BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83078_g1_i1 len=1360 path=[1338:0-1359]

Length=1360
                                                                      Score     E

ref|XP_008230605.1|  PREDICTED: GDSL esterase/lipase At3g27950          423   7e-142   
emb|CDP02115.1|  unnamed protein product                                422   2e-141   
ref|XP_006446489.1|  hypothetical protein CICLE_v10015583mg             422   4e-141   
ref|XP_007216369.1|  hypothetical protein PRUPE_ppa019167mg             419   1e-140   
ref|XP_007031463.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    419   3e-140   
ref|XP_006470339.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     419   3e-140   
ref|XP_004142359.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     418   6e-140   
ref|XP_004159075.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     418   7e-140   
emb|CBI34924.3|  unnamed protein product                                416   3e-139   
ref|XP_002274412.3|  PREDICTED: GDSL esterase/lipase At3g27950          417   4e-139   Vitis vinifera
ref|XP_006421383.1|  hypothetical protein CICLE_v10005152mg             416   9e-139   
ref|XP_008458756.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     415   1e-138   
ref|XP_010029184.1|  PREDICTED: GDSL esterase/lipase At3g27950 is...    414   6e-138   
ref|XP_010029183.1|  PREDICTED: GDSL esterase/lipase At3g27950 is...    410   1e-136   
ref|XP_009334073.1|  PREDICTED: GDSL esterase/lipase At3g27950          410   1e-136   
ref|XP_004304620.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     409   2e-136   
gb|KDP45344.1|  hypothetical protein JCGZ_09593                         409   3e-136   
ref|XP_009778765.1|  PREDICTED: GDSL esterase/lipase At3g27950-li...    407   2e-135   
ref|XP_007151046.1|  hypothetical protein PHAVU_004G013900g             405   7e-135   
ref|XP_002517326.1|  Alpha-L-fucosidase 2 precursor, putative           405   8e-135   Ricinus communis
gb|ACZ74703.1|  carboxilic ester hydrolase                              405   1e-134   Phaseolus vulgaris [French bean]
ref|XP_008379791.1|  PREDICTED: GDSL esterase/lipase At3g27950          402   1e-133   
ref|XP_004142807.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     401   3e-133   
ref|XP_008458758.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     401   4e-133   
ref|XP_004156679.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     399   3e-132   
ref|XP_010243019.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    397   1e-131   
ref|XP_009617545.1|  PREDICTED: GDSL esterase/lipase At3g27950 is...    396   5e-131   
ref|XP_003524542.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     391   4e-129   
gb|KHN23536.1|  GDSL esterase/lipase                                    390   6e-129   
ref|NP_001241984.1|  uncharacterized protein LOC100785435 precursor     388   4e-128   
ref|XP_010243017.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    388   6e-128   
ref|XP_010243018.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    386   3e-127   
ref|XP_010322965.1|  PREDICTED: GDSL esterase/lipase At3g27950          384   1e-126   
ref|XP_006347466.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     382   1e-125   
ref|XP_004489281.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     382   1e-125   
gb|KHG13836.1|  hypothetical protein F383_18333                         380   4e-125   
gb|KDP26685.1|  hypothetical protein JCGZ_17843                         379   1e-124   
ref|XP_003618296.1|  GDSL esterase/lipase                               378   5e-124   
gb|KCW59731.1|  hypothetical protein EUGRSUZ_H02484                     377   3e-123   
ref|XP_004489280.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     374   9e-123   
gb|AFK46790.1|  unknown                                                 373   4e-122   
ref|XP_006852383.1|  hypothetical protein AMTR_s00049p00230810          370   7e-121   
ref|XP_002530044.1|  Alpha-L-fucosidase 2 precursor, putative           368   7e-120   Ricinus communis
emb|CBI16798.3|  unnamed protein product                                367   1e-119   
ref|XP_007044833.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    367   2e-119   
ref|XP_010248682.1|  PREDICTED: GDSL esterase/lipase At5g14450          366   3e-119   
ref|XP_010026633.1|  PREDICTED: uncharacterized protein LOC104417005    378   5e-118   
ref|XP_009778772.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    358   8e-117   
ref|XP_006852384.1|  hypothetical protein AMTR_s00049p00231110          358   1e-116   
gb|KDP45345.1|  hypothetical protein JCGZ_09594                         359   8e-116   
gb|KHG20639.1|  hypothetical protein F383_04246                         353   7e-115   
ref|XP_002285509.2|  PREDICTED: uncharacterized protein LOC100264440    366   2e-114   Vitis vinifera
ref|XP_007044832.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    367   3e-114   
gb|KDO82202.1|  hypothetical protein CISIN_1g017691mg                   352   3e-114   
ref|XP_006483961.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     353   4e-114   
gb|KEH24834.1|  GDSL-like lipase/acylhydrolase                          361   1e-113   
ref|XP_002271320.2|  PREDICTED: GDSL esterase/lipase At5g14450          351   2e-113   Vitis vinifera
ref|XP_002300062.1|  hypothetical protein POPTR_0001s35620g             350   4e-113   Populus trichocarpa [western balsam poplar]
emb|CBI34838.3|  unnamed protein product                                348   8e-113   
ref|XP_009617551.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    347   3e-112   
ref|XP_011003110.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     347   4e-112   
ref|XP_011101808.1|  PREDICTED: GDSL esterase/lipase At5g14450          346   2e-111   
ref|XP_006438237.1|  hypothetical protein CICLE_v10031879mg             344   3e-111   
ref|XP_010554006.1|  PREDICTED: GDSL esterase/lipase At3g27950          344   7e-111   
ref|XP_006470214.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     343   2e-110   
gb|AFK35005.1|  unknown                                                 343   3e-110   
ref|XP_007031628.1|  Esterase, putative isoform 2                       342   3e-110   
ref|XP_006446637.1|  hypothetical protein CICLE_v10015586mg             342   3e-110   
ref|XP_009121660.1|  PREDICTED: GDSL esterase/lipase At5g14450          342   6e-110   
ref|XP_004298997.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     342   6e-110   
ref|XP_007031630.1|  Esterase, putative                                 342   7e-110   
gb|KDP46394.1|  hypothetical protein JCGZ_10234                         342   9e-110   
ref|XP_006446639.1|  hypothetical protein CICLE_v10015574mg             341   1e-109   
emb|CDY09855.1|  BnaC09g43060D                                          341   1e-109   
ref|XP_009771352.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    342   1e-109   
ref|XP_003624763.1|  GDSL esterase/lipase                               341   2e-109   
ref|XP_002521491.1|  Esterase precursor, putative                       341   3e-109   Ricinus communis
ref|XP_009771353.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    340   5e-109   
dbj|BAK03632.1|  predicted protein                                      340   7e-109   
ref|XP_009771354.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    339   7e-109   
gb|KGN59717.1|  hypothetical protein Csa_3G840430                       339   7e-109   
ref|XP_004158356.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     337   1e-108   
ref|XP_008341370.1|  PREDICTED: GDSL esterase/lipase At5g14450          338   2e-108   
ref|XP_006470213.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     337   3e-108   
dbj|BAG09557.1|  acetylcholinesterase                                   337   6e-108   Macroptilium atropurpureum
gb|EMT15425.1|  GDSL esterase/lipase                                    337   7e-108   
gb|KDO49031.1|  hypothetical protein CISIN_1g016659mg                   337   8e-108   
emb|CDP13238.1|  unnamed protein product                                337   1e-107   
ref|XP_007159263.1|  hypothetical protein PHAVU_002G223300g             335   1e-107   
ref|XP_008230503.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    335   2e-107   
ref|XP_009370349.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     335   2e-107   
gb|KFK33714.1|  hypothetical protein AALP_AA5G050500                    335   2e-107   
ref|XP_007215529.1|  hypothetical protein PRUPE_ppa007107mg             335   2e-107   
ref|XP_010430826.1|  PREDICTED: GDSL esterase/lipase At3g27950          335   3e-107   
ref|XP_008782097.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     335   3e-107   
ref|XP_003547701.1|  PREDICTED: GDSL esterase/lipase At5g14450 is...    335   3e-107   
ref|XP_009371742.1|  PREDICTED: GDSL esterase/lipase At5g14450          334   4e-107   
ref|XP_004304671.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     334   4e-107   
ref|XP_008344421.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     335   6e-107   
gb|EYU44795.1|  hypothetical protein MIMGU_mgv1a008122mg                334   6e-107   
ref|XP_009359196.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     335   6e-107   
ref|XP_010502802.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     333   1e-106   
ref|XP_008464935.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    333   1e-106   
gb|AGZ15410.1|  acetylcholinesterase                                    333   1e-106   
ref|XP_003627819.1|  GDSL esterase/lipase                               333   1e-106   
ref|XP_003554066.1|  PREDICTED: GDSL esterase/lipase At3g26430          333   1e-106   
gb|KHN34622.1|  GDSL esterase/lipase                                    333   1e-106   
ref|XP_010929893.1|  PREDICTED: alpha-L-fucosidase 3                    332   3e-106   
ref|XP_010089185.1|  GDSL esterase/lipase                               332   3e-106   
ref|XP_010100370.1|  GDSL esterase/lipase                               344   3e-106   
ref|XP_003624771.1|  GDSL esterase/lipase                               332   3e-106   
ref|XP_008804229.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     332   4e-106   
ref|XP_011097365.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     332   5e-106   
ref|XP_006852386.1|  hypothetical protein AMTR_s00049p00231360          331   6e-106   
ref|XP_010029093.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     332   7e-106   
ref|XP_008230502.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    331   1e-105   
ref|XP_006395388.1|  hypothetical protein EUTSA_v10004399mg             331   1e-105   
ref|XP_009386685.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     330   2e-105   
ref|XP_008379194.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     330   2e-105   
ref|XP_004491984.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    330   2e-105   
ref|XP_010514503.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     329   3e-105   
ref|XP_004493252.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     330   3e-105   
ref|XP_008464936.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    329   4e-105   
ref|XP_008365369.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     329   5e-105   
gb|KEH22102.1|  GDSL-like lipase/acylhydrolase                          329   5e-105   
ref|XP_007161910.1|  hypothetical protein PHAVU_001G107900g             329   6e-105   
ref|XP_010420084.1|  PREDICTED: GDSL esterase/lipase At5g14450          329   6e-105   
gb|ACG38411.1|  alpha-L-fucosidase 2 precursor                          329   8e-105   Zea mays [maize]
gb|ACJ85056.1|  unknown                                                 328   1e-104   Medicago truncatula
gb|KHG01562.1|  hypothetical protein F383_21105                         328   1e-104   
gb|EAZ04511.1|  hypothetical protein OsI_26662                          328   1e-104   Oryza sativa Indica Group [Indian rice]
ref|NP_001060129.1|  Os07g0586200                                       328   1e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010551928.1|  PREDICTED: GDSL esterase/lipase At5g14450          328   1e-104   
ref|XP_008464934.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     328   1e-104   
ref|XP_004141116.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     328   2e-104   
ref|XP_007044830.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    328   2e-104   
ref|XP_006657897.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     328   2e-104   
ref|XP_010453569.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     328   2e-104   
gb|EYU34754.1|  hypothetical protein MIMGU_mgv11b006645mg               327   2e-104   
ref|NP_196949.1|  GDSL esterase/lipase                                  327   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912877.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     327   3e-104   
ref|XP_002463099.1|  hypothetical protein SORBIDRAFT_02g037820          328   3e-104   Sorghum bicolor [broomcorn]
ref|XP_009415970.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     327   3e-104   
ref|XP_009406370.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     327   5e-104   
ref|XP_010678671.1|  PREDICTED: GDSL esterase/lipase At5g14450          326   7e-104   
ref|XP_006399957.1|  hypothetical protein EUTSA_v10013537mg             328   8e-104   
ref|XP_007031627.1|  Esterase, putative isoform 1                       327   1e-103   
gb|KEH24835.1|  GDSL-like lipase/acylhydrolase                          325   1e-103   
ref|NP_001266613.1|  alpha-L-fucosidase 2 precursor                     326   1e-103   
ref|XP_004173555.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    325   2e-103   
ref|XP_006289899.1|  hypothetical protein CARUB_v10003515mg             325   3e-103   
ref|NP_001105800.1|  uncharacterized protein LOC606473 precursor        325   3e-103   Zea mays [maize]
gb|KFK25684.1|  hypothetical protein AALP_AA8G145800                    325   3e-103   
ref|XP_002871620.1|  GDSL-motif lipase/hydrolase family protein         324   4e-103   
ref|XP_004141199.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     323   6e-103   
ref|XP_007151151.1|  hypothetical protein PHAVU_004G022200g             323   8e-103   
emb|CDY49758.1|  BnaA02g29130D                                          323   9e-103   
dbj|BAI23204.1|  acetylcholinesterase                                   323   1e-102   Salicornia europaea [chicken-claws]
ref|XP_002530042.1|  Alpha-L-fucosidase 2 precursor, putative           323   1e-102   Ricinus communis
ref|XP_010492254.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     323   1e-102   
gb|KCW59732.1|  hypothetical protein EUGRSUZ_H02485                     323   2e-102   
ref|XP_004958162.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     323   3e-102   
ref|XP_006604953.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     322   4e-102   
ref|XP_006852380.1|  hypothetical protein AMTR_s00049p00229270          322   5e-102   
ref|XP_002282372.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     321   7e-102   Vitis vinifera
ref|XP_008230934.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     321   7e-102   
ref|XP_004306388.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     321   8e-102   
ref|XP_007216389.1|  hypothetical protein PRUPE_ppa021457mg             320   9e-102   
gb|EYU44799.1|  hypothetical protein MIMGU_mgv1a008141mg                320   1e-101   
ref|XP_004304672.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     321   1e-101   
ref|XP_007031629.1|  Esterase, putative                                 320   1e-101   
sp|Q9LII9.1|GDL54_ARATH  RecName: Full=GDSL esterase/lipase At3g2...    320   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034054.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    320   2e-101   
ref|XP_006292652.1|  hypothetical protein CARUB_v10018895mg             319   3e-101   
ref|XP_004239139.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     319   3e-101   
emb|CBI16795.3|  unnamed protein product                                322   3e-101   
ref|XP_002272185.2|  PREDICTED: GDSL esterase/lipase At5g14450-like     320   4e-101   Vitis vinifera
emb|CBI34837.3|  unnamed protein product                                319   6e-101   
ref|NP_189434.1|  GDSL esterase/lipase                                  318   6e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010110056.1|  GDSL esterase/lipase                               318   7e-101   
ref|XP_007227131.1|  hypothetical protein PRUPE_ppa026073mg             318   7e-101   
ref|XP_011042393.1|  PREDICTED: alpha-L-fucosidase 3-like               318   9e-101   
gb|KHN34166.1|  GDSL esterase/lipase                                    318   1e-100   
ref|XP_009779715.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     318   1e-100   
gb|KHN27427.1|  GDSL esterase/lipase                                    314   1e-100   
ref|XP_010044556.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     318   1e-100   
ref|XP_011042394.1|  PREDICTED: alpha-L-fucosidase 3-like               317   2e-100   
ref|XP_008221893.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     318   2e-100   
ref|XP_009129531.1|  PREDICTED: GDSL esterase/lipase At3g27950          323   2e-100   
ref|XP_010100372.1|  GDSL esterase/lipase                               317   2e-100   
ref|XP_010248683.1|  PREDICTED: GDSL esterase/lipase At3g26430          317   3e-100   
ref|XP_011097366.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    316   3e-100   
ref|XP_008356441.1|  PREDICTED: GDSL esterase/lipase At3g27950-like     315   5e-100   
gb|EYU22538.1|  hypothetical protein MIMGU_mgv1a008099mg                316   5e-100   
ref|XP_009611346.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     316   5e-100   
ref|XP_011101807.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     315   9e-100   
ref|XP_008221894.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     315   1e-99    
gb|EYU22539.1|  hypothetical protein MIMGU_mgv1a008099mg                315   1e-99    
ref|XP_007224644.1|  hypothetical protein PRUPE_ppa026400mg             314   2e-99    
ref|XP_010556209.1|  PREDICTED: alpha-L-fucosidase 3                    315   2e-99    
gb|EYU30623.1|  hypothetical protein MIMGU_mgv1a007766mg                315   2e-99    
ref|XP_007223009.1|  hypothetical protein PRUPE_ppa006817mg             315   2e-99    
ref|XP_010682275.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     315   2e-99    
ref|XP_011087101.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     314   3e-99    
ref|XP_006291234.1|  hypothetical protein CARUB_v10017365mg             315   5e-99    
gb|KHN29023.1|  GDSL esterase/lipase                                    314   6e-99    
ref|XP_003531330.1|  PREDICTED: GDSL esterase/lipase At3g26430 is...    314   7e-99    
ref|XP_010682312.1|  PREDICTED: uncharacterized protein LOC104897187    325   7e-99    
ref|XP_003562799.2|  PREDICTED: uncharacterized protein LOC100833243    327   7e-99    
ref|XP_010242789.1|  PREDICTED: esterase-like isoform X1                313   9e-99    
ref|XP_004504128.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     313   1e-98    
ref|XP_002285512.1|  PREDICTED: GDSL esterase/lipase At3g26430          313   1e-98    Vitis vinifera
ref|XP_007044829.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    313   1e-98    
ref|XP_006599078.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     313   1e-98    
ref|XP_010029090.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     313   1e-98    
ref|XP_010682277.1|  PREDICTED: GDSL esterase/lipase At3g26430          312   2e-98    
ref|XP_006357593.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     312   2e-98    
ref|XP_002311760.2|  GDSL-motif lipase/hydrolase family protein         312   3e-98    Populus trichocarpa [western balsam poplar]
ref|XP_008340092.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     313   3e-98    
ref|XP_010320940.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    311   4e-98    
ref|XP_007140963.1|  hypothetical protein PHAVU_008G155800g             311   5e-98    
ref|XP_002875415.1|  hypothetical protein ARALYDRAFT_484583             310   5e-98    
ref|XP_010044555.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     311   5e-98    
gb|AFK49466.1|  unknown                                                 310   6e-98    
ref|NP_001242659.1|  uncharacterized protein LOC100805314 precursor     311   6e-98    
emb|CBI16797.3|  unnamed protein product                                311   6e-98    
ref|XP_010044559.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    311   7e-98    
ref|XP_010110055.1|  GDSL esterase/lipase                               311   9e-98    
emb|CDP13237.1|  unnamed protein product                                310   9e-98    
ref|XP_009779717.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    310   1e-97    
ref|XP_002530043.1|  Alpha-L-fucosidase 2 precursor, putative           310   1e-97    Ricinus communis
ref|XP_008365370.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    310   1e-97    
gb|KCW86642.1|  hypothetical protein EUGRSUZ_B03271                     311   1e-97    
emb|CDY60176.1|  BnaC02g48210D                                          310   1e-97    
ref|XP_008365371.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    310   2e-97    
ref|XP_006355000.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     309   4e-97    
ref|XP_010556339.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    309   5e-97    
ref|XP_010425337.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     308   5e-97    
ref|XP_009359342.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    311   7e-97    
ref|XP_002875320.1|  GDSL-motif lipase/hydrolase family protein         308   9e-97    
ref|XP_004239137.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    308   9e-97    
ref|XP_008446147.1|  PREDICTED: GDSL esterase/lipase At3g26430          308   1e-96    
gb|KHG05491.1|  hypothetical protein F383_30482                         307   1e-96    
ref|XP_010044557.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     307   1e-96    
ref|NP_001060128.1|  Os07g0586100                                       308   1e-96    Oryza sativa Japonica Group [Japonica rice]
emb|CDP16617.1|  unnamed protein product                                307   2e-96    
