFSPQIQIDARQMHIQARPRFHPSGNPPSQTLSWHLAS  183

Query  917   ETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIA  1096
             ET STL  +   F+  +D K+SG TSG F LL G E    +K++ A     S GP  +  
Sbjct  184   ETKSTLNRSEHTFIGMEDTKASGATSGVFQLL-GSEEAVSSKSTAACLHSASGGPSYNTV  242

Query  1097  THTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPK  1261
               T  V  RD  +GSK +  +RS DN    R E      RSKSMLSAFFVK K+ K
Sbjct  243   LQTFCVTERDTSEGSKSLMAFRSLDN--MGRHEIIRPTVRSKSMLSAFFVKPKSSK  296



>ref|XP_006397808.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum]
 gb|ESQ39261.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum]
Length=305

 Score =   362 bits (928),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 219/294 (74%), Gaps = 5/294 (2%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDEVSMERSKSFV ALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTFDEVSMERSKSFVTALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQN D+STMEL+ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PS   A+K+LSWHL SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSET  189

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG +    S+ D K+  +TSG F+LL G E     K   A S+ P V   S+    
Sbjct  190   KSTLKGTTTVAPSSKDSKAFTKTSGVFHLL-GDEENLINKKPLAGSQVPGVPATSTTTRQ  248

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             T GV    ++  K M+ ++S DN   PRRE    P R+KS+LSAFFVKQKTPK+
Sbjct  249   TYGVAHKDVEVPKLMSAHKSLDN---PRREIIQAPVRTKSVLSAFFVKQKTPKL  299



>ref|XP_010518288.1| PREDICTED: protein ABIL1-like isoform X1 [Camelina sativa]
Length=306

 Score =   361 bits (927),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 188/294 (64%), Positives = 219/294 (74%), Gaps = 4/294 (1%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQN D+STM L+ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQNSDISTMVLRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PS   A+K+LSWHL SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSET  189

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG F+LL G E  N  K   A S+   V   S++   
Sbjct  190   KSTLKGTSTVAPSSKDSKAFTKTSGVFHLL-GDEENNTNKKPLAGSQVSGVPAVSTVTKQ  248

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
               GV    L+  K +  ++S DN  + RRE    P R+KS+LSAFFVKQKTPK+
Sbjct  249   AYGVAHRDLEVPKLVAAHKSLDN--NQRREIIQAPVRTKSVLSAFFVKQKTPKL  300



>ref|XP_010506619.1| PREDICTED: protein ABIL1 isoform X1 [Camelina sativa]
Length=306

 Score =   361 bits (927),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 219/294 (74%), Gaps = 4/294 (1%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +AL+NAVDHLGTVA KLTDL  QQN D+STM L+ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALINAVDHLGTVASKLTDLFDQQNSDISTMVLRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PS   A+K+LSWHL SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSET  189

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG F+LL G E  N  K   A S+   V   S++   
Sbjct  190   KSTLKGTSTVAPSSKDSKAFTKTSGVFHLL-GDEENNTNKKPLAGSQVSGVPAVSTVTKQ  248

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
               GV    L+  K +  ++S DN  + RRE    P R+KS+LSAFFVKQKTPK+
Sbjct  249   AYGVAHKDLEVPKLVAAHKSLDN--NQRREIIQAPVRTKSVLSAFFVKQKTPKL  300



>ref|XP_010261431.1| PREDICTED: protein ABIL1 isoform X1 [Nelumbo nucifera]
Length=298

 Score =   357 bits (915),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 194/291 (67%), Positives = 216/291 (74%), Gaps = 7/291 (2%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYL+SEQKQMVL+NLKDYAVRA
Sbjct  8     AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLNSEQKQMVLDNLKDYAVRA  67

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVAYKLTDL  QQ L+VSTMELK++C++QQLLTCQ Y +KEG RQQQLLA 
Sbjct  68    LVNAVDHLGTVAYKLTDLFEQQTLEVSTMELKVSCLDQQLLTCQIYMDKEGLRQQQLLAF  127

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQ-MDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASETT  925
             IPRHHKHY LPNSVNKKV FSP IQ  D RQ H Q+R RL  SG   +KTLSWHLASET 
Sbjct  128   IPRHHKHYILPNSVNKKVQFSPQIQAADARQMHFQARSRLHTSGTPPSKTLSWHLASETK  187

Query  926   STLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHT  1105
             STL G     +  +  K+SG TSG F LLD  E  + +K+S A     S    SS    T
Sbjct  188   STLNGTQHALMGMEGPKASGSTSGTFQLLDPEESVS-SKSSTARLHFSSGSSASSTVPQT  246

Query  1106  LGVMR--DALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
              GV R   + +GSK +T +RS DN  H   +    P R KS+LSAFFVK K
Sbjct  247   FGVTRRDTSSEGSKQLTAFRSIDNRGH--NQIIRAPVRRKSILSAFFVKPK  295



>ref|XP_009142675.1| PREDICTED: protein ABIL1 [Brassica rapa]
Length=303

 Score =   355 bits (912),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 219/295 (74%), Gaps = 8/295 (3%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDE SMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTFDEASMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQ+ DVSTME++ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQSCDVSTMEMRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHL-ASE  919
             A+IP HHKHY LPNSVNK+VHFSP  + + RQ H Q+  RL PS   A+K+LSWHL  SE
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRSESRQNHSQAISRLQPSDAPASKSLSWHLGGSE  189

Query  920   TTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIAT  1099
             T STLKG +    S+ D K+  +TSG F+LL   E     K     S+   V   SSI  
Sbjct  190   TKSTLKGTTTVASSSKDSKAFAKTSGVFHLLGDEE---NIKPLVGGSQVSGVPGTSSITR  246

Query  1100  HTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              T GV +  ++  K MT ++SFDN   PRRE    P R+KS+LSAFFVKQKTPK+
Sbjct  247   QTYGVAQKDMEAPKLMTGHKSFDN---PRREIIQAPVRTKSVLSAFFVKQKTPKL  298



>ref|XP_002880226.1| hypothetical protein ARALYDRAFT_483770 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56485.1| hypothetical protein ARALYDRAFT_483770 [Arabidopsis lyrata subsp. 
lyrata]
Length=298

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/294 (64%), Positives = 216/294 (73%), Gaps = 12/294 (4%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQN D+STMEL+ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PS   A+K+LSWHL SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSET  189

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    ++ D K+  +TSG F+LL  G+  N     P      S  P +S A  
Sbjct  190   KSTLKGTSTVAPNSKDSKAFTKTSGVFHLL--GDEENVVNKKPLAGSQVSGVPATSTAHK  247

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              L V        K +T +RS DN  +PRRE    P R+KS+LSAFFVKQK PK+
Sbjct  248   DLEV-------PKLLTAHRSLDN--NPRREIIQAPVRTKSVLSAFFVKQKAPKL  292



>emb|CDX79998.1| BnaA05g01580D [Brassica napus]
Length=303

 Score =   353 bits (906),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 218/295 (74%), Gaps = 8/295 (3%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDE SMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTFDEASMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQ+ DVSTME++ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQSCDVSTMEMRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHL-ASE  919
             A+IP HHKHY LPNSVNK+VHFSP  + + RQ H Q+  RL PS   A+K+LSWHL  SE
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRSESRQNHSQAISRLQPSDAPASKSLSWHLGGSE  189

Query  920   TTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIAT  1099
             T STLKG +    S+ D K+  +TSG F+LL   E     K     S+   V   SSI  
Sbjct  190   TKSTLKGTTTVASSSKDSKAFAKTSGVFHLLGDEE---NIKPLVGGSQVSGVPGTSSITR  246

Query  1100  HTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              T GV +  ++  K MT ++S DN   PRRE    P R+KS+LSAFFVKQKTPK+
Sbjct  247   QTYGVAQKDMEAPKLMTGHKSLDN---PRREIIQAPVRTKSVLSAFFVKQKTPKL  298



>ref|XP_006294665.1| hypothetical protein CARUB_v10023702mg [Capsella rubella]
 gb|EOA27563.1| hypothetical protein CARUB_v10023702mg [Capsella rubella]
Length=306

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 184/292 (63%), Positives = 216/292 (74%), Gaps = 4/292 (1%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTFDEVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V+A
Sbjct  12    AMTFDEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKA  71

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVA KLTDL  QQN D+STMEL+ +C++QQLLTC+ Y +KEG RQQQLLA+
Sbjct  72    LVNAVDHLGTVASKLTDLFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLLAV  131

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASETTS  928
             IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PS   A+K+LSWHL SET S
Sbjct  132   IPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSETKS  191

Query  929   TLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL  1108
             TLKG S    S+ D K+  +TSG F+L+ G E     K     S    V   S++     
Sbjct  192   TLKGTSTIAPSSKDSKAFTKTSGVFHLV-GDEENIVNKKPLVGSHVSGVPAVSTVTKQAY  250

Query  1109  GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             GV+   L+  K +  ++S DN  + RRE    P R+KS+LSAFFVKQKTPK+
Sbjct  251   GVVHKDLEVPKLLAVHKSVDN--NQRREIIQAPVRTKSVLSAFFVKQKTPKL  300



>ref|NP_566067.1| protein ABIL1 [Arabidopsis thaliana]
 sp|Q8S8M5.1|ABIL1_ARATH RecName: Full=Protein ABIL1; AltName: Full=Abl interactor-like 
protein 1; Short=AtABIL1 [Arabidopsis thaliana]
 gb|AAM15048.1| expressed protein [Arabidopsis thaliana]
 gb|AAM61699.1| unknown [Arabidopsis thaliana]
 gb|AAW49256.1| Abl interactor-like protein-1 [Arabidopsis thaliana]
 gb|ABF85765.1| At2g46225 [Arabidopsis thaliana]
 gb|AEC10659.1| protein ABIL1 [Arabidopsis thaliana]
Length=298

 Score =   352 bits (902),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/294 (63%), Positives = 215/294 (73%), Gaps = 12/294 (4%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMT DEVSMER+KSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTLDEVSMERNKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL   QN D+STME++ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDHQNSDISTMEMRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PS   A+K+LSWHL SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSET  189

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG F+LL  G+  N     P      S  P +S A  
Sbjct  190   KSTLKGTSTVAPSSKDSKAFSKTSGVFHLL--GDDENIANKKPLAGSQVSGVPAASTAHK  247

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              L V        K +T +RS DN  +PRRE    P R+KS+LSAFFVKQKTPK+
Sbjct  248   DLEV-------PKLLTAHRSLDN--NPRREIIQAPVRTKSVLSAFFVKQKTPKL  292



>ref|XP_010508051.1| PREDICTED: protein ABIL1-like isoform X1 [Camelina sativa]
Length=306

 Score =   352 bits (903),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/294 (62%), Positives = 217/294 (74%), Gaps = 4/294 (1%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             NS MTFD+VSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NSTMTFDDVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQN D+STM L+ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQNSDISTMVLRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PS   A+K+LSWHL SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSET  189

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG F+L+ G E     K   A S+   V   S++   
Sbjct  190   KSTLKGTSTVAPSSKDSKAFTKTSGVFHLI-GDEENIINKKPLAGSQVSGVPAVSTVTKQ  248

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
               GV    L+  K +  ++S +N  + RRE    P R+KS+LSAFFVKQKTPK+
Sbjct  249   AYGVAHKDLEVPKLLAAHKSLEN--NQRREIIQAPVRTKSVLSAFFVKQKTPKL  300



>emb|CDY42020.1| BnaC04g00980D [Brassica napus]
Length=303

 Score =   352 bits (902),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 220/297 (74%), Gaps = 12/297 (4%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQ+ DVS ME++ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQSSDVSIMEMRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHL-ASE  919
             A+IP HHKHY LPNSVNK+VHFSP  + + RQ H Q+  RL PS   A+K+LSWHL  SE
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRSESRQNHSQAISRLQPSDAPASKSLSWHLGGSE  189

Query  920   TTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVG-PG-SSI  1093
             T STLKG +    S+ D K+  +TSG F+LL     G+     P      + G PG S+I
Sbjct  190   TKSTLKGTTTVAPSSKDSKAFAKTSGVFHLL-----GDEENIKPLVGGSQASGVPGTSTI  244

Query  1094  ATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
                T GV +  ++  K MT ++S DN   PRRE    P R+KS+LSAFFVKQKTPK+
Sbjct  245   TRQTYGVAQKDMEAPKLMTGHKSLDN---PRREIIQAPVRTKSVLSAFFVKQKTPKL  298



>dbj|BAC43461.1| unknown protein [Arabidopsis thaliana]
Length=298

 Score =   350 bits (899),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 185/294 (63%), Positives = 215/294 (73%), Gaps = 12/294 (4%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMT DEVSMER+KSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTLDEVSMERNKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL   QN D+STME++ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDHQNSDISTMEMRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PS   A+K+LSWHL SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSDAPASKSLSWHLGSET  189

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG F+LL  G+  N     P      S  P +S A  
Sbjct  190   KSTLKGTSTVAPSSKDSKAFSKTSGVFHLL--GDDENIANKKPLAGSQVSGVPAASTAHK  247

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              L V        K +T +RS DN  +PRRE    P R+KS+LSAFFVKQKTPK+
Sbjct  248   DLEV-------PKLLTAHRSLDN--NPRREIILAPVRTKSVLSAFFVKQKTPKL  292



>gb|KFK37419.1| hypothetical protein AALP_AA4G254700 [Arabis alpina]
Length=290

 Score =   350 bits (898),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 185/294 (63%), Positives = 214/294 (73%), Gaps = 20/294 (7%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDEVSME SKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NQAMTFDEVSMEHSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQN D+STMEL+ +C+NQQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQNSDISTMELRASCVNQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHYTLPNSVNK+VHFSP  + D RQ H Q+  RL PSG            SET
Sbjct  130   AVIPMHHKHYTLPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSG------------SET  177

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG FNLL     G+      A S+  SV   S++   
Sbjct  178   KSTLKGTSAVAPSSRDSKAFTKTSGVFNLL-----GDEENKPLAGSQVSSVPATSTVTKQ  232

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             T GV+   L+  KP+T ++S DN  +PRRE    P R+KS+LSAFFVKQKT K+
Sbjct  233   TYGVVHKDLEVPKPLTVHKSLDN--NPRREIIRAPVRTKSVLSAFFVKQKTQKL  284



>gb|AFK45593.1| unknown [Lotus japonicus]
Length=301

 Score =   350 bits (898),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 220/297 (74%), Gaps = 9/297 (3%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSE--QKQMVLENLKDYAV  565
             AMTFDEVSME SKSFV ALQELKNLRPQLYSAAEYCE SYL SE   KQMVL+NLKDY V
Sbjct  2     AMTFDEVSMEHSKSFVFALQELKNLRPQLYSAAEYCENSYLRSECDHKQMVLDNLKDYTV  61

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             RALVNAVDHLGTVAYKLTDL+ QQ LDVSTM+LKI+ +NQ+LLTC+ YT+KEG RQQQLL
Sbjct  62    RALVNAVDHLGTVAYKLTDLLEQQTLDVSTMDLKISSLNQKLLTCRTYTDKEGLRQQQLL  121

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHI-QMDHRQH-IQSRGRLFPSGPAAAKTLSWHLASE  919
             A IPRHHKHY LPN+VNKKVHF+PHI ++D R++  Q+R     SG   AKTLSWHLASE
Sbjct  122   AYIPRHHKHYILPNAVNKKVHFNPHIKKIDTRKNSFQTRTGPLSSGTPVAKTLSWHLASE  181

Query  920   TTSTLKGASC-GFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIA  1096
             T STLK  +      + D K S +T+G F+LLD  E   + K S   +  P+  P S  A
Sbjct  182   TKSTLKKRTLHASTKSKDPKFSAKTTGVFHLLDNEE-NTQMKPSAGQNHLPNGVPTSRAA  240

Query  1097  THTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             THT+GV  RDAL+G KP+T + SF N    R E    P+RSKSML +FFVK K  K+
Sbjct  241   THTVGVTGRDALEGIKPLTAFGSFGNV--KRGEAAQAPSRSKSMLFSFFVKTKAAKI  295



>ref|XP_003554741.1| PREDICTED: protein ABIL1-like [Glycine max]
Length=301

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/294 (63%), Positives = 218/294 (74%), Gaps = 6/294 (2%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTFDEVSME +KSF+ ALQELKNLRPQLYSAA+YCEKSYL+S++KQM+LENLKDYA RA
Sbjct  5     AMTFDEVSMEHNKSFIFALQELKNLRPQLYSAADYCEKSYLNSDKKQMILENLKDYAARA  64

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVAYKL+D++ +Q  DVSTM+LK++ +NQ+LLTC  YT+KEG RQQQLLA 
Sbjct  65    LVNAVDHLGTVAYKLSDILEKQTFDVSTMDLKVSTLNQRLLTCHMYTDKEGLRQQQLLAF  124

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLASETTS  928
             IPRHHKHY LPNSV+KKVHF PH ++  RQ+  Q+R RL  SG   +KTLSWHLASET  
Sbjct  125   IPRHHKHYILPNSVHKKVHFIPHRKIGARQNSFQTRTRLHSSGTPISKTLSWHLASETKF  184

Query  929   TLKG-ASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHT  1105
             TLK  AS    +A D K S +TSG F+LL G E   R K S A     +  P S  AT T
Sbjct  185   TLKKQASRTSKNAKDSKFSAKTSGVFHLL-GSEGSTRMKTSAAQPHLANGVPTSGAATQT  243

Query  1106  LGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             LG   RDAL  SKP+T Y SFD+     RE   V TRSKS+LS+F VKQ   K+
Sbjct  244   LGATSRDALKRSKPLTAYGSFDD--RNGREAVQVHTRSKSVLSSFLVKQAAAKL  295



>ref|XP_010261432.1| PREDICTED: protein ABIL1 isoform X2 [Nelumbo nucifera]
Length=296

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 214/291 (74%), Gaps = 9/291 (3%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYL+SEQKQMVL+NLKDYAVRA
Sbjct  8     AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLNSEQKQMVLDNLKDYAVRA  67

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVAYKLTDL  QQ L+VSTMELK++C++QQLLTCQ Y +KEG RQQQLLA 
Sbjct  68    LVNAVDHLGTVAYKLTDLFEQQTLEVSTMELKVSCLDQQLLTCQIYMDKEGLRQQQLLAF  127

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQ-MDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASETT  925
             IPRHHKHY LP  +NKKV FSP IQ  D RQ H Q+R RL  SG   +KTLSWHLASET 
Sbjct  128   IPRHHKHYILP--INKKVQFSPQIQAADARQMHFQARSRLHTSGTPPSKTLSWHLASETK  185

Query  926   STLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHT  1105
             STL G     +  +  K+SG TSG F LLD  E  + +K+S A     S    SS    T
Sbjct  186   STLNGTQHALMGMEGPKASGSTSGTFQLLDPEESVS-SKSSTARLHFSSGSSASSTVPQT  244

Query  1106  LGVMR--DALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
              GV R   + +GSK +T +RS DN  H   +    P R KS+LSAFFVK K
Sbjct  245   FGVTRRDTSSEGSKQLTAFRSIDNRGH--NQIIRAPVRRKSILSAFFVKPK  293



>ref|XP_003626514.1| Protein ABIL1 [Medicago truncatula]
 gb|AES82732.1| ABIL1-like protein [Medicago truncatula]
Length=293

 Score =   346 bits (887),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 220/289 (76%), Gaps = 6/289 (2%)
 Frame = +2

Query  407   EVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAV  586
             E +ME+SKSFV ALQELKNLRPQLYSAA+YCEKSYL S+QK++VL+N+KDYA RALVNAV
Sbjct  2     EFAMEQSKSFVFALQELKNLRPQLYSAADYCEKSYLRSDQKEIVLDNMKDYAARALVNAV  61

Query  587   DHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHH  766
             DHLGTVA KL+DL+ QQ LDVSTM+LKI+ +NQ+LLTCQ YT KEG RQQQLLAIIPRHH
Sbjct  62    DHLGTVACKLSDLLEQQTLDVSTMDLKISTLNQRLLTCQVYTNKEGVRQQQLLAIIPRHH  121

Query  767   KHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLASETTSTLKG-  940
             KHY LPNSVNKKVHF P+ Q D +Q+  ++R R  PSG   AKTLSWHLASET STLK  
Sbjct  122   KHYILPNSVNKKVHFRPYKQTDAKQNSFRTRNRPQPSGTPVAKTLSWHLASETKSTLKKR  181

Query  941   ASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVM-  1117
             +S       D K S +T+G F+L D  E+  R K S + +  P+  P S  AT TLGV  
Sbjct  182   SSHASKKIKDAKFSAKTTGVFHLTDNEEI-TRFKPSASNNHVPNGVPTSGAATQTLGVTG  240

Query  1118  RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             RDAL+  +P+T + SFDN      ET HVP+RSKS+LS+FFVKQ++ K+
Sbjct  241   RDALEDFRPLTTFGSFDN--RNVHETVHVPSRSKSVLSSFFVKQRSAKL  287



>ref|XP_006397807.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum]
 gb|ESQ39260.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum]
Length=293

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 182/294 (62%), Positives = 211/294 (72%), Gaps = 17/294 (6%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDEVSMERSKSFV ALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTFDEVSMERSKSFVTALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQN D+STMEL+ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PSG            SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSG------------SET  177

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG +    S+ D K+  +TSG F+LL G E     K   A S+ P V   S+    
Sbjct  178   KSTLKGTTTVAPSSKDSKAFTKTSGVFHLL-GDEENLINKKPLAGSQVPGVPATSTTTRQ  236

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             T GV    ++  K M+ ++S DN   PRRE    P R+KS+LSAFFVKQKTPK+
Sbjct  237   TYGVAHKDVEVPKLMSAHKSLDN---PRREIIQAPVRTKSVLSAFFVKQKTPKL  287



>ref|XP_010924779.1| PREDICTED: protein ABIL1-like isoform X1 [Elaeis guineensis]
Length=303

 Score =   340 bits (872),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 213/296 (72%), Gaps = 5/296 (2%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSY+H+EQKQMVL+NLKDYAV
Sbjct  8     NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYVHNEQKQMVLDNLKDYAV  67

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             RALVNAVDHLGTVAYKLTDL  QQ LD+ST+ELKI+C+NQQ+LTCQ YT+KEG RQQ++ 
Sbjct  68    RALVNAVDHLGTVAYKLTDLFEQQTLDISTLELKISCLNQQILTCQTYTDKEGLRQQRMF  127

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHR-QHIQSRGRLFPSGPAAAKTLSWHLASET  922
                PRHHKHY LPNS +++V  S  +Q D    H+Q + R  P G  A+KTLSWHLASET
Sbjct  128   TNNPRHHKHYILPNSASRQVQSSSQLQKDATLNHVQPKPRPHPPGTPASKTLSWHLASET  187

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              S L GA     S  DI +   TS AF+ LD  + G     S    +  S  P S++A  
Sbjct  188   NSPLNGAPHAASSIGDIMAPKITSEAFHFLDTEDAGAPMPLSTHL-RSASGTPTSNMALR  246

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
             + G+ RD+L  SK +T +RSFDNP   R +    P RSKSMLSAFF K K+ K  K
Sbjct  247   SFGI-RDSLGPSKTLTAFRSFDNP--GRLQVYRPPARSKSMLSAFFAKNKSLKPRK  299



>ref|XP_010506621.1| PREDICTED: protein ABIL1 isoform X2 [Camelina sativa]
Length=294

 Score =   340 bits (872),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 211/294 (72%), Gaps = 16/294 (5%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +AL+NAVDHLGTVA KLTDL  QQN D+STM L+ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALINAVDHLGTVASKLTDLFDQQNSDISTMVLRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PSG            SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSG------------SET  177

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG F+LL G E  N  K   A S+   V   S++   
Sbjct  178   KSTLKGTSTVAPSSKDSKAFTKTSGVFHLL-GDEENNTNKKPLAGSQVSGVPAVSTVTKQ  236

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
               GV    L+  K +  ++S DN  + RRE    P R+KS+LSAFFVKQKTPK+
Sbjct  237   AYGVAHKDLEVPKLVAAHKSLDN--NQRREIIQAPVRTKSVLSAFFVKQKTPKL  288



>ref|XP_010518289.1| PREDICTED: protein ABIL1-like isoform X2 [Camelina sativa]
Length=294

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 182/294 (62%), Positives = 211/294 (72%), Gaps = 16/294 (5%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQN D+STM L+ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQNSDISTMVLRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PSG            SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSG------------SET  177

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG F+LL G E  N  K   A S+   V   S++   
Sbjct  178   KSTLKGTSTVAPSSKDSKAFTKTSGVFHLL-GDEENNTNKKPLAGSQVSGVPAVSTVTKQ  236

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
               GV    L+  K +  ++S DN  + RRE    P R+KS+LSAFFVKQKTPK+
Sbjct  237   AYGVAHRDLEVPKLVAAHKSLDN--NQRREIIQAPVRTKSVLSAFFVKQKTPKL  288



>gb|EYU32190.1| hypothetical protein MIMGU_mgv1a011425mg [Erythranthe guttata]
Length=282

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/293 (61%), Positives = 222/293 (76%), Gaps = 21/293 (7%)
 Frame = +2

Query  395   MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRAL  574
             MT DEVS+++SKSFV ALQELKNLRPQLYSAAEYCEKSYL++++KQM ++NLKDYA+RAL
Sbjct  1     MTPDEVSIDKSKSFVTALQELKNLRPQLYSAAEYCEKSYLNNDKKQMFMDNLKDYALRAL  60

Query  575   VNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAII  754
             VNA+DHLGTVAYKL+D++ QQ +++S+++ K+TC+NQ+LLTC+ YT+KEG RQQQLLAII
Sbjct  61    VNAIDHLGTVAYKLSDVLEQQTMEISSVDSKVTCLNQKLLTCRTYTDKEGLRQQQLLAII  120

Query  755   PRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTL  934
             PRHHKHY LPNSV KKV FS H+Q D RQ  Q++GRL+PS   AAKTLSWHLASET S +
Sbjct  121   PRHHKHYILPNSV-KKVDFSTHVQTDSRQTAQAKGRLYPS---AAKTLSWHLASETKSIM  176

Query  935   KGASCGFVSADD-IKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLG  1111
             KG+  G +S +D   S   +S AFN LDG   G R   S          P + +A  TLG
Sbjct  177   KGSPRGIMSTEDSKLSKKSSSSAFNSLDGQ--GKRKMKS---------TPATRVAMQTLG  225

Query  1112  VMR--DALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKS-MLSAFFVKQKTPK  1261
             V R  D+L+GSKP+ PY+ FDN    R+E    P RSKS ++SAFFVKQK  K
Sbjct  226   VTRRKDSLEGSKPVIPYKPFDNV--SRKEIVPPPDRSKSTVVSAFFVKQKGTK  276



>ref|NP_001118534.1| protein ABIL1 [Arabidopsis thaliana]
 gb|AEC10660.1| protein ABIL1 [Arabidopsis thaliana]
Length=329

 Score =   340 bits (871),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 216/325 (66%), Gaps = 43/325 (13%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMT DEVSMER+KSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTLDEVSMERNKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL   QN D+STME++ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDHQNSDISTMEMRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPA-------------  883
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PSG               
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSGAMSSSLSLLVNNTSS  189

Query  884   ------------------AAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNL  1009
                               A+K+LSWHL SET STLKG S    S+ D K+  +TSG F+L
Sbjct  190   QISNSLSNMLGLTHLDAPASKSLSWHLGSETKSTLKGTSTVAPSSKDSKAFSKTSGVFHL  249

Query  1010  LDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRR  1189
             L  G+  N     P      S  P +S A   L V        K +T +RS DN  +PRR
Sbjct  250   L--GDDENIANKKPLAGSQVSGVPAASTAHKDLEV-------PKLLTAHRSLDN--NPRR  298

Query  1190  ETTHVPTRSKSMLSAFFVKQKTPKV  1264
             E    P R+KS+LSAFFVKQKTPK+
Sbjct  299   EIIQAPVRTKSVLSAFFVKQKTPKL  323



>gb|KEH18771.1| ABIL1-like protein [Medicago truncatula]
Length=292

 Score =   337 bits (865),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 177/261 (68%), Positives = 201/261 (77%), Gaps = 4/261 (2%)
 Frame = +2

Query  356   MEVEQPKPP--PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQK  529
             ME+E+P      +SAMTFDEVSMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQK
Sbjct  1     MELERPTTTFHNSSAMTFDEVSMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQK  60

Query  530   QMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAY  709
             QMVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ Q  LDVSTM LK++ INQ+L TCQ Y
Sbjct  61    QMVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQHTLDVSTMGLKVSTINQKLHTCQIY  120

Query  710   TEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAA  886
             T+KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ+D +Q+  Q+R R   SG   
Sbjct  121   TDKEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQIDAKQNSFQTRTRFQSSGTPP  180

Query  887   AKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKP  1066
             AKTLSWHLASET STLKG      + ++ K + + SG F+LLD  E     K+SPA +  
Sbjct  181   AKTLSWHLASETKSTLKGTPQASPNIENPKFAAKASGYFHLLDNEE-STWMKSSPAHTHL  239

Query  1067  PSVGPGSSIATHTLGVMRDAL  1129
             P+  P S+I   TLG  R  +
Sbjct  240   PNGVPTSTIPVQTLGGTRRVI  260



>ref|XP_011093076.1| PREDICTED: protein ABIL1-like isoform X2 [Sesamum indicum]
Length=236

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 197/245 (80%), Gaps = 14/245 (6%)
 Frame = +2

Query  533   MVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYT  712
             MVL+NLKDYAVRALVNA+DHLGTVAYKLTD++ QQ LD+S+M+LK+TC+NQQLLTCQ YT
Sbjct  1     MVLDNLKDYAVRALVNAIDHLGTVAYKLTDILEQQTLDISSMDLKVTCLNQQLLTCQTYT  60

Query  713   EKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAK  892
             +KEG RQQQ+LAIIP+HHKHY LPN+VNKKVHFSPHIQ D RQ IQ+RGRL+PSG +AAK
Sbjct  61    DKEGLRQQQVLAIIPKHHKHYLLPNNVNKKVHFSPHIQTDPRQPIQARGRLYPSGASAAK  120

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG+S G +S +D KS G+T GAFNLLD  E   + K+ PA      
Sbjct  121   TLSWHLASETKSTLKGSSRGILSTEDSKSHGKTPGAFNLLDLEE-NTQMKSIPA------  173

Query  1073  VGPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
                 SS+A  TLGV  RD+ DG +P+TP+RSFDNP    RE    P RSKS+LSAFFVKQ
Sbjct  174   ----SSVAMQTLGVTRRDSSDGLRPLTPHRSFDNP--TLREIVRPPVRSKSVLSAFFVKQ  227

Query  1250  KTPKV  1264
             KTPK+
Sbjct  228   KTPKL  232



>ref|XP_011093164.1| PREDICTED: protein ABIL1-like isoform X4 [Sesamum indicum]
Length=264

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/270 (64%), Positives = 205/270 (76%), Gaps = 20/270 (7%)
 Frame = +2

Query  452   ELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVG  631
             ELKNLRPQLYSAAEYCEKSYL+SEQKQMVL+NLKDYAVRALVNA+DHLGTVAYKL+D++ 
Sbjct  8     ELKNLRPQLYSAAEYCEKSYLNSEQKQMVLDNLKDYAVRALVNAIDHLGTVAYKLSDILE  67

Query  632   QQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHF  811
             QQ  ++S+++LK+TC+NQQLLTCQ YT+KEG RQQQLLAIIPRHHKHYTLP+SVNKKVH 
Sbjct  68    QQASEISSIDLKLTCLNQQLLTCQTYTDKEGLRQQQLLAIIPRHHKHYTLPSSVNKKVHL  127

Query  812   SPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRT  991
             SPH Q D RQ IQ R      G + AKTL WHLASET STLKG+  G +S +D K +G+ 
Sbjct  128   SPHTQPDPRQAIQLR------GASVAKTLCWHLASETKSTLKGSPRGIMSIEDSKLTGKV  181

Query  992   SGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVM-RDALDGSKPMTPYRSFD  1168
             SG F  LD  +   R K++PA          + +A  TLGV  RD+L+GSK   P++S +
Sbjct  182   SGVFKSLD-AQGKTRMKSTPA----------TRVAMQTLGVTRRDSLEGSKSSIPHKSLE  230

Query  1169  NPPHPRRETTHVPTRSKSMLSAFFVKQKTP  1258
             NP   ++ET   P RSKSMLSA FVKQK P
Sbjct  231   NP--TKKETVPPPVRSKSMLSALFVKQKAP  258



>emb|CDX83376.1| BnaA03g21300D [Brassica napus]
Length=307

 Score =   337 bits (863),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 215/295 (73%), Gaps = 9/295 (3%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTF+EVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V+A
Sbjct  12    AMTFEEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKA  71

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVA KLTDL   Q+ D+STM+L+ +C++QQLLT + Y +KEG RQQQLLA+
Sbjct  72    LVNAVDHLGTVASKLTDLFDHQSSDISTMQLRASCVSQQLLTSRTYIDKEGLRQQQLLAV  131

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQ-SRGRLFPSGPAAAKTLSWHLASETT  925
             IP HHKHYTLPNSVNK+VHFSP  + D RQ H Q    RL PS   ++K+LSWHL SET 
Sbjct  132   IPMHHKHYTLPNSVNKRVHFSPLRRTDTRQNHYQVDISRLQPSDAPSSKSLSWHLGSETK  191

Query  926   STLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASP--AWSKPPSVGPGSSIAT  1099
             STLKG +    S+ D K+  +TSG F+L   G+  N     P    S+   V   S+IA 
Sbjct  192   STLKGTTSVASSSKDSKAFVKTSGVFHL--SGDEENIINKKPFVGVSQVSGVPATSTIAR  249

Query  1100  HTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              T GV   A++  K  T  +S DN   PR+E    P R+KS++SAFFVK KTPK+
Sbjct  250   QTYGVAHKAVEVPKLTTAQKSHDN---PRQEIIQAPVRTKSVMSAFFVKPKTPKL  301



>ref|XP_007147254.1| hypothetical protein PHAVU_006G108900g [Phaseolus vulgaris]
 gb|ESW19248.1| hypothetical protein PHAVU_006G108900g [Phaseolus vulgaris]
Length=296

 Score =   335 bits (860),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 184/300 (61%), Positives = 219/300 (73%), Gaps = 20/300 (7%)
 Frame = +2

Query  395   MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRAL  574
             MT D VSME SKSF+ ALQELKNLRPQLYSAAEYCEKSYLHS++KQ+VL+NLKDYAVRAL
Sbjct  1     MTLDVVSMEHSKSFIFALQELKNLRPQLYSAAEYCEKSYLHSDKKQVVLDNLKDYAVRAL  60

Query  575   VNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAII  754
             +NAVDHLGTVAYKL DL+ QQ  DVSTMELK++ +NQ+LLTC  YT+KEG RQQQLLA +
Sbjct  61    INAVDHLGTVAYKLNDLLEQQTFDVSTMELKVSTLNQKLLTCHVYTDKEGLRQQQLLAFV  120

Query  755   PRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLASETTST  931
             PRHHKHY LPNSVNKKVHFS H Q++ RQ+ +++R RL  SG   +KTLSWHLASET S+
Sbjct  121   PRHHKHYILPNSVNKKVHFSSHRQINARQNLVRTRTRLPSSGTPISKTLSWHLASETKSS  180

Query  932   LKG-ASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV------GPGSS  1090
             LK   S    +  + K S +TSG F+LLD  E   RT     W KP +       G  +S
Sbjct  181   LKKPTSRTSKNPKESKFSAKTSGVFHLLDSEE---RT-----WMKPSAAQLHLTNGTLTS  232

Query  1091  IA-THTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              A T T GV   DAL GSKP+T + SF++     RE   V +RSKS+LSA F+KQK  K+
Sbjct  233   RATTQTCGVTGEDALKGSKPLTKFGSFND--RNGREAAQVHSRSKSVLSALFMKQKAAKL  290



>ref|XP_007051672.1| ABI-1-like 1 isoform 2 [Theobroma cacao]
 gb|EOX95829.1| ABI-1-like 1 isoform 2 [Theobroma cacao]
Length=213

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 175/198 (88%), Gaps = 2/198 (1%)
 Frame = +2

Query  356  MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
            MEVE P+P  N AMTFDEVSMERSK+FVKALQELKNLRPQLYSAAEYCEKSYL SEQKQM
Sbjct  1    MEVEFPRPE-NPAMTFDEVSMERSKNFVKALQELKNLRPQLYSAAEYCEKSYLQSEQKQM  59

Query  536  VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
            VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ L+VSTMELK +C+NQQLL CQ YT+
Sbjct  60   VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLEVSTMELKASCLNQQLLMCQTYTD  119

Query  716  KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
            KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ D RQ + Q++ RL PSG  A+K
Sbjct  120  KEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQTDPRQNYFQAKSRLQPSGTPASK  179

Query  893  TLSWHLASETTSTLKGAS  946
            TLSWHLASET STLKG S
Sbjct  180  TLSWHLASETKSTLKGTS  197



>ref|XP_006294664.1| hypothetical protein CARUB_v10023702mg [Capsella rubella]
 gb|EOA27562.1| hypothetical protein CARUB_v10023702mg [Capsella rubella]
Length=294

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 178/292 (61%), Positives = 208/292 (71%), Gaps = 16/292 (5%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTFDEVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V+A
Sbjct  12    AMTFDEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKA  71

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVA KLTDL  QQN D+STMEL+ +C++QQLLTC+ Y +KEG RQQQLLA+
Sbjct  72    LVNAVDHLGTVASKLTDLFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLLAV  131

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASETTS  928
             IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PSG            SET S
Sbjct  132   IPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSG------------SETKS  179

Query  929   TLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL  1108
             TLKG S    S+ D K+  +TSG F+L+ G E     K     S    V   S++     
Sbjct  180   TLKGTSTIAPSSKDSKAFTKTSGVFHLV-GDEENIVNKKPLVGSHVSGVPAVSTVTKQAY  238

Query  1109  GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             GV+   L+  K +  ++S DN  + RRE    P R+KS+LSAFFVKQKTPK+
Sbjct  239   GVVHKDLEVPKLLAVHKSVDN--NQRREIIQAPVRTKSVLSAFFVKQKTPKL  288



>gb|KCW78126.1| hypothetical protein EUGRSUZ_D02333 [Eucalyptus grandis]
Length=223

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 182/220 (83%), Gaps = 5/220 (2%)
 Frame = +2

Query  356   MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
             ME+E+ +   N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYL+SEQKQM
Sbjct  1     MEMERLRSA-NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLNSEQKQM  59

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ+LD++ MELK+T  NQQLLTC+ Y++
Sbjct  60    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLIEQQSLDITVMELKVTGFNQQLLTCKTYSD  119

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
             KEG RQQQLLAIIPRHHKHY LPNSVNKKVHFSP IQ D RQ H Q+R RL PS   AAK
Sbjct  120   KEGLRQQQLLAIIPRHHKHYMLPNSVNKKVHFSPQIQKDVRQNHFQARSRLQPSATPAAK  179

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLL  1012
             TLSWHLASET STLKG      S +D   S +    F+LL
Sbjct  180   TLSWHLASETKSTLKGTQNASASTED---SAKKPELFHLL  216



>ref|XP_010508052.1| PREDICTED: protein ABIL1-like isoform X2 [Camelina sativa]
Length=294

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 209/294 (71%), Gaps = 16/294 (5%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             NS MTFD+VSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NSTMTFDDVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL  QQN D+STM L+ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDQQNSDISTMVLRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PSG            SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSG------------SET  177

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG F+L+ G E     K   A S+   V   S++   
Sbjct  178   KSTLKGTSTVAPSSKDSKAFTKTSGVFHLI-GDEENIINKKPLAGSQVSGVPAVSTVTKQ  236

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
               GV    L+  K +  ++S +N  + RRE    P R+KS+LSAFFVKQKTPK+
Sbjct  237   AYGVAHKDLEVPKLLAAHKSLEN--NQRREIIQAPVRTKSVLSAFFVKQKTPKL  288



>ref|NP_001189756.1| protein ABIL1 [Arabidopsis thaliana]
 gb|AEC10661.1| protein ABIL1 [Arabidopsis thaliana]
Length=286

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 179/294 (61%), Positives = 207/294 (70%), Gaps = 24/294 (8%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMT DEVSMER+KSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V
Sbjct  10    NPAMTLDEVSMERNKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTV  69

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             +ALVNAVDHLGTVA KLTDL   QN D+STME++ +C++QQLLTC+ Y +KEG RQQQLL
Sbjct  70    KALVNAVDHLGTVASKLTDLFDHQNSDISTMEMRASCVSQQLLTCRTYIDKEGLRQQQLL  129

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAKTLSWHLASET  922
             A+IP HHKHY LPNSVNK+VHFSP  + D RQ H Q+  RL PSG            SET
Sbjct  130   AVIPLHHKHYILPNSVNKRVHFSPLRRTDTRQNHYQAISRLQPSG------------SET  177

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              STLKG S    S+ D K+  +TSG F+LL  G+  N     P      S  P +S A  
Sbjct  178   KSTLKGTSTVAPSSKDSKAFSKTSGVFHLL--GDDENIANKKPLAGSQVSGVPAASTAHK  235

Query  1103  TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              L V        K +T +RS DN  +PRRE    P R+KS+LSAFFVKQKTPK+
Sbjct  236   DLEV-------PKLLTAHRSLDN--NPRREIIQAPVRTKSVLSAFFVKQKTPKL  280



>emb|CDY68381.1| BnaC03g72740D [Brassica napus]
Length=307

 Score =   331 bits (848),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 213/295 (72%), Gaps = 9/295 (3%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTF+EVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V+A
Sbjct  12    AMTFEEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKA  71

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVA KLTDL   Q+ D+STM+L+ +C++QQLLT + Y +KEG RQQQLLA+
Sbjct  72    LVNAVDHLGTVASKLTDLFDHQSSDISTMQLRASCVSQQLLTSRTYIDKEGLRQQQLLAV  131

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQ-SRGRLFPSGPAAAKTLSWHLASETT  925
             IP HHKHYTLPNSVNK+V FSP  + D RQ H Q    RL PS   ++K+LSWHL SET 
Sbjct  132   IPVHHKHYTLPNSVNKRVRFSPLRRTDTRQNHYQVDISRLQPSDAPSSKSLSWHLGSETK  191

Query  926   STLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASP--AWSKPPSVGPGSSIAT  1099
             STLKG +    S+ D K+  +TSG F+L   G+  N     P    S+   V   S+I  
Sbjct  192   STLKGTTTVASSSKDSKAFVKTSGVFHL--SGDEENIINKKPFVGGSQVSGVPATSTITR  249

Query  1100  HTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              T GV   A++  K  T ++S DN   PR E    P R+KS++SAFFVK KTPK+
Sbjct  250   QTYGVAHKAVEVPKLTTAHKSHDN---PRGEIIQAPVRTKSVMSAFFVKPKTPKL  301



>ref|XP_006577333.1| PREDICTED: protein ABIL1-like [Glycine max]
Length=296

 Score =   330 bits (846),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 179/293 (61%), Positives = 211/293 (72%), Gaps = 6/293 (2%)
 Frame = +2

Query  395   MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRAL  574
             MTFDEVSME  KSF+ ALQELKNLRPQLYSAA+YCEKSYL+S++K MVL+N+KDY VRAL
Sbjct  1     MTFDEVSMEHGKSFIFALQELKNLRPQLYSAADYCEKSYLNSDKKPMVLDNMKDYVVRAL  60

Query  575   VNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAII  754
             VNAVDHLGTVAYKL+D++ +Q  DVSTM+LK++ +NQ+LLT   YT+KEG RQQQLLA I
Sbjct  61    VNAVDHLGTVAYKLSDILEKQTFDVSTMDLKVSTLNQRLLTWHMYTDKEGLRQQQLLAFI  120

Query  755   PRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLASETTST  931
             PRHHKHY LPN VNKKVHF PH ++  RQ+  Q+R RL  SG   +KTLSWHLASET ST
Sbjct  121   PRHHKHYILPNPVNKKVHFIPHRKIGARQNSFQTRTRLHSSGTPISKTLSWHLASETKST  180

Query  932   LKG-ASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL  1108
             LK   S    +  D K   + SG F+LLD  E   R K S A     +  P S  AT T+
Sbjct  181   LKKQTSRTSKNTKDSKFYKKISGVFHLLD-SEGSTRMKTSAAQPHLTNGVPTSGAATQTM  239

Query  1109  GVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             G   RDAL  SKP+T Y SFD+     RE   V TRSKS+LS+FFVKQ   K+
Sbjct  240   GATGRDALKHSKPLTTYGSFDD--RNGREAVQVHTRSKSVLSSFFVKQTAAKL  290



>ref|XP_009133767.1| PREDICTED: protein ABIL1-like isoform X2 [Brassica rapa]
Length=304

 Score =   330 bits (846),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 213/295 (72%), Gaps = 12/295 (4%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTF+EVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V+A
Sbjct  12    AMTFEEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKA  71

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVA KLTDL   Q+ D+STM+L+ +C++QQLLT + Y +KEG RQQQLLA+
Sbjct  72    LVNAVDHLGTVASKLTDLFDHQSSDMSTMQLRASCVSQQLLTSRTYIDKEGLRQQQLLAV  131

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQ-SRGRLFPSGPAAAKTLSWHLASETT  925
             IP HHKHYTLPNSVNK+VHFSP  + D RQ H Q    RL PS   ++K+LSWHL SET 
Sbjct  132   IPMHHKHYTLPNSVNKRVHFSPLRRTDTRQNHYQVDISRLQPSDAPSSKSLSWHLGSETK  191

Query  926   STLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASP--AWSKPPSVGPGSSIAT  1099
             STLKG +    S+ D     +TSG F+L   G+  N     P    S+   V   S+IA 
Sbjct  192   STLKGTTSVASSSKDF---VKTSGVFHL--SGDEENIINKKPFVGVSQVSGVPATSTIAR  246

Query  1100  HTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              T GV   A++  K  T  +S DN   PR+E    P R+KS++SAFFVK KTPK+
Sbjct  247   QTYGVAHKAVEVPKLTTAQKSHDN---PRQEIIQAPVRTKSVMSAFFVKPKTPKL  298



>ref|XP_003626513.1| Protein ABIL1 [Medicago truncatula]
Length=305

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 219/301 (73%), Gaps = 18/301 (6%)
 Frame = +2

Query  407   EVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAV  586
             E +ME+SKSFV ALQELKNLRPQLYSAA+YCEKSYL S+QK++VL+N+KDYA RALVNAV
Sbjct  2     EFAMEQSKSFVFALQELKNLRPQLYSAADYCEKSYLRSDQKEIVLDNMKDYAARALVNAV  61

Query  587   DHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHH  766
             DHLGTVA KL+DL+ QQ LDVSTM+LKI+ +NQ+LLTCQ YT KEG RQQQLLAIIPRHH
Sbjct  62    DHLGTVACKLSDLLEQQTLDVSTMDLKISTLNQRLLTCQVYTNKEGVRQQQLLAIIPRHH  121

Query  767   KHYTLPN----SVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPA--------AAKTLSWH  907
             KHY LP+    SVNKKVHF P+ Q D +Q+  ++R R  PSG           AKTLSWH
Sbjct  122   KHYILPSRLNYSVNKKVHFRPYKQTDAKQNSFRTRNRPQPSGAWLGKLCRTPVAKTLSWH  181

Query  908   LASETTSTLKGASC-GFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPG  1084
             LASET STLK  S        D K S +T+G F+L D  E+  R K S + +  P+  P 
Sbjct  182   LASETKSTLKKRSSHASKKIKDAKFSAKTTGVFHLTDNEEI-TRFKPSASNNHVPNGVPT  240

Query  1085  SSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPK  1261
             S  AT TLGV  RDAL+  +P+T + SFDN      ET HVP+RSKS+LS+FFVKQ++ K
Sbjct  241   SGAATQTLGVTGRDALEDFRPLTTFGSFDN--RNVHETVHVPSRSKSVLSSFFVKQRSAK  298

Query  1262  V  1264
             +
Sbjct  299   L  299



>ref|XP_010053769.1| PREDICTED: protein ABIL1 [Eucalyptus grandis]
Length=202

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 173/196 (88%), Gaps = 2/196 (1%)
 Frame = +2

Query  356  MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
            ME+E+ +   N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYL+SEQKQM
Sbjct  1    MEMERLRSA-NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLNSEQKQM  59

Query  536  VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
            VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ+LD++ MELK+T  NQQLLTC+ Y++
Sbjct  60   VLDNLKDYAVRALVNAVDHLGTVAYKLTDLIEQQSLDITVMELKVTGFNQQLLTCKTYSD  119

Query  716  KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQSRGRLFPSGPAAAK  892
            KEG RQQQLLAIIPRHHKHY LPNSVNKKVHFSP IQ D RQ H Q+R RL PS   AAK
Sbjct  120  KEGLRQQQLLAIIPRHHKHYMLPNSVNKKVHFSPQIQKDVRQNHFQARSRLQPSATPAAK  179

Query  893  TLSWHLASETTSTLKG  940
            TLSWHLASET STLKG
Sbjct  180  TLSWHLASETKSTLKG  195



>ref|XP_008802046.1| PREDICTED: probable protein ABIL1 isoform X4 [Phoenix dactylifera]
Length=303

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 211/298 (71%), Gaps = 5/298 (2%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P N+AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLH+EQKQMVL+NLKDY
Sbjct  6     PENAAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHNEQKQMVLDNLKDY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
             AV+A+VNAVDHLGTVAYKLTDL  QQ LDVST ELKI+C+NQQ+LTCQ YT+KEG RQQ+
Sbjct  66    AVQAIVNAVDHLGTVAYKLTDLFEQQTLDVSTAELKISCLNQQILTCQTYTDKEGLRQQR  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMD-HRQHIQSRGRLFPSGPAAAKTLSWHLAS  916
             +     RHHKHY LP+SV++++     +Q+D +  H+Q++ R  P G  A+KTLSW LAS
Sbjct  126   MFTNTARHHKHYILPDSVSRRMQSCSQLQIDANLIHVQAKPRPDPPGSPASKTLSWLLAS  185

Query  917   ETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIA  1096
             ET S   GA        D K+   TS  F+LL+  +       S    +  S  P S  A
Sbjct  186   ETNSASDGAPREVSGTGDAKAPKITSEVFHLLNAEDAAAPMPLSTHL-RSASSNPTSYTA  244

Query  1097  THTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
              H+ G+ RD ++ SKP+  +RSFDNP   R +    P RSKS+LSAFF K K+ K  K
Sbjct  245   LHSFGI-RDPVEPSKPLITFRSFDNP--GRLQIYRPPVRSKSLLSAFFAKNKSLKPRK  299



>ref|XP_008792392.1| PREDICTED: protein ABIL1-like [Phoenix dactylifera]
Length=303

 Score =   325 bits (834),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 181/298 (61%), Positives = 213/298 (71%), Gaps = 9/298 (3%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLH+EQKQMVL+NLKDYAV
Sbjct  8     NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHNEQKQMVLDNLKDYAV  67

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             RALVNAVDHLGTVAYKLTDL  QQ LD+ST+ELKI+C+NQQ+LTC+ YT+KEG RQQ+++
Sbjct  68    RALVNAVDHLGTVAYKLTDLFEQQTLDISTLELKISCLNQQILTCETYTDKEGLRQQRMV  127

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMD-HRQHIQSRGRLFPSGPAAAKTLSWHLASET  922
                PRHHKHY LPNSV+++V  S  +  D +  H+Q + R  P G  A+KTLSWHLASET
Sbjct  128   TNNPRHHKHYILPNSVSRQVQSSSQLHKDANLNHVQPQPRPHPPGTPASKTLSWHLASET  187

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVG--PGSSIA  1096
              S   G         DI +   TS AF  LD  +        P  +   S G  P SS+A
Sbjct  188   NSASDGTPHAASCIGDIIAPKITSEAFYFLDKQDTA---APMPLSTHLQSAGGNPTSSMA  244

Query  1097  THTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
               + G+ RD+L+ SKP+T +RSFDNP   R +    P RSKSMLSAFF K K+ K  K
Sbjct  245   LRSFGI-RDSLEHSKPLTAFRSFDNP--GRLQIYRPPVRSKSMLSAFFAKNKSLKPRK  299



>gb|KEH18770.1| ABIL1-like protein [Medicago truncatula]
Length=232

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 183/225 (81%), Gaps = 3/225 (1%)
 Frame = +2

Query  356   MEVEQPKPP--PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQK  529
             ME+E+P      +SAMTFDEVSMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQK
Sbjct  1     MELERPTTTFHNSSAMTFDEVSMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQK  60

Query  530   QMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAY  709
             QMVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ Q  LDVSTM LK++ INQ+L TCQ Y
Sbjct  61    QMVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQHTLDVSTMGLKVSTINQKLHTCQIY  120

Query  710   TEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAA  886
             T+KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ+D +Q+  Q+R R   SG   
Sbjct  121   TDKEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQIDAKQNSFQTRTRFQSSGTPP  180

Query  887   AKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGG  1021
             AKTLSWHLASET STLKG      + ++ K + + SG F+LL  G
Sbjct  181   AKTLSWHLASETKSTLKGTPQASPNIENPKFAAKASGYFHLLGLG  225



>ref|XP_006842582.1| hypothetical protein AMTR_s00077p00158760 [Amborella trichopoda]
 gb|ERN04257.1| hypothetical protein AMTR_s00077p00158760 [Amborella trichopoda]
Length=307

 Score =   321 bits (822),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 174/297 (59%), Positives = 210/297 (71%), Gaps = 10/297 (3%)
 Frame = +2

Query  389   SAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVR  568
             +AMTFDE SMERSKSF+KAL ELKNLRPQLYSAAEYCEKSYLH+EQKQMVL+NLKDYAVR
Sbjct  10    AAMTFDEASMERSKSFMKALLELKNLRPQLYSAAEYCEKSYLHNEQKQMVLDNLKDYAVR  69

Query  569   ALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLA  748
             ALVNAVDHLGTVAYKLTDL  QQ +D S++ELKI+C+NQ L TCQAYT+KEG +QQQL  
Sbjct  70    ALVNAVDHLGTVAYKLTDLFEQQTVDASSVELKISCLNQHLQTCQAYTDKEGLKQQQLFT  129

Query  749   IIPRHHKHYTLP--NSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASET  922
             +IPRHHKHY LP  ++VNKK   +  I+ +  Q    + + FP G +A+KTLSWHLAS +
Sbjct  130   VIPRHHKHYVLPKLDTVNKKSQSNGQIRREAGQK-DVQAKPFPLGTSASKTLSWHLASNS  188

Query  923   TSTLKG-ASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTK-ASPAWSKPPSVGPGSSIA  1096
              +T +G       S  D  SS   SG F L D  EV   +   S A  +P +    S +A
Sbjct  189   KATPEGDLYTSTTSVRDSTSSATASGVFYLPD--EVATSSMPPSAARIEPSNRAADSGVA  246

Query  1097  THTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              H LG+  RDA + +K ++ YRSFDN    RRE +  P RSKSMLSA F K K+ K+
Sbjct  247   LHALGITRRDAAENAKSLSQYRSFDNV--GRREISRPPVRSKSMLSALFTKHKSAKI  301



>ref|XP_010917115.1| PREDICTED: protein ABIL1-like [Elaeis guineensis]
Length=303

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/298 (57%), Positives = 210/298 (70%), Gaps = 5/298 (2%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P N AMT DEVSMERSK FV ALQELKNLRPQLYSAAEYCE SYLH+EQKQMVL+NLKDY
Sbjct  6     PENPAMTSDEVSMERSKGFVMALQELKNLRPQLYSAAEYCENSYLHNEQKQMVLDNLKDY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
             AV+ALVNAVDHLGTVAYKLTDL  QQ LDVST+ LKI+C+NQ++LTCQ YT+KEG RQQ+
Sbjct  66    AVQALVNAVDHLGTVAYKLTDLFEQQTLDVSTVGLKISCLNQKILTCQKYTDKEGIRQQR  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMD-HRQHIQSRGRLFPSGPAAAKTLSWHLAS  916
             +     R+HKHY LPNSV++++  SP +Q D +  H+Q++ R   SG  A+KTLSWHLAS
Sbjct  126   MFTNTARYHKHYILPNSVSRRMQSSPQLQTDVNLIHVQAKPRPHSSGSPASKTLSWHLAS  185