gb|EEC82351.1|  hypothetical protein OsI_26660                          308   2e-96    Oryza sativa Indica Group [Indian rice]
dbj|BAD43265.1|  ENOD8-like protein                                     306   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_176949.1|  alpha-L-fucosidase 1                                  306   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491983.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     306   4e-96    
ref|XP_004233597.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    305   4e-96    
gb|KEH20768.1|  GDSL-like lipase/acylhydrolase                          306   4e-96    
ref|XP_008221990.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    306   5e-96    
ref|XP_010930359.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     306   7e-96    
gb|KFK33571.1|  hypothetical protein AALP_AA5G030900                    305   7e-96    
ref|XP_008340355.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     306   8e-96    
ref|XP_007159696.1|  hypothetical protein PHAVU_002G259500g             305   9e-96    
ref|XP_006438239.1|  hypothetical protein CICLE_v10031753mg             305   1e-95    
ref|XP_010470714.1|  PREDICTED: alpha-L-fucosidase 3-like               304   2e-95    
ref|XP_010514280.1|  PREDICTED: GDSL esterase/lipase At3g26430          305   2e-95    
gb|KDO82203.1|  hypothetical protein CISIN_1g016007mg                   305   2e-95    
ref|XP_006302412.1|  hypothetical protein CARUB_v10020484mg             304   2e-95    
ref|XP_010100371.1|  GDSL esterase/lipase                               305   2e-95    
ref|XP_006438238.1|  hypothetical protein CICLE_v10031741mg             304   3e-95    
ref|XP_004298998.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     304   3e-95    
ref|XP_008219730.1|  PREDICTED: LOW QUALITY PROTEIN: esterase-like      304   4e-95    
ref|XP_008353024.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     304   4e-95    
ref|XP_010044562.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    303   4e-95    
ref|XP_008365372.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    304   5e-95    
ref|XP_010415375.1|  PREDICTED: alpha-L-fucosidase 3-like               303   5e-95    
ref|XP_006471885.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    303   5e-95    
emb|CDY13633.1|  BnaA06g32900D                                          303   7e-95    
ref|XP_004135278.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     303   8e-95    
ref|XP_010510464.1|  PREDICTED: alpha-L-fucosidase 3                    302   9e-95    
ref|XP_007227294.1|  hypothetical protein PRUPE_ppa017062mg             302   9e-95    
ref|XP_010511747.1|  PREDICTED: alpha-L-fucosidase 3                    303   1e-94    
ref|XP_008219729.1|  PREDICTED: esterase-like                           302   1e-94    
ref|XP_010502567.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     302   2e-94    
gb|KEH22099.1|  GDSL-like lipase/acylhydrolase                          302   2e-94    
ref|XP_006357594.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     301   2e-94    
ref|NP_189274.1|  GDSL esterase/lipase                                  301   3e-94    
ref|XP_010044558.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    302   4e-94    
ref|XP_003589576.1|  Early nodulin                                      300   1e-93    
ref|XP_009152056.1|  PREDICTED: GDSL esterase/lipase At3g26430          300   1e-93    
emb|CDX83618.1|  BnaC07g23580D                                          299   2e-93    
ref|XP_006850822.1|  hypothetical protein AMTR_s00025p00126710          299   2e-93    
ref|XP_007140861.1|  hypothetical protein PHAVU_008G147700g             299   2e-93    
ref|XP_011071156.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    300   3e-93    
ref|XP_007019070.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    299   3e-93    
ref|XP_010682276.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     299   5e-93    
ref|XP_004300927.1|  PREDICTED: GDSL esterase/lipase At3g26430-like     298   6e-93    
gb|KDP26686.1|  hypothetical protein JCGZ_17844                         298   7e-93    
gb|AAA83209.1|  coil protein                                            296   8e-93    
gb|KEH22100.1|  GDSL-like lipase/acylhydrolase                          298   8e-93    
ref|XP_002888627.1|  hypothetical protein ARALYDRAFT_475890             297   9e-93    
ref|XP_007223054.1|  hypothetical protein PRUPE_ppa006965mg             298   9e-93    
ref|XP_009363153.1|  PREDICTED: esterase-like isoform X1                298   1e-92    
gb|EYU34753.1|  hypothetical protein MIMGU_mgv1a008002mg                297   1e-92    
ref|XP_006391214.1|  hypothetical protein EUTSA_v10018726mg             297   1e-92    
ref|XP_007141040.1|  hypothetical protein PHAVU_008G162300g             296   4e-92    
ref|XP_003545634.1|  PREDICTED: esterase-like isoform X1                296   5e-92    
ref|XP_002284922.1|  PREDICTED: GDSL esterase/lipase At1g54790          295   5e-92    
gb|KHG02510.1|  hypothetical protein F383_26287                         295   5e-92    
ref|XP_010278961.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     295   6e-92    
ref|XP_009105337.1|  PREDICTED: alpha-L-fucosidase 3                    295   6e-92    
ref|XP_007224325.1|  hypothetical protein PRUPE_ppa020425mg             295   7e-92    
gb|KFK41199.1|  hypothetical protein AALP_AA2G098300                    295   8e-92    
gb|KHG02509.1|  hypothetical protein F383_26286                         293   1e-91    
ref|XP_002284695.1|  PREDICTED: esterase                                295   1e-91    
ref|XP_009602454.1|  PREDICTED: GDSL esterase/lipase At1g54790          295   1e-91    
dbj|BAH00916.1|  unnamed protein product                                295   1e-91    
emb|CBI19019.3|  unnamed protein product                                295   2e-91    
gb|KHG01494.1|  Esterase                                                294   2e-91    
ref|XP_006471886.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    294   2e-91    
ref|XP_004302457.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    294   2e-91    
gb|EAY97978.1|  hypothetical protein OsI_19897                          294   2e-91    
ref|XP_011008211.1|  PREDICTED: esterase-like                           294   3e-91    
gb|KDP32799.1|  hypothetical protein JCGZ_12091                         294   3e-91    
emb|CDY56207.1|  BnaAnng14060D                                          293   4e-91    
emb|CAN71345.1|  hypothetical protein VITISV_024250                     293   4e-91    
ref|XP_009420985.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     293   5e-91    
sp|Q7Y1X1.1|EST_HEVBR  RecName: Full=Esterase; AltName: Full=Earl...    293   6e-91    
ref|XP_007141041.1|  hypothetical protein PHAVU_008G162300g             293   7e-91    
gb|EPS70495.1|  acetylcholinesterase                                    291   8e-91    
ref|XP_009359341.1|  PREDICTED: alpha-L-fucosidase 3-like               293   8e-91    
ref|XP_010025155.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    292   9e-91    
ref|XP_007030927.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    292   1e-90    
ref|XP_010938793.1|  PREDICTED: GDSL esterase/lipase At1g54790          292   1e-90    
ref|XP_006434193.1|  hypothetical protein CICLE_v10001435mg             292   1e-90    
ref|NP_001185228.1|  GDSL esterase/lipase                               291   2e-90    
ref|XP_009773596.1|  PREDICTED: GDSL esterase/lipase At1g54790          291   2e-90    
ref|XP_010664210.1|  PREDICTED: esterase-like                           292   2e-90    
emb|CDP17963.1|  unnamed protein product                                291   2e-90    
ref|XP_007030926.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    291   3e-90    
emb|CCG48014.1|  conserved hypothetical protein, expressed              291   3e-90    
ref|XP_009123458.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    291   4e-90    
emb|CDY01865.1|  BnaC06g29050D                                          290   4e-90    
emb|CDX71574.1|  BnaC04g18090D                                          291   4e-90    
emb|CBI19020.3|  unnamed protein product                                291   4e-90    
ref|XP_008812793.1|  PREDICTED: GDSL esterase/lipase At1g54790          290   5e-90    
ref|XP_010999386.1|  PREDICTED: esterase-like                           290   5e-90    
ref|XP_009405865.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     290   5e-90    
ref|XP_003589586.1|  Enod8.3                                            290   6e-90    
ref|XP_004494637.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    290   7e-90    
ref|XP_010025156.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    290   9e-90    
ref|XP_010278953.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     290   9e-90    
ref|XP_004230167.1|  PREDICTED: GDSL esterase/lipase At1g54790          290   1e-89    
ref|XP_007224356.1|  hypothetical protein PRUPE_ppa020848mg             290   1e-89    
ref|XP_010044561.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    290   1e-89    
ref|XP_004292695.1|  PREDICTED: esterase-like                           290   1e-89    
ref|XP_010414921.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    289   2e-89    
ref|XP_009127580.1|  PREDICTED: alpha-L-fucosidase 3-like               288   2e-89    
ref|XP_006392486.1|  hypothetical protein EUTSA_v10023524mg             289   2e-89    
ref|XP_002299380.2|  early nodulin 8 precursor family protein           289   2e-89    
ref|XP_010414922.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    289   3e-89    
ref|XP_010511213.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    288   4e-89    
ref|XP_006361875.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     288   5e-89    
ref|XP_003626963.1|  GDSL esterase/lipase                               286   7e-89    
gb|KHN27566.1|  GDSL esterase/lipase                                    286   7e-89    
emb|CAN82038.1|  hypothetical protein VITISV_033903                     287   8e-89    
emb|CDY32569.1|  BnaC02g17620D                                          289   9e-89    
dbj|BAJ89757.1|  predicted protein                                      287   9e-89    
gb|KHN27567.1|  GDSL esterase/lipase                                    286   9e-89    
ref|XP_004302456.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    287   9e-89    
ref|XP_002319556.2|  hypothetical protein POPTR_0013s02730g             287   1e-88    
emb|CDY12671.1|  BnaA02g13390D                                          289   1e-88    
dbj|BAJ97846.1|  predicted protein                                      287   1e-88    
ref|XP_008455063.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    286   2e-88    
gb|AET01439.2|  GDSL-like lipase/acylhydrolase                          285   2e-88    
ref|XP_006654372.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    286   2e-88    
ref|XP_010025157.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    289   2e-88    
ref|XP_002307434.1|  early nodulin 8 precursor family protein           286   2e-88    
gb|EMT24719.1|  GDSL esterase/lipase                                    286   2e-88    
ref|XP_002319029.2|  GDSL-motif lipase/hydrolase family protein         286   2e-88    
ref|XP_011099272.1|  PREDICTED: GDSL esterase/lipase At1g54790          286   2e-88    
ref|XP_006387516.1|  early nodulin 8 precursor family protein           286   3e-88    
ref|XP_004962147.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     285   5e-88    
ref|XP_006433175.1|  hypothetical protein CICLE_v10000365mg             296   6e-88    
ref|XP_009406457.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    285   7e-88    
ref|XP_004139194.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     285   7e-88    
ref|XP_006382647.1|  hypothetical protein POPTR_0005s04100g             285   8e-88    
ref|XP_011048918.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    285   8e-88    
ref|XP_010255795.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     285   8e-88    
ref|XP_004156431.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     285   9e-88    
ref|XP_011027532.1|  PREDICTED: esterase-like                           285   1e-87    
gb|KDP21506.1|  hypothetical protein JCGZ_21977                         285   1e-87    
ref|XP_006382646.1|  GDSL-motif lipase/hydrolase family protein         285   1e-87    
gb|KDO80652.1|  hypothetical protein CISIN_1g015153mg                   285   1e-87    
gb|KHG03048.1|  hypothetical protein F383_28241                         284   1e-87    
gb|KGN60869.1|  hypothetical protein Csa_2G020920                       284   1e-87    
ref|XP_004139196.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     284   1e-87    
gb|AFW77932.1|  hypothetical protein ZEAMMB73_209815                    284   1e-87    
ref|XP_004156429.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     284   1e-87    
gb|ABD32376.1|  Lipolytic enzyme, G-D-S-L                               284   1e-87    
ref|XP_002512338.1|  Alpha-L-fucosidase 2 precursor, putative           284   1e-87    
emb|CCG48013.1|  conserved hypothetical protein, expressed              284   2e-87    
ref|XP_007221845.1|  hypothetical protein PRUPE_ppa024482mg             284   2e-87    
ref|XP_008219728.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    301   2e-87    
ref|XP_011048917.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    284   3e-87    
gb|KHN33852.1|  Esterase                                                283   3e-87    
ref|XP_010546666.1|  PREDICTED: GDSL esterase/lipase At3g05180          283   3e-87    
ref|XP_011023543.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    283   4e-87    
ref|XP_007225083.1|  hypothetical protein PRUPE_ppa017577mg             283   6e-87    
gb|AFK34131.1|  unknown                                                 282   6e-87    
ref|XP_010255785.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    282   7e-87    
ref|XP_009406458.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    282   8e-87    
ref|XP_007226193.1|  hypothetical protein PRUPE_ppa015908mg             281   8e-87    
ref|XP_002513811.1|  Esterase precursor, putative                       282   9e-87    
emb|CBI32324.3|  unnamed protein product                                282   1e-86    
ref|XP_010652105.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     283   1e-86    
ref|XP_009335632.1|  PREDICTED: GDSL esterase/lipase At1g54790          281   1e-86    
ref|XP_011023542.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    281   1e-86    
ref|XP_008246517.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    281   1e-86    
ref|XP_004494638.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    281   1e-86    
ref|XP_011097367.1|  PREDICTED: GDSL esterase/lipase At5g14450-li...    280   1e-86    
ref|XP_010255784.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    282   1e-86    
ref|XP_004290869.1|  PREDICTED: esterase-like                           281   2e-86    
gb|AES82539.2|  GDSL-like lipase/acylhydrolase                          281   2e-86    
ref|XP_008246516.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    281   2e-86    
ref|XP_006473022.1|  PREDICTED: uncharacterized protein LOC102624203    295   2e-86    
gb|KDP23550.1|  hypothetical protein JCGZ_23383                         281   2e-86    
ref|XP_003626321.1|  GDSL esterase/lipase                               284   2e-86    
ref|XP_002894604.1|  hypothetical protein ARALYDRAFT_474754             281   2e-86    
ref|NP_564668.1|  GDSL esterase/lipase                                  281   2e-86    
ref|XP_010100369.1|  GDSL esterase/lipase                               293   3e-86    
ref|XP_008455108.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     283   3e-86    
ref|XP_007141047.1|  hypothetical protein PHAVU_008G162800g             281   3e-86    
ref|XP_004292697.1|  PREDICTED: esterase-like                           281   4e-86    
gb|AAM61525.1|  early nodule-specific protein, putative                 280   4e-86    
ref|XP_010256199.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     280   5e-86    
gb|EPS58572.1|  hypothetical protein M569_16239                         280   5e-86    
ref|XP_010089184.1|  GDSL esterase/lipase                               280   6e-86    
ref|XP_010242790.1|  PREDICTED: esterase-like isoform X2                279   6e-86    
ref|XP_008370518.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     280   8e-86    
ref|XP_010664903.1|  PREDICTED: uncharacterized protein LOC100262628    294   9e-86    
gb|KHN25211.1|  Esterase                                                278   1e-85    
ref|XP_010111858.1|  GDSL esterase/lipase                               279   2e-85    
ref|XP_003544687.2|  PREDICTED: esterase-like                           280   3e-85    
ref|XP_002524808.1|  Alpha-L-fucosidase 2 precursor, putative           279   3e-85    
ref|XP_010675009.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    277   7e-85    
ref|XP_007147074.1|  hypothetical protein PHAVU_006G094100g             277   9e-85    
ref|XP_002513813.1|  Esterase precursor, putative                       276   1e-84    
ref|XP_002300989.2|  hypothetical protein POPTR_0002s08430g             277   1e-84    
ref|XP_002513810.1|  Esterase precursor, putative                       276   1e-84    
ref|XP_009123459.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    276   1e-84    
gb|KHG16970.1|  hypothetical protein F383_21767                         276   1e-84    
ref|XP_010553740.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    276   2e-84    
ref|XP_010675010.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    276   2e-84    
ref|XP_003566260.1|  PREDICTED: GDSL esterase/lipase At1g54790          276   2e-84    
gb|KHG21223.1|  hypothetical protein F383_05901                         277   2e-84    
ref|XP_008388596.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    276   2e-84    
ref|XP_008388597.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    275   3e-84    
ref|XP_003589577.1|  Early nodulin                                      275   4e-84    
ref|XP_003554666.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    273   1e-83    
ref|XP_009373966.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    273   2e-83    
ref|XP_010553741.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    273   2e-83    
ref|XP_007207217.1|  hypothetical protein PRUPE_ppa001667mg             284   2e-83    
gb|KCW86649.1|  hypothetical protein EUGRSUZ_B03276                     271   3e-83    
ref|XP_006302395.1|  hypothetical protein CARUB_v10020463mg             273   4e-83    
ref|XP_003554667.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    272   4e-83    
ref|XP_006577255.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    272   4e-83    
ref|XP_009373965.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    272   5e-83    
ref|XP_006577256.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    272   5e-83    
gb|KHG09761.1|  hypothetical protein F383_12143                         272   6e-83    
ref|XP_010414923.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    272   6e-83    
gb|KHN33853.1|  Esterase                                                272   6e-83    
ref|XP_010511214.1|  PREDICTED: GDSL esterase/lipase At1g54790 is...    271   1e-82    
ref|XP_004163919.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     271   1e-82    
ref|XP_007050689.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    271   1e-82    
ref|XP_008345621.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    271   2e-82    
gb|ACU22979.1|  unknown                                                 271   2e-82    
ref|XP_009617585.1|  PREDICTED: GDSL esterase/lipase At5g14450-like     268   2e-82    
ref|XP_010070070.1|  PREDICTED: GDSL esterase/lipase At1g09390          270   3e-82    
ref|XP_008455044.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     271   3e-82    
ref|XP_008455055.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    270   3e-82    
ref|XP_010090352.1|  GDSL esterase/lipase                               280   4e-82    
ref|XP_004150835.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     269   6e-82    
gb|KEH22103.1|  GDSL-like lipase/acylhydrolase                          267   6e-82    
ref|XP_003591059.1|  GDSL esterase/lipase                               268   1e-81    
emb|CDY01858.1|  BnaC06g28980D                                          267   1e-81    
ref|XP_003536096.1|  PREDICTED: GDSL esterase/lipase At1g54790-li...    268   2e-81    
gb|KDO68828.1|  hypothetical protein CISIN_1g046546mg                   267   2e-81    
ref|XP_006480105.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     267   3e-81    
ref|NP_974029.1|  GDSL esterase/lipase                                  268   5e-81    
ref|XP_010913036.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    268   6e-81    
ref|XP_004139365.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     266   2e-80    
gb|ACU17816.1|  unknown                                                 265   2e-80    
gb|KCW55934.1|  hypothetical protein EUGRSUZ_I01728                     266   2e-80    
ref|XP_010674543.1|  PREDICTED: GDSL esterase/lipase At1g09390          263   1e-79    
ref|XP_004156481.1|  PREDICTED: GDSL esterase/lipase At1g54790-like     263   2e-79    
ref|XP_002301566.1|  hypothetical protein POPTR_0002s22450g             263   2e-79    
ref|XP_007159697.1|  hypothetical protein PHAVU_002G259500g             260   3e-79    
ref|XP_010914676.1|  PREDICTED: GDSL esterase/lipase LIP-4-like         261   5e-79    
ref|XP_010044560.1|  PREDICTED: GDSL esterase/lipase At3g26430-li...    260   6e-79    
ref|XP_006395556.1|  hypothetical protein EUTSA_v10004667mg             259   7e-79    
ref|XP_006595232.1|  PREDICTED: uncharacterized protein LOC100779421    272   7e-79    
ref|XP_006841596.1|  hypothetical protein AMTR_s00003p00205650          261   7e-79    
ref|XP_006382645.1|  hypothetical protein POPTR_0005s04100g             261   9e-79    
ref|XP_011010771.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    261   1e-78    
ref|XP_008447456.1|  PREDICTED: GDSL esterase/lipase At1g09390-like     261   1e-78    