Query  917   ETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIA  1096
             ET S    A     S  ++K+   T+  F+LL+  +       S    +  S  P SS+ 
Sbjct  186   ETNSASDRAPHAVPSTGNVKAPKITAEVFHLLNAEDTAAPMPLSTHL-QSASSNPTSSLG  244

Query  1097  THTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
              H+ G+ RD ++ SKP+  +RSFDNP   R +    P RSKS+LSAFF K K+ K  K
Sbjct  245   LHSFGI-RDPVEPSKPLITFRSFDNP--GRLQIYRPPVRSKSLLSAFFAKNKSLKPRK  299



>gb|KEH18772.1| ABIL1-like protein [Medicago truncatula]
Length=205

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 170/198 (86%), Gaps = 3/198 (2%)
 Frame = +2

Query  356  MEVEQPKPP--PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQK  529
            ME+E+P      +SAMTFDEVSMERSKSFV ALQELKNLRPQLYSAAEYCEKSYLHSEQK
Sbjct  1    MELERPTTTFHNSSAMTFDEVSMERSKSFVNALQELKNLRPQLYSAAEYCEKSYLHSEQK  60

Query  530  QMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAY  709
            QMVL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ Q  LDVSTM LK++ INQ+L TCQ Y
Sbjct  61   QMVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQHTLDVSTMGLKVSTINQKLHTCQIY  120

Query  710  TEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAA  886
            T+KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ+D +Q+  Q+R R   SG   
Sbjct  121  TDKEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQIDAKQNSFQTRTRFQSSGTPP  180

Query  887  AKTLSWHLASETTSTLKG  940
            AKTLSWHLASET STLKG
Sbjct  181  AKTLSWHLASETKSTLKG  198



>ref|XP_009133766.1| PREDICTED: protein ABIL1-like isoform X1 [Brassica rapa]
Length=336

 Score =   316 bits (809),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 214/327 (65%), Gaps = 44/327 (13%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTF+EVSMERSKSFVKALQELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLKDY V+A
Sbjct  12    AMTFEEVSMERSKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKA  71

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVA KLTDL   Q+ D+STM+L+ +C++QQLLT + Y +KEG RQQQLLA+
Sbjct  72    LVNAVDHLGTVASKLTDLFDHQSSDMSTMQLRASCVSQQLLTSRTYIDKEGLRQQQLLAV  131

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQ-HIQ-SRGRLFPSGPA--------------  883
             IP HHKHYTLPNSVNK+VHFSP  + D RQ H Q    RL PSG                
Sbjct  132   IPMHHKHYTLPNSVNKRVHFSPLRRTDTRQNHYQVDISRLQPSGAMSSSSWSLIDILVVV  191

Query  884   ------------------AAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNL  1009
                               ++K+LSWHL SET STLKG +    S+ D     +TSG F+L
Sbjct  192   INCNCLSNGLVLTHLDAPSSKSLSWHLGSETKSTLKGTTSVASSSKDF---VKTSGVFHL  248

Query  1010  LDGGEVGNRTKASP--AWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHP  1183
                G+  N     P    S+   V   S+IA  T GV   A++  K  T  +S DN   P
Sbjct  249   --SGDEENIINKKPFVGVSQVSGVPATSTIARQTYGVAHKAVEVPKLTTAQKSHDN---P  303

Query  1184  RRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             R+E    P R+KS++SAFFVK KTPK+
Sbjct  304   RQEIIQAPVRTKSVMSAFFVKPKTPKL  330



>ref|XP_008802044.1| PREDICTED: probable protein ABIL1 isoform X2 [Phoenix dactylifera]
Length=336

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 174/331 (53%), Positives = 211/331 (64%), Gaps = 38/331 (11%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P N+AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLH+EQKQMVL+NLKDY
Sbjct  6     PENAAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHNEQKQMVLDNLKDY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
             AV+A+VNAVDHLGTVAYKLTDL  QQ LDVST ELKI+C+NQQ+LTCQ YT+KEG RQQ+
Sbjct  66    AVQAIVNAVDHLGTVAYKLTDLFEQQTLDVSTAELKISCLNQQILTCQTYTDKEGLRQQR  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMD-HRQHIQSRGRLFPSGPA-----------  883
             +     RHHKHY LP+SV++++     +Q+D +  H+Q++ R  P G             
Sbjct  126   MFTNTARHHKHYILPDSVSRRMQSCSQLQIDANLIHVQAKPRPDPPGAGYLHLMLFQLFL  185

Query  884   ----------------------AAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSG  997
                                   A+KTLSW LASET S   GA        D K+   TS 
Sbjct  186   LCLSIYLCIHALYHVDWLKGSPASKTLSWLLASETNSASDGAPREVSGTGDAKAPKITSE  245

Query  998   AFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPP  1177
              F+LL+  +       S    +  S  P S  A H+ G+ RD ++ SKP+  +RSFDNP 
Sbjct  246   VFHLLNAEDAAAPMPLSTHL-RSASSNPTSYTALHSFGI-RDPVEPSKPLITFRSFDNP-  302

Query  1178  HPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
               R +    P RSKS+LSAFF K K+ K  K
Sbjct  303   -GRLQIYRPPVRSKSLLSAFFAKNKSLKPRK  332



>gb|KHN43134.1| Protein ABIL1 [Glycine soja]
Length=270

 Score =   303 bits (777),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 198/293 (68%), Gaps = 35/293 (12%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTFDEVSME +KSF+ ALQELKNLRPQLYSAA+YCEKSYL+S++KQM+LENLKDYAVRA
Sbjct  5     AMTFDEVSMEHNKSFIFALQELKNLRPQLYSAADYCEKSYLNSDKKQMILENLKDYAVRA  64

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVAYKL+D++ +Q  DVSTM+LK++ +NQ+LLTC  YT+KEG RQQQLLA 
Sbjct  65    LVNAVDHLGTVAYKLSDILEKQTFDVSTMDLKVSTLNQRLLTCHMYTDKEGLRQQQLLAF  124

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTST  931
             IPRHHKHY L                             PS P  +KTLSWHLASET  T
Sbjct  125   IPRHHKHYIL-----------------------------PSTP-ISKTLSWHLASETKFT  154

Query  932   LKG-ASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL  1108
             LK  AS    +A D K S +TSG F+LL G E   R K S A     +  P S  AT TL
Sbjct  155   LKKQASRTSKNAKDSKFSAKTSGVFHLL-GSEGSTRMKTSAAQPHLANGVPTSGAATQTL  213

Query  1109  GVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             G   RDAL  SKP+T Y SFD+     RE   V TRSKS+LS+F VKQ   K+
Sbjct  214   GATSRDALKRSKPLTAYGSFDD--RNGREAVQVHTRSKSVLSSFLVKQAAAKL  264



>ref|XP_010924781.1| PREDICTED: protein ABIL1-like isoform X2 [Elaeis guineensis]
Length=283

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 180/244 (74%), Gaps = 2/244 (1%)
 Frame = +2

Query  386   NSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAV  565
             N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSY+H+EQKQMVL+NLKDYAV
Sbjct  8     NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYVHNEQKQMVLDNLKDYAV  67

Query  566   RALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLL  745
             RALVNAVDHLGTVAYKLTDL  QQ LD+ST+ELKI+C+NQQ+LTCQ YT+KEG RQQ++ 
Sbjct  68    RALVNAVDHLGTVAYKLTDLFEQQTLDISTLELKISCLNQQILTCQTYTDKEGLRQQRMF  127

Query  746   AIIPRHHKHYTLPNSVNKKVHFSPHIQMDHR-QHIQSRGRLFPSGPAAAKTLSWHLASET  922
                PRHHKHY LPNS +++V  S  +Q D    H+Q + R  P G  A+KTLSWHLASET
Sbjct  128   TNNPRHHKHYILPNSASRQVQSSSQLQKDATLNHVQPKPRPHPPGTPASKTLSWHLASET  187

Query  923   TSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATH  1102
              S L GA     S  DI +   TS AF+ LD  + G     S    +  S  P S++A  
Sbjct  188   NSPLNGAPHAASSIGDIMAPKITSEAFHFLDTEDAGAPMPLSTHL-RSASGTPTSNMALR  246

Query  1103  TLGV  1114
             + G+
Sbjct  247   SFGI  250



>ref|XP_008343407.1| PREDICTED: protein ABIL1-like [Malus domestica]
Length=262

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 181/245 (74%), Gaps = 6/245 (2%)
 Frame = +2

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  DVSTM+LK+TC+NQ+LLTCQ Y +
Sbjct  16    VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTSDVSTMDLKVTCLNQKLLTCQTYMD  75

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAK  892
             KEG RQ QLLA IPRHHKHY LPNS+NKKVHFSPH+Q D RQH  Q+R  L  S  AA+K
Sbjct  76    KEGSRQHQLLAFIPRHHKHYILPNSMNKKVHFSPHVQTDTRQHPYQARAHLQFSSAAASK  135

Query  893   TLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS  1072
             TLSWHLASET STLKG      S  D K S  T+G F L++  E G+ +K+     + PS
Sbjct  136   TLSWHLASETNSTLKGTPQAQTSIGDTKISVNTAGVFQLVENEE-GSASKSLATQLQQPS  194

Query  1073  VGPGSSIATHTLG-VMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
               P S     TLG   R+A+DGSKPMT +RSF+N   PRR+T  VP RSKS+LSAFF KQ
Sbjct  195   GLPTSGGVKQTLGPGHREAVDGSKPMTAFRSFEN---PRRDTVRVPVRSKSVLSAFFAKQ  251

Query  1250  KTPKV  1264
             K+ K+
Sbjct  252   KSNKL  256



>gb|KHN35348.1| Protein ABIL1, partial [Glycine soja]
Length=270

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 194/296 (66%), Gaps = 41/296 (14%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTFDEVSME  KSF+ ALQELKNLRPQLYSAA+YCEKSYL+S++K MVL+N+KDY VRA
Sbjct  5     AMTFDEVSMEHGKSFIFALQELKNLRPQLYSAADYCEKSYLNSDKKPMVLDNMKDYVVRA  64

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNAVDHLGTVAYKL+D++ +Q  DVSTM+LK++ +NQ+LLT   YT+KEG RQQQLLA 
Sbjct  65    LVNAVDHLGTVAYKLSDILEKQTFDVSTMDLKVSTLNQRLLTWHMYTDKEGLRQQQLLAF  124

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTST  931
             IPRHHKHY LP++                                +KTLSWHLASET ST
Sbjct  125   IPRHHKHYILPST------------------------------PISKTLSWHLASETKST  154

Query  932   LKG-ASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVG---PGSSIAT  1099
             LK   S    +  D K   + SG F+LLD  E   R K S A   PP +    P S  AT
Sbjct  155   LKKQTSRTSKNTKDSKFYKKISGVFHLLD-SEGSTRMKTSAA---PPHLTNGVPTSGAAT  210

Query  1100  HTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              T+G   RDAL  SKP+T Y SFD+     RE   V TRSKS+LS+FFVKQ   K+
Sbjct  211   QTMGATGRDALKHSKPLTTYGSFDD--RNGREAVQVHTRSKSVLSSFFVKQTAAKL  264



>ref|XP_009394149.1| PREDICTED: probable protein ABIL1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 206/301 (68%), Gaps = 9/301 (3%)
 Frame = +2

Query  368   QPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLEN  547
             Q + P N+AMTFDEVS+ERSK FV+ALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVL+N
Sbjct  2     QQRRPENAAMTFDEVSLERSKGFVQALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDN  61

Query  548   LKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGF  727
             LK+YAVRALVNAVDHLGTVAYKLTDL  QQ+ DVST+ELKI C+NQQ+LTCQ +T+KEG 
Sbjct  62    LKEYAVRALVNAVDHLGTVAYKLTDLFEQQSSDVSTIELKIYCLNQQILTCQTFTDKEGL  121

Query  728   RQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQM-DHRQHIQSRGRLFPSGPAAAKTLSW  904
             RQQQL     RH KHY LPN V K+V  S  +Q+ ++    QS+     SG  A KTLSW
Sbjct  122   RQQQLFGTRRRHRKHYILPNVVGKRVESSSKLQIANNLTRAQSKPLPHASGNLAPKTLSW  181

Query  905   HLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVG--  1078
             HL+SE+ S            ++ KS   TS +F+LL+  E    T   P  S   +    
Sbjct  182   HLSSESNSAPSSEPHTAPRVEESKSFKVTSDSFHLLEAEEP---TAPLPLKSHLQAAKGH  238

Query  1079  PGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTP  1258
             P +  A+ T GV +D + G+K ++  +SF+N    RRE    P R++S+LSAFF + KT 
Sbjct  239   PTTDPASCTFGV-KDPVGGTKTLSGLKSFEN--SGRREICPPPARNRSILSAFFPRNKTL  295

Query  1259  K  1261
             K
Sbjct  296   K  296



>ref|XP_009394150.1| PREDICTED: probable protein ABIL1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   285 bits (730),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/301 (55%), Positives = 204/301 (68%), Gaps = 9/301 (3%)
 Frame = +2

Query  368   QPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLEN  547
             Q + P N+AMTFDEVS+ERSK FV+ALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVL+N
Sbjct  2     QQRRPENAAMTFDEVSLERSKGFVQALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDN  61

Query  548   LKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGF  727
             LK+YAVRALVNAVDHLGTVAYKLTDL  QQ+ DVST+ELKI C+NQQ+LTCQ +T+KEG 
Sbjct  62    LKEYAVRALVNAVDHLGTVAYKLTDLFEQQSSDVSTIELKIYCLNQQILTCQTFTDKEGL  121

Query  728   RQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQM-DHRQHIQSRGRLFPSGPAAAKTLSW  904
             RQQQL     RH KHY LPN V K+V  S  +Q+ ++    QS+     SG  A KTLSW
Sbjct  122   RQQQLFGTRRRHRKHYILPNVVGKRVESSSKLQIANNLTRAQSKPLPHASGNLAPKTLSW  181

Query  905   HLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVG--  1078
             HL+SE+ S            ++ KS   TS +F+LL        T   P  S   +    
Sbjct  182   HLSSESNSAPSSEPHTAPRVEESKSFKVTSDSFHLL----AEEPTAPLPLKSHLQAAKGH  237

Query  1079  PGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTP  1258
             P +  A+ T GV +D + G+K ++  +SF+N    RRE    P R++S+LSAFF + KT 
Sbjct  238   PTTDPASCTFGVKQDPVGGTKTLSGLKSFEN--SGRREICPPPARNRSILSAFFPRNKTL  295

Query  1259  K  1261
             K
Sbjct  296   K  296



>ref|XP_003569387.1| PREDICTED: probable protein ABIL1 [Brachypodium distachyon]
Length=306

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 197/291 (68%), Gaps = 17/291 (6%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             TF+E SMERSKSFVKALQELKNLRPQLYSA+EYCEKSYLHSEQKQMVL+NLKDYAVRALV
Sbjct  25    TFEEASMERSKSFVKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLDNLKDYAVRALV  84

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  +VST+ELK+  +NQQ+L CQ YT+KEG RQQQ++  + 
Sbjct  85    NAVDHLGTVAYKLTDLYEQQASEVSTLELKVASLNQQVLACQTYTDKEGLRQQQMIGTVT  144

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             RHHKHY +P++ NK++     +Q D    +  R R +PS     KTL WHLASE  S   
Sbjct  145   RHHKHYIVPSAGNKRMQAFSEMQTD--AELDLRPRPYPS----EKTLYWHLASEKNSKTN  198

Query  938   GASCGFVSADDIKSS--GRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLG  1111
             G      +  + K++    +SG F+L      G  + ASP   +  S    S+I     G
Sbjct  199   GVRESEFAHGETKTTKPSTSSGGFHL-----PGKESSASPLPKRLQSNVSSSAIVIRNSG  253

Query  1112  VMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              M+D   G++P++ + SFDNP    R+    P R+KSML+AFFV+ ++ K+
Sbjct  254   -MKDQ-PGARPLSSFSSFDNPRG--RQIQKAPLRTKSMLAAFFVRHRSGKM  300



>ref|XP_011093173.1| PREDICTED: protein ABIL1-like isoform X5 [Sesamum indicum]
Length=232

 Score =   279 bits (713),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 177/242 (73%), Gaps = 20/242 (8%)
 Frame = +2

Query  536   VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTE  715
             VL+NLKDYAVRALVNA+DHLGTVAYKL+D++ QQ  ++S+++LK+TC+NQQLLTCQ YT+
Sbjct  4     VLDNLKDYAVRALVNAIDHLGTVAYKLSDILEQQASEISSIDLKLTCLNQQLLTCQTYTD  63

Query  716   KEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
             KEG RQQQLLAIIPRHHKHYTLP+SVNKKVH SPH Q D RQ IQ R      G + AKT
Sbjct  64    KEGLRQQQLLAIIPRHHKHYTLPSSVNKKVHLSPHTQPDPRQAIQLR------GASVAKT  117

Query  896   LSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSV  1075
             L WHLASET STLKG+  G +S +D K +G+ SG F  LD  +   R K++PA       
Sbjct  118   LCWHLASETKSTLKGSPRGIMSIEDSKLTGKVSGVFKSLD-AQGKTRMKSTPA-------  169

Query  1076  GPGSSIATHTLGVM-RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQK  1252
                + +A  TLGV  RD+L+GSK   P++S +NP   ++ET   P RSKSMLSA FVKQK
Sbjct  170   ---TRVAMQTLGVTRRDSLEGSKSSIPHKSLENP--TKKETVPPPVRSKSMLSALFVKQK  224

Query  1253  TP  1258
              P
Sbjct  225   AP  226



>ref|NP_001043613.1| Os01g0622700 [Oryza sativa Japonica Group]
 sp|Q9AXA6.1|ABIL1_ORYSJ RecName: Full=Probable protein ABIL1; AltName: Full=Abl interactor-like 
protein 1 [Oryza sativa Japonica Group]
 dbj|BAB21082.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05527.1| Os01g0622700 [Oryza sativa Japonica Group]
 dbj|BAG95539.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71114.1| hypothetical protein OsI_02911 [Oryza sativa Indica Group]
Length=306

 Score =   281 bits (719),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 188/289 (65%), Gaps = 20/289 (7%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSFVKALQELKNLRPQLYSA+EYCEKSYLHSEQKQMVL+NLKDYAVRALV
Sbjct  32    TVDEASMERSKSFVKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLDNLKDYAVRALV  91

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  +VST+ELK+ C+NQQ+LTCQ YT+KEG RQQQ+     
Sbjct  92    NAVDHLGTVAYKLTDLYEQQASEVSTLELKVACLNQQVLTCQTYTDKEGIRQQQMTGTAT  151

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             RHHKHY +P   NK++     +Q D    I SR R +PS    AKTL WHLASE  S   
Sbjct  152   RHHKHYIVPTLANKRMQAFSEMQTD--ADIDSRPRPYPS----AKTLFWHLASEKNSKTN  205

Query  938   GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVM  1117
             GA       ++ K++   S           G     SP      +    S  A H +G M
Sbjct  206   GARQSEFVLEETKATKPASR----------GKEPSTSPLPKHLQTNLASSDFAMHNVG-M  254

Query  1118  RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             +D   G + ++ + SFDNP    R+    P R+KSML+AFFVK K+ K+
Sbjct  255   KDQ-PGVRHLSSFSSFDNPRG--RQIQKAPLRTKSMLAAFFVKHKSGKM  300



>ref|XP_008802045.1| PREDICTED: protein ABIL1-like isoform X3 [Phoenix dactylifera]
Length=307

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P N+AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLH+EQKQMVL+NLKDY
Sbjct  6     PENAAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHNEQKQMVLDNLKDY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
             AV+A+VNAVDHLGTVAYKLTDL  QQ LDVST ELKI+C+NQQ+LTCQ YT+KEG RQQ+
Sbjct  66    AVQAIVNAVDHLGTVAYKLTDLFEQQTLDVSTAELKISCLNQQILTCQTYTDKEGLRQQR  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMD-HRQHIQSRGRLFPSGPAAAKTLSWHLAS  916
             +     RHHKHY LP+SV++++     +Q+D +  H+Q++ R  P G  A+KTLSW LAS
Sbjct  126   MFTNTARHHKHYILPDSVSRRMQSCSQLQIDANLIHVQAKPRPDPPGSPASKTLSWLLAS  185

Query  917   ETTSTLKGASCGFVSADDIKSSGRTSGAFNLL  1012
             ET S   GA        D K+   TS  F+LL
Sbjct  186   ETNSASDGAPREVSGTGDAKAPKITSEVFHLL  217



>gb|EEE55009.1| hypothetical protein OsJ_02653 [Oryza sativa Japonica Group]
Length=306

 Score =   278 bits (712),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 187/289 (65%), Gaps = 20/289 (7%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSFVKALQELKNLRPQLYSA+EYCEKSYL SEQKQMVL+NLKDYAVRALV
Sbjct  32    TVDEASMERSKSFVKALQELKNLRPQLYSASEYCEKSYLQSEQKQMVLDNLKDYAVRALV  91

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  +VST+ELK+ C+NQQ+LTCQ YT+KEG RQQQ+     
Sbjct  92    NAVDHLGTVAYKLTDLYEQQASEVSTLELKVACLNQQVLTCQTYTDKEGIRQQQMTGTAT  151

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             RHHKHY +P   NK++     +Q D    I SR R +PS    AKTL WHLASE  S   
Sbjct  152   RHHKHYIVPTLANKRMQAFSEMQTD--ADIDSRPRPYPS----AKTLFWHLASEKNSKTN  205

Query  938   GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVM  1117
             GA       ++ K++   S           G     SP      +    S  A H +G M
Sbjct  206   GARQSEFVLEETKATKPASR----------GKEPSTSPLPKHLQTNLASSDFAMHNVG-M  254

Query  1118  RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             +D   G + ++ + SFDNP    R+    P R+KSML+AFFVK K+ K+
Sbjct  255   KDQ-PGVRHLSSFSSFDNPRG--RQIQKAPLRTKSMLAAFFVKHKSGKM  300



>ref|XP_009392459.1| PREDICTED: probable protein ABIL1 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 161/300 (54%), Positives = 189/300 (63%), Gaps = 18/300 (6%)
 Frame = +2

Query  392   AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
             AMTFDEVSMERSK+FVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVL+NLK+YAVRA
Sbjct  10    AMTFDEVSMERSKTFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDNLKNYAVRA  69

Query  572   LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
             LVNA+DHLGTVAYKLTDL  QQ LD+ST+E+KI+ +N++  TCQAY +KEG  Q Q+ A 
Sbjct  70    LVNAIDHLGTVAYKLTDLFEQQMLDISTIEMKISSLNERTFTCQAYVDKEGLNQLQMSAR  129

Query  752   IPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLASETTS  928
               RHHKHY LP+SV   V    HI  D   + IQ++      G + +KTLSWHLASE  S
Sbjct  130   TSRHHKHYILPDSVCNDVQNKSHIPADGNVNPIQAKSHSHAPGKSTSKTLSWHLASEVNS  189

Query  929   TLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL  1108
                G+        D K+    S  F+LL   E        PA S P S    +S    T 
Sbjct  190   ASNGSPLTAPCTQDAKAPKVNSEVFHLLVAEE--------PAPSLPLSSHLRASSGNVTF  241

Query  1109  GVMRDA------LDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
              +  D       L  SKP T  ++F    H + E     +RSKSMLS FF K KT K  K
Sbjct  242   DMTSDKFGSMDPLGASKPSTS-KTFGT--HSKLEIYRPHSRSKSMLSTFFTKNKTFKTRK  298



>gb|EMT08867.1| hypothetical protein F775_26056 [Aegilops tauschii]
Length=302

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 156/302 (52%), Positives = 193/302 (64%), Gaps = 16/302 (5%)
 Frame = +2

Query  362   VEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVL  541
             V  P P   +  TFDE SMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQK +VL
Sbjct  10    VPGPDPARPAPTTFDEASMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKHIVL  69

Query  542   ENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKE  721
             +NLKDYAVRALVNAVDHLGTVAYKLTDL  QQ  +VST+ELK+  +NQQ+LTCQ YT+KE
Sbjct  70    DNLKDYAVRALVNAVDHLGTVAYKLTDLYEQQVSEVSTVELKVASLNQQVLTCQTYTDKE  129

Query  722   GFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLS  901
             G RQQQ++    RHHKHY +P + NK++     +Q D      +   L P    + KTL 
Sbjct  130   GLRQQQMIGNATRHHKHYIVPTAGNKRMQAFSEMQTD------AEFDLKPKPYPSEKTLF  183

Query  902   WHLASETTSTLKGASCGFVSADDIKSSGRT-SGAFNLLDGGEVGNRTKASPAWSKPPSVG  1078
             WHLASE  +   G     +   + K++  T SG FNL      G     SP   +  S  
Sbjct  184   WHLASEKNTKTNGEHQSELGHGETKTTKPTSSGGFNL-----TGKELSVSPLPKRLQSNV  238

Query  1079  PGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTP  1258
               S I T  +G M+D   G++ +  + S DNP    R+    P R+KSML+AFFV+ ++ 
Sbjct  239   SSSDIVTRNIG-MKDQ-PGARHLASFSSLDNPRG--RQIQKAPVRTKSMLAAFFVRHRSG  294

Query  1259  KV  1264
             K+
Sbjct  295   KM  296



>ref|XP_006646118.1| PREDICTED: probable protein ABIL1-like [Oryza brachyantha]
Length=269

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 184/283 (65%), Gaps = 20/283 (7%)
 Frame = +2

Query  416   MERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDHL  595
             MERSKSFVKALQELKNLRPQLYSA+EYCEKSYLHSEQKQMVL+NLKDYAVRALVNAVDHL
Sbjct  1     MERSKSFVKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLDNLKDYAVRALVNAVDHL  60

Query  596   GTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHHKHY  775
             GTVAYKLTDL  QQ  +VST+ELK+ C+NQQ+LTCQ YT+KEG RQQQ+     RHHKHY
Sbjct  61    GTVAYKLTDLYEQQASEVSTLELKVACLNQQVLTCQTYTDKEGLRQQQMTGTAGRHHKHY  120

Query  776   TLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLKGASCGF  955
              +PN  NK++     +Q D    I SR R +PS     KTL WHLASE  S   GA    
Sbjct  121   IVPNLANKRMQAFNEMQTD--AEIDSRPRPYPS----EKTLFWHLASEKNSKSNGARQSE  174

Query  956   VSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVMRDALDG  1135
                ++ K++   S           G     SP      S    S+ A H +G M+D    
Sbjct  175   FVLEETKATKPASR----------GKEPSTSPLPKHLQSNSASSNFAMHNVG-MKDQ-PV  222

Query  1136  SKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              + ++ + SFDNP    R+    P R+KSML+AFFVK K+ K+
Sbjct  223   VRHLSSFSSFDNPRG--RQIQKAPLRTKSMLAAFFVKHKSGKM  263



>gb|EPS71503.1| hypothetical protein M569_03258, partial [Genlisea aurea]
Length=180

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 152/182 (84%), Gaps = 2/182 (1%)
 Frame = +2

Query  398  TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
            TF+E S+ERS+SFV ALQELKNLRPQL+SAAEYCEKSYL+S+QKQMVLENLKDY VRALV
Sbjct  1    TFEETSLERSRSFVTALQELKNLRPQLHSAAEYCEKSYLNSDQKQMVLENLKDYTVRALV  60

Query  578  NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
            NA+DH GTVA+KL D++ QQ++D S ++LKI+ +NQQLLTCQ YT+KEG RQQQLLAIIP
Sbjct  61   NAIDHFGTVAFKLCDILEQQSVDASAVDLKISHLNQQLLTCQTYTDKEGLRQQQLLAIIP  120

Query  758  RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
            RHHKHY LPNSVNKKV F+P++Q D R  +Q  GRL        KTLSWHLA+ET ST +
Sbjct  121  RHHKHYVLPNSVNKKVQFNPNVQTDPRHPVQ--GRLTQISQPGGKTLSWHLATETKSTFR  178

Query  938  GA  943
             +
Sbjct  179  SS  180



>emb|CDM82654.1| unnamed protein product [Triticum aestivum]
 emb|CDM83462.1| unnamed protein product [Triticum aestivum]
Length=305

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/299 (52%), Positives = 191/299 (64%), Gaps = 16/299 (5%)
 Frame = +2

Query  371   PKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENL  550
             P P   +  TFDE SMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQK +VL+NL
Sbjct  16    PDPARPAPTTFDEASMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKHIVLDNL  75

Query  551   KDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFR  730
             KDYAVRALVNAVDHLGTVAYKLTDL  QQ  +VST+ELK+  +NQQ+LTCQ YT+KEG R
Sbjct  76    KDYAVRALVNAVDHLGTVAYKLTDLYEQQVSEVSTVELKVASLNQQVLTCQTYTDKEGLR  135

Query  731   QQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHL  910
             QQQ++    RHHKHY +P + NK++     +Q D      +   L P    + KTL WHL
Sbjct  136   QQQMIGNATRHHKHYIVPTAGNKRMQAFSEMQTD------AEFDLKPKPYPSEKTLFWHL  189

Query  911   ASETTSTLKGASCGFVSADDIKSSGRT-SGAFNLLDGGEVGNRTKASPAWSKPPSVGPGS  1087
             ASE  +   G     +   + K++  T SG FNL      G     SP   +  S    S
Sbjct  190   ASEKNTKTNGEHQSELGHGETKTTKPTSSGGFNL-----TGKELSVSPLPKRLQSNVSSS  244

Query  1088  SIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              I T  +G M+D   G++ +  + S DN     R+    P R+KSML+AFFV+ ++ K+
Sbjct  245   DIVTRNIG-MKDQ-PGARHLASFSSLDNTRG--RQIQKAPVRTKSMLAAFFVRHRSGKM  299



>ref|XP_002458183.1| hypothetical protein SORBIDRAFT_03g028350 [Sorghum bicolor]
 gb|EES03303.1| hypothetical protein SORBIDRAFT_03g028350 [Sorghum bicolor]
Length=295

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 190/292 (65%), Gaps = 24/292 (8%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSFVKALQELKNLRPQLYSA+EYCEKSYLHSEQKQMVL+NLKDYAVRALV
Sbjct  19    TVDEASMERSKSFVKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLDNLKDYAVRALV  78

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  ++ST+ELK++C+NQQ+LTCQ YT+KEG RQQQ+     
Sbjct  79    NAVDHLGTVAYKLTDLYEQQASEISTLELKVSCLNQQVLTCQTYTDKEGVRQQQMTGAAR  138

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGP---AAAKTLSWHLASETTS  928
             RHHKHY +P + NK++     +Q D           F S P   ++A+TL WHL SE  S
Sbjct  139   RHHKHYIVPYAGNKRMQAFSDMQADAD---------FDSTPRPYSSARTLQWHLVSEKNS  189

Query  929   TLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL  1108
                      ++  D K++  +S  F L      G  + ASP      S    +S+    +
Sbjct  190   KTSRPDQSEIAQGDTKTTKPSSSGFRL------GKESSASPLSRNVQS--NITSLDIVNV  241

Query  1109  GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             G M+D    ++ ++ + S DNP    R+    P R+KSML+AFFVK ++ K+
Sbjct  242   G-MKDQ-PTTRHLSSFSSLDNPRG--RQIQKAPLRTKSMLAAFFVKHRSAKM  289



>ref|XP_009406792.1| PREDICTED: probable protein ABIL1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 157/310 (51%), Positives = 188/310 (61%), Gaps = 25/310 (8%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P + AMTFDE S+ERSKSFVK+LQELKNLRPQLYSAAEYCEKSYLH+EQKQ VL+NLK+Y
Sbjct  6     PESGAMTFDEASVERSKSFVKSLQELKNLRPQLYSAAEYCEKSYLHNEQKQTVLDNLKNY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
             A RALVNAVDHLGTVAY+LTDL  QQ LDVSTME+KI+C+NQ+   CQAY + EG  + Q
Sbjct  66    AGRALVNAVDHLGTVAYRLTDLFEQQMLDVSTMEMKISCLNQRAFACQAYGDTEGLSKLQ  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLAS  916
             +   I RHHKHY+LPNS  + +  S         +  ++R      G   +KTLSWHLAS
Sbjct  126   MTGRISRHHKHYSLPNSGRRSLQSSSQWPAGGNANPCKARPHSHAPGKPGSKTLSWHLAS  185

Query  917   ETTSTLKG-----ASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS---  1072
             E  S         A C      D KSS   S  F+LL   E        PA S+P S   
Sbjct  186   EANSAQNEAPPLPAPC----TGDAKSSKIDSQVFHLLVAEE--------PATSQPLSSLL  233

Query  1073  ----VGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFF  1240
                  G G+S        +   L+ SKP++ +RSFDNP   R     +P   KS+LS  F
Sbjct  234   LQAASGNGTSYMISNKFNLMGPLEDSKPISAFRSFDNPSSRREICKPLPQHGKSLLSTLF  293

Query  1241  VKQKTPKVNK  1270
              K KT K  K
Sbjct  294   TKNKTLKARK  303



>ref|XP_004969207.1| PREDICTED: probable protein ABIL1-like [Setaria italica]
Length=300

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 191/290 (66%), Gaps = 23/290 (8%)
 Frame = +2

Query  404   DEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNA  583
             DE SMERSKSFVKALQELKNLRPQLYSA+EYCEKSYLHSEQKQMVL+NLKDYAVRALVNA
Sbjct  25    DEASMERSKSFVKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLDNLKDYAVRALVNA  84

Query  584   VDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRH  763
             VDHLGTVAYKLTDL  QQ  ++ST+ELK+ C+NQQ+LTCQ YT+KEG RQQQ+     RH
Sbjct  85    VDHLGTVAYKLTDLYEQQASEISTLELKVACLNQQVLTCQTYTDKEGLRQQQMTGAARRH  144

Query  764   HKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGP---AAAKTLSWHLASETTSTL  934
             HKHY +P + NK++     +Q +           F S P   ++AKTL WHL SE  S  
Sbjct  145   HKHYIVPYAGNKRMQSFSEMQGNAD---------FDSTPRPYSSAKTLQWHLVSEKNSKS  195

Query  935   KGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGV  1114
                     +  + K++  +S  F LL     G  + ASP      S    +S+   ++G 
Sbjct  196   NRPDQSESTPGETKTTKPSSSGFRLL-----GKESSASPLSKHVQS--NLTSLDIVSVG-  247

Query  1115  MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             M+D   G++ ++ + SFDNP    R+    P R+KSML+AFFVK ++ K+
Sbjct  248   MKDQ-PGTRHLSSFSSFDNPRG--RQIQKAPLRTKSMLAAFFVKHRSAKM  294



>ref|XP_009406793.1| PREDICTED: protein ABIL1-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=304

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 188/310 (61%), Gaps = 27/310 (9%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P + AMTFDE S+ERSKSFVK+LQELKNLRPQLYSAAEYCEKSYLH+EQKQ VL+NLK+Y
Sbjct  6     PESGAMTFDEASVERSKSFVKSLQELKNLRPQLYSAAEYCEKSYLHNEQKQTVLDNLKNY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
             A RALVNAVDHLGTVAY+LTDL  QQ LDVSTME+KI+C+NQ+   CQAY + EG  + Q
Sbjct  66    AGRALVNAVDHLGTVAYRLTDLFEQQMLDVSTMEMKISCLNQRAFACQAYGDTEGLSKLQ  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGPAAAKTLSWHLAS  916
             +   I RHHKHY+LPNS  + +  S         +  ++R      G   +KTLSWHLAS
Sbjct  126   MTGRISRHHKHYSLPNSGRRSLQSSSQWPAGGNANPCKARPHSHAPGKPGSKTLSWHLAS  185

Query  917   ETTSTLKG-----ASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPS---  1072
             E  S         A C      D KSS   S  F+LL+           PA S+P S   
Sbjct  186   EANSAQNEAPPLPAPC----TGDAKSSKIDSQVFHLLE----------EPATSQPLSSLL  231

Query  1073  ----VGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFF  1240
                  G G+S        +   L+ SKP++ +RSFDNP   R     +P   KS+LS  F
Sbjct  232   LQAASGNGTSYMISNKFNLMGPLEDSKPISAFRSFDNPSSRREICKPLPQHGKSLLSTLF  291

Query  1241  VKQKTPKVNK  1270
              K KT K  K
Sbjct  292   TKNKTLKARK  301



>ref|XP_010230991.1| PREDICTED: probable protein ABIL4 isoform X1 [Brachypodium distachyon]
Length=308

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 188/292 (64%), Gaps = 17/292 (6%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSF+KALQELKNLRPQLYSA+EYCEKSYLH+EQKQMVL+NLKDYAVRA+V
Sbjct  29    TVDEASMERSKSFIKALQELKNLRPQLYSASEYCEKSYLHTEQKQMVLDNLKDYAVRAVV  88

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  ++ST ELK+  +NQQ+ TCQ Y +KEG RQQQ++    
Sbjct  89    NAVDHLGTVAYKLTDLFEQQASEISTFELKVARLNQQIFTCQIYVDKEGVRQQQMMTANM  148

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             +HHKHY LP++  K+     H+     Q  +S+ R +PS    AKTLSWHLAS+ ++   
Sbjct  149   KHHKHYILPSTSYKRTQAVAHLGTSTNQ--ESKPRPYPS----AKTLSWHLASDNSALAN  202

Query  938   GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGS-SIATHTLGV  1114
             GA     +  D  SS  +S    LL     G    ASP   +P  +   + S  T  +G 
Sbjct  203   GAHKSTFALGDTISSKISSDGMCLL-----GMEMPASP-MRRPLQLDRNTKSDVTQKVGA  256

Query  1115  MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
                +  G K MT + SFD P    RE    P  +KSML+A F+K K+ K+ K
Sbjct  257   KDQS--GVKHMTTFSSFDRPKG--REIQKAPIGTKSMLTALFIKHKSTKMKK  304



>gb|EMS54348.1| hypothetical protein TRIUR3_24588 [Triticum urartu]
Length=275

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 184/284 (65%), Gaps = 16/284 (6%)
 Frame = +2

Query  416   MERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDHL  595
             MERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQK +VL+NLKDYAVRALVNAVDHL
Sbjct  1     MERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKHIVLDNLKDYAVRALVNAVDHL  60

Query  596   GTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHHKHY  775
             GTVAYKLTDL  QQ  +VST+ELK+  +NQQ+LTCQ YT+KEG RQQQ++    RHHKHY
Sbjct  61    GTVAYKLTDLYEQQVSEVSTVELKVASLNQQVLTCQTYTDKEGLRQQQMIGNATRHHKHY  120

Query  776   TLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLKGASCGF  955
              +P + NK++     +Q D      +   L P    + KTL WHLASE  +   G     
Sbjct  121   IVPTAGNKRMQAFSEMQTD------AEFDLKPKPYPSEKTLFWHLASEKNTKTNGEHQSE  174

Query  956   VSADDIKSSGRT-SGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVMRDALD  1132
             +   + K++  T SG FNL      G     SP   +  S    S I T  +G M+D   
Sbjct  175   LGHGETKTTKPTSSGGFNL-----TGKELSVSPLPKRLQSTVSSSDIVTRNIG-MKDQ-P  227

Query  1133  GSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             G++ +  + S DNP    R+    P R+KSML+AFFV+ ++ K+
Sbjct  228   GARHLASFSSLDNPRG--RQIQKAPVRTKSMLAAFFVRHRSGKM  269



>ref|XP_004961070.1| PREDICTED: probable protein ABIL4-like [Setaria italica]
Length=297

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/291 (52%), Positives = 184/291 (63%), Gaps = 21/291 (7%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSF+KALQELKNLRPQLYSA+EYCEKSYLHSEQKQMVL+NLKDYAVRA+V
Sbjct  24    TVDEASMERSKSFIKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLDNLKDYAVRAVV  83

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  +VST ELK+  +NQQ+ TCQ YT+KEG RQQQ++    
Sbjct  84    NAVDHLGTVAYKLTDLFEQQASEVSTFELKVARLNQQVFTCQVYTDKEGLRQQQMMGTNI  143

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             +HHKHY LP++ +K+     H+  D  Q  +S+ R +PS    AKTLSWHLASE ++T  
Sbjct  144   KHHKHYILPSTGHKRSPAHAHLPADTDQ--ESKPRPYPS----AKTLSWHLASENSTTAN  197

Query  938   GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVM  1117
              A     +  D  SS   S           G    ASP           SS A   +G  
Sbjct  198   AAHKPTFALVDTASSKPAS-----------GKERSASPMRRPLQFNRSTSSDAMQKVGTK  246

Query  1118  RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
               +  G K  + + SFDNP    R     P  +KSML+A F+K K+ K+ K
Sbjct  247   NQS--GVKEFSTFHSFDNP--KGRAIQKAPVGTKSMLAALFIKHKSAKMKK  293



>ref|XP_003567834.1| PREDICTED: probable protein ABIL4 isoform X2 [Brachypodium distachyon]
Length=303

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 189/292 (65%), Gaps = 22/292 (8%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSF+KALQELKNLRPQLYSA+EYCEKSYLH+EQKQMVL+NLKDYAVRA+V
Sbjct  29    TVDEASMERSKSFIKALQELKNLRPQLYSASEYCEKSYLHTEQKQMVLDNLKDYAVRAVV  88

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  ++ST ELK+  +NQQ+ TCQ Y +KEG RQQQ++    
Sbjct  89    NAVDHLGTVAYKLTDLFEQQASEISTFELKVARLNQQIFTCQIYVDKEGVRQQQMMTANM  148

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             +HHKHY LP++  K+     H+     Q  +S+ R +PS    AKTLSWHLAS+ ++   
Sbjct  149   KHHKHYILPSTSYKRTQAVAHLGTSTNQ--ESKPRPYPS----AKTLSWHLASDNSALAN  202

Query  938   GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGS-SIATHTLGV  1114
             GA     +  D  SS  +S      DG E+     ASP   +P  +   + S  T  +G 
Sbjct  203   GAHKSTFALGDTISSKISS------DGMEMP----ASP-MRRPLQLDRNTKSDVTQKVGA  251

Query  1115  MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
                +  G K MT + SFD P    RE    P  +KSML+A F+K K+ K+ K
Sbjct  252   KDQS--GVKHMTTFSSFDRPKG--REIQKAPIGTKSMLTALFIKHKSTKMKK  299



>ref|XP_008802043.1| PREDICTED: protein ABIL1-like isoform X1 [Phoenix dactylifera]
Length=340

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 142/245 (58%), Positives = 167/245 (68%), Gaps = 34/245 (14%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P N+AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLH+EQKQMVL+NLKDY
Sbjct  6     PENAAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHNEQKQMVLDNLKDY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
             AV+A+VNAVDHLGTVAYKLTDL  QQ LDVST ELKI+C+NQQ+LTCQ YT+KEG RQQ+
Sbjct  66    AVQAIVNAVDHLGTVAYKLTDLFEQQTLDVSTAELKISCLNQQILTCQTYTDKEGLRQQR  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMD-HRQHIQSRGR------------LFP---  871
             +     RHHKHY LP+SV++++     +Q+D +  H+Q++ R            LF    
Sbjct  126   MFTNTARHHKHYILPDSVSRRMQSCSQLQIDANLIHVQAKPRPDPPGAGYLHLMLFQLFL  185

Query  872   ------------------SGPAAAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSG  997
                                G  A+KTLSW LASET S   GA        D K+   TS 
Sbjct  186   LCLSIYLCIHALYHVDWLKGSPASKTLSWLLASETNSASDGAPREVSGTGDAKAPKITSE  245

Query  998   AFNLL  1012
              F+LL
Sbjct  246   VFHLL  250



>ref|XP_009416405.1| PREDICTED: probable protein ABIL1 [Musa acuminata subsp. malaccensis]
Length=272

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 178/307 (58%), Gaps = 46/307 (15%)
 Frame = +2

Query  368   QPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLEN  547
             Q + P N AMTFDEVSMERSKSFV A+QELKNLRPQLYSAAEYCEKSYL SEQKQMVL+N
Sbjct  2     QQRRPENGAMTFDEVSMERSKSFVMAMQELKNLRPQLYSAAEYCEKSYLRSEQKQMVLDN  61

Query  548   LKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGF  727
             LK YAVRA+VNAVDHLGTVAYKLTDL  QQ LD STME+KI+C+NQQ  TCQAY +K+G 
Sbjct  62    LKSYAVRAIVNAVDHLGTVAYKLTDLFEQQLLDASTMEMKISCLNQQNFTCQAYGDKDGL  121

Query  728   RQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWH  907
              Q Q  A   RHHKHY LP+                                A+  LSWH
Sbjct  122   SQHQTPARTLRHHKHYILPSQY------------------------------ASNMLSWH  151

Query  908   LASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGS  1087
             +ASE  S   G          +K     S  F+LL    V     AS   S P     G+
Sbjct  152   VASEANSAATGDPLAAPCTRGVKCYKVNSEVFHLL----VAEDPAASLPLSAPLRATSGN  207

Query  1088  SI------ATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQ  1249
              I       + ++G    +L   KP++  +SFD+P   RRE    P RSKSMLS FF K 
Sbjct  208   VIFDMIPNKSASMG----SLKSPKPISAIKSFDSPG--RREICRPPGRSKSMLSTFFNKN  261

Query  1250  KTPKVNK  1270
             KT K  K
Sbjct  262   KTFKTRK  268



>ref|XP_006655638.1| PREDICTED: probable protein ABIL4-like [Oryza brachyantha]
Length=302

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 152/293 (52%), Positives = 190/293 (65%), Gaps = 19/293 (6%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSFV+ALQELKNLRPQLYSA+EYCEKSYLHSEQKQMVLENLKDYAVRA+V
Sbjct  23    TVDEASMERSKSFVRALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLENLKDYAVRAVV  82

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  +VST+ELK+  +NQQ+LTCQ +T++ G RQQQ+     
Sbjct  83    NAVDHLGTVAYKLTDLFEQQASEVSTVELKVARLNQQILTCQIFTDRAGLRQQQIGGTTL  142

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             +HHKHY LP++ +K+   + H+Q D+ Q   S  + +PS    AKTLSWHLASE + +  
Sbjct  143   KHHKHYILPSTSHKRTQVA-HLQKDNGQ--DSMPKPYPS----AKTLSWHLASENSISTP  195

Query  938   GAS-CGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSI-ATHTLG  1111
             GA    F   D I S   ++ +  LL     G    ASP   KP  +   +S  A   +G
Sbjct  196   GAQKYTFTLGDTISSKPASNSSLYLL-----GKDIPASP-MHKPLQLNGNTSFDAKKNIG  249

Query  1112  VMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
                      K ++ + S D P    RE   VP  +KSML+  F+K K+ K+ K
Sbjct  250   AKDQP--SFKYISTFNSLDKPRG--REIQKVPGGTKSMLATLFIKHKSAKMRK  298



>ref|NP_001056454.1| Os05g0585400 [Oryza sativa Japonica Group]
 sp|Q6I588.1|ABIL4_ORYSJ RecName: Full=Probable protein ABIL4; AltName: Full=Abl interactor-like 
protein 4 [Oryza sativa Japonica Group]
 gb|AAT47063.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18368.1| Os05g0585400 [Oryza sativa Japonica Group]
 dbj|BAG90465.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79770.1| hypothetical protein OsI_21168 [Oryza sativa Indica Group]
 gb|EEE64851.1| hypothetical protein OsJ_19708 [Oryza sativa Japonica Group]
Length=302

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 150/292 (51%), Positives = 187/292 (64%), Gaps = 17/292 (6%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSFVKALQELKNLRPQLYSA+EYCEKSYLHSEQKQMVLENLKDYAVRA+V
Sbjct  23    TVDEASMERSKSFVKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLENLKDYAVRAVV  82

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  +VST+ELK+  +NQQ+LTCQ +T++ G RQQ++     
Sbjct  83    NAVDHLGTVAYKLTDLFEQQASEVSTVELKVARLNQQILTCQIFTDRAGLRQQKIGGTTF  142

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             +HHKHY LP++ +K+   +  +Q D+ Q   S+ + +PS    AKTLSWHL+SE + +  
Sbjct  143   KHHKHYILPSTGHKRTQ-AARLQTDNGQ--DSKPKPYPS----AKTLSWHLSSENSISTT  195

Query  938   GA-SCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGV  1114
             GA    F   D I S   ++G+  LL     G    ASP        G  S  A   +G 
Sbjct  196   GAQKYTFTLGDTISSKPASNGSMYLL-----GKDIPASPMHKPLQPNGNTSFDAKKNVGS  250

Query  1115  MRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
                   G   M+ + + D P    RE   VP  +KSML+  F+K K+ K  K
Sbjct  251   KDQP--GFMHMSTFNALDKPRG--REIQKVPVSTKSMLATLFIKHKSAKTRK  298



>ref|XP_008656080.1| PREDICTED: probable protein ABIL4 [Zea mays]
 gb|AFW81267.1| hypothetical protein ZEAMMB73_840807 [Zea mays]
Length=298

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 145/291 (50%), Positives = 182/291 (63%), Gaps = 22/291 (8%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSF+KALQELKNLRPQLY+A+EYCEKSYLHSEQKQ VL+NLKDYA+RA+V
Sbjct  26    TVDEASMERSKSFIKALQELKNLRPQLYTASEYCEKSYLHSEQKQKVLDNLKDYALRAVV  85

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  +VST ELK+  +NQQ+ TCQ YT+KEG RQQQ++    
Sbjct  86    NAVDHLGTVAYKLTDLFEQQASEVSTYELKVARLNQQIFTCQVYTDKEGLRQQQMMGANI  145

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             +HHKHY LP +  K+   + H+Q D  Q  +S+ R +PS    AKTLSWHL+SE ++   
Sbjct  146   KHHKHYILPPTGYKRSLANGHLQADTDQ--ESKPRPYPS----AKTLSWHLSSENSTKAN  199

Query  938   GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVM  1117
                  F   D   S   +            G    ASP   +P      +S  T T  V 
Sbjct  200   AHKPTFALVDTAPSKPSS------------GKERSASP-MRRPLQFNRSTSSDT-TQKVG  245

Query  1118  RDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
                + G K ++ + SFDNP    R     P  +KSML+A F++ K+ K  +
Sbjct  246   AKNISGVKELSTFHSFDNPKG--RAIQKAPVGTKSMLAALFIRHKSSKAKR  294



>ref|NP_001149311.1| LOC100282934 [Zea mays]
 gb|ACG34975.1| protein ABIL1 [Zea mays]
Length=301

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 185/292 (63%), Gaps = 23/292 (8%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERS SFVKALQELKNLRPQLYSA+EYCEKSYL SEQKQ+VL+N+KDYAVRALV
Sbjct  24    TVDEASMERSMSFVKALQELKNLRPQLYSASEYCEKSYLRSEQKQVVLDNMKDYAVRALV  83

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  +Q  +++T+ELK+ C+NQQ+ TCQ YT+KEG RQQQ++    
Sbjct  84    NAVDHLGTVAYKLTDLYEEQASEITTLELKVACLNQQVRTCQTYTDKEGLRQQQMMGAAR  143

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGP---AAAKTLSWHLASETTS  928
             RHH HY +P + NK++      Q D           F   P   ++A+TL WHL SE  S
Sbjct  144   RHHNHYIVPYAGNKRMQAFSVTQADAD---------FDPTPRPFSSARTLEWHLVSEKNS  194

Query  929   TLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL  1108
                       +  + K++  +S  F LL     G  + ASP      S    +S+   ++
Sbjct  195   KTSRPDQSETALGETKTTKASSSGFRLL-----GKESSASPLSRNVQS--NITSLDIVSV  247

Query  1109  GVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
             G M+D    ++ ++ + S DNP    R+    P R+KSML+AFFVK ++ K+
Sbjct  248   G-MKDQ-PTTRHLSSFSSLDNPRG--RQIQKAPLRTKSMLAAFFVKHRSAKM  295



>ref|XP_002440340.1| hypothetical protein SORBIDRAFT_09g029940 [Sorghum bicolor]
 gb|EES18770.1| hypothetical protein SORBIDRAFT_09g029940 [Sorghum bicolor]
Length=297

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 150/297 (51%), Positives = 186/297 (63%), Gaps = 35/297 (12%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERSKSF+KALQ LKNLRPQLYSA+EYCEKSYL+SEQKQMVL+NLKDYAVRA+V
Sbjct  26    TVDEASMERSKSFIKALQVLKNLRPQLYSASEYCEKSYLNSEQKQMVLDNLKDYAVRAVV  85

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  QQ  +VST ELK+  +NQQ+ TCQ YT+KEG RQQQ++    
Sbjct  86    NAVDHLGTVAYKLTDLFEQQASEVSTYELKVARLNQQIFTCQVYTDKEGLRQQQMMTANI  145

Query  758   RHHKHYTLPNSVNKKVHFSP---HIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTS  928
             +HHKHY LP    +    SP   H+Q D  Q  +S+ R +PS    AKTLSWHL+SE ++
Sbjct  146   KHHKHYILPPGYKR----SPAHGHLQADTDQ--ESKPRPYPS----AKTLSWHLSSENST  195

Query  929   ---TLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIAT  1099
                T K       +A    +SG+   A  +    +  NR+ +S A  K   VG  +    
Sbjct  196   KANTHKPTFALLETAPSTPASGKERSASPMRRPLQF-NRSTSSDAMQK---VGTKNQ---  248

Query  1100  HTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKVNK  1270
                        G K  + + SFDNP    R     P  +KSML+A F+K K+ K+ K
Sbjct  249   ----------SGVKEFSTFHSFDNPKG--RAIQKAPVGTKSMLAALFIKHKSSKMKK  293



>tpg|DAA58511.1| TPA: hypothetical protein ZEAMMB73_369391 [Zea mays]
Length=416

 Score =   249 bits (635),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/290 (49%), Positives = 184/290 (63%), Gaps = 21/290 (7%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERS SFVKALQELKNLRPQLYSA+EYCEKSYL SEQKQ+VL+N+KDYAVRALV
Sbjct  141   TVDEASMERSMSFVKALQELKNLRPQLYSASEYCEKSYLRSEQKQVVLDNMKDYAVRALV  200

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  +Q  +++T+ELK+ C+NQQ+ TCQ YT+KEG RQQQ++    
Sbjct  201   NAVDHLGTVAYKLTDLYEEQASEITTLELKVACLNQQVRTCQTYTDKEGLRQQQMMGAAR  260

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             RHH HY +P + NK++      Q D         R F S    A+TL WHL SE  S   
Sbjct  261   RHHNHYIVPYAGNKRMQAFSVTQAD--ADFDPTPRPFSS----ARTLEWHLVSEKNSKTS  314

Query  938   GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTLGVM  1117
                   ++  + K++  +S  F LL     G  + ASP      S    S+I   +L ++
Sbjct  315   RPDQSEIALGETKTTKASSSGFRLL-----GKESSASPL-----SRNVQSNIT--SLDIV  362

Query  1118  RDALD-GSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
                +   ++ ++ + S DNP    R+    P R+KSML+AFFVK ++ K+
Sbjct  363   SAGMKPTTRHLSSFSSLDNPRG--RQIQKAPLRTKSMLAAFFVKHRSAKM  410



>ref|XP_009410866.1| PREDICTED: probable protein ABIL1 [Musa acuminata subsp. malaccensis]
Length=299

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 189/297 (64%), Gaps = 13/297 (4%)
 Frame = +2

Query  380   PPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDY  559
             P   AMTFDEVS+ERSK FV+ALQELKNLRPQLYSAAEYCEKSYL SEQKQMV++NLK+Y
Sbjct  6     PELGAMTFDEVSLERSKGFVQALQELKNLRPQLYSAAEYCEKSYLRSEQKQMVVDNLKEY  65

Query  560   AVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQ  739
              VRALVN VDHLGTVAYKLTDL  QQ+ D++T+E KI+C+ QQ+L CQA+T +E  RQ Q
Sbjct  66    GVRALVNVVDHLGTVAYKLTDLSEQQSSDMATVEQKISCLCQQILACQAFTGEECLRQHQ  125