>ref|XP_008230605.1| PREDICTED: GDSL esterase/lipase At3g27950 [Prunus mume]
Length=377

 Score =   423 bits (1088),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 220/347 (63%), Positives = 264/347 (76%), Gaps = 16/347 (5%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPAVYNFGDSNSDTG  SAA+ EV PPNGE+FFG PSGR+ DGRL+IDFIAE L L
Sbjct  33    RSCGFPAVYNFGDSNSDTGAISAAISEVPPPNGESFFGHPSGRFSDGRLIIDFIAEKLQL  92

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             PYL+ YLDS+GT+FRHGANFAT GSSI PGGYSPF L IQ+SQFI+FK  +I LY +L+ 
Sbjct  93    PYLSPYLDSLGTNFRHGANFATGGSSIRPGGYSPFHLGIQLSQFIRFKSHSIALYKQLSS  152

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
               +     LPRPE+FSK+LYTFDIGQNDL++G Q+  V +   SIP I+++ SQA+ QLY
Sbjct  153   NRR-----LPRPEDFSKALYTFDIGQNDLAYGLQHGTVEEVRASIPAILNQLSQAISQLY  207

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR FW+HNTGP GCLP SV Y++    N+D++GC    N VAQEFNRQLK  V +LR
Sbjct  208   KEGARFFWVHNTGPDGCLPYSVIYDQSKPVNLDQSGCVMPLNEVAQEFNRQLKDSVSRLR  267

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
             ++L  AVFT V +YSAKYA++SNA S GF DPF FCC         CGK K + N TVYG
Sbjct  268   SELPLAVFTYVAVYSAKYALISNAKSQGFVDPFDFCCGSYYGYHIDCGK-KAIVNGTVYG  326

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             +PC +PSRHISWDG+HYS+AANL++A  I+  GSFS+PP  V EACR
Sbjct  327   NPCKNPSRHISWDGIHYSQAANLLIAERIL-NGSFSNPPVSVTEACR  372



>emb|CDP02115.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   422 bits (1086),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 215/348 (62%), Positives = 267/348 (77%), Gaps = 13/348 (4%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             + C FPA+YNFGDSNSDTGGRSA+L  V PPNGETFF  PSGR+CDGRL+IDF+AE LGL
Sbjct  36    KSCKFPALYNFGDSNSDTGGRSASLDMVAPPNGETFFKAPSGRFCDGRLIIDFMAEELGL  95

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKL--  465
             PYL+AYLDSIG++FRHGANFAT GSSI PGGYSPF L +QI QF+QFK RT  LY +L  
Sbjct  96    PYLSAYLDSIGSNFRHGANFATGGSSIRPGGYSPFHLQLQIGQFLQFKSRTTLLYKELNH  155

Query  466   AGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ  645
             +  +   +  LPRP++FS +LYTFDIGQNDL++GF++++ ++T +SIP ++DK  +A++Q
Sbjct  156   SAKSPPLQSRLPRPQDFSDALYTFDIGQNDLAYGFEHTSEAETRESIPSMLDKLGEAIHQ  215

Query  646   LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlq  825
             LY  GARNFW+HNTGPIGCLP SV Y      N+D NGC    N+VAQEFN QL+ +VLQ
Sbjct  216   LYKAGARNFWVHNTGPIGCLPYSVIYYLPKPRNLDGNGCVEPQNKVAQEFNEQLRRKVLQ  275

Query  826   lraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETV  978
             LRAQL  A FT VDMYSAKY+++SNA   GF+DP  FCC         CG+ K + N TV
Sbjct  276   LRAQLPAAAFTYVDMYSAKYSLISNAKKLGFEDPSQFCCGSYYGYHIGCGE-KAIVNGTV  334

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             YG+PC +PS HISWDG+HYSEAAN +LA++++  GS +DP   V EAC
Sbjct  335   YGNPCPNPSEHISWDGIHYSEAANALLAKTVL-DGSLADPKVSVGEAC  381



>ref|XP_006446489.1| hypothetical protein CICLE_v10015583mg [Citrus clementina]
 gb|ESR59729.1| hypothetical protein CICLE_v10015583mg [Citrus clementina]
Length=384

 Score =   422 bits (1084),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 220/353 (62%), Positives = 266/353 (75%), Gaps = 13/353 (4%)
 Frame = +1

Query  97    GGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIA  276
             GG   + C FPAVYNFGDSNSDTGG SAA+ +V PPNGE+FFG PSGR+CDGRL+ID IA
Sbjct  28    GGASLKGCGFPAVYNFGDSNSDTGGISAAMTQVPPPNGESFFGHPSGRFCDGRLIIDLIA  87

Query  277   ENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             E + LPYL+ YLDS+GT+FR+GANFAT GSSI PGG+SPF L IQISQFIQFK RT  +Y
Sbjct  88    EKVKLPYLSPYLDSVGTNFRNGANFATGGSSIRPGGFSPFHLGIQISQFIQFKSRTSAVY  147

Query  457   NKLAG--TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
             N+L+   T   +K  LPRP +FSK+LYTFDIGQNDL++GFQ++N  Q   SIP I+ +FS
Sbjct  148   NQLSPNRTTPPFKSNLPRPRDFSKALYTFDIGQNDLAYGFQHTNEEQVRASIPDILSQFS  207

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
             +A++QLY EGAR FWIHNTGPIGCLP SV Y+K   NN+D++GC    N +AQEFNRQLK
Sbjct  208   KAVHQLYKEGARFFWIHNTGPIGCLPYSVIYDKSKPNNLDQSGCVKPQNEMAQEFNRQLK  267

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKM  963
              +V QLR QL    FT VD+YS KYA++SNA + GF DP  FCC         CGK K  
Sbjct  268   DKVSQLRLQLPYGAFTYVDVYSVKYALISNAQNQGFVDPMNFCCGSYYGYHIDCGK-KAT  326

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              N TVYG+PC  PS+HISWDG+HYS+AANL +A  I+  GSFS+PP  + + C
Sbjct  327   VNGTVYGNPCHHPSKHISWDGIHYSQAANLWVANRIL-NGSFSNPPVSIEQVC  378



>ref|XP_007216369.1| hypothetical protein PRUPE_ppa019167mg, partial [Prunus persica]
 gb|EMJ17568.1| hypothetical protein PRUPE_ppa019167mg, partial [Prunus persica]
Length=357

 Score =   419 bits (1078),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 262/347 (76%), Gaps = 16/347 (5%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA+YNFGDSNSDTG  SAA+ EV PPNGE+FFG PSGR+ DGRL+IDFIAE L L
Sbjct  13    RSCGFPAIYNFGDSNSDTGAISAAISEVPPPNGESFFGHPSGRFSDGRLIIDFIAEKLQL  72

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             PYL+ YLDS+GT+FRHGANFAT GSSI PGGYSPF L IQ+SQFI+FK ++  LY +L+ 
Sbjct  73    PYLSPYLDSLGTNFRHGANFATGGSSIRPGGYSPFHLGIQLSQFIRFKSQSFALYKQLSS  132

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
               +     LPRPE+FSK+LYTFDIGQNDL++G Q+  V +   SIP I+   SQA+ QLY
Sbjct  133   NRR-----LPRPEDFSKALYTFDIGQNDLAYGLQHGTVEEVRASIPAILSHLSQAISQLY  187

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR FW+H+TGP GCLP SV Y++    N+D++GC    N VAQEFNRQLK  V +LR
Sbjct  188   KEGARFFWVHDTGPHGCLPYSVIYDQSKPVNLDQSGCVKPLNEVAQEFNRQLKDSVSRLR  247

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
             ++L  AVFT VD+YSAKYA++SNA S GF DPF FCC         CGK K + N TVYG
Sbjct  248   SELPLAVFTYVDVYSAKYALISNAKSQGFVDPFDFCCGSYYGYHVDCGK-KAIVNGTVYG  306

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             +PC +PSRHISWDG+HYS+AANL++A  I+  GSFS+PP  V E CR
Sbjct  307   NPCKNPSRHISWDGIHYSQAANLLIAERIL-NGSFSNPPVSVTEVCR  352



>ref|XP_007031463.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007031464.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY02389.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY02390.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
Length=384

 Score =   419 bits (1078),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 224/381 (59%), Positives = 274/381 (72%), Gaps = 16/381 (4%)
 Frame = +1

Query  16    EIWKRILVFEmmlmslglmgclVNGIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEV  195
             E WK    F +++  L      V   GG L    C FPA+YNFGDSNSDTGG SAA  E+
Sbjct  4     ESWKLFYTFGILVFGLAAQWAAVKSDGGSL---SCGFPAIYNFGDSNSDTGGISAAFTEI  60

Query  196   RPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSIL  375
              PPNGETFFG P+GR CDGRL+IDFIAENL LPYL+AYLDS+GT+FRHGANFAT GSSI 
Sbjct  61    PPPNGETFFGHPAGRACDGRLIIDFIAENLQLPYLSAYLDSVGTNFRHGANFATGGSSIR  120

Query  376   PGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDV--LPRPEEFSKSLYTFDIGQ  549
             P GYSPF L +QISQFIQFK RT  LYN+L+ + ++   +  LPRP EFS++LYTFDIGQ
Sbjct  121   PPGYSPFNLGVQISQFIQFKARTTALYNQLSLSRRIPVTISNLPRPAEFSQALYTFDIGQ  180

Query  550   NDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNK  729
             NDL+HGFQ +  +Q   SIP I+ + SQA++ LY EGAR FW+HNTGP+GCLP +V ++K
Sbjct  181   NDLAHGFQVTTENQVRASIPNIIGQLSQAIHLLYKEGARFFWVHNTGPLGCLPYNVLHDK  240

Query  730   DNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGS  909
                  +DKNGC    N VA EFNRQLK ++ +LR QL  A FT VD+YSAKY ++S+A +
Sbjct  241   SKPGILDKNGCVKPLNEVAMEFNRQLKDKISRLRTQLPFAKFTYVDVYSAKYGLISSAKT  300

Query  910   HGFQDPFTFCC---------CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILA  1062
              G+ DP  FCC         CGK K + N TVYGDPC+ PSRHISWDG+HYS+AAN+ +A
Sbjct  301   LGYVDPVNFCCGSFYGNHINCGK-KAIVNGTVYGDPCNHPSRHISWDGIHYSQAANMWVA  359

Query  1063  RSIMYGGSFSDPPRPVAEACR  1125
               I+  GS SDPP P+ +AC 
Sbjct  360   DRIL-NGSLSDPPVPIQDACH  379



>ref|XP_006470339.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Citrus sinensis]
 gb|KDO66203.1| hypothetical protein CISIN_1g016732mg [Citrus sinensis]
Length=384

 Score =   419 bits (1078),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 219/353 (62%), Positives = 266/353 (75%), Gaps = 13/353 (4%)
 Frame = +1

Query  97    GGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIA  276
             GG   + C FPAVYNFGDSNSDTGG SAA+ +V PPNGE+FFG PSGR+CDGRL+ID IA
Sbjct  28    GGASLKGCGFPAVYNFGDSNSDTGGISAAMTQVPPPNGESFFGHPSGRFCDGRLIIDLIA  87

Query  277   ENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             E + LPYL+ YLDS+GT+FR+GANFAT GSSI PGG+SPF L IQISQFIQFK RT  +Y
Sbjct  88    EKVKLPYLSPYLDSVGTNFRNGANFATGGSSIRPGGFSPFHLGIQISQFIQFKSRTSAVY  147

Query  457   NKLAG--TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
             N+L+   T   +K  LPRP +FSK+LYTFDIGQNDL++GFQ++N  Q   SIP I+ +FS
Sbjct  148   NQLSPNRTTPPFKSNLPRPRDFSKALYTFDIGQNDLAYGFQHTNEEQVRASIPDILSQFS  207

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
             +A++QLY EGAR FWIHNTGPIGCLP SV Y+K   NN+D++GC    N +AQEFNRQLK
Sbjct  208   KAVHQLYKEGARFFWIHNTGPIGCLPYSVIYDKSKPNNLDQSGCVKPQNEMAQEFNRQLK  267

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKM  963
              +V QLR QL    FT VD+YS KYA++SNA + GF DP  FCC         CGK K  
Sbjct  268   DKVSQLRLQLPYGAFTYVDVYSVKYALISNAQNQGFVDPMNFCCGSFYGYHIDCGK-KAT  326

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              N TVYG+PC  PS++ISWDG+HYS+AANL +A  I+  GSFS+PP  + + C
Sbjct  327   VNGTVYGNPCHHPSKYISWDGIHYSQAANLWVANRIL-NGSFSNPPVSIEQVC  378



>ref|XP_004142359.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Cucumis sativus]
 gb|KGN52374.1| hypothetical protein Csa_5G630770 [Cucumis sativus]
Length=381

 Score =   418 bits (1075),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 217/350 (62%), Positives = 265/350 (76%), Gaps = 15/350 (4%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA+YNFGDSNSDTGG SAAL  ++PPNGETFFG PSGR CDGRL+IDFIAE L L
Sbjct  30    RTCGFPAIYNFGDSNSDTGGISAALNAIQPPNGETFFGHPSGRACDGRLIIDFIAEKLKL  89

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             PYL+AYLDS+GTSFRHGANFAT GSSI PGGYSPF L IQ+SQFIQFK RT +LYN+L  
Sbjct  90    PYLSAYLDSLGTSFRHGANFATGGSSIRPGGYSPFHLGIQVSQFIQFKSRTTDLYNRLRS  149

Query  472   --TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ  645
                  +  + + RP+EFSK+LYTFDIGQNDL++G+Q+S+  Q   SIP I+D F +A+ Q
Sbjct  150   RIRTSIPIEHIARPQEFSKALYTFDIGQNDLAYGYQHSSEEQVRASIPDILDAFCEAVQQ  209

Query  646   LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlq  825
             LY EGAR FW+HNTGPIGCLP S+ YNK   N  D NGC  + N V++EFNRQLK+++L+
Sbjct  210   LYKEGARYFWVHNTGPIGCLPYSILYNKSPENR-DSNGCVKSQNTVSREFNRQLKSQLLK  268

Query  826   lraqlqqavFTVVDMYSAKYAVVSNAGSHGF-QDPFTFCC---------CGKNKKMANET  975
             L  +L  A    VD+YS KY +++ A + GF ++P  FCC         CGK +++ N T
Sbjct  269   LGKKLPFARIIHVDVYSVKYLLITKAKTQGFVKNPVKFCCGSYYGYHIDCGK-REVVNGT  327

Query  976   VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             VYG+PC DPSRHISWDG+HYSEAANL +A  I+  GSFSDPP PV +AC+
Sbjct  328   VYGNPCEDPSRHISWDGIHYSEAANLWIANHIL-NGSFSDPPLPVDKACQ  376



>ref|XP_004159075.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Cucumis sativus]
Length=381

 Score =   418 bits (1075),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 217/350 (62%), Positives = 265/350 (76%), Gaps = 15/350 (4%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA+YNFGDSNSDTGG SAAL  ++PPNGETFFG PSGR CDGRL+IDFIAE L L
Sbjct  30    RTCGFPAIYNFGDSNSDTGGISAALNAIQPPNGETFFGHPSGRACDGRLIIDFIAEKLKL  89

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             PYL+AYLDS+GTSFRHGANFAT GSSI PGGYSPF L IQ+SQFIQFK RT +LYN+L  
Sbjct  90    PYLSAYLDSLGTSFRHGANFATGGSSIRPGGYSPFHLGIQVSQFIQFKSRTTDLYNRLRS  149

Query  472   --TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ  645
                  +  + + RP+EFSK+LYTFDIGQNDL++G+Q+S+  Q   SIP I+D F +A+ Q
Sbjct  150   RIRTSIPIEHIARPQEFSKALYTFDIGQNDLAYGYQHSSEEQVRASIPDILDAFCEAVQQ  209

Query  646   LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlq  825
             LY EGAR FW+HNTGPIGCLP S+ YNK   N  D NGC  + N V++EFNRQLK+++L+
Sbjct  210   LYKEGARYFWVHNTGPIGCLPYSILYNKSPENR-DSNGCVKSQNTVSREFNRQLKSQLLK  268

Query  826   lraqlqqavFTVVDMYSAKYAVVSNAGSHGF-QDPFTFCC---------CGKNKKMANET  975
             L  +L  A    VD+YS KY +++ A + GF ++P  FCC         CGK +++ N T
Sbjct  269   LGKKLPFARIIHVDVYSVKYLLITKAKTQGFVKNPVKFCCGSYYGYHIDCGK-REVVNGT  327

Query  976   VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             VYG+PC DPSRHISWDG+HYSEAANL +A  I+  GSFSDPP PV +AC+
Sbjct  328   VYGNPCEDPSRHISWDGIHYSEAANLWIANHIL-NGSFSDPPLPVDKACQ  376



>emb|CBI34924.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   416 bits (1070),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 219/357 (61%), Positives = 266/357 (75%), Gaps = 13/357 (4%)
 Frame = +1

Query  88    GIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVID  267
             G+ GG   RRC FPA++NFGDSNSDTGGRSAA+ EV  PNGETFFGK SGR+CDGRL++D
Sbjct  23    GVMGGHGPRRCSFPAIFNFGDSNSDTGGRSAAISEVFLPNGETFFGKASGRFCDGRLILD  82