Query  740   LLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASE  919
             L A  PRH KHYTLP  V   V  S  +Q +H        +  P    A KTLSWHLAS 
Sbjct  126   LFAATPRHLKHYTLPKFVGTSVESSSMLQ-NHINPSHVEAKPLPHT-WAPKTLSWHLASG  183

Query  920   TTST-LKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASP--AWSKPPSVGPGSS  1090
             + S+  +         DD K+ G T+ +  +L+       T   P  ++ +     P  +
Sbjct  184   SNSSPNRDPPHTAFRVDDSKAFGMTADSCRVLE-----ETTAPLPLSSYLQAAKRRPTIN  238

Query  1091  IATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPK  1261
             +A+ T  V +D L+G++ +  + S ++    +RE    P R+KS+LSA F + KT K
Sbjct  239   VASRTFAV-KDPLEGTRTVAGFESSND--SGQREICQPPPRNKSILSALFPRNKTLK  292



>gb|ACR34577.1| unknown [Zea mays]
 tpg|DAA58510.1| TPA: protein ABIL1 [Zea mays]
Length=418

 Score =   248 bits (634),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 142/291 (49%), Positives = 184/291 (63%), Gaps = 21/291 (7%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERS SFVKALQELKNLRPQLYSA+EYCEKSYL SEQKQ+VL+N+KDYAVRALV
Sbjct  141   TVDEASMERSMSFVKALQELKNLRPQLYSASEYCEKSYLRSEQKQVVLDNMKDYAVRALV  200

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  +Q  +++T+ELK+ C+NQQ+ TCQ YT+KEG RQQQ++    
Sbjct  201   NAVDHLGTVAYKLTDLYEEQASEITTLELKVACLNQQVRTCQTYTDKEGLRQQQMMGAAR  260

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             RHH HY +P + NK++      Q D         R F S    A+TL WHL SE  S   
Sbjct  261   RHHNHYIVPYAGNKRMQAFSVTQAD--ADFDPTPRPFSS----ARTLEWHLVSEKNSKTS  314

Query  938   GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIATHTL--G  1111
                   ++  + K++  +S  F LL     G  + ASP      S    S+I +  +   
Sbjct  315   RPDQSEIALGETKTTKASSSGFRLL-----GKESSASPL-----SRNVQSNITSLDIVSA  364

Query  1112  VMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
              M+D    ++ ++ + S DNP    R+    P R+KSML+AFFVK ++ K+
Sbjct  365   GMKDQ-PTTRHLSSFSSLDNPRG--RQIQKAPLRTKSMLAAFFVKHRSAKM  412



>ref|XP_004488722.1| PREDICTED: protein ABIL1-like [Cicer arietinum]
Length=328

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 138/178 (78%), Gaps = 2/178 (1%)
 Frame = +2

Query  524   QKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQ  703
             +++ VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ Q  LDVSTM+LK++ INQ+LLTCQ
Sbjct  100   KEERVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQHTLDVSTMDLKVSTINQKLLTCQ  159

Query  704   AYTEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDHRQH-IQSRGRLFPSGP  880
              YT KEG RQQQLLA IPRHHKHY LPNSVNKKVHFSPHIQ+D +Q+  Q+R R   SG 
Sbjct  160   IYTHKEGLRQQQLLAFIPRHHKHYILPNSVNKKVHFSPHIQIDAKQNSFQTRTRFQSSGA  219

Query  881   AAAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPA  1054
               AKTLSWHLASET STLKG      + ++ K S + SG F+LLD  E     K+SPA
Sbjct  220   PPAKTLSWHLASETKSTLKGTPHASPNIENPKFSAKASGFFHLLDNEE-STWMKSSPA  276



>tpg|DAA58512.1| TPA: hypothetical protein ZEAMMB73_369391 [Zea mays]
Length=386

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 147/218 (67%), Gaps = 11/218 (5%)
 Frame = +2

Query  398   TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
             T DE SMERS SFVKALQELKNLRPQLYSA+EYCEKSYL SEQKQ+VL+N+KDYAVRALV
Sbjct  141   TVDEASMERSMSFVKALQELKNLRPQLYSASEYCEKSYLRSEQKQVVLDNMKDYAVRALV  200

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             NAVDHLGTVAYKLTDL  +Q  +++T+ELK+ C+NQQ+ TCQ YT+KEG RQQQ++    
Sbjct  201   NAVDHLGTVAYKLTDLYEEQASEITTLELKVACLNQQVRTCQTYTDKEGLRQQQMMGAAR  260

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLASETTSTLK  937
             RHH HY +P + NK++      Q D         R F S    A+TL WHL SE  S   
Sbjct  261   RHHNHYIVPYAGNKRMQAFSVTQAD--ADFDPTPRPFSS----ARTLEWHLVSEKNSKTS  314

Query  938   GASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASP  1051
                   ++  + K++  +S  F LL     G  + ASP
Sbjct  315   RPDQSEIALGETKTTKASSSGFRLL-----GKESSASP  347



>gb|EMT22024.1| hypothetical protein F775_00995 [Aegilops tauschii]
Length=255

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = +2

Query  398  TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALV  577
            T DE SMERSKSFVKALQELKNLRPQLYSA+EYCEKSYL++ QKQMVL+NLKDYAVRA+V
Sbjct  24   TVDEASMERSKSFVKALQELKNLRPQLYSASEYCEKSYLNTHQKQMVLDNLKDYAVRAVV  83

Query  578  NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
            NAVDHLGTVAYKLTDL  QQ  ++ST ELK+  +NQQ+ TCQ Y +KEG RQQQ++    
Sbjct  84   NAVDHLGTVAYKLTDLFEQQASEISTFELKVARLNQQIFTCQIYVDKEGSRQQQMMGASM  143

Query  758  RHHKHYTLPNSVNKKVHFSPHIQMDHRQHIQSRGRLFPSG  877
            +HHKHY LP++  K+     H+  D  Q  +S+ R +PSG
Sbjct  144  KHHKHYILPSTGYKRTQAVAHLGTDTNQ--ESQPRPYPSG  181



>ref|XP_008369969.1| PREDICTED: probable protein ABIL1 [Malus domestica]
Length=124

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = +2

Query  356  MEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  535
            ME+EQ +P  N AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM
Sbjct  1    MELEQHRPG-NPAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQM  59

Query  536  VLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQ  685
            VL+NLKDYAVRALVNAVDHLGTVAYKLTDL+ QQ  DVSTM+LK+TC+NQ
Sbjct  60   VLDNLKDYAVRALVNAVDHLGTVAYKLTDLLDQQTSDVSTMDLKVTCLNQ  109



>ref|XP_002981240.1| hypothetical protein SELMODRAFT_113760 [Selaginella moellendorffii]
 gb|EFJ17941.1| hypothetical protein SELMODRAFT_113760 [Selaginella moellendorffii]
Length=150

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +2

Query  356  MEVEQPKPP----PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSE  523
            M+   P P       +A+T+DEVSM RS+ FV ALQELKNLRPQL+SAAEYCE SYL+SE
Sbjct  1    MQASSPSPTISTVTETALTYDEVSMHRSRHFVMALQELKNLRPQLHSAAEYCESSYLYSE  60

Query  524  QKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQ  703
            QKQ VLENLKDY+V+ALVNAVDHLGTVA KL DL+ QQN ++ + +L+I+ + Q+  TCQ
Sbjct  61   QKQAVLENLKDYSVKALVNAVDHLGTVACKLNDLLDQQNSEIVSADLRISSLAQRYRTCQ  120

Query  704  AYTEKEGFRQQQLLAIIPRHHKHYTLP  784
             YT++E  +QQ L    PRHHKHY+ P
Sbjct  121  EYTDREALKQQCLYKTYPRHHKHYSFP  147



>ref|XP_002982709.1| hypothetical protein SELMODRAFT_116820 [Selaginella moellendorffii]
 gb|EFJ16462.1| hypothetical protein SELMODRAFT_116820 [Selaginella moellendorffii]
Length=150

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = +2

Query  389  SAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVR  568
            +A+T+DEVSM RS+ FV ALQELKNLRPQL+SAAEYCE SYL+SEQKQ VLENLKDY+V+
Sbjct  16   TALTYDEVSMHRSRHFVMALQELKNLRPQLHSAAEYCESSYLYSEQKQAVLENLKDYSVK  75

Query  569  ALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLA  748
            ALVNAVDHLGTVA KL DL+ QQN ++ + +L+I+ + Q+  TCQ YT++E  +QQ L  
Sbjct  76   ALVNAVDHLGTVACKLNDLLDQQNSEIVSADLRISSLAQRYRTCQEYTDREALKQQCLYK  135

Query  749  IIPRHHKHYTLP  784
              PRHHKHY+ P
Sbjct  136  TYPRHHKHYSFP  147



>ref|XP_001783354.1| predicted protein [Physcomitrella patens]
 gb|EDQ51849.1| predicted protein [Physcomitrella patens]
Length=164

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +2

Query  395  MTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRAL  574
            MTFDE+ M+RS+ FV+AL+ELKNLRPQLYSAAEYCE SYL+S+QKQ+VL+NLKDY+V+AL
Sbjct  1    MTFDELEMQRSRHFVQALKELKNLRPQLYSAAEYCESSYLYSDQKQVVLDNLKDYSVKAL  60

Query  575  VNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAII  754
            VNAVDHLGTVAYKL DL+GQQ  ++S  EL+   + Q++ +CQ ++++EG +QQ L   +
Sbjct  61   VNAVDHLGTVAYKLNDLLGQQTTEISATELRAASVAQRMRSCQEHSDREGLKQQSLAKTM  120

Query  755  PRHHKHYTLP  784
              +HKHY LP
Sbjct  121  HANHKHYVLP  130



>gb|EMS46505.1| hypothetical protein TRIUR3_15295 [Triticum urartu]
Length=413

 Score =   184 bits (467),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = +2

Query  449  QELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLV  628
            +ELKNLRPQLYSA+EYCE+SYL++ QKQMVL+NLKDYAVRA+VNAVDHLGTVAYKLTDL 
Sbjct  199  RELKNLRPQLYSASEYCERSYLNTHQKQMVLDNLKDYAVRAVVNAVDHLGTVAYKLTDLF  258

Query  629  GQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVH  808
             QQ  ++ST ELK+  +NQQ+ TCQ Y +KEG RQQQ++    +HHKHY LP++  K+  
Sbjct  259  EQQASEISTFELKLARLNQQIFTCQIYVDKEGSRQQQMMGASMKHHKHYILPSTGYKRTQ  318

Query  809  FSPHIQMDHRQHIQSRGRLFPSG  877
               H+  D  Q  +S+ R +PSG
Sbjct  319  AVAHLGTDTNQ--ESQPRPYPSG  339



>gb|ACN40612.1| unknown [Picea sitchensis]
Length=255

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = +2

Query  362  VEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHS-EQKQMV  538
            +EQ +   +  MTFDE SM RS  F+ AL++LK+LRP LY AA+YCEKSYLH+ EQK  V
Sbjct  1    MEQKQASIDGGMTFDEFSMRRSSHFLNALEDLKSLRPHLYFAADYCEKSYLHNQEQKTKV  60

Query  539  LENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEK  718
            L+N KDYAV+ALVNAVDH+G VA KL DL+  +  +++  EL+I C+ Q++L C+ YT+ 
Sbjct  61   LDNSKDYAVKALVNAVDHIGNVASKLNDLLSNETAEIAATELRIDCLKQRVLACKEYTDG  120

Query  719  EGFRQQQLLAIIPRHHKHYTLPNS  790
            +  RQQ L+  IPR H+HY LP +
Sbjct  121  KALRQQCLVQTIPRFHRHYVLPEA  144



>emb|CDY26141.1| BnaC06g10550D [Brassica napus]
Length=199

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  413  SMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDH  592
            SMERSKSFVKAL ELKNLRPQLYSA +YCEKSYLHSEQKQMVL+NLKDY V+ALVN VDH
Sbjct  11   SMERSKSFVKALHELKNLRPQLYSAVDYCEKSYLHSEQKQMVLDNLKDYTVKALVNVVDH  70

Query  593  LGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTC  700
            LGTVA KLT+L  QQ+ D+STMEL+ +C++QQLLTC
Sbjct  71   LGTVASKLTNLFDQQSSDISTMELRASCVSQQLLTC  106



>emb|CDX86786.1| BnaA09g21760D [Brassica napus]
Length=239

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 131/236 (56%), Gaps = 36/236 (15%)
 Frame = +2

Query  656   MELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHHKHYTLPNSVNKKVHFSPHIQMDH  835
             M+L+ +C++QQLLT + Y +KEG RQQQLLA+IP HHKHYTLPNSVNK+VHFSP  + D 
Sbjct  1     MQLRASCVSQQLLTSRTYIDKEGLRQQQLLAVIPMHHKHYTLPNSVNKRVHFSPLRRTDT  60

Query  836   RQ-HIQ-SRGRLFPSGPA-------------------------------AAKTLSWHLAS  916
             RQ H Q    RL PSG                                 ++K+LSWHL S
Sbjct  61    RQNHYQVDISRLQPSGAMSPSWSLIDVLVVVINCNCLSNGLVLTHLDAPSSKSLSWHLGS  120

Query  917   ETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGSSIA  1096
             ET STLKG +    S+ D K+  +TSG F+L    E     K     S+   V   S+I 
Sbjct  121   ETKSTLKGTTTVASSSKDSKAFVKTSGVFHLSGDEENIINKKPFVGGSQVSGVPATSTIT  180

Query  1097  THTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPKV  1264
               T GV   A++  K  T ++S DN   PR E    P R+KS++SAFFVK KTPK+
Sbjct  181   RQTYGVAHKAVEVPKLTTAHKSHDN---PRGEIIQAPVRTKSVMSAFFVKPKTPKL  233



>emb|CBI23020.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 160/319 (50%), Gaps = 49/319 (15%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P P  A T+DEVSME+S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK+
Sbjct  7     PLPREASTYDEVSMEQSLLFSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVMETLKE  66

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YA++ALVN VDHLG+V YK+ DL+ ++  +VS  EL+++CI Q+L TC  Y + EG  QQ
Sbjct  67    YAIKALVNTVDHLGSVTYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCHEYMDHEGVSQQ  126

Query  737   QLLAIIPRHHKHYTLP-----NSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLS  901
              L+   P++HK Y LP     N    K  +      D     Q R        A   T+ 
Sbjct  127   SLVIDTPKYHKRYILPVGETMNGGRTKSKYQGRSLDDEDDWHQFRN-------AVRATI-  178

Query  902   WHLASETTSTLKGAS---------------CGFVSADDIKSSGRTSGAFNLLDGGEVGNR  1036
               + + ++S  KG S                G +   D++    +   F LL  G V +R
Sbjct  179   --IDTPSSSFRKGNSPSPSPRLSRPATFSFTGTMPRKDLEKRAVSPHRFPLLRSGSVSSR  236

Query  1037  TKASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRET----THV  1204
                +P  S+P    P ++ A               P  P +S     HP RE        
Sbjct  237   P-TTPNSSRP--TTPNTAAARRY------------PSEPRKSASMRLHPERENPKDMEQY  281

Query  1205  PTRSKSMLSAFFVKQKTPK  1261
             P++SK +L A   ++K+ K
Sbjct  282   PSKSKRLLKALLSRRKSKK  300



>ref|XP_010662870.1| PREDICTED: protein ABIL2 isoform X2 [Vitis vinifera]
 ref|XP_010662871.1| PREDICTED: protein ABIL2 isoform X2 [Vitis vinifera]
 ref|XP_010662872.1| PREDICTED: protein ABIL2 isoform X2 [Vitis vinifera]
Length=314

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 160/319 (50%), Gaps = 49/319 (15%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P P  A T+DEVSME+S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK+
Sbjct  10    PLPREASTYDEVSMEQSLLFSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVMETLKE  69

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YA++ALVN VDHLG+V YK+ DL+ ++  +VS  EL+++CI Q+L TC  Y + EG  QQ
Sbjct  70    YAIKALVNTVDHLGSVTYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCHEYMDHEGVSQQ  129

Query  737   QLLAIIPRHHKHYTLP-----NSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLS  901
              L+   P++HK Y LP     N    K  +      D     Q R        A   T+ 
Sbjct  130   SLVIDTPKYHKRYILPVGETMNGGRTKSKYQGRSLDDEDDWHQFRN-------AVRATI-  181

Query  902   WHLASETTSTLKGAS---------------CGFVSADDIKSSGRTSGAFNLLDGGEVGNR  1036
               + + ++S  KG S                G +   D++    +   F LL  G V +R
Sbjct  182   --IDTPSSSFRKGNSPSPSPRLSRPATFSFTGTMPRKDLEKRAVSPHRFPLLRSGSVSSR  239

Query  1037  TKASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRET----THV  1204
                +P  S+P    P ++ A               P  P +S     HP RE        
Sbjct  240   P-TTPNSSRP--TTPNTAAARRY------------PSEPRKSASMRLHPERENPKDMEQY  284

Query  1205  PTRSKSMLSAFFVKQKTPK  1261
             P++SK +L A   ++K+ K
Sbjct  285   PSKSKRLLKALLSRRKSKK  303



>emb|CDY57047.1| BnaC08g15010D [Brassica napus]
Length=120

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +2

Query  413  SMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDH  592
            SMERSKSF KAL ELKNLRPQLYSAA+YCEKSYLHSEQKQMVL+NLK+Y V+ALVN VDH
Sbjct  23   SMERSKSFFKALHELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKEYTVKALVNVVDH  82

Query  593  LGTVAYKLTDLVGQQNLDVSTMELKITCINQ  685
            LGTVA KLT+L  QQ+ DVSTMEL+ +C++Q
Sbjct  83   LGTVASKLTNLFDQQSSDVSTMELRASCVSQ  113



>ref|XP_010662869.1| PREDICTED: protein ABIL2 isoform X1 [Vitis vinifera]
Length=340

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 160/319 (50%), Gaps = 49/319 (15%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P P  A T+DEVSME+S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK+
Sbjct  36    PLPREASTYDEVSMEQSLLFSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVMETLKE  95

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YA++ALVN VDHLG+V YK+ DL+ ++  +VS  EL+++CI Q+L TC  Y + EG  QQ
Sbjct  96    YAIKALVNTVDHLGSVTYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCHEYMDHEGVSQQ  155

Query  737   QLLAIIPRHHKHYTLP-----NSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLS  901
              L+   P++HK Y LP     N    K  +      D     Q R        A   T+ 
Sbjct  156   SLVIDTPKYHKRYILPVGETMNGGRTKSKYQGRSLDDEDDWHQFRN-------AVRATI-  207

Query  902   WHLASETTSTLKGAS---------------CGFVSADDIKSSGRTSGAFNLLDGGEVGNR  1036
               + + ++S  KG S                G +   D++    +   F LL  G V +R
Sbjct  208   --IDTPSSSFRKGNSPSPSPRLSRPATFSFTGTMPRKDLEKRAVSPHRFPLLRSGSVSSR  265

Query  1037  TKASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRET----THV  1204
                +P  S+P    P ++ A               P  P +S     HP RE        
Sbjct  266   P-TTPNSSRP--TTPNTAAARRY------------PSEPRKSASMRLHPERENPKDMEQY  310

Query  1205  PTRSKSMLSAFFVKQKTPK  1261
             P++SK +L A   ++K+ K
Sbjct  311   PSKSKRLLKALLSRRKSKK  329



>ref|XP_010426437.1| PREDICTED: protein ABIL2 [Camelina sativa]
Length=312

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 160/329 (49%), Gaps = 63/329 (19%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P  + A  +DEVSM+++  F   LQ+LKNLR QLYSAAEY E SY   ++KQ+V+E LKD
Sbjct  2     PESHEASNYDEVSMQQTMLFSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKD  61

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YAV+ALVN VDHLG+V YK+ D + ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  62    YAVKALVNTVDHLGSVTYKVNDFIDEKVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQ  121

Query  737   QLLAIIPRHHKHYTLP-------NSVNKKVHFSPHIQ-----MDHRQHIQSRGRLFPSGP  880
              L+   P+ HK Y LP        ++ K  +F   ++        R  +++  R  P  P
Sbjct  122   SLVIDTPKFHKRYILPAGEIMTTTNLEKLKYFGSSLEDADDWNQFRNAVRATIRETPPLP  181

Query  881   AAAKTLSWHLASETTSTL----KGASCGFVSADDIKSSGRTSGA---FNLLDGGEVGNRT  1039
                 T      S+T+S      + A+  F S    K   + S +   F LL  G V  R 
Sbjct  182   VRKST------SQTSSPRLPPQRSATFSFTSTIPKKEQDKISVSPHRFPLLRSGSVATRK  235

Query  1040  KASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETT-------  1198
              AS +    PS                     S+ +TP R    P  PRR  +       
Sbjct  236   SASISRPTTPS--------------------KSRSITPIR---YPSEPRRSASVRVAFEK  272

Query  1199  --------HVPTRSKSMLSAFFVKQKTPK  1261
                      VP++SK +L A   ++KT K
Sbjct  273   ENQKETEQQVPSKSKRLLKALLSRRKTKK  301



>ref|XP_010515274.1| PREDICTED: protein ABIL2-like [Camelina sativa]
Length=312

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 159/329 (48%), Gaps = 63/329 (19%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P  + A  +DEVSM+++  F   LQ+LKNLR QLYSAAEY E SY   ++KQ+V+E LKD
Sbjct  2     PESHEASNYDEVSMQQTMLFSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKD  61

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YAV+ALVN VDHLG+V YK+ D + ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  62    YAVKALVNTVDHLGSVTYKVNDFIDEKVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQ  121

Query  737   QLLAIIPRHHKHYTLP-------NSVNKKVHFSPHIQ-----MDHRQHIQSRGRLFPSGP  880
              L+   P+ HK Y LP        ++ K  +F   ++        R  +++  R  P  P
Sbjct  122   SLVIDTPKFHKRYILPAGEIMTATNLEKLKYFGSSLEDADDWNQFRNAVRATIRETPPLP  181

Query  881   AAAKTLSWHLASETTSTL----KGASCGFVSADDIKSSGRTS---GAFNLLDGGEVGNRT  1039
                 T      S+T+S      + A+  F S    K   + S     F LL  G V  R 
Sbjct  182   VRKST------SQTSSPRLPPQRSATFSFTSTIPKKEQDKLSVLPHRFPLLRSGSVATRK  235

Query  1040  KASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETT-------  1198
              AS +    PS                     S+ +TP R    P  PRR  +       
Sbjct  236   SASISRPTTPS--------------------KSRSITPIR---YPSEPRRSASVRVAFQK  272

Query  1199  --------HVPTRSKSMLSAFFVKQKTPK  1261
                      VP++SK +L A   ++KT K
Sbjct  273   ENQKETEQQVPSKSKRLLKALLSRRKTKK  301



>ref|NP_190498.1| ABL interactor-like protein 2 [Arabidopsis thaliana]
 ref|NP_001030832.1| ABL interactor-like protein 2 [Arabidopsis thaliana]
 sp|Q9M3A3.1|ABIL2_ARATH RecName: Full=Protein ABIL2; AltName: Full=Abl interactor-like 
protein 2; Short=AtABIL2 [Arabidopsis thaliana]
 emb|CAB66408.1| putative protein [Arabidopsis thaliana]
 gb|AAW49257.1| Abl interactor-like protein-2 [Arabidopsis thaliana]
 gb|ABG48437.1| At3g49290 [Arabidopsis thaliana]
 gb|AEE78522.1| ABL interactor-like protein 2 [Arabidopsis thaliana]
 gb|AEE78523.1| ABL interactor-like protein 2 [Arabidopsis thaliana]
Length=312

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 157/323 (49%), Gaps = 51/323 (16%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P  + A  +DEVSM++S  F   LQ+LKNLR QLYSAAEY E SY   ++KQ+V+E LKD
Sbjct  2     PASHEASNYDEVSMQQSMLFSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKD  61

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YAV+ALVN VDHLG+V YK+ D + ++  +VS  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  62    YAVKALVNTVDHLGSVTYKVNDFIDEKVDEVSETELRVSCIEQRLRMCQEYMDHEGRSQQ  121

Query  737   QLLAIIPRHHKHYTLP-------NSVNKKVHFSPHIQ-MDHRQHIQS--RGRLFPSGPAA  886
              L+   P+ HK Y LP        ++ K  +F   ++  D     ++  R  +  + P  
Sbjct  122   SLVIDTPKFHKRYILPAGEIMTATNLEKLKYFGSSLEDADDWNQFRNAVRATIRETPPPP  181

Query  887   AKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGA---FNLLDGGEVGNRTKASPAW  1057
              +  +   +S      + A+  F S    K   + S +   F LL  G V  R  AS + 
Sbjct  182   VRKSTSQSSSPRQPPQRSATFSFTSTIPKKEQDKRSVSPHRFPLLRSGSVATRKSASISR  241

Query  1058  SKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETT-------------  1198
                PS                     S+ +TP R    P  PRR  +             
Sbjct  242   PTTPS--------------------KSRSITPIR---YPSEPRRSASVRVAFEKDNQKET  278

Query  1199  --HVPTRSKSMLSAFFVKQKTPK  1261
                 P++SK +L A   ++KT K
Sbjct  279   EQQQPSKSKRLLKALLSRRKTKK  301



>ref|XP_006291525.1| hypothetical protein CARUB_v10017674mg [Capsella rubella]
 gb|EOA24423.1| hypothetical protein CARUB_v10017674mg [Capsella rubella]
Length=312

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 111/329 (34%), Positives = 160/329 (49%), Gaps = 63/329 (19%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P  + A  +DEVSM+++  F   LQ+LKNLR QLYSAAEY E SY   ++KQ+V+E LKD
Sbjct  2     PESHEASNYDEVSMQQTMLFSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKD  61

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YAV+ALVN VDHLG+V YK+ D + ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  62    YAVKALVNTVDHLGSVTYKVNDFIDEKVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQ  121

Query  737   QLLAIIPRHHKHYTLP-------NSVNKKVHFSPHIQ-----MDHRQHIQSRGRLFPSGP  880
              L+   P+ HK Y LP        ++ K  +F   ++        R  +++  R  P  P
Sbjct  122   SLVIDTPKFHKRYILPAGEIMTATNLEKLKYFGSSLEDADDWNQFRNAVRATIRETPPLP  181

Query  881   AAAKTLSWHLASETTSTL----KGASCGFVSADDIKSSGRTSGA---FNLLDGGEVGNRT  1039
                 T      S+T+S      + A+  F S    K   + S +   F LL  G V  R 
Sbjct  182   VRKST------SQTSSPRLPPQRSATFSFTSTIPKKEQDKRSVSPHRFPLLRSGSVATRK  235

Query  1040  KASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETT-------  1198
              AS +    PS                     S+ +TP R   +P  PRR  +       
Sbjct  236   SASISRPTTPS--------------------KSRSITPIR---HPSEPRRSASVRVAFEK  272

Query  1199  --------HVPTRSKSMLSAFFVKQKTPK  1261
                       P++SK +L A   ++KT K
Sbjct  273   ENQKETEQQQPSKSKRLLKALLSRRKTKK  301



>ref|XP_006288227.1| hypothetical protein CARUB_v10001467mg [Capsella rubella]
 gb|EOA21125.1| hypothetical protein CARUB_v10001467mg [Capsella rubella]
Length=321

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/313 (35%), Positives = 154/313 (49%), Gaps = 32/313 (10%)
 Frame = +2

Query  383   PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
             P  A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKDYA
Sbjct  10    PREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYA  69

Query  563   VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
             ++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ L
Sbjct  70    IKALVNTVDHLGSVTYKVNDFVDEKVDEVAGAELRVSCIEQRLRMCQEYMDHEGRSQQSL  129

Query  743   LAIIPRHHKHYTLPNSVNKK---------VHFSPHIQMD---HRQHIQSRGRLFPSGPAA  886
             L   P+ HK Y LP+   K+         V  S   + D    R  ++++ R  P  P  
Sbjct  130   LIETPKFHKRYILPSGEIKRGGNLAKLKNVEGSFDGEEDLNQFRNAVRAKIRETPPPPVK  189

Query  887   AKTLS--WHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWS  1060
                L        + ++T   +S       +      +   F LL  G V  R    P+  
Sbjct  190   KPILQSPSQRKPQRSATFSFSSISTAPKKEQDKREVSPHRFPLLRSGSVAIR----PSSV  245

Query  1061  KPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRS------FDNPPHPRRETTHVPTRSKS  1222
               P+    S   T T            P  P RS      F+       E  H P++SK 
Sbjct  246   SRPTTPSKSRAVTPT--------PKRYPSEPRRSASVRVAFEKEAQKEPEHQHQPSKSKR  297

Query  1223  MLSAFFVKQKTPK  1261
             +L A   ++KT K
Sbjct  298   LLKALLSRRKTKK  310



>ref|NP_974829.1| ABL interactor-like protein 3 [Arabidopsis thaliana]
 gb|AED93284.1| ABL interactor-like protein 3 [Arabidopsis thaliana]
Length=240

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKD
Sbjct  8    PMPREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKD  67

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  68   YAIKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQ  127

Query  737  QLLAIIPRHHKHYTLPNSVNKK  802
             L+   P+ HK Y LP+   K+
Sbjct  128  SLVIDTPKFHKRYFLPSGEIKR  149



>ref|XP_010266575.1| PREDICTED: protein ABIL2 isoform X2 [Nelumbo nucifera]
Length=313

 Score =   155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A T+DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKD
Sbjct  13   PQPQEASTYDELSMQQSLLFSDSLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKD  72

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG++ YK+  L+ ++  +VS  EL+++CI Q+L +CQAY + +G  QQ
Sbjct  73   YAIKALVNTVDHLGSMTYKVNGLLDEKVEEVSGTELRVSCIEQRLRSCQAYIDHQGLAQQ  132

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P++HK Y LP
Sbjct  133  SLVITTPKYHKRYILP  148



>ref|XP_002875960.1| hypothetical protein ARALYDRAFT_485287 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52219.1| hypothetical protein ARALYDRAFT_485287 [Arabidopsis lyrata subsp. 
lyrata]
Length=312

 Score =   155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 155/323 (48%), Gaps = 51/323 (16%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P  + A  +DEVSM++S  F   LQ+LKNLR QLYSAAEY E SY   ++KQ+V+E LKD
Sbjct  2     PASHDASNYDEVSMQQSMLFSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKD  61

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YAV+ALVN VDHLG+V YK+ D +  +  +VS  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  62    YAVKALVNTVDHLGSVTYKVNDFIDDKVDEVSETELRVSCIEQRLRMCQEYMDHEGRSQQ  121

Query  737   QLLAIIPRHHKHYTLP-------NSVNKKVHFSPHIQ-MDHRQHIQS--RGRLFPSGPAA  886
              L+   P+ HK Y LP        ++ K  +F   ++  D     ++  R  +  + P  
Sbjct  122   SLVIDTPKFHKRYILPAGEIMTATNLEKLKYFGSSLEDADDWNQFRNAVRATIRETPPPP  181

Query  887   AKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGA---FNLLDGGEVGNRTKASPAW  1057
              +  +    S      + A+  F S    K   + S +   F LL  G V  R  AS + 
Sbjct  182   VRKSTSQTPSPRQPPQRSATFSFTSTIPKKEQDKRSVSPHRFPLLRSGSVATRKSASISR  241

Query  1058  SKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETT-------------  1198
                PS                     S+ +TP R    P  PRR  +             
Sbjct  242   PTTPS--------------------KSRSITPIR---YPSEPRRSASVRVAFEKENQKET  278

Query  1199  --HVPTRSKSMLSAFFVKQKTPK  1261
                 P++SK +L A   ++KT K
Sbjct  279   EQQQPSKSKRLLKALLSRRKTKK  301



>ref|XP_010266572.1| PREDICTED: protein ABIL2 isoform X1 [Nelumbo nucifera]
 ref|XP_010266574.1| PREDICTED: protein ABIL2 isoform X1 [Nelumbo nucifera]
Length=314

 Score =   155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A T+DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKD
Sbjct  13   PQPQEASTYDELSMQQSLLFSDSLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKD  72

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG++ YK+  L+ ++  +VS  EL+++CI Q+L +CQAY + +G  QQ
Sbjct  73   YAIKALVNTVDHLGSMTYKVNGLLDEKVEEVSGTELRVSCIEQRLRSCQAYIDHQGLAQQ  132

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P++HK Y LP
Sbjct  133  SLVITTPKYHKRYILP  148



>gb|KHN23356.1| Protein ABIL2 [Glycine soja]
Length=329

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = +2

Query  374  KPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            +P    A  +DEV M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK
Sbjct  10   QPVSQEASNYDEVFMQQSLLFDDSLKDLKNLRAQLYSAAEYFELSYSNDDQKQVVVETLK  69

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYA++ALVN VDHLG+V YK+ DL+ ++ ++VS  EL+++CI Q++ TC  Y + EG  Q
Sbjct  70   DYAIKALVNTVDHLGSVTYKVNDLLDEKVVEVSVAELRVSCIEQRIKTCHEYMDHEGRTQ  129

Query  734  QQLLAIIPRHHKHYTLP-NSVNKKVHFSPHIQMDH  835
            Q L+   P++HK Y LP NSV + +H +   +  H
Sbjct  130  QSLVISTPKYHKRYILPGNSVGETMHGANRTKSKH  164



>ref|XP_010912294.1| PREDICTED: putative protein ABIL2 isoform X3 [Elaeis guineensis]
Length=322

 Score =   155 bits (392),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A TFDE+SM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+  LKDYAV+A
Sbjct  17   ASTFDELSMQQSLLFSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQLVVNTLKDYAVKA  76

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            LVN VDHLG+V++K+  L+ ++  +VS  EL+++CI Q++ TCQA+ ++EG  QQ L+  
Sbjct  77   LVNTVDHLGSVSFKVNGLLDEKVDEVSGTELRVSCIEQRIRTCQAFIDREGLSQQSLVIT  136

Query  752  IPRHHKHYTLP  784
             P++HK Y LP
Sbjct  137  APKYHKRYILP  147



>ref|XP_004307967.1| PREDICTED: protein ABIL2-like [Fragaria vesca subsp. vesca]
Length=319

 Score =   155 bits (392),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QKQ V+E LKD
Sbjct  7    PIPGVASNFDEVSMHQSLLFSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQTVVETLKD  66

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  QQ
Sbjct  67   YAIKALVNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGLSQQ  126

Query  737  QLLAIIPRHHKHYTLP  784
              +   P++HK Y LP
Sbjct  127  SSVIDTPKYHKRYILP  142



>ref|XP_010912262.1| PREDICTED: putative protein ABIL2 isoform X1 [Elaeis guineensis]
 ref|XP_010912270.1| PREDICTED: putative protein ABIL2 isoform X1 [Elaeis guineensis]
 ref|XP_010912276.1| PREDICTED: putative protein ABIL2 isoform X1 [Elaeis guineensis]
Length=323

 Score =   155 bits (392),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A TFDE+SM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+  LKDYAV+A
Sbjct  17   ASTFDELSMQQSLLFSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQLVVNTLKDYAVKA  76

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            LVN VDHLG+V++K+  L+ ++  +VS  EL+++CI Q++ TCQA+ ++EG  QQ L+  
Sbjct  77   LVNTVDHLGSVSFKVNGLLDEKVDEVSGTELRVSCIEQRIRTCQAFIDREGLSQQSLVIT  136

Query  752  IPRHHKHYTLP  784
             P++HK Y LP
Sbjct  137  APKYHKRYILP  147



>ref|NP_197819.2| ABL interactor-like protein 3 [Arabidopsis thaliana]
 sp|Q6NMC6.1|ABIL3_ARATH RecName: Full=Protein ABIL3; AltName: Full=Abl interactor-like 
protein 3; Short=AtABIL3 [Arabidopsis thaliana]
 gb|AAS49097.1| At5g24310 [Arabidopsis thaliana]
 gb|AAW49258.1| Abl interactor-like protein-3 [Arabidopsis thaliana]
 dbj|BAD95383.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF00710.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93285.1| ABL interactor-like protein 3 [Arabidopsis thaliana]
Length=321

 Score =   155 bits (392),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKD
Sbjct  8    PMPREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKD  67

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  68   YAIKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQ  127

Query  737  QLLAIIPRHHKHYTLPNSVNKK  802
             L+   P+ HK Y LP+   K+
Sbjct  128  SLVIDTPKFHKRYFLPSGEIKR  149



>ref|XP_006394685.1| hypothetical protein EUTSA_v10004602mg [Eutrema salsugineum]
 gb|ESQ31971.1| hypothetical protein EUTSA_v10004602mg [Eutrema salsugineum]
Length=322

 Score =   155 bits (392),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +2

Query  383  PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
            P  A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKDYA
Sbjct  10   PREATNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYA  69

Query  563  VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
            ++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ L
Sbjct  70   IKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSL  129

Query  743  LAIIPRHHKHYTLPN  787
            +   P+ HK Y LP+
Sbjct  130  VIDTPKFHKRYILPS  144



>ref|XP_002516649.1| Protein ABIL2, putative [Ricinus communis]
 gb|EEF45668.1| Protein ABIL2, putative [Ricinus communis]
Length=312

 Score =   155 bits (391),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A  +DEVSM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYA++A
Sbjct  10   ASNYDEVSMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKA  69

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            LVN VDHLG+V YK+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  QQ L+  
Sbjct  70   LVNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGITQQSLVIN  129

Query  752  IPRHHKHYTLP  784
             P++HK Y LP
Sbjct  130  TPKYHKRYILP  140



>ref|XP_010493575.1| PREDICTED: protein ABIL3-like [Camelina sativa]
Length=321

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKD
Sbjct  8    PMPREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKD  67

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  68   YALKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQ  127

Query  737  QLLAIIPRHHKHYTLPNSVNKK  802
             L+   P+ HK Y LP+   K+
Sbjct  128  SLVIDTPKFHKRYILPSGEIKR  149



>ref|XP_009623773.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009623774.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana tomentosiformis]
Length=324

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = +2

Query  371  PKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENL  550
            P+ P N    FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + EQK++V+  L
Sbjct  13   PREPAN----FDEVSMHQSMLFSDSLKDLKNLRKQLYSAAEYFELSYSNDEQKEVVVNTL  68

Query  551  KDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFR  730
            KDYA++ALVN VDHLG+V YK++DL+ ++  +VS  EL+++CI Q+L TCQ Y + EG  
Sbjct  69   KDYAIKALVNTVDHLGSVTYKVSDLLDEKVDEVSGTELRLSCIEQRLKTCQEYIDHEGLS  128

Query  731  QQQLLAIIPRHHKHYTLPNSVNKKVH  808
            QQ L+   P++HK Y LP  V + VH
Sbjct  129  QQSLVIHTPKYHKRYILP--VGETVH  152



>dbj|BAB10397.1| unnamed protein product [Arabidopsis thaliana]
Length=333

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 0/142 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKD
Sbjct  8    PMPREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKD  67

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  68   YAIKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQ  127

Query  737  QLLAIIPRHHKHYTLPNSVNKK  802
             L+   P+ HK Y LP+   K+
Sbjct  128  SLVIDTPKFHKRYFLPSGEIKR  149



>gb|EYU25243.1| hypothetical protein MIMGU_mgv1a009919mg [Erythranthe guttata]
Length=327

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P     +DEVSM++S  F  +L++LKNLR QLYSAAEY E +Y++ +QK +V+  LKD
Sbjct  11   PFPREPANYDEVSMQQSMLFSDSLEDLKNLRKQLYSAAEYFEMTYINDDQKDIVVNTLKD  70

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL+ ++   VS  EL+++CI Q+L TCQ Y ++EG  QQ
Sbjct  71   YAIKALVNTVDHLGSVTYKVNDLLDEKVDQVSGTELRVSCIEQRLRTCQEYIDREGLSQQ  130

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P +HK Y LP
Sbjct  131  SLVINTPNYHKRYILP  146



>ref|XP_009623775.1| PREDICTED: protein ABIL2-like isoform X2 [Nicotiana tomentosiformis]
Length=323

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = +2

Query  371  PKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENL  550
            P+ P N    FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + EQK++V+  L
Sbjct  13   PREPAN----FDEVSMHQSMLFSDSLKDLKNLRKQLYSAAEYFELSYSNDEQKEVVVNTL  68

Query  551  KDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFR  730
            KDYA++ALVN VDHLG+V YK++DL+ ++  +VS  EL+++CI Q+L TCQ Y + EG  
Sbjct  69   KDYAIKALVNTVDHLGSVTYKVSDLLDEKVDEVSGTELRLSCIEQRLKTCQEYIDHEGLS  128

Query  731  QQQLLAIIPRHHKHYTLPNSVNKKVH  808
            QQ L+   P++HK Y LP  V + VH
Sbjct  129  QQSLVIHTPKYHKRYILP--VGETVH  152



>gb|KDP45550.1| hypothetical protein JCGZ_18175 [Jatropha curcas]
Length=314

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DEVSM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYA++ALVN
Sbjct  13   YDEVSMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKALVN  72

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  QQ L+   P+
Sbjct  73   TVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGLTQQSLVINTPK  132

Query  761  HHKHYTLP  784
            +HK Y LP
Sbjct  133  YHKRYILP  140



>ref|XP_010421253.1| PREDICTED: protein ABIL3 isoform X1 [Camelina sativa]
Length=321

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKD
Sbjct  8    PMPREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYSNDEQKQIVVETLKD  67

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  68   YALKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQ  127

Query  737  QLLAIIPRHHKHYTLPN  787
             L+   P+ HK Y LP+
Sbjct  128  SLVIDTPKFHKRYILPS  144



>ref|XP_010454735.1| PREDICTED: protein ABIL3-like [Camelina sativa]
Length=321

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKD
Sbjct  8    PMPREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYSNDEQKQIVVETLKD  67

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  68   YALKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQ  127

Query  737  QLLAIIPRHHKHYTLPN  787
             L+   P+ HK Y LP+
Sbjct  128  SLVIDTPKFHKRYILPS  144



>ref|XP_010267571.1| PREDICTED: protein ABIL3-like [Nelumbo nucifera]
Length=309

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A T+DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYA++A
Sbjct  16   ASTYDELSMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKA  75

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            LVN VDHLG+V YK+  L+ ++ ++VS  EL+++CI Q+L +CQ YT+ +G  QQ L+ +
Sbjct  76   LVNTVDHLGSVTYKVNGLLDEKVVEVSGTELRVSCIEQRLRSCQDYTDHQGRAQQSLVIM  135

Query  752  IPRHHKHYTLP  784
             P++HK Y LP
Sbjct  136  TPKYHKRYILP  146



>ref|XP_011024852.1| PREDICTED: protein ABIL2 [Populus euphratica]
Length=334

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A  +DEVSM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYA++A
Sbjct  13   ASNYDEVSMQQSLLFSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKA  72

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            LVN VDHLG+V YK+ DL  ++  +VS  E ++ CI Q+L TCQ Y + EG  QQ L+  
Sbjct  73   LVNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVCCIEQRLRTCQEYIDHEGISQQSLVID  132

Query  752  IPRHHKHYTLP  784
             P++HK Y LP
Sbjct  133  TPKYHKRYILP  143



>ref|XP_010421254.1| PREDICTED: protein ABIL3 isoform X2 [Camelina sativa]
Length=315

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKD
Sbjct  2    PMPREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYSNDEQKQIVVETLKD  61

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  62   YALKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQ  121

Query  737  QLLAIIPRHHKHYTLPN  787
             L+   P+ HK Y LP+
Sbjct  122  SLVIDTPKFHKRYILPS  138



>ref|XP_006441129.1| hypothetical protein CICLE_v10021055mg [Citrus clementina]
 gb|ESR54369.1| hypothetical protein CICLE_v10021055mg [Citrus clementina]
Length=234

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P       +DEV+M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKD
Sbjct  11   PMTRDVSNYDEVAMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKD  70

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YAV+ALVN VDHLG+V YK+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  QQ
Sbjct  71   YAVKALVNTVDHLGSVTYKVNDLLDEKVDEVSDTEHRVSCIEQRLRTCQEYIDHEGLSQQ  130

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P++HK Y LP
Sbjct  131  SLVINTPKYHKRYILP  146



>ref|XP_009784226.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009784227.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana sylvestris]
Length=324

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 103/146 (71%), Gaps = 6/146 (4%)
 Frame = +2

Query  371  PKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENL  550
            P+ P N    FDEVSM +S  F  +L +LKNLR QLYSAAEY E SY + EQK++V+  L
Sbjct  14   PREPAN----FDEVSMHQSMLFSDSLTDLKNLRKQLYSAAEYFELSYSNDEQKEVVVNTL  69

Query  551  KDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFR  730
            KDYA++ALVN VDHLG+V YK++DL+ ++  +VS  EL+++CI Q+L TCQ Y + EG  
Sbjct  70   KDYAIKALVNTVDHLGSVTYKVSDLLDEKVDEVSGTELRLSCIEQRLKTCQEYIDHEGLS  129

Query  731  QQQLLAIIPRHHKHYTLPNSVNKKVH  808
            QQ L+   P++HK Y LP  V + VH
Sbjct  130  QQSLVIHTPKYHKRYILP--VGETVH  153



>ref|XP_011075964.1| PREDICTED: protein ABIL2-like [Sesamum indicum]
Length=328

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P     +DEVSM++S  F  +L++LKNLR QLYSAAEY E SY + +QK +V+  LKD
Sbjct  11   PFPREPANYDEVSMQQSMLFSDSLKDLKNLRKQLYSAAEYFELSYTNDDQKHIVVNTLKD  70

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL+ ++  +VS  EL+++CI Q+L TCQ Y ++EG  QQ
Sbjct  71   YAIKALVNTVDHLGSVTYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCQEYIDREGISQQ  130

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P +HK Y LP
Sbjct  131  SLVINTPNYHKRYILP  146



>emb|CDP05046.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/313 (35%), Positives = 161/313 (51%), Gaps = 28/313 (9%)
 Frame = +2

Query  383   PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
             P     +DE SM++S  F  +L++LKNLR QLYSAAEY E SY   +QKQ+V+  LKDYA
Sbjct  13    PREPAIYDEASMQQSMVFSDSLKDLKNLRKQLYSAAEYFELSYTSDDQKQIVVNTLKDYA  72

Query  563   VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
             ++ALVN VDHLG+++YK+ DL+ ++  +VS  EL+++CI Q+L TCQ Y ++EG  QQ L
Sbjct  73    IKALVNTVDHLGSMSYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCQDYIDREGLSQQSL  132

Query  743   LAIIPRHHKHYTL--PNSVNKKVHFSPHIQM----------DHRQHIQSRGRLFPS----  874
             +   P++HK Y L    S+N   H   H Q             R  +++  R  PS    
Sbjct  133   VINTPKYHKRYILTAAESMNGVNHLKLHQQRCSLDDEDDWHQFRNAVRATIREIPSSAVR  192

Query  875   ---GPAAAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKA  1045
                 P+ +  LS    + + S   G   G  S     S  R    F LL  G + +R + 
Sbjct  193   NGRSPSPSPRLSQQPGNFSFS---GTFPGKESEKRTVSPHR----FPLLRTGSLASR-QT  244

Query  1046  SPAWSKPPSVGPGSSIATH-TLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSKS  1222
             +P  S+P S  P      + ++G    A         + +    P   R+T H  ++SK 
Sbjct  245   TPKKSRPTSPNPTRPTTPNPSIGRQFPAEARKSASMRFHAERGSPKDPRDTDHNSSKSKR  304

Query  1223  MLSAFFVKQKTPK  1261
             +L A   ++K+ K
Sbjct  305   LLKALLSRRKSKK  317



>ref|XP_007136512.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris]
 ref|XP_007136513.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris]
 gb|ESW08506.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris]
 gb|ESW08507.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris]
Length=327

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 100/314 (32%), Positives = 160/314 (51%), Gaps = 25/314 (8%)
 Frame = +2

Query  374   KPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
             +P    A  +DEV M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK
Sbjct  10    QPVSQEASNYDEVFMQQSLLFDDSLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLK  69

Query  554   DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
             DYA++ALVN VDHLG+V YK+ DL+ ++ ++VS  +L+++CI Q++ TCQ Y + EG  Q
Sbjct  70    DYAIKALVNTVDHLGSVTYKVNDLLDEKVVEVSVADLRVSCIEQRIKTCQEYMDHEGRTQ  129

Query  734   QQLLAIIPRHHKHYTLPNSVNKKVHFS------------------PHIQMDHRQHIQSRG  859
             Q L+   P++HK Y LP  V + +H +                  PH +   R  I+   
Sbjct  130   QSLVISTPKYHKRYILP--VGETMHGANCTKSKYEGYNLDDEDDWPHFRNAVRATIRETP  187

Query  860   RLFPSGPAAAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRT  1039
                PS     ++ S  L  + +      S   +   D++    +   F LL  G   +R 
Sbjct  188   ---PSTARRGRSPSPSLQPQRSGAFSFTSSSSMPKKDLERQSVSPYRFPLLRTGSRSSRP  244

Query  1040  KASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETTHVPTRSK  1219
               +P  S+P +  P      +     +      +  +  R +     P ++    P++SK
Sbjct  245   -TTPKISRPTTPNPSRPTTPNPSNARQRYPSEPRKSSSMRLYAE-RDPAKDVEQYPSKSK  302

Query  1220  SMLSAFFVKQKTPK  1261
              +L A   ++K+ K
Sbjct  303   RLLKALLSRRKSKK  316



>ref|XP_009344687.1| PREDICTED: protein ABIL2-like [Pyrus x bretschneideri]
 ref|XP_009344688.1| PREDICTED: protein ABIL2-like [Pyrus x bretschneideri]
Length=327

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKD
Sbjct  12   PIPRVASNFDEVSMHQSLLFSDSLKDLKNLRRQLYSAAEYFELSYTNDDQKQIVVETLKD  71

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL  ++  +VS  E +++CI Q++ TCQ Y + EG  QQ
Sbjct  72   YAIKALVNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQ  131

Query  737  QLLAIIPRHHKHYTLPNS  790
              +   P++HK Y  P S
Sbjct  132  SSIIDTPKYHKRYIFPVS  149



>ref|XP_009784228.1| PREDICTED: protein ABIL2-like isoform X2 [Nicotiana sylvestris]
Length=323

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 103/146 (71%), Gaps = 6/146 (4%)
 Frame = +2

Query  371  PKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENL  550
            P+ P N    FDEVSM +S  F  +L +LKNLR QLYSAAEY E SY + EQK++V+  L
Sbjct  14   PREPAN----FDEVSMHQSMLFSDSLTDLKNLRKQLYSAAEYFELSYSNDEQKEVVVNTL  69

Query  551  KDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFR  730
            KDYA++ALVN VDHLG+V YK++DL+ ++  +VS  EL+++CI Q+L TCQ Y + EG  
Sbjct  70   KDYAIKALVNTVDHLGSVTYKVSDLLDEKVDEVSGTELRLSCIEQRLKTCQEYIDHEGLS  129

Query  731  QQQLLAIIPRHHKHYTLPNSVNKKVH  808
            QQ L+   P++HK Y LP  V + VH
Sbjct  130  QQSLVIHTPKYHKRYILP--VGETVH  153



>ref|XP_006350530.1| PREDICTED: protein ABIL3-like isoform X1 [Solanum tuberosum]
 ref|XP_006350531.1| PREDICTED: protein ABIL3-like isoform X2 [Solanum tuberosum]
Length=325

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 100/138 (72%), Gaps = 4/138 (3%)
 Frame = +2

Query  371  PKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENL  550
            P+ P N    FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + EQK +V++ L
Sbjct  13   PREPAN----FDEVSMHQSMLFSDSLKDLKNLRKQLYSAAEYFELSYSNDEQKDVVVDTL  68

Query  551  KDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFR  730
            K+YA++ALVN VDHLG+V YK++DL+ ++  +VS  EL+I+CI Q+L TCQ Y + EG  
Sbjct  69   KEYAIKALVNTVDHLGSVTYKVSDLLDEKVDEVSGTELRISCIEQRLKTCQEYIDNEGLS  128

Query  731  QQQLLAIIPRHHKHYTLP  784
            QQ L+   P++HK Y LP
Sbjct  129  QQSLVIHTPKYHKRYILP  146



>ref|XP_008376759.1| PREDICTED: protein ABIL2-like [Malus domestica]
Length=327

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKD
Sbjct  12   PIPRVASNFDEVSMHQSLLFSDSLKDLKNLRRQLYSAAEYFELSYTNDDQKQIVVETLKD  71

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL  ++  +VS  E +++CI Q++ TCQ Y + EG  QQ
Sbjct  72   YAIKALVNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQ  131

Query  737  QLLAIIPRHHKHYTLPNS  790
              +   P++HK Y  P S
Sbjct  132  SSIIDTPKYHKRYIFPVS  149



>ref|XP_010318026.1| PREDICTED: protein ABIL3 [Solanum lycopersicum]
Length=325

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = +2

Query  383  PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
            P     FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + EQK +V++ LK+YA
Sbjct  13   PREPANFDEVSMHQSMLFSDSLKDLKNLRKQLYSAAEYFELSYSNDEQKDVVVDTLKEYA  72

Query  563  VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
            ++ALVN VDHLG+V YK++DL+ ++  +VS  EL+I+CI Q+L TCQ Y + EG  QQ L
Sbjct  73   IKALVNTVDHLGSVTYKVSDLLDEKVDEVSGTELRISCIEQRLKTCQEYIDNEGMSQQSL  132

Query  743  LAIIPRHHKHYTLP  784
            +   P++HK Y LP
Sbjct  133  VIHTPKYHKRYILP  146



>ref|XP_007039080.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao]
 ref|XP_007039081.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao]
 gb|EOY23581.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao]
 gb|EOY23582.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao]
Length=325

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 2/144 (1%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P    A  +DEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QK +V+E LKD
Sbjct  8    PMSREASNYDEVSMHQSLLFADSLKDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKD  67

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL+ ++  +V   EL+++CI Q+L TCQ Y + EG  QQ
Sbjct  68   YAIKALVNTVDHLGSVTYKVNDLLDEKVDEVCGTELRVSCIEQRLRTCQEYIDHEGISQQ  127

Query  737  QLLAIIPRHHKHYTLPNSVNKKVH  808
             L+   P++HK Y LP  V K +H
Sbjct  128  SLVINTPKYHKRYILP--VGKTMH  149



>ref|XP_009348527.1| PREDICTED: protein ABIL2-like isoform X2 [Pyrus x bretschneideri]
Length=322

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKD
Sbjct  7    PIPQVASNFDEVSMHQSLLFSDSLKDLKNLRRQLYSAAEYFELSYTNDDQKQIVVETLKD  66

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL  ++  +VS  E +++CI Q++ TCQ Y + EG  QQ
Sbjct  67   YAIKALVNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQ  126

Query  737  QLLAIIPRHHKHYTLPNS  790
              +   P++HK Y  P S
Sbjct  127  SSIIDTPKYHKRYIFPVS  144



>ref|XP_009348526.1| PREDICTED: protein ABIL2-like isoform X1 [Pyrus x bretschneideri]
Length=327

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKD
Sbjct  12   PIPQVASNFDEVSMHQSLLFSDSLKDLKNLRRQLYSAAEYFELSYTNDDQKQIVVETLKD  71

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL  ++  +VS  E +++CI Q++ TCQ Y + EG  QQ
Sbjct  72   YAIKALVNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQ  131

Query  737  QLLAIIPRHHKHYTLPNS  790
              +   P++HK Y  P S
Sbjct  132  SSIIDTPKYHKRYIFPVS  149



>ref|XP_010671428.1| PREDICTED: protein ABIL3 [Beta vulgaris subsp. vulgaris]
Length=351

 Score =   154 bits (388),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 113/335 (34%), Positives = 163/335 (49%), Gaps = 61/335 (18%)
 Frame = +2

Query  401   FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
             +DE+SM +S  F  +L++LKNLR QLYSAAEY E SY + +QKQ V+E LKDYA++ALVN
Sbjct  19    YDEMSMHQSLLFADSLKDLKNLRTQLYSAAEYFELSYTNDDQKQFVIETLKDYAIKALVN  78