Query  268   FIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTI  447
             FI+E LGLPYLNAYLDS+GT+F HGANFAT GSSI PGGYSPF L+IQ++QF +FK +T 
Sbjct  83    FISETLGLPYLNAYLDSMGTNFWHGANFATGGSSIRPGGYSPFHLEIQLAQFKRFKSQTT  142

Query  448   ELYNKLAG--TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMD  621
              L+ +L    T   +K  +PRP +FSK+LYT DIGQNDL++GFQ++N  + L SIP I++
Sbjct  143   ALFLQLNHNCTTAPFKSEVPRPRDFSKALYTIDIGQNDLAYGFQHTNEEKVLASIPDILN  202

Query  622   KFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNr  801
               S  ++QLY EG R FWIHNTGPIGCLP SV Y +    N+D+ GC   HN+VAQEFN+
Sbjct  203   VLSGVVHQLYEEGGRTFWIHNTGPIGCLPYSVIYYQQKPRNLDRYGCVKPHNKVAQEFNK  262

Query  802   qlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKN  954
             QLK  V++LRAQL  A FT VD+YS KY++VS A   GF D   FCC         CG+ 
Sbjct  263   QLKDMVIKLRAQLPHAEFTYVDVYSVKYSLVSQAKDLGFVDLMNFCCGSYYGYHVECGQ-  321

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K + N TVYG PC  PSRHISWDG HYSEAAN  +A++I+  GSFSDPP PV+EAC 
Sbjct  322   KAVVNGTVYGIPCEHPSRHISWDGTHYSEAANEWVAKAIL-NGSFSDPPIPVSEACH  377



>ref|XP_002274412.3| PREDICTED: GDSL esterase/lipase At3g27950 [Vitis vinifera]
Length=388

 Score =   417 bits (1071),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 219/357 (61%), Positives = 266/357 (75%), Gaps = 13/357 (4%)
 Frame = +1

Query  88    GIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVID  267
             G+ GG   RRC FPA++NFGDSNSDTGGRSAA+ EV  PNGETFFGK SGR+CDGRL++D
Sbjct  33    GVMGGHGPRRCSFPAIFNFGDSNSDTGGRSAAISEVFLPNGETFFGKASGRFCDGRLILD  92

Query  268   FIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTI  447
             FI+E LGLPYLNAYLDS+GT+F HGANFAT GSSI PGGYSPF L+IQ++QF +FK +T 
Sbjct  93    FISETLGLPYLNAYLDSMGTNFWHGANFATGGSSIRPGGYSPFHLEIQLAQFKRFKSQTT  152

Query  448   ELYNKLAG--TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMD  621
              L+ +L    T   +K  +PRP +FSK+LYT DIGQNDL++GFQ++N  + L SIP I++
Sbjct  153   ALFLQLNHNCTTAPFKSEVPRPRDFSKALYTIDIGQNDLAYGFQHTNEEKVLASIPDILN  212

Query  622   KFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNr  801
               S  ++QLY EG R FWIHNTGPIGCLP SV Y +    N+D+ GC   HN+VAQEFN+
Sbjct  213   VLSGVVHQLYEEGGRTFWIHNTGPIGCLPYSVIYYQQKPRNLDRYGCVKPHNKVAQEFNK  272

Query  802   qlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKN  954
             QLK  V++LRAQL  A FT VD+YS KY++VS A   GF D   FCC         CG+ 
Sbjct  273   QLKDMVIKLRAQLPHAEFTYVDVYSVKYSLVSQAKDLGFVDLMNFCCGSYYGYHVECGQ-  331

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K + N TVYG PC  PSRHISWDG HYSEAAN  +A++I+  GSFSDPP PV+EAC 
Sbjct  332   KAVVNGTVYGIPCEHPSRHISWDGTHYSEAANEWVAKAIL-NGSFSDPPIPVSEACH  387



>ref|XP_006421383.1| hypothetical protein CICLE_v10005152mg [Citrus clementina]
 gb|ESR34623.1| hypothetical protein CICLE_v10005152mg [Citrus clementina]
Length=384

 Score =   416 bits (1068),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 264/353 (75%), Gaps = 13/353 (4%)
 Frame = +1

Query  97    GGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIA  276
             GG   + C FPAVYNFGDSNSDTGG SAA+ +V  PNGE+FFG PSGR+CDGRL+ID IA
Sbjct  28    GGASLKGCGFPAVYNFGDSNSDTGGISAAMTQVPSPNGESFFGHPSGRFCDGRLIIDLIA  87

Query  277   ENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             E + LPYL+ YLDS+GT+FR+GANFAT GSSI PGG+SPF L IQISQFIQFK RT  +Y
Sbjct  88    EKVKLPYLSPYLDSVGTNFRNGANFATGGSSIRPGGFSPFHLGIQISQFIQFKSRTSAVY  147

Query  457   NKLA--GTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
             N+L+   T   +K  LPRP +FSK+LYTFDIGQNDL++GFQ++N  Q   SIP ++ +FS
Sbjct  148   NQLSPNRTTPPFKSNLPRPRDFSKALYTFDIGQNDLAYGFQHTNEEQVRASIPDLLSQFS  207

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
             +A++QLY EG R FWIHNTGPIGCLP SV Y+K   NN+D++GC    N +AQEFNRQLK
Sbjct  208   KAVHQLYKEGERFFWIHNTGPIGCLPYSVIYDKSKPNNLDQSGCVKPQNEMAQEFNRQLK  267

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKM  963
              +V QLR QL    FT VD+YS KYA++SNA + GF DP  FCC         CGK K  
Sbjct  268   DKVSQLRLQLPYGAFTYVDVYSVKYALISNAQNQGFVDPMNFCCGCYYGYHIDCGK-KAT  326

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              N TVYG+PC  PS+HISWDG+HYS+AANL +A  I+  GSFS+PP  + + C
Sbjct  327   VNGTVYGNPCHHPSKHISWDGIHYSQAANLWVANRIL-NGSFSNPPVSIEQVC  378



>ref|XP_008458756.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Cucumis melo]
 ref|XP_008458757.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Cucumis melo]
Length=381

 Score =   415 bits (1067),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 217/348 (62%), Positives = 264/348 (76%), Gaps = 15/348 (4%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAAL  ++PPNGETFFG PSGR CDGRL+IDFIAE L LPY
Sbjct  32    CGFPAIYNFGDSNSDTGGISAALNAIQPPNGETFFGHPSGRACDGRLIIDFIAEKLKLPY  91

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+AYLDSIGTSFRHGANFAT GSSI PGGYSPF L IQ+SQFIQFK RT +L+N+L   N
Sbjct  92    LSAYLDSIGTSFRHGANFATGGSSIRPGGYSPFHLGIQVSQFIQFKSRTTDLFNRLRSHN  151

Query  478   QVYKDV--LPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
             +    +  + RP+EFSK+LYTFDIGQNDL++G+Q+S+  Q   SIP I+D F +A+ QLY
Sbjct  152   RTAIPIKHIARPQEFSKALYTFDIGQNDLAYGYQHSSEEQVRASIPDILDTFCEAVQQLY  211

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR FW+HNTGPIGCLP S+ YNK   N  D +GC  + N V++EFNRQLK+++L+LR
Sbjct  212   KEGARYFWVHNTGPIGCLPYSILYNKSPENR-DSSGCVKSQNTVSREFNRQLKSQLLKLR  270

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGF-QDPFTFCC---------CGKNKKMANETVY  981
              +L  A    VDMYS KY +++ A S GF ++P  FCC         CGK +++ N TVY
Sbjct  271   KKLPFARIVHVDMYSVKYLLITKAKSQGFVKNPVKFCCGSYYGYHIDCGK-REVVNGTVY  329

Query  982   GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             G+PC DPSR ISWDG+HYSEAAN  +A  I+  GSFSDPP PV +AC+
Sbjct  330   GNPCEDPSRQISWDGIHYSEAANSWIANHIL-DGSFSDPPLPVDKACQ  376



>ref|XP_010029184.1| PREDICTED: GDSL esterase/lipase At3g27950 isoform X2 [Eucalyptus 
grandis]
 gb|KCW56032.1| hypothetical protein EUGRSUZ_I01796 [Eucalyptus grandis]
Length=383

 Score =   414 bits (1063),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 216/346 (62%), Positives = 267/346 (77%), Gaps = 13/346 (4%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C F A++NFGDSNSDTG  SAAL EV  PNGETFFG PSGR+CDGRL+IDFIAE+L LPY
Sbjct  34    CEFSAIFNFGDSNSDTGAISAALSEVAAPNGETFFGHPSGRFCDGRLIIDFIAEDLKLPY  93

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+AYLDSI T+FRHGANFAT GSSI PGGYSPF L IQ+SQF++FK R  ELYN+L  +N
Sbjct  94    LSAYLDSIETNFRHGANFATGGSSIRPGGYSPFHLGIQLSQFVRFKSRITELYNQLNQSN  153

Query  478   Q--VYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
             +   +   LPRP++FSK+LYTFDIGQNDL++GFQ++   Q + SIP I+++FS+A++QLY
Sbjct  154   KASTFSYRLPRPQDFSKALYTFDIGQNDLAYGFQHTTGEQVIASIPDILNQFSRAVHQLY  213

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR FW+HNTGPIGCLP ++ Y+K    N+D+ GC    N VA++FN+QLK R+LQLR
Sbjct  214   EEGARVFWVHNTGPIGCLPYNIIYDKSKPGNLDRYGCVRPQNEVAKDFNKQLKDRILQLR  273

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
             AQL  AVFT VD+YSAKY+++S A   GF DP +FCC         CGK K + N TVYG
Sbjct  274   AQLSAAVFTYVDVYSAKYSLISEAKDQGFVDPSSFCCGSYYGFHIDCGK-KAIVNGTVYG  332

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             +PC DPS+HISWDG+HYSEAAN  LA  I+ GGSFS P   + ++C
Sbjct  333   NPCEDPSKHISWDGIHYSEAANKWLASRIL-GGSFSHPAVSIRKSC  377



>ref|XP_010029183.1| PREDICTED: GDSL esterase/lipase At3g27950 isoform X1 [Eucalyptus 
grandis]
 gb|KCW56031.1| hypothetical protein EUGRSUZ_I01796 [Eucalyptus grandis]
Length=384

 Score =   410 bits (1055),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 215/347 (62%), Positives = 265/347 (76%), Gaps = 14/347 (4%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C F A++NFGDSNSDTG  SAAL EV  PNGETFFG PSGR+CDGRL+IDFIAE+L LPY
Sbjct  34    CEFSAIFNFGDSNSDTGAISAALSEVAAPNGETFFGHPSGRFCDGRLIIDFIAEDLKLPY  93

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+AYLDSI T+FRHGANFAT GSSI PGGYSPF L IQ+SQF++FK R  ELYN+L  + 
Sbjct  94    LSAYLDSIETNFRHGANFATGGSSIRPGGYSPFHLGIQLSQFVRFKSRITELYNQLNQST  153

Query  478   ---QVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
                  +   LPRP++FSK+LYTFDIGQNDL++GFQ++   Q + SIP I+++FS+A++QL
Sbjct  154   DKASTFSYRLPRPQDFSKALYTFDIGQNDLAYGFQHTTGEQVIASIPDILNQFSRAVHQL  213

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlql  828
             Y EGAR FW+HNTGPIGCLP ++ Y+K    N+D+ GC    N VA++FN+QLK R+LQL
Sbjct  214   YEEGARVFWVHNTGPIGCLPYNIIYDKSKPGNLDRYGCVRPQNEVAKDFNKQLKDRILQL  273

Query  829   raqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVY  981
             RAQL  AVFT VD+YSAKY+++S A   GF DP +FCC         CGK K + N TVY
Sbjct  274   RAQLSAAVFTYVDVYSAKYSLISEAKDQGFVDPSSFCCGSYYGFHIDCGK-KAIVNGTVY  332

Query  982   GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G+PC DPS+HISWDG+HYSEAAN  LA  I+ GGSFS P   + ++C
Sbjct  333   GNPCEDPSKHISWDGIHYSEAANKWLASRIL-GGSFSHPAVSIRKSC  378



>ref|XP_009334073.1| PREDICTED: GDSL esterase/lipase At3g27950 [Pyrus x bretschneideri]
Length=378

 Score =   410 bits (1053),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/344 (61%), Positives = 255/344 (74%), Gaps = 16/344 (5%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTG  SAA+ EV PPNGETFFGKPSGR  DGRL+IDFIAE + +PY
Sbjct  36    CRFPAIYNFGDSNSDTGAISAAISEVPPPNGETFFGKPSGRLSDGRLIIDFIAEKMQIPY  95

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+ YLDS+GT+FRHG NFAT+GSSI PGGYSPF L IQISQFI+FK R+I LY +L  T 
Sbjct  96    LSPYLDSLGTNFRHGVNFATSGSSIRPGGYSPFHLGIQISQFIRFKSRSIALYKQLQSTR  155

Query  478   QVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGE  657
             +     LPRPE+F K+LYTFDIGQNDL++G Q+  + +   SIP I+ + SQA+ QLY E
Sbjct  156   R-----LPRPEDFPKALYTFDIGQNDLAYGIQHGTIEEVRTSIPAILSQLSQAISQLYKE  210

Query  658   GARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlraq  837
             GAR FW+HNTGP GCLP SV Y+K    N+DK+GC    N VAQEFNRQLK  +++LR+Q
Sbjct  211   GARFFWVHNTGPQGCLPYSVIYDKSKPGNLDKSGCVKPLNAVAQEFNRQLKNSIMRLRSQ  270

Query  838   lqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYGDP  990
             L  A FT VD+YSAKY ++S+A   GF DPF FCC         CG+ K + N TVYG+P
Sbjct  271   LPLAAFTYVDVYSAKYTLISDAKKQGFVDPFDFCCGSYYGFHIDCGR-KAVVNGTVYGNP  329

Query  991   CSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             CS P+ HISWDG+HYS+AAN ++A  I+  GS S PP  +  AC
Sbjct  330   CSSPTTHISWDGIHYSQAANALIASRIL-NGSLSGPPVSITHAC  372



>ref|XP_004304620.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   409 bits (1051),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 212/345 (61%), Positives = 255/345 (74%), Gaps = 15/345 (4%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTG  SAA+ EV PPNGE+FFG  SGR+CDGRL+IDFIAE L LPY
Sbjct  26    CRFPAIYNFGDSNSDTGAISAAIAEVPPPNGESFFGHSSGRFCDGRLIIDFIAEKLKLPY  85

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+ YLDS+GT+FRHGANFAT GSSI PGGYSPF L IQ+SQFI+FK ++I LY + +   
Sbjct  86    LSPYLDSVGTNFRHGANFATGGSSIRPGGYSPFHLGIQLSQFIRFKSQSIALYKQQSPDT  145

Query  478   QVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGE  657
             Q     LPRPE+FSK+LYT DIGQNDL++GFQ+  + Q   SIP I+ +  QA+ +LY E
Sbjct  146   Q----RLPRPEDFSKALYTIDIGQNDLAYGFQHGTIEQVRASIPDILSQLDQAINKLYKE  201

Query  658   GARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlraq  837
             GAR FW+HNTGP GCLP +V Y+K    N+DK+GC    N VAQEFNR+LK  V  LR Q
Sbjct  202   GARFFWVHNTGPHGCLPYNVIYDKSKPGNLDKSGCVKPTNEVAQEFNRRLKNSVSHLRKQ  261

Query  838   lqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYGDP  990
             L  AVFT VD+YSAKY V+S A + GF DPF FCC         CGK K + N TVYG+P
Sbjct  262   LPLAVFTYVDVYSAKYTVISKAKNEGFVDPFDFCCGSYKGYHIDCGK-KAIVNGTVYGNP  320

Query  991   CSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             C +PS+HISWDG+HYS+AAN++LA  I+  G  SDPP  + EAC 
Sbjct  321   CHNPSKHISWDGIHYSQAANILLANQII-NGLLSDPPVSITEACH  364



>gb|KDP45344.1| hypothetical protein JCGZ_09593 [Jatropha curcas]
Length=381

 Score =   409 bits (1051),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 207/351 (59%), Positives = 260/351 (74%), Gaps = 15/351 (4%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C F A+YNFGDSNSDTGG SAA+ EV  PNGETFFG PSGRYCDGRL+IDFIAE L L
Sbjct  31    QKCGFQAIYNFGDSNSDTGGISAAISEVTSPNGETFFGHPSGRYCDGRLIIDFIAERLKL  90

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             PYL+AYLDSIGT FRHG NFAT GSSI PGG+SPF L IQ+SQFIQFK RT  LYNKL  
Sbjct  91    PYLSAYLDSIGTDFRHGVNFATGGSSIRPGGFSPFHLGIQVSQFIQFKARTTALYNKLGA  150

Query  472   TNQ----VYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQAL  639
             +       +K  LPRP +FS +LYTFDIGQNDL++G Q++   + + SIP I+++FS+A+
Sbjct  151   SETGKLPPFKRNLPRPADFSTALYTFDIGQNDLAYGLQHTTEEKVIMSIPDILNQFSEAV  210

Query  640   YQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarv  819
             ++LY EGAR FW+HNTGPIGCLP S  Y++    ++D++GC    N++AQEFNRQL+ +V
Sbjct  211   HRLYKEGARIFWVHNTGPIGCLPYSPIYHQSKPGDLDQSGCVKPQNKIAQEFNRQLQNKV  270

Query  820   lqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANE  972
              QLR +L  + FT +D+YSAKY ++S A + GF DP  FCC         CGK K + N 
Sbjct  271   SQLRKKLPHSAFTYIDVYSAKYQLISTAKNQGFVDPMNFCCGSYYGYHIDCGK-KAIVNG  329

Query  973   TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             TVYG+PC  PS HISWDG+HYS+AANL +A  ++  GS S PP  + +AC+
Sbjct  330   TVYGNPCQHPSMHISWDGIHYSQAANLWVANKVL-NGSHSHPPFSIEDACQ  379



>ref|XP_009778765.1| PREDICTED: GDSL esterase/lipase At3g27950-like isoform X1 [Nicotiana 
sylvestris]
Length=379

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/350 (59%), Positives = 259/350 (74%), Gaps = 14/350 (4%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             +  C FPA+YNFGDSNSDTGG+SAA  EV+PPNGETFF KP GR CDGRL++D IA+ L 
Sbjct  25    EEACGFPAIYNFGDSNSDTGGKSAAFHEVQPPNGETFFRKPFGRVCDGRLIVDLIADRLD  84

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLA  468
             LPYL+AYLDSIG  FR+GANFAT GSSILPGGYSPF+L +QISQF+QFKKRTI L N   
Sbjct  85    LPYLSAYLDSIGADFRNGANFATVGSSILPGGYSPFYLGVQISQFLQFKKRTILLSNLTI  144

Query  469   GTNQVY--KDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALY  642
               ++ +  K  +P+P++FSK++YTFDIGQNDLS+GFQ+++ +Q   SIP+I+D F+ A++
Sbjct  145   TNSKRFSSKVNIPKPDDFSKAIYTFDIGQNDLSYGFQHTHEAQVRASIPQILDNFTHAIH  204