Query  581   AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
              VDHLG+V YK+ DL+ ++  +VS  E  ++CI Q+L TCQ Y E+EG  QQ  +   P+
Sbjct  79    TVDHLGSVTYKVNDLLEEKVEEVSETEFHVSCIEQRLRTCQEYIEREGMAQQSSIIDTPK  138

Query  761   HHKHYTLP-----NSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKTLSWHLAS--E  919
             +HK Y LP     NS N          +D     Q R  +  +    + T+    +S  E
Sbjct  139   YHKRYVLPAGQTMNSSNLANLKYKSCGIDEDDWFQFRSAIRATIQETSSTMRETPSSNRE  198

Query  920   TTSTLKGASCGFVSADDIKSSGRTSGAFNLLDGGEVGNRTKASPAWSKPPSVGPGS----  1087
             T S+++       S  ++ S+ + S +F        G  T  SPA    PS  PGS    
Sbjct  199   TPSSIRERPS---SIREMNSTFKESASF-----ARRGRST--SPA--SRPSRSPGSFSFA  246

Query  1088  -----------SIATHTLGVMRDALDGSKPMTP--------------------------Y  1156
                        S++ H   ++R     S+P TP                           
Sbjct  247   SSAPRKEQDKRSVSPHRFPLLRSGSLASRPTTPKSSRPTTPNSGVERHRYLSDSWKSVSM  306

Query  1157  RSFDNPPHPRRETTHVPTRSKSMLSAFFVKQKTPK  1261
             R  D    P +ET   P++SK +L A   ++K+ K
Sbjct  307   RVHDEKEKP-KETERHPSKSKRLLKALLSRRKSKK  340



>ref|XP_003523358.1| PREDICTED: protein ABIL2-like isoform X1 [Glycine max]
 ref|XP_006578895.1| PREDICTED: protein ABIL2-like isoform X2 [Glycine max]
Length=325

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P    A  +DEV M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKD
Sbjct  11   PVSQEASNYDEVFMQQSLLFDDSLKDLKNLRAQLYSAAEYFELSYSNDDQKQIVVETLKD  70

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL+ ++ ++VS  EL+++CI Q++ TC  Y ++EG  QQ
Sbjct  71   YAIKALVNTVDHLGSVTYKVNDLLDEKVVEVSVAELRVSCIEQRIKTCHEYMDREGRTQQ  130

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P++HK Y LP
Sbjct  131  SLVISTPKYHKRYILP  146



>ref|XP_009351988.1| PREDICTED: protein ABIL2-like [Pyrus x bretschneideri]
Length=322

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QK +V+E LKD
Sbjct  7    PVPRVASNFDEVSMHQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKD  66

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL  ++  +VS  E +++CI Q++ TCQ Y + EG  QQ
Sbjct  67   YAIKALVNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIKTCQEYIDHEGLSQQ  126

Query  737  QLLAIIPRHHKHYTLP  784
              +   P++HK Y LP
Sbjct  127  SSIIDTPKYHKRYILP  142



>ref|XP_008381232.1| PREDICTED: protein ABIL2-like [Malus domestica]
 ref|XP_008381238.1| PREDICTED: protein ABIL2-like [Malus domestica]
Length=322

 Score =   153 bits (386),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QK +V+E LKD
Sbjct  7    PVPRVASNFDEVSMHQSLLFSDSLRDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKD  66

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL  ++  +VS  E +++CI Q++ TCQ Y + EG  QQ
Sbjct  67   YAIKALVNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQ  126

Query  737  QLLAIIPRHHKHYTLP  784
              +   P++HK Y LP
Sbjct  127  SSVIDTPKYHKRYILP  142



>ref|XP_008810684.1| PREDICTED: putative protein ABIL2 [Phoenix dactylifera]
 ref|XP_008810685.1| PREDICTED: putative protein ABIL2 [Phoenix dactylifera]
 ref|XP_008810686.1| PREDICTED: putative protein ABIL2 [Phoenix dactylifera]
 ref|XP_008810687.1| PREDICTED: putative protein ABIL2 [Phoenix dactylifera]
Length=323

 Score =   152 bits (385),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A TFDE+SM +S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+  LKDYAV+A
Sbjct  17   ASTFDELSMHQSLLFSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQLVVNTLKDYAVKA  76

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            LVN VDHLG+V++K+  L+ ++  +VS  EL+++CI Q++ TCQA  ++EG  QQ L+  
Sbjct  77   LVNTVDHLGSVSFKVNGLLDEKVDEVSGTELRVSCIEQRIRTCQALIDREGLSQQSLVIT  136

Query  752  IPRHHKHYTLP  784
             P++HK Y LP
Sbjct  137  APKYHKRYILP  147



>ref|XP_004169136.1| PREDICTED: protein ABIL2-like [Cucumis sativus]
Length=325

 Score =   152 bits (385),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            FDE+SM++S  F   L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYAV+ALVN
Sbjct  10   FDEISMKQSLIFSDCLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKALVN  69

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V +K+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  QQ L+   P+
Sbjct  70   TVDHLGSVTFKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGHSQQSLVINTPK  129

Query  761  HHKHYTLP  784
            +HK Y LP
Sbjct  130  YHKRYILP  137



>ref|XP_004146227.1| PREDICTED: protein ABIL2-like [Cucumis sativus]
Length=325

 Score =   152 bits (385),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            FDE+SM++S  F   L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYAV+ALVN
Sbjct  10   FDEISMKQSLIFSDCLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKALVN  69

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V +K+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  QQ L+   P+
Sbjct  70   TVDHLGSVTFKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGHSQQSLVINTPK  129

Query  761  HHKHYTLP  784
            +HK Y LP
Sbjct  130  YHKRYILP  137



>ref|XP_008466838.1| PREDICTED: protein ABIL2 [Cucumis melo]
 ref|XP_008466839.1| PREDICTED: protein ABIL2 [Cucumis melo]
Length=327

 Score =   152 bits (385),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            FDE+SM++S  F   L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYAV+ALVN
Sbjct  10   FDEISMKQSLIFSDCLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKALVN  69

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V +K+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  QQ L+   P+
Sbjct  70   TVDHLGSVTFKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGHSQQSLVINTPK  129

Query  761  HHKHYTLP  784
            +HK Y LP
Sbjct  130  YHKRYILP  137



>ref|XP_006404160.1| hypothetical protein EUTSA_v10010561mg [Eutrema salsugineum]
 gb|ESQ45613.1| hypothetical protein EUTSA_v10010561mg [Eutrema salsugineum]
Length=312

 Score =   152 bits (384),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 106/323 (33%), Positives = 155/323 (48%), Gaps = 51/323 (16%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P    A  +DEVSM++S  F   L++L+NLR QLYSAAEY E SY   +++Q+V+E LKD
Sbjct  2     PESQEASNYDEVSMQQSMLFSDGLKDLRNLRTQLYSAAEYFELSYTTDDKRQIVVETLKD  61

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YAV+ALVN VDHLG++ YK+ D + ++   VS  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  62    YAVKALVNTVDHLGSITYKVNDFIDEKVDVVSETELRVSCIEQRLRMCQEYMDHEGRSQQ  121

Query  737   QLLAIIPRHHKHYTLP-------NSVNKKVHFSPHIQ-MDHRQHIQS--RGRLFPSGPAA  886
              L+   P+ HK Y LP        ++ K  +F   ++  D     ++  R  +  + P  
Sbjct  122   SLVIDTPKFHKRYILPAGEIMTATNLEKVKYFGSSLEDSDDWNQFKNAVRATIRETPPPP  181

Query  887   AKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGA---FNLLDGGEVGNRTKASPAW  1057
             A+  + H         + A+  F S    K   + S +   F LL  G V  R  AS + 
Sbjct  182   ARKSTSHTPPPRKPPQRSATFSFTSTMPKKEQDKRSVSPHRFPLLRSGSVATRKSASISR  241

Query  1058  SKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRSFDNPPHPRRETT-------------  1198
                PS                     S+ +TP R    P  PRR  +             
Sbjct  242   PTTPS--------------------KSRAITPIR---YPSEPRRSASVRVACEKENQKET  278

Query  1199  --HVPTRSKSMLSAFFVKQKTPK  1261
                 P++SK +L A   ++KT K
Sbjct  279   EQQQPSKSKRLLKALLSRRKTKK  301



>ref|XP_007218279.1| hypothetical protein PRUPE_ppa008359mg [Prunus persica]
 gb|EMJ19478.1| hypothetical protein PRUPE_ppa008359mg [Prunus persica]
Length=335

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 94/136 (69%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QK +V+E LKD
Sbjct  9    PVPRVASNFDEVSMHQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKD  68

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D   ++  +VS  E +++CI Q+L TCQ Y + EG  QQ
Sbjct  69   YAIKALVNTVDHLGSVTYKVNDFFDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGLSQQ  128

Query  737  QLLAIIPRHHKHYTLP  784
              +   P++HK Y LP
Sbjct  129  SSVIDTPKYHKRYILP  144



>ref|XP_006441130.1| hypothetical protein CICLE_v10021055mg [Citrus clementina]
 gb|ESR54370.1| hypothetical protein CICLE_v10021055mg [Citrus clementina]
Length=334

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DEV+M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYAV+ALVN
Sbjct  19   YDEVAMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKALVN  78

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  QQ L+   P+
Sbjct  79   TVDHLGSVTYKVNDLLDEKVDEVSDTEHRVSCIEQRLRTCQEYIDHEGLSQQSLVINTPK  138

Query  761  HHKHYTLP  784
            +HK Y LP
Sbjct  139  YHKRYILP  146



>ref|XP_008234720.1| PREDICTED: protein ABIL2 [Prunus mume]
 ref|XP_008234721.1| PREDICTED: protein ABIL2 [Prunus mume]
Length=326

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 94/136 (69%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  FDEVSM +S  F  +L++LKNLR QLYSAAEY E SY + +QK +V+E LKD
Sbjct  11   PVPRVASNFDEVSMHQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKD  70

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D   ++  +VS  E +++CI Q+L TCQ Y + EG  QQ
Sbjct  71   YAIKALVNTVDHLGSVTYKVNDFFDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGLSQQ  130

Query  737  QLLAIIPRHHKHYTLP  784
              +   P++HK Y LP
Sbjct  131  SSVIDTPKYHKRYILP  146



>ref|XP_003526721.1| PREDICTED: protein ABIL2-like isoform X1 [Glycine max]
 ref|XP_006581654.1| PREDICTED: protein ABIL2-like isoform X2 [Glycine max]
 ref|XP_006581655.1| PREDICTED: protein ABIL2-like isoform X3 [Glycine max]
Length=326

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  374  KPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            +P    A  +DEV M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK
Sbjct  10   QPVSQEASNYDEVFMQQSLLFDDSLKDLKNLRAQLYSAAEYFELSYSNDDQKQVVVETLK  69

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYA++ALVN VDHLG+V YK+ DL+ ++ ++VS  EL+++CI Q++ TC  Y + EG  Q
Sbjct  70   DYAIKALVNTVDHLGSVTYKVNDLLDEKVVEVSVAELRVSCIEQRIKTCHEYMDHEGRTQ  129

Query  734  QQLLAIIPRHHKHYTLP  784
            Q L+   P++HK Y LP
Sbjct  130  QSLVISTPKYHKRYILP  146



>ref|XP_002872104.1| hypothetical protein ARALYDRAFT_489290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48363.1| hypothetical protein ARALYDRAFT_489290 [Arabidopsis lyrata subsp. 
lyrata]
Length=321

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  A  + E+SM +S  F  +L++LKNLR QLYSAAEY E SY + EQKQ+V+E LKD
Sbjct  8    PMPREASNYHEISMRQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKD  67

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ D V ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  68   YAIKALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQ  127

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P+ HK Y LP
Sbjct  128  SLVIDTPKFHKRYILP  143



>gb|KHN19504.1| Protein ABIL2 [Glycine soja]
Length=325

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P    A  +DEV M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKD
Sbjct  11   PVSQEASNYDEVFMQQSLLFDDSLKDLKNLRAQLYSAAEYFELSYSNDDQKQIVVETLKD  70

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL+ ++ ++VS  EL+++CI Q++ TC  Y + EG  QQ
Sbjct  71   YAIKALVNTVDHLGSVTYKVNDLLDEKVVEVSVAELRVSCIEQRIKTCHEYMDHEGRTQQ  130

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P++HK Y LP
Sbjct  131  SLVISTPKYHKRYILP  146



>gb|KGN57659.1| hypothetical protein Csa_3G238740 [Cucumis sativus]
Length=377

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            FDE+SM++S  F   L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYAV+ALVN
Sbjct  10   FDEISMKQSLIFSDCLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKALVN  69

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V +K+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  QQ L+   P+
Sbjct  70   TVDHLGSVTFKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGHSQQSLVINTPK  129

Query  761  HHKHYTLP  784
            +HK Y LP
Sbjct  130  YHKRYILP  137



>ref|XP_003588502.1| Protein ABIL3 [Medicago truncatula]
 gb|AES58753.1| ABIL1-like protein [Medicago truncatula]
Length=323

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  374  KPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            +P P  A  +DEV M ++  F  +L +LKNLR QLYSAAEY E SY + +QKQ+++E LK
Sbjct  7    QPLPRMASNYDEVFMHQTLLFDDSLTDLKNLRTQLYSAAEYFELSYTNDDQKQILVETLK  66

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYAV+AL+N VDHLG+VAYK++DL+ ++  +V   +L+++CI Q++ TCQ + + EG  Q
Sbjct  67   DYAVKALINTVDHLGSVAYKVSDLLDEKVTEVFGEDLRLSCIEQRIKTCQGFMDHEGHTQ  126

Query  734  QQLLAIIPRHHKHYTLP  784
            Q L+   P+HHK Y LP
Sbjct  127  QSLVISTPKHHKRYILP  143



>emb|CDY05919.1| BnaC08g20960D [Brassica napus]
Length=315

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 104/316 (33%), Positives = 155/316 (49%), Gaps = 34/316 (11%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P    A  +DE SM++S  F   L++L+NLR QLYSAAEY E SY   +++Q+V+E LKD
Sbjct  2     PESREASNYDEASMDQSMLFSDGLKDLRNLRTQLYSAAEYFELSYTTDDKRQIVVETLKD  61

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YAV+ALVN VDHLG++ YK+ D + ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  62    YAVKALVNTVDHLGSITYKVNDFIDERVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQ  121

Query  737   QLLAIIPRHHKHYTLP-------NSVNKKVHFSPHIQ-----MDHRQHIQSRGRLFPSGP  880
              L+   P+ HK Y LP        +++K  +F   ++        R  +++  R  P  P
Sbjct  122   SLVIETPKFHKRYILPAGETIKTTNLDKLNYFGSSLEDADDWNQFRNAVRATIRETPPPP  181

Query  881   AAAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGA---FNLLDGGEVGNRTKASP  1051
                +  +   +S      + A+  F S    K   + S +   F LL  G V  R  AS 
Sbjct  182   PPVRKSTSQASSPRQPPQRSATFSFTSTIPKKEQDKRSVSPHRFPLLRSGSVATRKSAS-  240

Query  1052  AWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRS------FDNPPHPRRETTHVPTR  1213
               S+P +     SI                P  P RS      F+       E    P++
Sbjct  241   -ISRPTTPSKSRSITPIRY-----------PSEPRRSASVRVGFEKENQKETEQQQQPSK  288

Query  1214  SKSMLSAFFVKQKTPK  1261
             SK +L A   ++KT K
Sbjct  289   SKRLLKALLSRRKTKK  304



>ref|XP_006595602.1| PREDICTED: uncharacterized protein LOC100808485 isoform X1 [Glycine 
max]
 gb|KHN03203.1| Protein ABIL2 [Glycine soja]
Length=324

 Score =   150 bits (378),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +2

Query  374  KPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            +P    A  +DEV M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK
Sbjct  7    QPLSREASNYDEVFMQQSLLFDDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLK  66

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYA++AL+N+VDHLG+V YK+ DL+ ++ ++VS  +L+++CI Q++ TC A+ + EG  Q
Sbjct  67   DYAIKALINSVDHLGSVTYKVNDLLDEKIVEVSETQLRLSCIQQRISTCHAFMDHEGRTQ  126

Query  734  QQLLAIIPRHHKHYTLP  784
            Q L+   P++HK Y LP
Sbjct  127  QSLVIDAPKYHKRYILP  143



>gb|KEH39727.1| ABIL1-like protein [Medicago truncatula]
Length=342

 Score =   150 bits (380),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  374  KPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            +P P  A  +DEV M ++  F  +L +LKNLR QLYSAAEY E SY + +QKQ+++E LK
Sbjct  26   QPLPRMASNYDEVFMHQTLLFDDSLTDLKNLRTQLYSAAEYFELSYTNDDQKQILVETLK  85

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYAV+AL+N VDHLG+VAYK++DL+ ++  +V   +L+++CI Q++ TCQ + + EG  Q
Sbjct  86   DYAVKALINTVDHLGSVAYKVSDLLDEKVTEVFGEDLRLSCIEQRIKTCQGFMDHEGHTQ  145

Query  734  QQLLAIIPRHHKHYTLP  784
            Q L+   P+HHK Y LP
Sbjct  146  QSLVISTPKHHKRYILP  162



>ref|XP_009149749.1| PREDICTED: protein ABIL2 [Brassica rapa]
 ref|XP_009149750.1| PREDICTED: protein ABIL2 [Brassica rapa]
 emb|CDY08121.1| BnaA06g16050D [Brassica napus]
Length=317

 Score =   149 bits (377),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 104/319 (33%), Positives = 153/319 (48%), Gaps = 38/319 (12%)
 Frame = +2

Query  377   PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
             P    A  +DE SM++S  F   L++L+NLR QLYSAAEY E SY   +++Q+V+E LKD
Sbjct  2     PESREASNYDEASMDQSMLFSDGLKDLRNLRTQLYSAAEYFELSYTTDDKRQIVVETLKD  61

Query  557   YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
             YAV+ALVN VDHLG++ YK+ D + ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ
Sbjct  62    YAVKALVNTVDHLGSITYKVNDFIDEKVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQ  121

Query  737   QLLAIIPRHHKHYTLP-------NSVNKKVHFSPHIQMDHRQHIQSRGRLFPSGPAAAKT  895
              L+   P+ HK Y LP        +++K  +F   ++ D     Q R  +  +       
Sbjct  122   SLVIETPKFHKRYILPAGETIKTTNLDKLKYFGSSLE-DADDWNQFRNAVRATIRETPPP  180

Query  896   LSWHLASETTSTL--------KGASCGFVSADDIKSSGRTSGA---FNLLDGGEVGNRTK  1042
                    ++TS          + A+  F S    K   + S +   F LL  G V  R  
Sbjct  181   PPPPPVRKSTSQASSPRQPPQRSATFSFTSTIPKKDQDKRSVSPHRFPLLRSGSVATRKS  240

Query  1043  ASPAWSKPPSVGPGSSIATHTLGVMRDALDGSKPMTPYRS------FDNPPHPRRETTHV  1204
             AS   S+P +     SI                P  P RS      F+       E    
Sbjct  241   AS--ISRPTTPSKSRSITPIRY-----------PSEPRRSASVRVGFEKENQKETEQQQQ  287

Query  1205  PTRSKSMLSAFFVKQKTPK  1261
             P++SK +L A   ++KT K
Sbjct  288   PSKSKRLLKALLSRRKTKK  306



>ref|XP_004498509.1| PREDICTED: protein ABIL2-like isoform X2 [Cicer arietinum]
Length=322

 Score =   149 bits (377),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  374  KPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            +P    A  +DEV M ++  F  +L++LKNLR QLYSAAEY E SY + +QKQ+++E LK
Sbjct  7    QPASRMASNYDEVFMHQTLLFDDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQVLVETLK  66

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYA++AL+N VDHLG+VAYK++DL+ ++  +V   EL+++CI Q++ TCQ + + EG  Q
Sbjct  67   DYAIKALINTVDHLGSVAYKVSDLLDEKVTNVLGEELRLSCIEQRIKTCQGFMDHEGHTQ  126

Query  734  QQLLAIIPRHHKHYTLP  784
            Q L+   P+HHK Y LP
Sbjct  127  QALVISTPKHHKRYILP  143



>ref|XP_010109248.1| hypothetical protein L484_011870 [Morus notabilis]
 gb|EXC21428.1| hypothetical protein L484_011870 [Morus notabilis]
Length=289

 Score =   148 bits (374),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  383  PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
            P  +  FDEVSM +S  F  +LQ+LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYA
Sbjct  27   PRESSNFDEVSMHQSLLFSDSLQDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYA  86

Query  563  VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
            ++ALVN VDHLG+V+YK+ D++ ++  +VS  EL+++CI Q+L TCQ Y + EG  QQ  
Sbjct  87   IKALVNTVDHLGSVSYKVNDILDEKVDEVSGTELRVSCIEQRLRTCQEYIDHEGLIQQSS  146

Query  743  LAIIPRHHK  769
            +   P++HK
Sbjct  147  VINTPKYHK  155



>gb|KCW46573.1| hypothetical protein EUGRSUZ_K00391 [Eucalyptus grandis]
Length=285

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P  + A  +DEVSM++S  F  +L++L++LR QLYSAAEY E SY + +QKQ+V+E L+D
Sbjct  10   PITHEASNYDEVSMQQSLLFSNSLKDLRSLRTQLYSAAEYFEMSYTNDDQKQIVVETLRD  69

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  +Q
Sbjct  70   YAIKALVNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGRSEQ  129

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P+ HK Y LP
Sbjct  130  SLVIDTPKFHKRYILP  145



>ref|XP_004498510.1| PREDICTED: protein ABIL2-like isoform X3 [Cicer arietinum]
Length=311

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A  +DEV M ++  F  +L++LKNLR QLYSAAEY E SY + +QKQ+++E LKDYA++A
Sbjct  2    ASNYDEVFMHQTLLFDDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQVLVETLKDYAIKA  61

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            L+N VDHLG+VAYK++DL+ ++  +V   EL+++CI Q++ TCQ + + EG  QQ L+  
Sbjct  62   LINTVDHLGSVAYKVSDLLDEKVTNVLGEELRLSCIEQRIKTCQGFMDHEGHTQQALVIS  121

Query  752  IPRHHKHYTLP  784
             P+HHK Y LP
Sbjct  122  TPKHHKRYILP  132



>ref|XP_010035277.1| PREDICTED: protein ABIL2 [Eucalyptus grandis]
 ref|XP_010035278.1| PREDICTED: protein ABIL2 [Eucalyptus grandis]
 ref|XP_010035279.1| PREDICTED: protein ABIL2 [Eucalyptus grandis]
 gb|KCW46570.1| hypothetical protein EUGRSUZ_K00391 [Eucalyptus grandis]
 gb|KCW46571.1| hypothetical protein EUGRSUZ_K00391 [Eucalyptus grandis]
 gb|KCW46572.1| hypothetical protein EUGRSUZ_K00391 [Eucalyptus grandis]
Length=325

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 98/136 (72%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P  + A  +DEVSM++S  F  +L++L++LR QLYSAAEY E SY + +QKQ+V+E L+D
Sbjct  10   PITHEASNYDEVSMQQSLLFSNSLKDLRSLRTQLYSAAEYFEMSYTNDDQKQIVVETLRD  69

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK+ DL+ ++  +VS  E +++CI Q+L TCQ Y + EG  +Q
Sbjct  70   YAIKALVNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGRSEQ  129

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P+ HK Y LP
Sbjct  130  SLVIDTPKFHKRYILP  145



>ref|XP_006491995.1| PREDICTED: protein ABIL2-like isoform X1 [Citrus sinensis]
 ref|XP_006491996.1| PREDICTED: protein ABIL2-like isoform X2 [Citrus sinensis]
Length=334

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DEV+M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYAV+ALVN
Sbjct  19   YDEVAMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKALVN  78

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+ D++ ++  +V   E +++CI Q+L TCQ Y + EG  QQ L+   P+
Sbjct  79   TVDHLGSVTYKVNDILDEKVDEVLDTEHRVSCIEQRLRTCQEYIDHEGLSQQSLVINTPK  138

Query  761  HHKHYTLP  784
            +HK Y LP
Sbjct  139  YHKRYILP  146



>gb|KDO43393.1| hypothetical protein CISIN_1g038307mg [Citrus sinensis]
Length=322

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DEV+M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYAV+ALVN
Sbjct  19   YDEVAMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKALVN  78

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+ D++ ++  +V   E +++CI Q+L TCQ Y + EG  QQ L+   P+
Sbjct  79   TVDHLGSVTYKVNDILDEKVDEVLDTEHRVSCIEQRLRTCQEYIDHEGLSQQSLVINTPK  138

Query  761  HHKHYTLP  784
            +HK Y LP
Sbjct  139  YHKRYILP  146



>ref|XP_010915983.1| PREDICTED: probable protein ABIL3 [Elaeis guineensis]
Length=326

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 104/147 (71%), Gaps = 4/147 (3%)
 Frame = +2

Query  356  MEVEQPKPPPNS----AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSE  523
            ME   P P  ++    A  +DE+S+++S  F  +L++LKN+R QLYSAAEY E SY + +
Sbjct  1    MEATSPSPSFSAHREEAPAYDEISIQQSLLFSHSLRDLKNMRSQLYSAAEYFELSYSNDD  60

Query  524  QKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQ  703
            QKQMV+  LKDYA++ALVN VDHLG+V+YK+ +L+ ++  +VS  E +++C+ Q L TCQ
Sbjct  61   QKQMVMNTLKDYALKALVNTVDHLGSVSYKVNNLLNKKVGEVSGTEFRVSCLEQILRTCQ  120

Query  704  AYTEKEGFRQQQLLAIIPRHHKHYTLP  784
             Y ++EG  QQ L +  P++HKHY LP
Sbjct  121  EYMDQEGRFQQSLASPAPKYHKHYILP  147



>ref|XP_004498508.1| PREDICTED: protein ABIL2-like isoform X1 [Cicer arietinum]
Length=359

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  374  KPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            +P    A  +DEV M ++  F  +L++LKNLR QLYSAAEY E SY + +QKQ+++E LK
Sbjct  44   QPASRMASNYDEVFMHQTLLFDDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQVLVETLK  103

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYA++AL+N VDHLG+VAYK++DL+ ++  +V   EL+++CI Q++ TCQ + + EG  Q
Sbjct  104  DYAIKALINTVDHLGSVAYKVSDLLDEKVTNVLGEELRLSCIEQRIKTCQGFMDHEGHTQ  163

Query  734  QQLLAIIPRHHKHYTLP  784
            Q L+   P+HHK Y LP
Sbjct  164  QALVISTPKHHKRYILP  180



>gb|KHG04211.1| Protein ABIL3 [Gossypium arboreum]
Length=235

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = +2

Query  383  PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
            P  A  +DEVSM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYA
Sbjct  26   PQEASNYDEVSMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYA  85

Query  563  VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
            V+A+VN VDHLG+V YK+ + + ++  DVS  EL+++C+ +++  CQ Y + +G  QQ L
Sbjct  86   VKAIVNTVDHLGSVTYKVNEFLDEKVDDVSGTELQVSCVEEKVRKCQEYIDLKGISQQSL  145

Query  743  LAIIPRHHKHYTLP  784
            +   P +HK Y LP
Sbjct  146  MINTPMYHKRYILP  159



>gb|KEH35459.1| ABIL1-like protein [Medicago truncatula]
Length=247

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = +2

Query  380  PPNS--AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            PP S  A  FDEV M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK
Sbjct  10   PPFSQEASNFDEVYMQQSLLFDDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLK  69

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYA++ALVN VDHLG+V YK+ DL+ ++ ++VS  EL+++CI Q++ + Q + +  G  Q
Sbjct  70   DYAIKALVNTVDHLGSVTYKVNDLLDEKVVEVSGAELRVSCIEQRMRSYQGFADHGGRSQ  129

Query  734  QQLLAIIPRHHKHYTLP  784
            Q L+   P++HK Y LP
Sbjct  130  QSLVISTPKYHKRYILP  146



>ref|XP_008783161.1| PREDICTED: probable protein ABIL3 [Phoenix dactylifera]
 ref|XP_008783162.1| PREDICTED: probable protein ABIL3 [Phoenix dactylifera]
 ref|XP_008783163.1| PREDICTED: probable protein ABIL3 [Phoenix dactylifera]
Length=324