Query  643   QLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvl  822
             QLY EGARNFWIHNTGPIGCLP SV         +D  GC  + N VA+EFN+QLK ++ 
Sbjct  205   QLYTEGARNFWIHNTGPIGCLPYSVISYPLKPQGLDATGCIESQNEVAREFNKQLKDKIS  264

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMANE  972
              LR +L  +  T VD+YSAKY ++S A   GF DP  FCC          CG+   + N 
Sbjct  265   HLRKELTYSAITYVDIYSAKYKLISTAKKQGFGDPMKFCCGWYNNGYEVACGQT-TVVNR  323

Query  973   TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             T YG  CSDP+++ISWDG+HY++AAN+ LA SI+  GSFSDPP PV ++C
Sbjct  324   TEYGKACSDPTKYISWDGIHYTDAANVWLANSIL-NGSFSDPPVPVEQSC  372



>ref|XP_007151046.1| hypothetical protein PHAVU_004G013900g [Phaseolus vulgaris]
 gb|ESW23040.1| hypothetical protein PHAVU_004G013900g [Phaseolus vulgaris]
Length=379

 Score =   405 bits (1042),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 260/348 (75%), Gaps = 15/348 (4%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +CWFPA+YNFGDSNSDTG  SAA   V+PPNG +FFG  SGR  DGRL+ID++ E L LP
Sbjct  34    KCWFPAIYNFGDSNSDTGAVSAAFTGVKPPNGISFFGSLSGRASDGRLIIDYMTEELKLP  93

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGT  474
             YL+AYLDS+G+++RHGANFA  GSSI PGGYSPF L +Q+ QF+QFK RT  L+N+L+  
Sbjct  94    YLSAYLDSVGSNYRHGANFAVGGSSIRPGGYSPFPLGLQVDQFLQFKSRTNILFNQLS-D  152

Query  475   NQV---YKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ  645
             N++   +K  LPRPE+FS+++YTFDIGQNDL+ G Q+++  Q +QSIP I+ +F QA+ Q
Sbjct  153   NRIEPPFKSTLPRPEDFSRAIYTFDIGQNDLAFGLQHTSQEQVIQSIPDILSQFFQAVQQ  212

Query  646   LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlq  825
             LY EGAR FWIHNTGPIGCLP S  Y +    N+D NGC   HN +AQEFNRQLK +V Q
Sbjct  213   LYNEGARVFWIHNTGPIGCLPYSYIYYEPKKGNIDANGCVKPHNDLAQEFNRQLKDQVFQ  272

Query  826   lraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETV  978
             LR +   A FT VD+YSAKY +V+NA S GF  P  FCC         CGK K + N TV
Sbjct  273   LRTKFPLAKFTYVDVYSAKYELVNNARSQGFMSPLEFCCGSYYGYHINCGK-KAIVNGTV  331

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             YG+PC +PS+H+SWDG+HYS+AAN  +A+ I+Y GSFSDPP P+ +AC
Sbjct  332   YGNPCQNPSQHVSWDGIHYSQAANQWVAKRILY-GSFSDPPIPIGQAC  378



>ref|XP_002517326.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF44868.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=368

 Score =   405 bits (1040),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 212/356 (60%), Positives = 256/356 (72%), Gaps = 14/356 (4%)
 Frame = +1

Query  91    IGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDF  270
             +  G   ++C F AVYNFGDSNSDTGG SAAL EV  PNGETFFG P+GR+CDGRL+IDF
Sbjct  8     VMSGTHLQQCEFQAVYNFGDSNSDTGGISAALSEVTSPNGETFFGHPAGRFCDGRLIIDF  67

Query  271   IAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIE  450
             +AE + LPYL+ YLDS+GT FRHGANFAT GSSI PGGYSPF L IQISQFIQFK R   
Sbjct  68    LAERVKLPYLSPYLDSVGTDFRHGANFATGGSSIRPGGYSPFHLGIQISQFIQFKARVTA  127

Query  451   LYNKL--AGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDK  624
             LYN    +G    +K  LPRP +F ++LYTFDIGQNDL++GFQ++   Q + SIP I+ +
Sbjct  128   LYNTRSSSGNTPPFKSNLPRPADFPRALYTFDIGQNDLAYGFQHTTEEQVIISIPDILSQ  187

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             FSQA+++LY EGAR FW+HNT PIGCLP S  YN     N D+NGC  + N VAQEFN+Q
Sbjct  188   FSQAVHRLYEEGARIFWVHNTSPIGCLPYSAIYNSKP-GNRDQNGCVKSQNEVAQEFNKQ  246

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNK  957
             LK  VL+L ++L  + FT VD+YSAKY ++S A S GF DP  FCC         CGK K
Sbjct  247   LKNTVLELTSRLLHSAFTYVDVYSAKYQLISTAKSQGFLDPMKFCCGSYYGYHIDCGK-K  305

Query  958   KMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              + N T+YG+PC  PS+HISWDG+HYS+AAN  +A  I+  GS S P   V EACR
Sbjct  306   AIVNGTIYGNPCKIPSKHISWDGIHYSQAANQWVADKIL-NGSHSYPSFSVEEACR  360



>gb|ACZ74703.1| carboxilic ester hydrolase [Phaseolus vulgaris]
Length=379

 Score =   405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 206/348 (59%), Positives = 260/348 (75%), Gaps = 15/348 (4%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +CWFPA+YNFGDSNSDTG  SAA   V+PPNG +FFG  SGR  DGRL+ID++ E L LP
Sbjct  34    KCWFPAIYNFGDSNSDTGAVSAAFTGVKPPNGISFFGSLSGRASDGRLIIDYMTEELKLP  93

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGT  474
             YL+AYLDS+G+++RHGANFA  GSSI PGGYSPF L +Q+ QF+QFK RT  L+N+L+  
Sbjct  94    YLSAYLDSVGSNYRHGANFAVGGSSIRPGGYSPFPLGLQVDQFLQFKSRTNILFNQLS-D  152

Query  475   NQV---YKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ  645
             N++   +K  LPRPE+FS+++YTFDIGQNDL+ G Q+++  Q +QSIP I+ +F QA+ Q
Sbjct  153   NRIEPPFKSTLPRPEDFSRAIYTFDIGQNDLAFGLQHTSQEQVIQSIPDILSQFFQAVQQ  212

Query  646   LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlq  825
             LY EGAR FWIHNTGPIGCLP S  Y +    N+D NGC   HN +AQEFNRQLK +V Q
Sbjct  213   LYDEGARVFWIHNTGPIGCLPYSYIYYEPKKGNIDANGCVKPHNDLAQEFNRQLKDQVFQ  272

Query  826   lraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETV  978
             LR +   A FT VD+Y+AKY +V+NA S GF  P  FCC         CGK K + N TV
Sbjct  273   LRTKFPLAKFTYVDVYTAKYELVNNARSQGFMSPLEFCCGSYYGYHINCGK-KAIVNGTV  331

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             YG+PC +PS+H+SWDG+HYS+AAN  +A+ I+Y GSFSDPP P+ +AC
Sbjct  332   YGNPCKNPSQHVSWDGIHYSQAANQWVAKRILY-GSFSDPPIPIGQAC  378



>ref|XP_008379791.1| PREDICTED: GDSL esterase/lipase At3g27950 [Malus domestica]
Length=378

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 208/345 (60%), Positives = 249/345 (72%), Gaps = 16/345 (5%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTG  SAA+ EV PPNGETFFGKPSGR  DGRL+IDF AE L +PY
Sbjct  36    CRFPAIYNFGDSNSDTGAISAAISEVPPPNGETFFGKPSGRLSDGRLIIDFXAEKLQIPY  95

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+ YLDS+GT+F HGANFAT GSS  PGGYSPF L IQISQFI+FK  +I LY +L  T 
Sbjct  96    LSPYLDSLGTNFLHGANFATGGSSXRPGGYSPFHLGIQISQFIRFKSHSIALYKQLHSTR  155

Query  478   QVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGE  657
             +     LPRPE+F K+LYTFDIGQNDL++G Q+  + +   SIP I+ + SQA+ QLY E
Sbjct  156   R-----LPRPEDFPKALYTFDIGQNDLAYGIQHGTIZEVRASIPAILSQLSQAISQLYKE  210

Query  658   GARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlraq  837
             GAR FW+HNTGP GCLP SV Y K    N+DK+GC    N VAQEFNRQLK  ++ LR+ 
Sbjct  211   GARFFWVHNTGPQGCLPYSVIYXKSKPGNLDKSGCVKPLNAVAQEFNRQLKNSIMLLRSL  270

Query  838   lqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYGDP  990
             L  A FT VD+YSAKY ++S+A   GF DPF FCC         CG+ K + N TVYG+P
Sbjct  271   LPLAAFTYVDVYSAKYTLISDAKKQGFVDPFDFCCGSYYGFHIDCGR-KAVVNGTVYGNP  329

Query  991   CSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             CS P+ HISWDG+HYS+AAN ++A  I+  GS SDPP  +  AC 
Sbjct  330   CSSPTTHISWDGIHYSQAANALIASRIL-NGSLSDPPVSITHACH  373



>ref|XP_004142807.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Cucumis sativus]
 gb|KGN51393.1| hypothetical protein Csa_5G524860 [Cucumis sativus]
Length=380

 Score =   401 bits (1031),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 256/351 (73%), Gaps = 20/351 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAVYNFGDSNSDTGG SAA      PNG TFFG PSGR CDGRL+IDFIAE L  PY
Sbjct  33    CRFPAVYNFGDSNSDTGGISAAFNVFESPNGMTFFGHPSGRACDGRLIIDFIAEKLKFPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             LNAYLDS+GTSFRHGANFAT GSSI PGGYSPF L +Q+SQFIQFK RT  LYN+L   N
Sbjct  93    LNAYLDSVGTSFRHGANFATGGSSIRPGGYSPFHLGLQVSQFIQFKSRTTYLYNRLQSNN  152

Query  478   Q---VYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
             +   + K  + RP+EFSK+LY FDI QNDLS+GFQ+S+  Q   SIP I++ FS+A+ Q+
Sbjct  153   RTTILIKSNIARPQEFSKALYMFDIAQNDLSYGFQHSSEEQVRASIPDILNTFSEAVQQV  212

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHN--NVDKNGCAATHNRVAQEFNrqlkarvl  822
             Y EGAR FW+HNTGP+GCLP S+    DNH   N+D  GC  + N VAQE NRQLK  ++
Sbjct  213   YKEGARYFWVHNTGPVGCLPFSIL---DNHRPGNIDSIGCVKSANEVAQELNRQLKNLLV  269

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANET  975
             +LR +L  A  T+VDMYSAKY +VS A + GF  P +FCC         CGK K++ N T
Sbjct  270   KLRKELPLARITLVDMYSAKYFLVSKAKTEGFLSPVSFCCGSFHGFHLNCGK-KEVVNGT  328

Query  976   VY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             VY  + C+DPS+HISWDG+HYSE ANL +A  I+  GSFSDPP P+ +AC+
Sbjct  329   VYENNACNDPSKHISWDGIHYSETANLWIADHIL-NGSFSDPPLPIDKACQ  378



>ref|XP_008458758.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Cucumis melo]
Length=380

 Score =   401 bits (1030),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 211/351 (60%), Positives = 255/351 (73%), Gaps = 20/351 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAVYNFGDSNSDTGG SAA   +  PNG TFFG PSGR CDGRL++DFIAE L  PY
Sbjct  33    CRFPAVYNFGDSNSDTGGISAAFNVIESPNGMTFFGHPSGRACDGRLIVDFIAEKLKFPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             LNAYLDS+GT+FRHGANFAT GSSI PGGYSPF L +Q+SQFIQFK RT  LYN+L   N
Sbjct  93    LNAYLDSVGTNFRHGANFATGGSSIRPGGYSPFHLGLQVSQFIQFKSRTTYLYNRLQSNN  152

Query  478   QV---YKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
             +     K  + RP+EFSK+LY FDI QNDLS+GFQ+S+  Q   SIP I++ FS+A+ Q+
Sbjct  153   RTNIPIKSSIARPQEFSKALYMFDIAQNDLSYGFQHSSEEQVRASIPDILNTFSEAVQQV  212

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHN--NVDKNGCAATHNRVAQEFNrqlkarvl  822
             Y EG R FW+HNTGP+GCLP S+    DNH   N+D  GC  + N VAQE NRQLK  ++
Sbjct  213   YKEGGRYFWVHNTGPVGCLPFSIL---DNHRPGNIDSIGCVKSANEVAQELNRQLKNLLV  269

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANET  975
             +LR +L  A  T++DMYSAKY +VS A + GF  P +FCC         CGK K++ N T
Sbjct  270   KLRKELPLARITLIDMYSAKYLLVSKAKTEGFLSPVSFCCGSFHGFHLNCGK-KEVVNGT  328

Query  976   VY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             VY  + C DPS+HISWDG+HYSEAANL +A  I+  GSFSDPP P+ +AC+
Sbjct  329   VYENNACKDPSKHISWDGIHYSEAANLWIADHIL-NGSFSDPPLPIDKACQ  378



>ref|XP_004156679.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Cucumis sativus]
Length=380

 Score =   399 bits (1025),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 213/351 (61%), Positives = 255/351 (73%), Gaps = 20/351 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAVYNFGDSNSDTGG SAA      PNG TFFG PSGR CDGRL+IDFIAE L  PY
Sbjct  33    CRFPAVYNFGDSNSDTGGISAAFNVFESPNGMTFFGHPSGRACDGRLIIDFIAEKLKFPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             LNAYLDS+GTSFRHGANFAT GSSI PGGYSPF L +Q+SQFIQFK RT  LYN+L   N
Sbjct  93    LNAYLDSVGTSFRHGANFATGGSSIRPGGYSPFHLGLQVSQFIQFKSRTTYLYNRLQSNN  152

Query  478   Q---VYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
             +   + K  + RP+EFSK+LY FDI QNDLS+GFQ+S+  Q   SIP I++ FS+A+ Q+
Sbjct  153   RTTILIKSNIARPQEFSKALYMFDIAQNDLSYGFQHSSEEQVRASIPDILNTFSEAVQQV  212

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHN--NVDKNGCAATHNRVAQEFNrqlkarvl  822
             Y EGAR FW+HNTGP+GCLP S+    DNH   N+D  GC  + N VAQE NRQLK  ++
Sbjct  213   YKEGARYFWVHNTGPVGCLPFSIL---DNHRPGNIDSIGCVKSANEVAQELNRQLKNLLV  269

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANET  975
             +LR +L  A  T+VDMYSAKY +VS A + GF  P +FCC         C K K++ N T
Sbjct  270   KLRKELPLARITLVDMYSAKYFLVSKAKTEGFLSPVSFCCGSFHGFHLNCMK-KEVVNGT  328

Query  976   VY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             VY  + C+DPS+HISWDG+HYSE ANL +A  I+  GSFSDPP P+ +AC+
Sbjct  329   VYENNACNDPSKHISWDGIHYSETANLWIADHIL-NGSFSDPPLPIDKACQ  378



>ref|XP_010243019.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X3 [Nelumbo 
nucifera]
Length=374

 Score =   397 bits (1019),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 210/347 (61%), Positives = 247/347 (71%), Gaps = 13/347 (4%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGGRSA+   +  P GETFFGKPSGR+CDGRLVIDFIAE LGLPY
Sbjct  28    CNFPAIYNFGDSNSDTGGRSASFDALPLPFGETFFGKPSGRFCDGRLVIDFIAEQLGLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+AYLDSIGTSFRHGANFA  GSSI  GGYSPF L IQISQF Q K RT +LY +  G  
Sbjct  88    LSAYLDSIGTSFRHGANFAFGGSSIRVGGYSPFHLSIQISQFRQLKARTTDLYGQRQGKA  147

Query  478   QV--YKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
             +    K  LP+PE+FSK+LYTFDIGQNDL++GFQ++   Q  +SIP ++D+ S A+  LY
Sbjct  148   RTPSSKWNLPKPEDFSKALYTFDIGQNDLAYGFQHTTEDQVRESIPDMLDQLSDAIQTLY  207

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR FWIHNTGP+GCLP S  Y++    N+D+ GC    N VAQEFNRQLK RV Q R
Sbjct  208   EEGARVFWIHNTGPLGCLPYSFIYDQSKPGNLDEGGCVKPENDVAQEFNRQLKDRVTQFR  267

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
              +L  A FT VD+YS KY +VSNA   GF DP  FCC         CGK   + N T YG
Sbjct  268   LRLPHAAFTYVDVYSVKYELVSNATKQGFDDPMKFCCGSYYGYHVDCGKT-AVVNGTTYG  326

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               CS+P   +SWDG+HYSE AN  +A  ++ GG  SDPP P+ +ACR
Sbjct  327   KACSNPRAQVSWDGIHYSEEANRRIADRLL-GGQMSDPPVPITQACR  372



>ref|XP_009617545.1| PREDICTED: GDSL esterase/lipase At3g27950 isoform X1 [Nicotiana 
tomentosiformis]
Length=385

 Score =   396 bits (1017),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 204/346 (59%), Positives = 256/346 (74%), Gaps = 16/346 (5%)
 Frame = +1

Query  124   FPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLN  303
             FPA+YNFGDSNSDTGG+SAA  EV+PPNGETFF +P GR CDGRL+ID IA+ L L YL+
Sbjct  36    FPAIYNFGDSNSDTGGKSAAFHEVQPPNGETFFNRPFGRVCDGRLIIDLIADRLDLQYLS  95

Query  304   AYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQV  483
             AYLDSIG  FR+GANFAT GSSILPGGYSPF+L IQISQF+QFKKR I L + L  TN  
Sbjct  96    AYLDSIGADFRNGANFATVGSSILPGGYSPFYLGIQISQFLQFKKRII-LLSDLTITNSK  154

Query  484   Y---KDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYG  654
             +   K  +P+P++FSK+LY FDIGQNDLS+GFQ+++ +Q   SIP+I+D F+QA++QLY 
Sbjct  155   WSSSKVNIPKPDDFSKALYIFDIGQNDLSYGFQHTHEAQVRASIPQILDNFTQAIHQLYT  214

Query  655   EGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlra  834
             EGARNFWIHNTGPIGCLP S+         +D  GC  + N VA+EFN+QLK R+  LR 
Sbjct  215   EGARNFWIHNTGPIGCLPYSLISYPLKPQGLDAIGCVESQNEVAREFNKQLKNRISHLRK  274

Query  835   qlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMANETVYG  984
             +L  +  T VD+YSAKY ++S +   GF DP  FCC          CG+   + N T YG
Sbjct  275   ELTHSAITYVDIYSAKYKLISTSKKQGFGDPMKFCCGWYNNGYEVACGQT-TVVNGTEYG  333

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               CSDP+++ISWDG+HY++AAN+ LA SI+  GSFSDPP P+ ++C
Sbjct  334   KACSDPTKYISWDGIHYTDAANVWLANSIL-NGSFSDPPVPIEQSC  378



>ref|XP_003524542.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Glycine max]
Length=379

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 255/347 (73%), Gaps = 13/347 (4%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +CWFPA+YNFGDSNSDTG   AA   V+PPNG +FFG  SGR  DGRL+IDF+ E L LP
Sbjct  34    KCWFPAIYNFGDSNSDTGAVFAAFTGVKPPNGISFFGSLSGRASDGRLIIDFMTEELKLP  93

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG-  471
             YLNAYLDS+G+++RHGANFA  GSSI PGG+SPF L +Q++QF+ FK RT  L+N+L+  
Sbjct  94    YLNAYLDSVGSNYRHGANFAVGGSSIRPGGFSPFPLGLQVAQFLLFKSRTNTLFNQLSNN  153

Query  472   -TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
              T   +K+ +PRPE+FS++LYTFDIGQNDL+ G Q+++  Q ++SIP+I+++F QA+ QL
Sbjct  154   RTEPPFKNSVPRPEDFSRALYTFDIGQNDLAFGLQHTSQEQVIKSIPEILNQFFQAVQQL  213

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlql  828
             Y  GAR FWIHNTGPIGCLP S  Y +    NVD NGC    N +AQEFNRQLK +V Q+
Sbjct  214   YNVGARVFWIHNTGPIGCLPYSYIYYEPKKGNVDANGCVKPQNDLAQEFNRQLKDQVFQI  273

Query  829   raqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVY  981
             R +   A FT VD+Y+AKY ++SNA + GF  P  FCC         CGK   + N TVY
Sbjct  274   RRKFPLAKFTYVDVYTAKYELISNARNQGFVSPLEFCCGSYYGYHINCGKT-AIVNGTVY  332

Query  982   GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G+PC +PS+H+SWDG+HYS+AAN  +A+ I+Y GS SDPP  + +AC
Sbjct  333   GNPCKNPSQHVSWDGIHYSQAANQWVAKRILY-GSLSDPPVQIGQAC  378



>gb|KHN23536.1| GDSL esterase/lipase [Glycine soja]
Length=379

 Score =   390 bits (1002),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 254/347 (73%), Gaps = 13/347 (4%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +CWFPA+YNFGDSNSDTG   AA   V+PPNG +FFG  SGR  DGRL+IDF+ E L LP
Sbjct  34    KCWFPAIYNFGDSNSDTGAVFAAFTGVKPPNGISFFGSLSGRASDGRLIIDFMTEELKLP  93

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG-  471
             YLNAYLDS+G+++RHGANFA  GSSI PGG+SPF L +Q++QF+ FK  T  L+N+ +  
Sbjct  94    YLNAYLDSVGSNYRHGANFAVGGSSIRPGGFSPFPLGLQVAQFLLFKFHTNTLFNQFSNN  153

Query  472   -TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
              T Q +K+ LPRPE+FSK+LYTFDIGQNDL+ G Q+++  Q ++SIP+I+++F QA+ QL
Sbjct  154   RTEQPFKNSLPRPEDFSKALYTFDIGQNDLAFGLQHTSQEQVIKSIPEILNQFFQAVQQL  213

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlql  828
             Y  GAR FWIHNTGPIGCLP S  Y +    N+D NGC    N +AQEFNRQLK +V QL
Sbjct  214   YNVGARVFWIHNTGPIGCLPYSYIYYEPKKGNIDANGCVKPQNDLAQEFNRQLKDQVFQL  273

Query  829   raqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVY  981
             R +   A FT VD+Y+AKY +++N  + GF  P  FCC         CGK   + N TVY
Sbjct  274   RRKFPLAKFTYVDVYTAKYELINNTRNQGFVSPLEFCCGSYYGYHINCGKT-AIINGTVY  332

Query  982   GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G+PC +PS+H+SWDG+HYS+AAN  +A+ I+Y GS SDPP P+ +AC
Sbjct  333   GNPCKNPSQHVSWDGIHYSQAANQWVAKKILY-GSLSDPPVPIGQAC  378



>ref|NP_001241984.1| uncharacterized protein LOC100785435 precursor [Glycine max]
 gb|ACU17951.1| unknown [Glycine max]
Length=379

 Score =   388 bits (997),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/347 (57%), Positives = 253/347 (73%), Gaps = 13/347 (4%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +CWFPA+YNFGDSNSDTG   AA   V+PPNG +FFG  SGR  DGRL+IDF+ E L LP
Sbjct  34    KCWFPAIYNFGDSNSDTGAVFAAFTGVKPPNGISFFGSLSGRASDGRLIIDFMTEELKLP  93

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG-  471
             YLNAYLDS+G+++RHGANFA  GSSI PGG+SPF L +Q++QF+ FK  T  L+N+ +  
Sbjct  94    YLNAYLDSVGSNYRHGANFAVGGSSIRPGGFSPFPLGLQVAQFLLFKFHTNTLFNQFSNN  153

Query  472   -TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
              T Q +K+ LPRPE+FSK+LYTFDIGQNDL+ G Q+++  Q ++SIP+I+++F QA+ QL
Sbjct  154   RTEQPFKNSLPRPEDFSKALYTFDIGQNDLAFGLQHTSQEQVIKSIPEILNQFFQAVQQL  213

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlql  828
             Y  GAR FWIHNTGPIGCLP S  Y +    N+D NGC    N +AQEFNRQLK +V QL
Sbjct  214   YNVGARVFWIHNTGPIGCLPNSYIYYEPKKGNIDANGCVKPQNDLAQEFNRQLKDQVFQL  273

Query  829   raqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVY  981
             R +   A FT VD+Y+AKY +++N  + GF  P  FCC         CGK   + N TVY
Sbjct  274   RRKFPLAKFTYVDVYTAKYELINNTRNQGFVSPLEFCCGSYYGYHINCGKT-AIINGTVY  332

Query  982   GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G+PC +PS+H+SWDG+HYS+AAN  +A+ I+Y GS SDPP P+ + C
Sbjct  333   GNPCKNPSQHVSWDGIHYSQAANQWVAKKILY-GSLSDPPVPIGQTC  378



>ref|XP_010243017.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X1 [Nelumbo 
nucifera]
Length=388

 Score =   388 bits (996),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 211/361 (58%), Positives = 248/361 (69%), Gaps = 27/361 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGGRSA+   +  P GETFFGKPSGR+CDGRLVIDFIAE LGLPY
Sbjct  28    CNFPAIYNFGDSNSDTGGRSASFDALPLPFGETFFGKPSGRFCDGRLVIDFIAEQLGLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+AYLDSIGTSFRHGANFA  GSSI  GGYSPF L IQISQF Q K RT +LY +  G  
Sbjct  88    LSAYLDSIGTSFRHGANFAFGGSSIRVGGYSPFHLSIQISQFRQLKARTTDLYGQRQGKA  147

Query  478   QV--YKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ--  645
             +    K  LP+PE+FSK+LYTFDIGQNDL++GFQ++   Q  +SIP ++D+ S A+ Q  
Sbjct  148   RTPSSKWNLPKPEDFSKALYTFDIGQNDLAYGFQHTTEDQVRESIPDMLDQLSDAIQQFC  207

Query  646   ------------LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQ  789
                         LY EGAR FWIHNTGP+GCLP S  Y++    N+D+ GC    N VAQ
Sbjct  208   DCCCVVDGGGQTLYEEGARVFWIHNTGPLGCLPYSFIYDQSKPGNLDEGGCVKPENDVAQ  267

Query  790   EFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------  942
             EFNRQLK RV Q R +L  A FT VD+YS KY +VSNA   GF DP  FCC         
Sbjct  268   EFNRQLKDRVTQFRLRLPHAAFTYVDVYSVKYELVSNATKQGFDDPMKFCCGSYYGYHVD  327

Query  943   CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             CGK   + N T YG  CS+P   +SWDG+HYSE AN  +A  ++ GG  SDPP P+ +AC
Sbjct  328   CGKT-AVVNGTTYGKACSNPRAQVSWDGIHYSEEANRRIADRLL-GGQMSDPPVPITQAC  385

Query  1123  R  1125
             R
Sbjct  386   R  386



>ref|XP_010243018.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X2 [Nelumbo 
nucifera]
Length=387

 Score =   386 bits (992),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 247/360 (69%), Gaps = 26/360 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGGRSA+   +  P GETFFGKPSGR+CDGRLVIDFIAE LGLPY
Sbjct  28    CNFPAIYNFGDSNSDTGGRSASFDALPLPFGETFFGKPSGRFCDGRLVIDFIAEQLGLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+AYLDSIGTSFRHGANFA  GSSI  GGYSPF L IQISQF Q K RT +LY +  G  
Sbjct  88    LSAYLDSIGTSFRHGANFAFGGSSIRVGGYSPFHLSIQISQFRQLKARTTDLYGQRQGKA  147

Query  478   QV--YKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQAL----  639
             +    K  LP+PE+FSK+LYTFDIGQNDL++GFQ++   Q  +SIP ++D+ S A+    
Sbjct  148   RTPSSKWNLPKPEDFSKALYTFDIGQNDLAYGFQHTTEDQVRESIPDMLDQLSDAIQFCD  207

Query  640   ---------YQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQE  792
                        LY EGAR FWIHNTGP+GCLP S  Y++    N+D+ GC    N VAQE
Sbjct  208   CCCVVDGGGQTLYEEGARVFWIHNTGPLGCLPYSFIYDQSKPGNLDEGGCVKPENDVAQE  267

Query  793   FNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------C  945
             FNRQLK RV Q R +L  A FT VD+YS KY +VSNA   GF DP  FCC         C
Sbjct  268   FNRQLKDRVTQFRLRLPHAAFTYVDVYSVKYELVSNATKQGFDDPMKFCCGSYYGYHVDC  327

Query  946   GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             GK   + N T YG  CS+P   +SWDG+HYSE AN  +A  ++ GG  SDPP P+ +ACR
Sbjct  328   GKT-AVVNGTTYGKACSNPRAQVSWDGIHYSEEANRRIADRLL-GGQMSDPPVPITQACR  385



>ref|XP_010322965.1| PREDICTED: GDSL esterase/lipase At3g27950 [Solanum lycopersicum]
Length=376

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 206/350 (59%), Positives = 258/350 (74%), Gaps = 17/350 (5%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +C FPA+YNFGDSNSDTGG+SAA  +V PPNG TFFG P GR CDGRL+ID IA+ L L 
Sbjct  25    KCVFPAIYNFGDSNSDTGGKSAAFRQVPPPNGLTFFGSPMGRMCDGRLIIDLIADRLELQ  84

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGT  474
             YL+ YLDS+  +FR+GANFATAGSSILPGGYSPF L++QISQF+QFKKRT+ L + L+  
Sbjct  85    YLSPYLDSVMANFRNGANFATAGSSILPGGYSPFSLEVQISQFLQFKKRTM-LLSDLSIP  143

Query  475   NQVY----KDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALY  642
             N+      K  +  P++FSK+LYTFDIGQNDLS+GFQY++ +Q   SIP I+D F+QA++
Sbjct  144   NKSKWSSSKVNIANPQDFSKALYTFDIGQNDLSYGFQYTHEAQVRASIPLIIDNFTQAIH  203

Query  643   QLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvl  822
             QLY EGA NFWIHNTGPIGCLP SV         +D  GC    N+VA+EFN QLK R+L
Sbjct  204   QLYYEGAVNFWIHNTGPIGCLPYSVIDYPLKPQGLDGIGCIENENKVAREFNEQLKDRIL  263

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMANE  972
              LRA+L  A FT VD+YSAKY ++S+A   GF DP  FCC          CG+   + N 
Sbjct  264   HLRAELPGAAFTYVDIYSAKYQLISSAKEQGFGDPLKFCCGWYNNGSEVACGQT-AIVNG  322

Query  973   TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             T +G  CSDP+++ISWDGVHY++AAN+ LA+SI+  GSFSDPP P+ ++C
Sbjct  323   TEHGKACSDPTKYISWDGVHYTDAANVWLAKSIL-NGSFSDPPVPIEQSC  371



>ref|XP_006347466.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Solanum tuberosum]
Length=376

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 205/357 (57%), Positives = 259/357 (73%), Gaps = 14/357 (4%)
 Frame = +1

Query  88    GIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVID  267
             G+  G    +C FPA+YNFGDSNSDTGG+SAA  +V PPNG TFFG P GR CDGRL+ID
Sbjct  15    GLVFGEISNKCVFPAIYNFGDSNSDTGGKSAAFRQVPPPNGLTFFGSPMGRVCDGRLIID  74

Query  268   FIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTI  447
              IA+ L L YL+ YLDS+  +FR+GANFATAGSSILPGGYSPF L++QISQF+QFKKRTI
Sbjct  75    LIADRLELQYLSPYLDSVMANFRNGANFATAGSSILPGGYSPFSLEVQISQFLQFKKRTI  134

Query  448   ELYNKLAGTNQVY--KDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMD  621
              L +     N  +  K  +  P++FSK+LYTFDIGQNDLS+GFQ+++ +Q   SIP I+ 
Sbjct  135   LLSDLSIPNNSKWSSKVNIANPQDFSKALYTFDIGQNDLSYGFQHTHEAQVRASIPLIIG  194

Query  622   KFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNr  801
              F+QA++QLY EGA NFWIHNTGPIGCLP SV         +D  GC    N+VA+EFN 
Sbjct  195   NFTQAIHQLYYEGAVNFWIHNTGPIGCLPYSVIDYPLKPQGLDGIGCIENQNKVAREFNE  254

Query  802   qlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGK  951
             QLK R+L LRA+L +A FT VD+YSAKY ++S+A   GF DP  FCC          CG+
Sbjct  255   QLKDRILHLRAELPRAAFTYVDIYSAKYQLISSAKEQGFGDPLKFCCGWYNNGSEVACGQ  314

Query  952   NKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                + N T +G  CSDP+++ISWDG+HY++AAN+ LA+SI+  GSFSDPP P+ ++C
Sbjct  315   T-AIVNGTEHGKACSDPTKYISWDGIHYTDAANVWLAKSIL-NGSFSDPPVPIEQSC  369



>ref|XP_004489281.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Cicer arietinum]
Length=378

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/348 (56%), Positives = 249/348 (72%), Gaps = 13/348 (4%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C +PA+YNFGDSNSDTG   A    VRPPNG TFFG  SGR  DGRL+IDFI+E L L
Sbjct  33    KKCVYPAIYNFGDSNSDTGAVYATFTGVRPPNGMTFFGSLSGRASDGRLIIDFISEELKL  92

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             PYL+AYL+S+G+++RHGANFA  G+SI PGGYSP  L +Q+SQFI FK  T  L+N+L+ 
Sbjct  93    PYLSAYLNSVGSNYRHGANFAVGGASIRPGGYSPINLGLQVSQFILFKSHTNTLFNQLSD  152

Query  472   --TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ  645
               T    +  LPR E+FSK+LYT DIGQNDL+ G Q+++  +   SIP+I+++FSQA+ Q
Sbjct  153   NRTEPPLRSGLPRNEDFSKALYTIDIGQNDLAIGLQHTSEEEVKSSIPEILNQFSQAVKQ  212

Query  646   LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlq  825
             LY EGAR FWIHNTGPIGCLP    Y +    N+D NGC   HN +AQE+N+QLK +V +
Sbjct  213   LYNEGARVFWIHNTGPIGCLPYDYIYYQHKKGNLDGNGCVKPHNELAQEYNKQLKDQVFE  272

Query  826   lraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETV  978
             LR +   A FT VD+Y+ KY ++SNA S GF  P  FCC         CGK K + N TV
Sbjct  273   LRRKFPLAKFTYVDVYTVKYKLISNAKSQGFVSPLEFCCGSYYGYHIDCGK-KAIINGTV  331

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             YG+PC +PS+HISWDG+HYS+AAN  +A+ I+Y GSFSDPP  +  AC
Sbjct  332   YGNPCKNPSQHISWDGIHYSQAANQWIAKQILY-GSFSDPPVSIENAC  378



>gb|KHG13836.1| hypothetical protein F383_18333 [Gossypium arboreum]
Length=364

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 211/371 (57%), Positives = 252/371 (68%), Gaps = 20/371 (5%)
 Frame = +1

Query  22    WKRILVFEmmlmslglmgclVNGIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRP  201
             WK   +F ++          V   GG      C +PA+YNFGDSNSDTGG SAA+ E+  
Sbjct  5     WKLFYLFGILFWGFSQRWRTVESNGGSF---SCGYPAIYNFGDSNSDTGGISAAMFEILS  61

Query  202   PNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPG  381
             PNGETFFG P+             AENL LPYL+AYLDS+GT+FRHGANFAT GSSI P 
Sbjct  62    PNGETFFGHPA-------------AENLKLPYLSAYLDSVGTNFRHGANFATGGSSIRPP  108

Query  382   GYSPFFLDIQISQFIQFKKRTIELYNKLA--GTNQVYKDVLPRPEEFSKSLYTFDIGQND  555
             GYSPF + +QISQFIQFK RT  LYN+L     N +    LPRP EFS++LYT DIGQND
Sbjct  109   GYSPFNIWVQISQFIQFKARTTSLYNQLTLNRRNPLTISNLPRPAEFSQALYTIDIGQND  168

Query  556   LSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDN  735
             L+HGFQY+ V Q L SIP I+ +  Q ++ LY EGAR FW+HNTGPIGCLP+SV Y    
Sbjct  169   LAHGFQYTTVKQVLASIPDIIGQLPQVIHTLYNEGARFFWVHNTGPIGCLPVSVLYEISK  228

Query  736   HNNVDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHG  915
               N+DKNGC    N VA EFNRQLK  + QLRAQL  A FT VD+YSAKY +VS+A + G
Sbjct  229   PWNLDKNGCVRLQNEVAMEFNRQLKDMISQLRAQLPFARFTYVDVYSAKYTLVSDAKNLG  288

Query  916   FQDPFTFCCCGKNKK-MANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFS  1092
             F +   FCC    KK MAN TVYG+PC+ PS+HISWDG+HYS+AAN+ +A  I+  GSFS
Sbjct  289   FVEAVNFCCGNCTKKGMANGTVYGNPCNHPSKHISWDGIHYSQAANMWVAERIL-NGSFS  347

Query  1093  DPPRPVAEACR  1125
             DPP  +  AC 
Sbjct  348   DPPLSIQSACH  358



>gb|KDP26685.1| hypothetical protein JCGZ_17843 [Jatropha curcas]
Length=380

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 253/356 (71%), Gaps = 19/356 (5%)
 Frame = +1

Query  103   LPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAEN  282
             L    C FPA++NFGDSNSDTGG+SAA   +  PNG +FF KPSGRYCDGR +IDF+AE 
Sbjct  22    LHSNSCHFPAIFNFGDSNSDTGGKSAAFHRLPYPNGYSFFNKPSGRYCDGRDIIDFLAEK  81