 Score =   147 bits (371),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 100/148 (68%), Gaps = 5/148 (3%)
 Frame = +2

Query  356  MEVEQPKPPPNSAM-----TFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHS  520
            ME   P P   SA       +DE+SM++S  F  +L++LKNLR QLYSAAEY E S  H 
Sbjct  1    METISPSPSSFSAHQEEAPAYDEISMKQSLLFSHSLKDLKNLRSQLYSAAEYFELSCSHD  60

Query  521  EQKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTC  700
            +QK+  +  LKDYA+ ALVN VDHLG+V+YK+ DL+ ++  +VS  E +++CI Q+L TC
Sbjct  61   DQKRTAMNTLKDYALEALVNTVDHLGSVSYKVNDLLNEKVGEVSGTEFRVSCIEQRLRTC  120

Query  701  QAYTEKEGFRQQQLLAIIPRHHKHYTLP  784
            Q Y ++EG  QQ L+   P++HKHY LP
Sbjct  121  QEYIDQEGRSQQSLVIQAPKYHKHYILP  148



>ref|XP_002317785.1| hypothetical protein POPTR_0012s02400g [Populus trichocarpa]
 gb|EEE96005.1| hypothetical protein POPTR_0012s02400g [Populus trichocarpa]
Length=341

 Score =   147 bits (372),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A  +DEVSM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYA++A
Sbjct  13   ASNYDEVSMQQSLLFSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKA  72

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            LVN VDHLG+V YK+ DL+ ++  +VS  E ++ CI Q+L TCQ Y + EG  QQ L+  
Sbjct  73   LVNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVCCIEQRLRTCQEYIDHEGISQQSLVID  132

Query  752  IPRHHKH  772
             P++HK 
Sbjct  133  TPKYHKR  139



>ref|NP_001242020.1| uncharacterized protein LOC100808485 [Glycine max]
 gb|ACU19668.1| unknown [Glycine max]
Length=324

 Score =   147 bits (370),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = +2

Query  374  KPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            +P    A  +DEV M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK
Sbjct  7    QPLSREASNYDEVFMQQSLLFDDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLK  66

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYA++A +N+VDHLG+V YK+ DL+ ++ ++VS  +L+++CI Q++ TC A+ + EG  Q
Sbjct  67   DYAIKAPINSVDHLGSVTYKVNDLLDEKIVEVSETQLRLSCIQQRISTCHAFMDHEGRTQ  126

Query  734  QQLLAIIPRHHKHYTLP  784
            Q L+   P++HK Y LP
Sbjct  127  QSLVIDAPKYHKRYILP  143



>ref|XP_010541486.1| PREDICTED: protein ABIL3-like [Tarenaya hassleriana]
Length=318

 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A  +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY + EQK++V+E LKDYA++A
Sbjct  14   APNYDELSMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKEIVVETLKDYAIKA  73

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            LVN VDHLG+V YK+ D + ++  +VS  EL+++C+ Q+L  CQ Y + EG  QQ L+  
Sbjct  74   LVNTVDHLGSVTYKVNDFLDEKVDEVSGTELRVSCMEQRLRMCQEYMDHEGRSQQSLVIN  133

Query  752  IPRHHKHYTLP  784
             P+ HK Y LP
Sbjct  134  TPKFHKRYILP  144



>gb|AFK46504.1| unknown [Medicago truncatula]
Length=168

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A  +DEV M ++  F  +L +LKNLR QLYSAAEY E SY + +QKQ+++E LKDYAV+A
Sbjct  2    ASNYDEVFMHQTLLFDDSLTDLKNLRIQLYSAAEYFELSYTNDDQKQILVETLKDYAVKA  61

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            L+N VDHLG+VAYK+ DL+ ++  +V   +L+++CI Q++ TCQ + + EG  QQ L+  
Sbjct  62   LINTVDHLGSVAYKVGDLLDEKVTEVFGEDLRLSCIEQRIKTCQGFMDHEGHTQQSLVIS  121

Query  752  IPRHHKHYTLP  784
             P+HHK Y LP
Sbjct  122  TPKHHKRYILP  132



>ref|XP_003602276.1| Protein ABIL2 [Medicago truncatula]
 gb|AES72527.1| ABIL1-like protein [Medicago truncatula]
Length=326

 Score =   147 bits (370),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = +2

Query  380  PPNS--AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLK  553
            PP S  A  FDEV M++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LK
Sbjct  10   PPFSQEASNFDEVYMQQSLLFDDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLK  69

Query  554  DYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQ  733
            DYA++ALVN VDHLG+V YK+ DL+ ++ ++VS  EL+++CI Q++ + Q + +  G  Q
Sbjct  70   DYAIKALVNTVDHLGSVTYKVNDLLDEKVVEVSGAELRVSCIEQRMRSYQGFADHGGRSQ  129

Query  734  QQLLAIIPRHHKHYTLP  784
            Q L+   P++HK Y LP
Sbjct  130  QSLVISTPKYHKRYILP  146



>ref|XP_004502669.1| PREDICTED: protein ABIL2-like [Cicer arietinum]
Length=326

 Score =   144 bits (362),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            FDEV M++S  F  +L++LKNLR QLYSAAEY E SY + + KQ+V+E LKDYA++ALVN
Sbjct  19   FDEVYMQQSLLFDDSLKDLKNLRTQLYSAAEYFELSYTNDDHKQIVVETLKDYAIKALVN  78

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+ DL+ ++ ++VS  EL+++CI Q++ T Q + + +G  QQ L+   P+
Sbjct  79   TVDHLGSVTYKVNDLLDEKVVEVSGAELRVSCIEQRMRTYQGHMDHKGRTQQSLVISTPK  138

Query  761  HHKHYTLP  784
            +HK Y LP
Sbjct  139  YHKRYILP  146



>ref|XP_009150953.1| PREDICTED: protein ABIL3 isoform X2 [Brassica rapa]
 emb|CDX88092.1| BnaA06g26830D [Brassica napus]
Length=321

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 92/140 (66%), Gaps = 0/140 (0%)
 Frame = +2

Query  383  PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
            P     +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY +    Q V+E LKDYA
Sbjct  10   PREGSNYDEISMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDGDTQSVVETLKDYA  69

Query  563  VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
            ++ALVN VDHLG+V YK+ D V ++   V+  EL++ CI Q+L  CQ Y + EG  QQ L
Sbjct  70   IKALVNTVDHLGSVTYKVNDFVDEKVDQVTGTELRVACIEQRLRMCQEYMDHEGRSQQSL  129

Query  743  LAIIPRHHKHYTLPNSVNKK  802
            +   P+ HK Y LP+   KK
Sbjct  130  VINTPKFHKRYILPSGEIKK  149



>ref|XP_010519446.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
 ref|XP_010519447.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
 ref|XP_010519448.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
 ref|XP_010519449.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
 ref|XP_010519450.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
Length=321

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P    +  +DEVSM++S  F  +L++LKNL+ QLYSAAEY E SY + EQKQ+V+E LKD
Sbjct  8    PVSRESSNYDEVSMQQSLLFSDSLKDLKNLKAQLYSAAEYFELSYTNDEQKQIVVETLKD  67

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG+V YK++D + ++  +VS   L+++CI Q+L   Q + + EG  QQ
Sbjct  68   YAIKALVNTVDHLGSVTYKVSDFLDEKVDEVSGTALRVSCIEQRLRKSQEFMDHEGRSQQ  127

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P+ HK Y LP
Sbjct  128  SLMINAPKFHKRYILP  143



>ref|XP_002518857.1| Protein ABIL2, putative [Ricinus communis]
 gb|EEF43390.1| Protein ABIL2, putative [Ricinus communis]
Length=308

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 92/138 (67%), Gaps = 0/138 (0%)
 Frame = +2

Query  371  PKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENL  550
            P P    A   DE+ M++S  F   L++LK+LR QLYSAAEY EKSY   +QKQ+V+E L
Sbjct  11   PGPDTEEASNHDELFMKQSMLFSDTLKDLKSLRKQLYSAAEYFEKSYSKEDQKQIVVETL  70

Query  551  KDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFR  730
            KDYAV+AL+N +DHLG+VAYK+ +L   +  ++S +EL+ +C+ Q+  TCQ Y    G  
Sbjct  71   KDYAVKALINTIDHLGSVAYKVNNLFDNKADEISALELRFSCLEQRRQTCQEYINHGGLS  130

Query  731  QQQLLAIIPRHHKHYTLP  784
            QQ L+   P++HK Y  P
Sbjct  131  QQFLVVQTPKYHKRYIFP  148



>ref|XP_009150952.1| PREDICTED: protein ABIL3 isoform X1 [Brassica rapa]
Length=322

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = +2

Query  383  PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
            P     +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY +    Q V+E LKDYA
Sbjct  10   PREGSNYDEISMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDGDTQSVVETLKDYA  69

Query  563  VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
            ++ALVN VDHLG+V YK+ D V ++   V+  EL++ CI Q+L  CQ Y + EG  QQ L
Sbjct  70   IKALVNTVDHLGSVTYKVNDFVDEKVDQVTGTELRVACIEQRLRMCQEYMDHEGRSQQSL  129

Query  743  LAIIPRHHKHYTLPNS  790
            +   P+ HK Y LP++
Sbjct  130  VINTPKFHKRYILPSA  145



>gb|KHG04210.1| Protein ABIL3 [Gossypium arboreum]
Length=185

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  383  PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
            P  A  +DEVSM++S  F  +L++LKNLR QLYSAAEY E SY + +QKQ+V+E LKDYA
Sbjct  35   PQEASNYDEVSMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYA  94

Query  563  VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
            V+A+VN VDHLG+V YK+ + + ++  DVS  EL+++C+ +++  CQ Y + +G  QQ L
Sbjct  95   VKAIVNTVDHLGSVTYKVNEFLDEKVDDVSGTELQVSCVEEKVRKCQEYIDLKGISQQSL  154

Query  743  LAIIPRHHK  769
            +   P +HK
Sbjct  155  MINTPMYHK  163



>gb|KHG10845.1| Protein ABIL2 [Gossypium arboreum]
Length=330

 Score =   142 bits (358),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +2

Query  377  PPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKD  556
            P P  +   DEV M++S  F   L++LKNLR QLYSAAEY E +Y    QKQ+V + LKD
Sbjct  11   PVPQQSSHRDEVLMQQSLVFADNLKDLKNLREQLYSAAEYFEMAYTKEMQKQIVEDTLKD  70

Query  557  YAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQ  736
            YA++ALVN VDHLG++AYK+   + ++  D S MEL++ C+ Q+L TCQ Y    G  QQ
Sbjct  71   YAIKALVNTVDHLGSIAYKINTFLDEKINDYSVMELRLFCLEQRLRTCQDYVNLGGLSQQ  130

Query  737  QLLAIIPRHHKHYTLP  784
             L+   P+HHKHY  P
Sbjct  131  SLVLEAPKHHKHYIFP  146



>ref|XP_002264080.2| PREDICTED: protein ABIL2-like isoform X6 [Vitis vinifera]
Length=322

 Score =   141 bits (355),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 2/144 (1%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DE SM++S  F  +L++LK+LR QLYSAAEY E+ Y   +QKQ+VLE LKDYA++ALVN
Sbjct  29   YDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKALVN  88

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+   +  +  +V   EL+ +CI Q++ TC+ +  + GF QQ LL   P+
Sbjct  89   TVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRTPK  148

Query  761  HHKHYTLPN--SVNKKVHFSPHIQ  826
            HHK YT P   + N   H  P  Q
Sbjct  149  HHKRYTFPGGETTNTTGHTIPTYQ  172



>ref|XP_010659662.1| PREDICTED: protein ABIL2-like isoform X5 [Vitis vinifera]
Length=325

 Score =   141 bits (356),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DE SM++S  F  +L++LK+LR QLYSAAEY E+ Y   +QKQ+VLE LKDYA++ALVN
Sbjct  29   YDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKALVN  88

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+   +  +  +V   EL+ +CI Q++ TC+ +  + GF QQ LL   P+
Sbjct  89   TVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRTPK  148

Query  761  HHKHYTLP  784
            HHK YT P
Sbjct  149  HHKRYTFP  156



>emb|CDX80429.1| BnaC07g30150D [Brassica napus]
Length=325

 Score =   141 bits (355),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = +2

Query  383  PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
            P     +DE+SM++S  F  +L++LKNLR QLYSAAEY E SY +      V+E LKDYA
Sbjct  10   PREGSNYDEISMQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDGDTHSVVETLKDYA  69

Query  563  VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
            ++ALVN VDHLG+V YK+ D V ++   V+  EL++ CI Q+L  CQ Y + EG  QQ L
Sbjct  70   IKALVNTVDHLGSVTYKVNDFVDEKVDQVTGTELRVACIEQRLRMCQEYMDHEGRSQQSL  129

Query  743  LAIIPRHHKHYTLPNSVNKK  802
            +   P+ HK Y LP+   KK
Sbjct  130  VINTPKFHKRYILPSGEIKK  149



>ref|XP_010659665.1| PREDICTED: protein ABIL2-like isoform X7 [Vitis vinifera]
 ref|XP_010659668.1| PREDICTED: protein ABIL2-like isoform X7 [Vitis vinifera]
 ref|XP_010659674.1| PREDICTED: protein ABIL2-like isoform X7 [Vitis vinifera]
Length=314

 Score =   141 bits (355),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DE SM++S  F  +L++LK+LR QLYSAAEY E+ Y   +QKQ+VLE LKDYA++ALVN
Sbjct  18   YDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKALVN  77

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+   +  +  +V   EL+ +CI Q++ TC+ +  + GF QQ LL   P+
Sbjct  78   TVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRTPK  137

Query  761  HHKHYTLP  784
            HHK YT P
Sbjct  138  HHKRYTFP  145



>ref|XP_006852591.1| hypothetical protein AMTR_s00021p00216340 [Amborella trichopoda]
 gb|ERN14058.1| hypothetical protein AMTR_s00021p00216340 [Amborella trichopoda]
Length=296

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +2

Query  383  PNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYA  562
            P  A T+DE+SM++S  F  +LQ+LKNLR QLYSAAE+ E SY +   KQ V++ LKD+A
Sbjct  10   PQEASTYDEISMQQSLIFSDSLQDLKNLRAQLYSAAEHFELSYTNDNHKQTVVDTLKDFA  69

Query  563  VRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQL  742
            VRALVN VDHLG+V+Y++  L+ ++  +VS  E +I C+ Q++  CQ Y + EG  +Q +
Sbjct  70   VRALVNTVDHLGSVSYRVNGLLNEKVEEVSETEFRIGCMEQRVRMCQEYMDHEGLGEQSI  129

Query  743  LAIIPRHHKHYTLPNSVN  796
                P++HK Y L  +++
Sbjct  130  TITAPKYHKRYMLKGNLS  147



>emb|CBI34535.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DE SM++S  F  +L++LK+LR QLYSAAEY E+ Y   +QKQ+VLE LKDYA++ALVN
Sbjct  18   YDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKALVN  77

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+   +  +  +V   EL+ +CI Q++ TC+ +  + GF QQ LL   P+
Sbjct  78   TVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRTPK  137

Query  761  HHKHYTLP  784
            HHK YT P
Sbjct  138  HHKRYTFP  145



>ref|XP_010659659.1| PREDICTED: protein ABIL2-like isoform X4 [Vitis vinifera]
Length=369

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DE SM++S  F  +L++LK+LR QLYSAAEY E+ Y   +QKQ+VLE LKDYA++ALVN
Sbjct  84   YDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKALVN  143

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+   +  +  +V   EL+ +CI Q++ TC+ +  + GF QQ LL   P+
Sbjct  144  TVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRTPK  203

Query  761  HHKHYTLP  784
            HHK YT P
Sbjct  204  HHKRYTFP  211



>ref|XP_010659654.1| PREDICTED: protein ABIL2-like isoform X3 [Vitis vinifera]
Length=372

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DE SM++S  F  +L++LK+LR QLYSAAEY E+ Y   +QKQ+VLE LKDYA++ALVN
Sbjct  84   YDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKALVN  143

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+   +  +  +V   EL+ +CI Q++ TC+ +  + GF QQ LL   P+
Sbjct  144  TVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRTPK  203

Query  761  HHKHYTLP  784
            HHK YT P
Sbjct  204  HHKRYTFP  211



>ref|XP_010659647.1| PREDICTED: protein ABIL2-like isoform X2 [Vitis vinifera]
Length=377

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DE SM++S  F  +L++LK+LR QLYSAAEY E+ Y   +QKQ+VLE LKDYA++ALVN
Sbjct  84   YDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKALVN  143

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+   +  +  +V   EL+ +CI Q++ TC+ +  + GF QQ LL   P+
Sbjct  144  TVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRTPK  203

Query  761  HHKHYTLP  784
            HHK YT P
Sbjct  204  HHKRYTFP  211



>ref|XP_010659643.1| PREDICTED: protein ABIL2-like isoform X1 [Vitis vinifera]
Length=380

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  401  FDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVN  580
            +DE SM++S  F  +L++LK+LR QLYSAAEY E+ Y   +QKQ+VLE LKDYA++ALVN
Sbjct  84   YDEYSMQQSLLFGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKALVN  143

Query  581  AVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPR  760
             VDHLG+V YK+   +  +  +V   EL+ +CI Q++ TC+ +  + GF QQ LL   P+
Sbjct  144  TVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRTPK  203

Query  761  HHKHYTLP  784
            HHK YT P
Sbjct  204  HHKRYTFP  211



>ref|XP_011022465.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011022466.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011022467.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011022468.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011022469.1| PREDICTED: protein ABIL2-like [Populus euphratica]
Length=312

 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 93/149 (62%), Gaps = 4/149 (3%)
 Frame = +2

Query  338  NLELSEMEVEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLH  517
            N + S   V  P+ P N     DE+ M++S  F   L++LKNLR QLYSAA+Y E +Y  
Sbjct  3    NSKTSSSSVNGPQEPSN----HDELFMQQSLLFSDTLKDLKNLRKQLYSAADYFELAYYK  58

Query  518  SEQKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLT  697
             +QKQ+V+E LKDYA++ALV+ VDHLG+VAYK+   + Q+  +VS MEL+  C  Q+L  
Sbjct  59   EDQKQIVVETLKDYAIKALVSTVDHLGSVAYKVNKFLDQEIGEVSEMELRFFCTEQRLEA  118

Query  698  CQAYTEKEGFRQQQLLAIIPRHHKHYTLP  784
            CQ Y  + G  QQ L    P HHK Y  P
Sbjct  119  CQEYINQGGLSQQSLAIKTPTHHKRYIFP  147



>gb|KDP25264.1| hypothetical protein JCGZ_20420 [Jatropha curcas]
Length=308

 Score =   137 bits (346),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +2

Query  404  DEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNA  583
            DE+ M++S  F + LQ+LKNLR QLYSAAEY E +Y   +QKQ+V+E LKDY ++AL+N 
Sbjct  22   DELFMQQSLLFSETLQDLKNLRKQLYSAAEYFETTYRKEDQKQIVVETLKDYTIKALINT  81

Query  584  VDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRH  763
            +DHLG+VAYK+     ++   VS ++L+ TC+ Q+L TC+ Y    G  QQ L+   P++
Sbjct  82   IDHLGSVAYKVNSFSDEKLRGVSALDLRFTCLEQKLRTCEEYINHSGLSQQFLMVETPKY  141

Query  764  HKHYTLP  784
            HK Y  P
Sbjct  142  HKRYIFP  148



>ref|XP_002299451.2| hypothetical protein POPTR_0001s10950g [Populus trichocarpa]
 ref|XP_006368791.1| hypothetical protein POPTR_0001s10950g [Populus trichocarpa]
 gb|EEE84256.2| hypothetical protein POPTR_0001s10950g [Populus trichocarpa]
 gb|ERP65360.1| hypothetical protein POPTR_0001s10950g [Populus trichocarpa]
Length=312

 Score =   137 bits (345),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 1/144 (1%)
 Frame = +2

Query  404  DEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNA  583
            +E+ M++S  F  AL++LKNLR QLYSAA+Y E +Y   +QKQ+V+ENLKDYA++AL+N 
Sbjct  20   EELLMQQSLLFSDALKDLKNLRKQLYSAADYFELAYNKEDQKQIVVENLKDYAIKALINT  79

Query  584  VDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRH  763
            VDHLG+VAYK+   + Q+  +VS MEL+ +C  Q+L  CQ Y  + G  QQ L+   P H
Sbjct  80   VDHLGSVAYKVDRFLDQKIDEVSGMELRFSCSEQRLEACQKYINQGGLSQQSLVIKTPYH  139

Query  764  HKHYTLPNSVNKKVHFSPHIQMDH  835
            +K Y  P        FS H + DH
Sbjct  140  YKRYIFPVDEETMDSFS-HAKPDH  162



>gb|AAZ74718.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74720.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74721.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74722.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74723.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74724.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74725.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74726.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74727.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74728.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74729.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74730.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74731.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74732.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74733.1| At5g24310 [Arabidopsis thaliana]
 gb|AAZ74734.1| At5g24310 [Arabidopsis thaliana]
Length=111

 Score =   130 bits (328),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +2

Query  452  ELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVG  631
            +LKNLR QLYSAAEY E SY + EQKQ+V+E LKDYA++ALVN VDHLG+V YK+ D V 
Sbjct  1    DLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKALVNTVDHLGSVTYKVNDFVD  60

Query  632  QQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHHKHYTLP  784
            ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ L+   P+ HK Y LP
Sbjct  61   EKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDTPKFHKRYFLP  111



>ref|XP_010107272.1| hypothetical protein L484_007833 [Morus notabilis]
 gb|EXC14466.1| hypothetical protein L484_007833 [Morus notabilis]
Length=263

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 91/141 (65%), Gaps = 5/141 (4%)
 Frame = +2

Query  362  VEQPKPPPNSAMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVL  541
            V  PKP  +     DE+ M++   F ++L ELKNLR QLYSAAEY E SY   +QKQ+V+
Sbjct  10   VSAPKPSHH-----DELFMQQRMVFSESLNELKNLRKQLYSAAEYFELSYSKDDQKQIVV  64

Query  542  ENLKDYAVRALVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKE  721
            E LKDY ++A +N VDHLG++A K+ + V ++ +DVS  +LK +CI Q+  T Q   ++ 
Sbjct  65   ETLKDYTIKAFINTVDHLGSMADKVNNFVDEKTVDVSEADLKFSCIEQRQRTSQDLIDRS  124

Query  722  GFRQQQLLAIIPRHHKHYTLP  784
            G  QQ L    PRHHK Y +P
Sbjct  125  GLFQQSLAFSFPRHHKRYIIP  145



>ref|XP_009420789.1| PREDICTED: putative protein ABIL2 isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=324

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A  FDE+SM++S  F  +L+ELKNLR QLYSAAEY E SY   + KQ V+  L++YA++A
Sbjct  18   ASNFDELSMDQSLLFSDSLKELKNLRSQLYSAAEYFELSYATDDHKQFVVNTLREYAIKA  77

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            +VN VDHLG+V++K+T L+  +  +VS  E +++CI Q++  C+   ++EG  QQ L+  
Sbjct  78   VVNTVDHLGSVSFKVTGLLEAKVDEVSGAESRVSCIEQRIRACRELVDREGLSQQSLVIK  137

Query  752  IPRHHKHYTLP  784
             PR+HK Y +P
Sbjct  138  APRYHKRYIVP  148



>ref|XP_009420773.1| PREDICTED: putative protein ABIL2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=350

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A  FDE+SM++S  F  +L+ELKNLR QLYSAAEY E SY   + KQ V+  L++YA++A
Sbjct  18   ASNFDELSMDQSLLFSDSLKELKNLRSQLYSAAEYFELSYATDDHKQFVVNTLREYAIKA  77

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            +VN VDHLG+V++K+T L+  +  +VS  E +++CI Q++  C+   ++EG  QQ L+  
Sbjct  78   VVNTVDHLGSVSFKVTGLLEAKVDEVSGAESRVSCIEQRIRACRELVDREGLSQQSLVIK  137

Query  752  IPRHHKHYTLP  784
             PR+HK Y +P
Sbjct  138  APRYHKRYIVP  148



>gb|AAZ74719.1| At5g24310 [Arabidopsis thaliana]
Length=111

 Score =   129 bits (325),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 62/111 (56%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +2

Query  452  ELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVG  631
            +LKNLR QLYSAAEY E SY + EQKQ+V+E LKDYA++ALVN VDHLG+V YK+ D V 
Sbjct  1    DLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKALVNTVDHLGSVTYKVNDFVD  60

Query  632  QQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHHKHYTLP  784
            ++  +V+  EL+++CI Q+L  CQ Y + EG  QQ L+   P  HK Y LP
Sbjct  61   EKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDTPNFHKRYFLP  111



>ref|XP_009420781.1| PREDICTED: putative protein ABIL2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=349

 Score =   136 bits (342),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +2

Query  392  AMTFDEVSMERSKSFVKALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRA  571
            A  FDE+SM++S  F  +L+ELKNLR QLYSAAEY E SY   + KQ V+  L++YA++A
Sbjct  18   ASNFDELSMDQSLLFSDSLKELKNLRSQLYSAAEYFELSYATDDHKQFVVNTLREYAIKA  77

Query  572  LVNAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAI  751
            +VN VDHLG+V++K+T L+  +  +VS  E +++CI Q++  C+   ++EG  QQ L+  
Sbjct  78   VVNTVDHLGSVSFKVTGLLEAKVDEVSGAESRVSCIEQRIRACRELVDREGLSQQSLVIK  137

Query  752  IPRHHKHYTLP  784
             PR+HK Y +P
Sbjct  138  APRYHKRYIVP  148



>ref|XP_001767060.1| predicted protein [Physcomitrella patens]
 gb|EDQ68226.1| predicted protein [Physcomitrella patens]
Length=129

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +2

Query  452  ELKNLRPQLYSAAEYCEKSYLHSEQKQMVLENLKDYAVRALVNAVDHLGTVAYKLTDLVG  631
            EL++LRPQLY AA+YCE  YL  + KQ VL+NLKDY+V+ALVNAVDHLGTVAYKL DL+ 
Sbjct  1    ELQSLRPQLYQAADYCEHQYLFGDNKQGVLDNLKDYSVKALVNAVDHLGTVAYKLNDLIS  60

Query  632  QQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIPRHHKHYTLP  784
             Q+  V   +L  + I Q+L  CQ ++++EG +QQ +   +  +HK YTLP
Sbjct  61   MQHEAVDNTQLAASAIAQRLRACQEHSDREGLKQQSMAKTMHVNHKQYTLP  111



>ref|XP_008802047.1| PREDICTED: protein ABIL1-like isoform X5 [Phoenix dactylifera]
Length=272

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 101/179 (56%), Gaps = 34/179 (19%)
 Frame = +2

Query  578   NAVDHLGTVAYKLTDLVGQQNLDVSTMELKITCINQQLLTCQAYTEKEGFRQQQLLAIIP  757
             N +DHLGTVAYKLTDL  QQ LDVST ELKI+C+NQQ+LTCQ YT+KEG RQQ++     
Sbjct  4     NRLDHLGTVAYKLTDLFEQQTLDVSTAELKISCLNQQILTCQTYTDKEGLRQQRMFTNTA  63

Query  758   RHHKHYTLPNSVNKKVHFSPHIQMD-HRQHIQSRGR------------LFP---------  871
             RHHKHY LP+SV++++     +Q+D +  H+Q++ R            LF          
Sbjct  64    RHHKHYILPDSVSRRMQSCSQLQIDANLIHVQAKPRPDPPGAGYLHLMLFQLFLLCLSIY  123

Query  872   ------------SGPAAAKTLSWHLASETTSTLKGASCGFVSADDIKSSGRTSGAFNLL  1012
                          G  A+KTLSW LASET S   GA        D K+   TS  F+LL
Sbjct  124   LCIHALYHVDWLKGSPASKTLSWLLASETNSASDGAPREVSGTGDAKAPKITSEVFHLL  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5050657640886