Query  283   LGLPYLNAYLDSIGTSFRHGANFATAGSSILPG-------GYSPFFLDIQISQFIQFKKR  441
             L LPYL+AYLDSIGT+FRHGANFAT GS+I P        G+SP  LDIQ+SQF QFK+R
Sbjct  82    LELPYLSAYLDSIGTNFRHGANFATGGSTIQPADGNIFGSGFSPISLDIQLSQFEQFKER  141

Query  442   TIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMD  621
             T+ELYN+    N + K  LPRPE+FSK+LYT DIGQNDL    +  +  Q ++S+PKI++
Sbjct  142   TLELYNQGRTLNVMNK--LPRPEDFSKALYTLDIGQNDLHAWIKLMSEKQVVESLPKIIN  199

Query  622   KFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNr  801
             +F+QA+ +LY  GAR FWIHNTGPIGCLP +V +      N D+NGC  +HN +AQEFNR
Sbjct  200   QFAQAIEKLYQLGARIFWIHNTGPIGCLPFAVIFYPPKPENRDENGCVKSHNDIAQEFNR  259

Query  802   qlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKN  954
             QLK RV QLR QL  A  T  D+Y+AKY+++S A  HGF DP  +CC         CG+ 
Sbjct  260   QLKDRVSQLRKQLPNAALTYTDIYTAKYSLISEAKKHGFADPLGYCCGHYGDYRLQCGRK  319

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               +    + GDPCS+P  +ISWDG+HYS+AAN I+A SI+  GS S+PP  ++EAC
Sbjct  320   AIVNGTEISGDPCSNPELYISWDGIHYSQAANKIIAHSIL-DGSLSEPPISISEAC  374



>ref|XP_003618296.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES74514.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=378

 Score =   378 bits (970),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 198/348 (57%), Positives = 249/348 (72%), Gaps = 13/348 (4%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C +PA+YNFGDSNSDTG  +A    V PPNG ++FG  +GR  DGRL+IDFI+E L L
Sbjct  33    KKCEYPAIYNFGDSNSDTGAANAIYTAVTPPNGISYFGSTTGRASDGRLIIDFISEELKL  92

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             PYL+AYL+SIG+++RHGANFA  G+SI PGGYSP FL +Q+SQFI FK  T  L+N+L+ 
Sbjct  93    PYLSAYLNSIGSNYRHGANFAVGGASIRPGGYSPIFLGLQVSQFILFKSHTKILFNQLSD  152

Query  472   --TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ  645
               T   +K  LPR EEFSK+LYT DIGQNDL+ G Q ++  Q  +SIP I+ +FSQA+ Q
Sbjct  153   NRTESPFKSGLPRNEEFSKALYTIDIGQNDLAIGLQNTSEEQVKRSIPDILSQFSQAVQQ  212

Query  646   LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlq  825
             LY EGAR FWIHN GPIGCLP +  Y      N+D  GC   HN +AQE+NRQLK +V Q
Sbjct  213   LYNEGARVFWIHNVGPIGCLPYNNIYYPHKKGNLDVYGCVIPHNELAQEYNRQLKDKVFQ  272

Query  826   lraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETV  978
             LR +   A FT VD+Y+AKY ++SNA S GF +P  FCC         CG  K + N TV
Sbjct  273   LRRKFPLAKFTYVDVYTAKYKLISNAKSQGFVNPLEFCCGSYYGYHINCGL-KAIINGTV  331

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             YG+PC +PS+HISWDG+HYS+AAN  +A+ I+Y GSFSDPP  V +AC
Sbjct  332   YGNPCDNPSKHISWDGIHYSQAANQWVAKQILY-GSFSDPPVSVGKAC  378



>gb|KCW59731.1| hypothetical protein EUGRSUZ_H02484 [Eucalyptus grandis]
Length=407

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 245/359 (68%), Gaps = 20/359 (6%)
 Frame = +1

Query  94    GGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFI  273
              G L  R C FPA++NFGDSNSDTGG+SAA   + PPNG+TFFG  SGRYCDG++++DFI
Sbjct  47    AGPLQSRACEFPAIFNFGDSNSDTGGKSAAFHRLLPPNGDTFFGTSSGRYCDGKVILDFI  106

Query  274   AENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQF  432
             AE LGLPYL+AYLDS+GT+FRHGANFAT GS+I P       GG+SP  LDI++SQF QF
Sbjct  107   AEKLGLPYLSAYLDSMGTNFRHGANFATGGSTIQPVDTRIFEGGFSPISLDIELSQFEQF  166

Query  433   KKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPK  612
             K RT+EL+   AG +   K  LPRPE+FSK+LYT DIGQNDL    +     Q L SIP 
Sbjct  167   KARTLELH---AGKSDYAKSSLPRPEDFSKALYTMDIGQNDLHATLKSMTEKQALASIPN  223

Query  613   IMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQE  792
             I++KF+ A+ +LY +GAR FWIHNTGPIGCLP    ++    N  DKNGC A++N++AQE
Sbjct  224   ILNKFAVAVERLYQQGARAFWIHNTGPIGCLPHYFVFDPPESNATDKNGCLASYNKIAQE  283

Query  793   FNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------C  945
             FN QLK  V +LR +L       +D+YSAKY ++S A  HGF  P  +CC         C
Sbjct  284   FNMQLKTLVSKLRLRLVGTTLNYIDIYSAKYTLISEAQKHGFGGPLEYCCGHDGDYTVYC  343

Query  946   GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G+   +    V GD CSDPS+ ISWDGVHYS AAN  +A  ++  GS SD   P+ E+C
Sbjct  344   GQKAIVNGTEVVGDSCSDPSKVISWDGVHYSHAANQWVANRVV-DGSLSDVQVPLTESC  401



>ref|XP_004489280.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Cicer arietinum]
Length=378

 Score =   374 bits (961),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 249/347 (72%), Gaps = 13/347 (4%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +C +PA+YNFGDSNSDTG   A    V+PPNG TFFG  SGR  DGRL+IDFI+E L LP
Sbjct  33    KCLYPAIYNFGDSNSDTGAVYATFTGVKPPNGMTFFGNISGRASDGRLIIDFISEELKLP  92

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG-  471
             YL+AYL+S+G+++RHGANFA  G+SI PGGYSP  L +Q+SQFI FK  T  L+N+L+  
Sbjct  93    YLSAYLNSVGSNYRHGANFAAGGASIRPGGYSPINLGLQVSQFILFKSHTKILFNQLSDN  152

Query  472   -TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
              T    +  LPR E+FSK+LYT DIGQND+++GFQ+++  Q  +SIP+I+ +FSQA+ QL
Sbjct  153   RTEPPLRSSLPRNEDFSKALYTIDIGQNDIAYGFQHASEEQVQKSIPEILSQFSQAVKQL  212

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlql  828
             Y EGAR FWIHNTGPIGCLP +    +    N+D NGC    N++AQEFN++LK +V QL
Sbjct  213   YNEGARVFWIHNTGPIGCLPFNYFSYEHKKGNLDANGCVKPQNKIAQEFNKKLKDQVFQL  272

Query  829   raqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVY  981
             R +L  A FT VDMY AKY ++ NA S GF     FCC         CG  K++ N TV 
Sbjct  273   RRKLPLAKFTYVDMYKAKYELIINARSQGFVSLLDFCCGSYTGYRINCG-TKEIINGTVD  331

Query  982   GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G PC++PS+HI WDG+HYS+ AN ++A+ I+Y GSFSDPP PV +AC
Sbjct  332   GKPCTNPSQHIIWDGIHYSQRANQLVAKQILY-GSFSDPPVPVEQAC  377



>gb|AFK46790.1| unknown [Medicago truncatula]
Length=378

 Score =   373 bits (957),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 247/348 (71%), Gaps = 13/348 (4%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C +PA+YNFGDSNSDTG  +A    V PPNG ++FG   GR  DG L+IDFI+E L L
Sbjct  33    KKCEYPAIYNFGDSNSDTGAANAIYTAVTPPNGISYFGSTIGRASDGCLIIDFISEELKL  92

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             PYL+AYL+SIG+++RHGANFA  G+SI PGGYSP FL +Q+SQFI FK  T  L+N+L+ 
Sbjct  93    PYLSAYLNSIGSNYRHGANFAVGGASIRPGGYSPIFLGLQVSQFILFKSHTKILFNQLSD  152

Query  472   --TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ  645
               T   +K  LPR EEFSK+LYT DIGQNDL+ G Q ++  Q  +SIP I+ +FSQA+ Q
Sbjct  153   NRTESPFKSGLPRNEEFSKALYTIDIGQNDLAIGLQNTSEEQVKRSIPDILSQFSQAVQQ  212

Query  646   LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlq  825
             LY EGAR FWIHN GPIGCLP +  Y      N+D  GC   HN +AQE+NRQLK +V Q
Sbjct  213   LYNEGARVFWIHNVGPIGCLPYNNIYYPHKKGNLDVYGCVIPHNELAQEYNRQLKDKVFQ  272

Query  826   lraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETV  978
             LR +   A FT VD+Y+AKY ++SNA S GF +P  FCC         CG  K + N TV
Sbjct  273   LRRKFPLAKFTYVDVYTAKYKLISNAKSQGFVNPLEFCCGSYYGYHINCGL-KAIINGTV  331

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             YG+PC +PS+HISWDG+HYS+AAN  +A+ I+Y GSFSDPP  V +AC
Sbjct  332   YGNPCDNPSKHISWDGIHYSQAANQWVAKQILY-GSFSDPPVSVGKAC  378



>ref|XP_006852383.1| hypothetical protein AMTR_s00049p00230810 [Amborella trichopoda]
 gb|ERN13850.1| hypothetical protein AMTR_s00049p00230810 [Amborella trichopoda]
Length=379

 Score =   370 bits (949),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 241/356 (68%), Gaps = 21/356 (6%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +C FPA++NFGDSNSDTG  SA+  EV PPNGETFF KPSGR CDGRL+IDFIAENLGLP
Sbjct  28    KCEFPAIFNFGDSNSDTGAISASFFEVPPPNGETFFRKPSGRVCDGRLMIDFIAENLGLP  87

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIEL  453
             YL AYLDS+G  FRHGANFAT GS+I P       GG SPF LDIQI QF QFK R+  L
Sbjct  88    YLTAYLDSLGEGFRHGANFATGGSTIRPQNVTLFEGGVSPFSLDIQILQFDQFKSRSNAL  147

Query  454   YNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQ  633
             Y K        K  +P+PE+F K+LYTFDIGQNDL  GF+  +      SIPKI+   SQ
Sbjct  148   YVK----ENALKANVPKPEDFCKALYTFDIGQNDLVAGFRTMSDDGVRASIPKILVGLSQ  203

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  LYG+GAR+FWIHNTGPIGCLP+SV Y      N+DK GC  T N VAQEFNRQLK 
Sbjct  204   VIQLLYGQGARSFWIHNTGPIGCLPLSVIYYPLKPRNIDKYGCVYTQNDVAQEFNRQLKV  263

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMA  966
              V QLR QL  A  T VD+YSAK+ ++++A   GF DP  FCC         CG+   + 
Sbjct  264   MVSQLRKQLPLAALTYVDVYSAKFNLITHAKEQGFGDPMKFCCGHAGDYTVGCGRKAVVN  323

Query  967   NETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR*IE  1134
                +YG  C +PS ++SWDGVHYS AAN  +A  I+  G  S+PP P+ +AC+ ++
Sbjct  324   GTEIYGSSCGNPSMYVSWDGVHYSHAANQWIANHIL-NGQLSEPPLPLPQACKRVD  378



>ref|XP_002530044.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF32344.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=397

 Score =   368 bits (944),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 245/351 (70%), Gaps = 19/351 (5%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG+SAA   +  PNG + F KPSGRYCDGR +IDFIAE LGLPY
Sbjct  46    CNFPAIFNFGDSNSDTGGKSAAFHRLPYPNGYSLFKKPSGRYCDGRDIIDFIAERLGLPY  105

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             LNAYLDSIGT+FRHGANFAT GS+I P       GG+SP  LDIQ+ QF QFK+RT+ELY
Sbjct  106   LNAYLDSIGTNFRHGANFATGGSTIQPVDSRIFEGGFSPISLDIQLLQFEQFKERTLELY  165

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+  G +    + LPRPE+FSK+LYT DIGQNDL  GF      Q L+SIP I++ F+QA
Sbjct  166   NQ--GRSSYVVNSLPRPEDFSKALYTLDIGQNDLHSGFGSMTEKQVLESIPGIINHFAQA  223

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + +LY  GAR FWIHNTGPIGCLP +V        N+D+ GC  +HN ++Q+FNRQLK R
Sbjct  224   VEKLYQLGARTFWIHNTGPIGCLPYAVIKYPPEPGNMDQIGCVNSHNNISQDFNRQLKDR  283

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMAN  969
             V +LR QL  A  T  D+Y+AKY+++S + + GF DPF +CC         CG    +  
Sbjct  284   VSRLRKQLPDAALTYTDIYTAKYSLISESKNQGFADPFGYCCGHYGDYRVQCGGKATVNG  343

Query  970   ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               + GDPCS+P  +ISWDG+HYS+AAN I+A  I+  G  SDPP  + E C
Sbjct  344   TEISGDPCSNPELYISWDGIHYSQAANQIVANRIL-DGFLSDPPLFINETC  393



>emb|CBI16798.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 201/351 (57%), Positives = 244/351 (70%), Gaps = 19/351 (5%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTG  SA L  V  PNG+ F GKPSGRY DGRL+IDFIAENLGLPY
Sbjct  30    CHFPAIYNFGDSNSDTGSVSAVLRRVPFPNGQNF-GKPSGRYSDGRLIIDFIAENLGLPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYS-------PFFLDIQISQFIQFKKRTIELY  456
             LNAYLDSIGTSFRHGANFA  GS+I P           P  L+IQ+ QF QFK RT +LY
Sbjct  89    LNAYLDSIGTSFRHGANFAATGSTIQPPHLRMFEEVCYPLSLNIQLLQFAQFKARTTQLY  148

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              ++  ++   K+ LPRPE+FSK+LYT D GQNDL  GF    V Q  +SIP I+++FSQA
Sbjct  149   PQVQNSD--IKNTLPRPEDFSKALYTMDTGQNDLHDGFTSMTVEQVQKSIPNIINQFSQA  206

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + QLY +GA+ FWIHNTGPIGCLP  V       +NVD+ GC  ++N VAQEFNRQLK  
Sbjct  207   IEQLYQQGAKIFWIHNTGPIGCLPFFVINYPPKPDNVDQTGCIKSYNEVAQEFNRQLKDM  266

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------CGKNKKMANE  972
             V QLR++L  A+ T VD+YSAKY+++S A  HGF DPF  CC        CGK   +   
Sbjct  267   VSQLRSKLGDALLTYVDIYSAKYSLISEAKIHGFVDPFGQCCGQNGKFRECGKKAVVNGT  326

Query  973   TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              V G  C++PS ++SWDGVHY++AAN  +A  I+  GS SDPP P++EAC 
Sbjct  327   EVDGASCTNPSEYVSWDGVHYTDAANQWVAGHIL-NGSLSDPPLPISEACH  376



>ref|XP_007044833.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOY00665.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 2 
[Theobroma cacao]
Length=408

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 243/349 (70%), Gaps = 17/349 (5%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG+SAA G +  PNG TFF KP+GRYCDG+L+IDFIAE LGLPY
Sbjct  57    CDFPAIFNFGDSNSDTGGKSAAFGRIPLPNGNTFFHKPAGRYCDGKLIIDFIAEKLGLPY  116

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L AYLDSI  +F+HGANFATAGS+I          G+SP  LD+Q+ QF QFK+R  ELY
Sbjct  117   LGAYLDSIIANFQHGANFATAGSTIQSLDARMFKQGFSPISLDVQLLQFQQFKERINELY  176

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +  G N   K  L RPE+FS++LYTFDIGQNDLS  F+     Q +QS+P I+++ +QA
Sbjct  177   KE--GLNSNIKSKLARPEDFSRALYTFDIGQNDLSAAFKSMTEKQAVQSVPGIINQLAQA  234

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + +L+ +GAR FWIHNT PIGCLP  V        N+D+NGC  +HN VAQEFNRQLK R
Sbjct  235   VKRLHHQGARTFWIHNTSPIGCLPYQVLDYPPQTENMDQNGCIRSHNEVAQEFNRQLKER  294

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------CGKNKKMANET  975
             V QLR QL  AV T VD+YSAKY+++S A  HGF +P T+CC       C + K +    
Sbjct  295   VSQLRMQLPDAVLTYVDIYSAKYSLISEAKKHGFANPLTYCCGHYRDILCWRKKIVNGTE  354

Query  976   VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             + G  C +PS +ISWDG+HYS AANL +A   +  G FSDP  P+ EAC
Sbjct  355   ILGTSCGNPSAYISWDGIHYSHAANLWVANKAL-DGLFSDPSTPITEAC  402



>ref|XP_010248682.1| PREDICTED: GDSL esterase/lipase At5g14450 [Nelumbo nucifera]
Length=385

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 199/353 (56%), Positives = 241/353 (68%), Gaps = 23/353 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA     PPNG++FFGKPSGR CDGRL+IDFIAENLGLPY
Sbjct  33    CNFPAIYNFGDSNSDTGGISAAFQRTPPPNGQSFFGKPSGRVCDGRLIIDFIAENLGLPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDSIGT+FRHGANFAT GS       +I   G SPF LD+Q+  F QF++RT E  
Sbjct  93    LSAYLDSIGTNFRHGANFATGGSTIRRQNETIFEAGISPFSLDVQLWHFDQFQERTSEAR  152

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N    + +     LP+PEEFSK+LY  DIGQNDLS GF+    SQ   SIP I+D FS A
Sbjct  153   NTSEDSGK-----LPKPEEFSKALYILDIGQNDLSVGFRKMTDSQIRASIPDILDHFSAA  207

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYN-KDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             + QLY  GAR+FWIHNTGPIGCLPI   Y+   +   VD  GC  +HN +A EFNR LK 
Sbjct  208   VQQLYERGARSFWIHNTGPIGCLPIYRIYSPPPDPGLVDPYGCIKSHNDIAMEFNRLLKD  267

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMA  966
             +V++LR++L  A  T VD+Y+AKY ++S + S GF DP   CC         CG+N  + 
Sbjct  268   KVMKLRSELSHAALTYVDVYAAKYGLISRSNSQGFVDPQKICCGHHESYHVWCGQNAMIN  327

Query  967   NETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                VYG PC DPS +ISWD +HY+EAAN  +A  I+  GS SDPP P+ +AC 
Sbjct  328   GSEVYGAPCGDPSIYISWDSIHYTEAANHWVANHIL-DGSLSDPPLPITQACH  379



>ref|XP_010026633.1| PREDICTED: uncharacterized protein LOC104417005 [Eucalyptus grandis]
Length=886

 Score =   378 bits (970),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 245/359 (68%), Gaps = 20/359 (6%)
 Frame = +1

Query  94    GGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFI  273
              G L  R C FPA++NFGDSNSDTGG+SAA   + PPNG+TFFG  SGRYCDG++++DFI
Sbjct  47    AGPLQSRACEFPAIFNFGDSNSDTGGKSAAFHRLLPPNGDTFFGTSSGRYCDGKVILDFI  106

Query  274   AENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQF  432
             AE LGLPYL+AYLDS+GT+FRHGANFAT GS+I P       GG+SP  LDI++SQF QF
Sbjct  107   AEKLGLPYLSAYLDSMGTNFRHGANFATGGSTIQPVDTRIFEGGFSPISLDIELSQFEQF  166

Query  433   KKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPK  612
             K RT+EL+   AG +   K  LPRPE+FSK+LYT DIGQNDL    +     Q L SIP 
Sbjct  167   KARTLELH---AGKSDYAKSSLPRPEDFSKALYTMDIGQNDLHATLKSMTEKQALASIPN  223

Query  613   IMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQE  792
             I++KF+ A+ +LY +GAR FWIHNTGPIGCLP    ++    N  DKNGC A++N++AQE
Sbjct  224   ILNKFAVAVERLYQQGARAFWIHNTGPIGCLPHYFVFDPPESNATDKNGCLASYNKIAQE  283

Query  793   FNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------C  945
             FN QLK  V +LR +L       +D+YSAKY ++S A  HGF  P  +CC         C
Sbjct  284   FNMQLKTLVSKLRLRLVGTTLNYIDIYSAKYTLISEAQKHGFGGPLEYCCGHDGDYTVYC  343

Query  946   GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G+   +    V GD CSDPS+ ISWDGVHYS AAN  +A  ++  GS SD   P+ E+C
Sbjct  344   GQKAIVNGTEVVGDSCSDPSKVISWDGVHYSHAANQWVANRVV-DGSLSDVQVPLTESC  401


 Score =   323 bits (829),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 234/353 (66%), Gaps = 24/353 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +  P G +FFGKPSGR+ DG++VIDF+AE LGLP+
Sbjct  538   CRFPAIYNFGDSNSDTGGLSAAFYWLPSPYGNSFFGKPSGRFSDGQVVIDFMAEKLGLPF  597

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G+ + HGANFAT GS+I            SP  LD+Q+ QF QFK RT EL+
Sbjct  598   LSAYLDSVGSDYLHGANFATGGSTIQRIDGRAFDARLSPISLDLQLLQFQQFKARTNELF  657

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             +    +       LP P +FS +LYT DIGQNDL  GF++    Q   SIP I  +F+  
Sbjct  658   SDGVTSR------LPLPGDFSNALYTLDIGQNDLHLGFKFMTEEQARASIPNITHQFASV  711

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISV-AYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             + +LY EGAR FWIHNTGPIGC+P++    +    + VD  GC  +HN +AQEFNRQLK 
Sbjct  712   VEKLYQEGARAFWIHNTGPIGCIPLTARRISAMQPDKVDGIGCVKSHNEIAQEFNRQLKE  771

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMA  966
             RV+ LRA+L  AV T VDMYSAK+ ++S A  HGF DP  +CC         CG    + 
Sbjct  772   RVIDLRAKLTDAVLTYVDMYSAKFMLISEAKQHGFTDPLRYCCGHNGDNVVPCGMKMAVD  831

Query  967   NETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                V GD CSDPS+HISWDG+HYS AANL +A  I+  GSFSDPP  + EACR
Sbjct  832   GVEVSGDSCSDPSQHISWDGIHYSHAANLWIANKIL-DGSFSDPPVAITEACR  883



>ref|XP_009778772.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X2 [Nicotiana 
sylvestris]
Length=357

 Score =   358 bits (920),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 189/350 (54%), Positives = 241/350 (69%), Gaps = 36/350 (10%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             +  C FPA+YNFGDSNSDTGG+SAA  EV+PPN                      A+ L 
Sbjct  25    EEACGFPAIYNFGDSNSDTGGKSAAFHEVQPPN----------------------ADRLD  62

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLA  468
             LPYL+AYLDSIG  FR+GANFAT GSSILPGGYSPF+L +QISQF+QFKKRTI L N   
Sbjct  63    LPYLSAYLDSIGADFRNGANFATVGSSILPGGYSPFYLGVQISQFLQFKKRTILLSNLTI  122

Query  469   GTNQVY--KDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALY  642
               ++ +  K  +P+P++FSK++YTFDIGQNDLS+GFQ+++ +Q   SIP+I+D F+ A++
Sbjct  123   TNSKRFSSKVNIPKPDDFSKAIYTFDIGQNDLSYGFQHTHEAQVRASIPQILDNFTHAIH  182

Query  643   QLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvl  822
             QLY EGARNFWIHNTGPIGCLP SV         +D  GC  + N VA+EFN+QLK ++ 
Sbjct  183   QLYTEGARNFWIHNTGPIGCLPYSVISYPLKPQGLDATGCIESQNEVAREFNKQLKDKIS  242

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMANE  972
              LR +L  +  T VD+YSAKY ++S A   GF DP  FCC          CG+   + N 
Sbjct  243   HLRKELTYSAITYVDIYSAKYKLISTAKKQGFGDPMKFCCGWYNNGYEVACGQT-TVVNR  301

Query  973   TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             T YG  CSDP+++ISWDG+HY++AAN+ LA SI+  GSFSDPP PV ++C
Sbjct  302   TEYGKACSDPTKYISWDGIHYTDAANVWLANSIL-NGSFSDPPVPVEQSC  350



>ref|XP_006852384.1| hypothetical protein AMTR_s00049p00231110 [Amborella trichopoda]
 gb|ERN13851.1| hypothetical protein AMTR_s00049p00231110 [Amborella trichopoda]
Length=356

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 197/354 (56%), Positives = 237/354 (67%), Gaps = 26/354 (7%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +C FPA++NFGDSNSDTG  SA+  +V PPNGETFFGKP GR CDGRL++DFIAE LGLP
Sbjct  9     KCEFPAIFNFGDSNSDTGAISASFSQVAPPNGETFFGKPMGRVCDGRLIVDFIAETLGLP  68

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIEL  453
             YL AYLDS+G  F HGANFATAGS++ P       GG SPF L+ Q+ QF QFK R+  L
Sbjct  69    YLTAYLDSLGNGFSHGANFATAGSTVRPQNVTLFQGGVSPFSLNYQVLQFTQFKSRSSFL  128

Query  454   YNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQ  633
             Y K   TN      +P+PE+FSK+LYTFDIGQNDL+ GF+  +      SIP+I+   SQ
Sbjct  129   YIK-GKTN------VPKPEDFSKALYTFDIGQNDLAAGFRTISDDAVRASIPQILASISQ  181

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+  LYGEGAR FWIHNTGPIGCLP S  Y      N+DK GC  T N VAQEFNRQLK 
Sbjct  182   AIQVLYGEGARTFWIHNTGPIGCLPFSAMYYPFKPRNIDKYGCVYTQNDVAQEFNRQLKL  241

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
              V QLR QL  A  T VD+YSAK+ ++S+A   GF DP  FCC          CG++  +
Sbjct  242   MVSQLREQLPHAELTYVDVYSAKFNLISHAKEEGFVDPLKFCCGYGKDGYNAWCGRSTNV  301

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                 VY D C   S ++SWDG+HYSEAAN  +A  I + G  S+PP P+ +AC 
Sbjct  302   NGTIVY-DVCDKASMYVSWDGIHYSEAANRWIANHI-FNGQLSEPPLPLTQACH  353



>gb|KDP45345.1| hypothetical protein JCGZ_09594 [Jatropha curcas]
Length=443

 Score =   359 bits (921),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 191/348 (55%), Positives = 239/348 (69%), Gaps = 16/348 (5%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             +  C F A+Y+FGDS +DTGG SAA G V PP+GETFFGKPSGR CDGRL+IDF+AE LG
Sbjct  101   KSNCAFAAIYSFGDSFADTGGMSAAFGPVPPPHGETFFGKPSGRLCDGRLIIDFMAEYLG  160

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLA  468
             LPYL+AYLDSIGT+F  GANFA+AGSSI PG  SPFFL +Q+SQFIQFK RT ELYN   
Sbjct  161   LPYLSAYLDSIGTTFAKGANFASAGSSIRPGPRSPFFLALQVSQFIQFKARTAELYN---  217

Query  469   GTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
               N   +  LP P++FSK+LYTFDIG NDL+ GF  +   Q   + P I+ +FSQA+ +L
Sbjct  218   --NSKNRGSLPNPKDFSKALYTFDIGHNDLAFGFLNTTEDQVHLAFPDILAQFSQAVQRL  275

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlql  828
             Y EGAR F +HN GPIGC P  VA     +  +DKN CA   N   QEFNRQLK  V+QL
Sbjct  276   YIEGARAFLVHNVGPIGCDPFGVAMYPPKNTTLDKNRCAVAQNEAVQEFNRQLKDTVVQL  335

Query  829   raqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMANETV  978
             R QL  A  T +D+Y  K++++ +A + GF+DP++FCC          CG   +  N T 
Sbjct  336   RKQLPLAAITYIDVYKVKFSLIDDARNQGFEDPWSFCCGILEPKLVLFCGTKSEDNNTTR  395

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 C+DPS+ ISWDGVH+SEAAN  + +  ++ GS SDPP P+ +AC
Sbjct  396   VATSCTDPSKIISWDGVHFSEAANKWVVKK-LFDGSSSDPPVPINQAC  442


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  109  QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIA  276
            +  C F A+Y+FGDS +DTGG SAA G V PP+GETFFGKPSGR CDGRL+IDF+A
Sbjct  33   KSNCAFAAIYSFGDSFADTGGMSAAFGPVPPPHGETFFGKPSGRLCDGRLIIDFMA  88



>gb|KHG20639.1| hypothetical protein F383_04246 [Gossypium arboreum]
Length=356

 Score =   353 bits (907),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 233/347 (67%), Gaps = 36/347 (10%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SA L E+ PPN                      AE + LPY
Sbjct  30    CGFPAIYNFGDSNSDTGGISATLNEILPPN----------------------AEGIKLPY  67

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
             L+AY+DSIGT+FRHGANFAT GSS+ P G+SPF L IQISQFIQFK RT  LYN+L+   
Sbjct  68    LSAYMDSIGTNFRHGANFATGGSSVRPPGFSPFNLGIQISQFIQFKARTTTLYNRLSLNR  127

Query  478   QVYKDV--LPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
             ++   +  LPRP EFS++LYTFDIGQNDL HGFQ  +  Q   SIP I+ +FS+A++ LY
Sbjct  128   RIPLSISNLPRPAEFSQALYTFDIGQNDLGHGFQTMSEKQVRDSIPDIIGEFSKAIHILY  187

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR FWIHNTGP+GCLP +V Y K    NVDKNGC    N  A EFN+QLK ++  LR
Sbjct  188   KEGARFFWIHNTGPLGCLPYNVIYGKK-PGNVDKNGCVKAQNEAAMEFNKQLKNKITWLR  246

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
              QL  A FT VD+YSAKY +++NA   GF DPF FCC         CGK K   N TVYG
Sbjct  247   TQLPFAKFTYVDVYSAKYDLINNAKKLGFVDPFNFCCGSFYGYHINCGK-KATVNGTVYG  305

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             +PC  PS HISWDG+HYSE AN++++  I+  GS SDPP  + +AC 
Sbjct  306   NPCDHPSNHISWDGIHYSETANMLVSNRIL-NGSLSDPPVSIQDACH  351



>ref|XP_002285509.2| PREDICTED: uncharacterized protein LOC100264440 [Vitis vinifera]
Length=791

 Score =   366 bits (939),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 250/360 (69%), Gaps = 20/360 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTG  SA L  V  PNG+ F GKPSGRY DGRL+IDFIAENLGLPY
Sbjct  30    CHFPAIYNFGDSNSDTGSVSAVLRRVPFPNGQNF-GKPSGRYSDGRLIIDFIAENLGLPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPGGYS-------PFFLDIQISQFIQFKKRTIELY  456
             LNAYLDSIGTSFRHGANFA  GS+I P           P  L+IQ+ QF QFK RT +LY
Sbjct  89    LNAYLDSIGTSFRHGANFAATGSTIQPPHLRMFEEVCYPLSLNIQLLQFAQFKARTTQLY  148

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              ++  ++   K+ LPRPE+FSK+LYT D GQNDL  GF    V Q  +SIP I+++FSQA
Sbjct  149   PQVQNSD--IKNTLPRPEDFSKALYTMDTGQNDLHDGFTSMTVEQVQKSIPNIINQFSQA  206

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + QLY +GA+ FWIHNTGPIGCLP  V       +NVD+ GC  ++N VAQEFNRQLK  
Sbjct  207   IEQLYQQGAKIFWIHNTGPIGCLPFFVINYPPKPDNVDQTGCIKSYNEVAQEFNRQLKDM  266

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------CGKNKKMANE  972
             V QLR++L  A+ T VD+YSAKY+++S A  HGF DPF  CC        CGK   +   
Sbjct  267   VSQLRSKLGDALLTYVDIYSAKYSLISEAKIHGFVDPFGQCCGQNGKFRECGKKAVVNGT  326

Query  973   TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC-R*IELSMQL  1149
              V G  C++PS ++SWDGVHY++AAN  +A  I+  GS SDPP P++EAC + + L ++L
Sbjct  327   EVDGASCTNPSEYVSWDGVHYTDAANQWVAGHIL-NGSLSDPPLPISEACHKPLHLELRL  385


 Score =   311 bits (796),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 226/358 (63%), Gaps = 28/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SA  G+  PPNGETFF KP+GRY DGRLVIDF+AE LGLPY
Sbjct  438   CDFPAIFNFGDSNSDTGGLSAVYGQAPPPNGETFFHKPAGRYSDGRLVIDFMAERLGLPY  497

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLD++G++F HGANFATAGS+I P        GYSP  L+IQ  +F  F +R+ + Y
Sbjct  498   LSAYLDAVGSNFTHGANFATAGSTIRPQNTTFQQTGYSPISLNIQFYEFNDFHRRS-QTY  556

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKIMDKFS  630
                 G   V++ +LP+ E FS++LYTFDIGQNDL+ G+ + N+S  Q    +P +M++F 
Sbjct  557   RNQGG---VFEKLLPKEEFFSRALYTFDIGQNDLTAGY-FLNMSGDQVRAYVPDLMNQFK  612

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  +Y +G R+FWIHNTGP+ CLP  +         VD  GC    N VA+ FN +L 
Sbjct  613   TIIQYVYDQGGRSFWIHNTGPVACLPYILDRLPITAGQVDHIGCVGPVNDVAKYFNTKLN  672

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGK  951
               V++LR Q   A  T VD+YS KY ++S A   GF +P   CC             CG 
Sbjct  673   ETVVELRKQFPLAAITYVDVYSVKYTLISKAKELGFVEPLKACCGPGGKYNYNVKVGCGW  732

Query  952   NKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                +    V G  C DP+  I+WDG+HY+EAAN  +   I+ GG+FSDPP P+A AC 
Sbjct  733   KGVVDGREVEGTSCKDPTVKINWDGIHYTEAANKWVFDQIV-GGAFSDPPVPLAMACH  789



>ref|XP_007044832.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY00664.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
Length=843

 Score =   367 bits (942),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 196/349 (56%), Positives = 243/349 (70%), Gaps = 17/349 (5%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG+SAA G +  PNG TFF KP+GRYCDG+L+IDFIAE LGLPY
Sbjct  492   CDFPAIFNFGDSNSDTGGKSAAFGRIPLPNGNTFFHKPAGRYCDGKLIIDFIAEKLGLPY  551

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L AYLDSI  +F+HGANFATAGS+I          G+SP  LD+Q+ QF QFK+R  ELY
Sbjct  552   LGAYLDSIIANFQHGANFATAGSTIQSLDARMFKQGFSPISLDVQLLQFQQFKERINELY  611

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +  G N   K  L RPE+FS++LYTFDIGQNDLS  F+     Q +QS+P I+++ +QA
Sbjct  612   KE--GLNSNIKSKLARPEDFSRALYTFDIGQNDLSAAFKSMTEKQAVQSVPGIINQLAQA  669

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + +L+ +GAR FWIHNT PIGCLP  V        N+D+NGC  +HN VAQEFNRQLK R
Sbjct  670   VKRLHHQGARTFWIHNTSPIGCLPYQVLDYPPQTENMDQNGCIRSHNEVAQEFNRQLKER  729

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------CGKNKKMANET  975
             V QLR QL  AV T VD+YSAKY+++S A  HGF +P T+CC       C + K +    
Sbjct  730   VSQLRMQLPDAVLTYVDIYSAKYSLISEAKKHGFANPLTYCCGHYRDILCWRKKIVNGTE  789

Query  976   VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             + G  C +PS +ISWDG+HYS AANL +A   +  G FSDP  P+ EAC
Sbjct  790   ILGTSCGNPSAYISWDGIHYSHAANLWVANKAL-DGLFSDPSTPITEAC  837


 Score =   338 bits (867),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/349 (53%), Positives = 228/349 (65%), Gaps = 21/349 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C F A+Y  GDSNSDTG  SA  G V PP GETFFG+PSGRY DGRL+IDFIA+ L LP+
Sbjct  35    CHFSAIYALGDSNSDTGSVSATFGRVPPPYGETFFGRPSGRYSDGRLIIDFIADELKLPF  94

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             LNAYLD+I + + HGANFA +GS+I P        G++P  LDIQ+ QF Q K+RT ELY
Sbjct  95    LNAYLDAIESIYSHGANFAASGSTIQPADSKLVGAGFNPLSLDIQLLQFEQLKERTNELY  154

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
                 G +    D L RPEEFSK+LY  D GQNDL +G   +   Q   S+P I+ + + A
Sbjct  155   ----GQDISITDRLSRPEEFSKALYMLDCGQNDLHYGLVTTTEEQVKASVPNIISQLTVA  210

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + +LY  GAR FW+HNTGPIGCLPI V  +     N D+ GC  ++N VAQEFN+QLK R
Sbjct  211   IKKLYQNGARIFWMHNTGPIGCLPIFVINSPPKPGNADQAGCIKSYNEVAQEFNKQLKDR  270

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMAN  969
             V QLRA+L  A    VD+YSAKY+++S A  HGF  PF  CC         CGK   +  
Sbjct  271   VSQLRAKLLDARLIYVDIYSAKYSLISEANKHGFVGPFMNCCGQYGYYHVECGKASVVNG  330

Query  970   ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAE  1116
               ++G  CSDPS+HISWDG+HY+EAAN  +A  I+  GS SDPP P+  
Sbjct  331   TEIFGPSCSDPSKHISWDGIHYTEAANHWVANKIL-DGSLSDPPVPITR  378



>gb|KDO82202.1| hypothetical protein CISIN_1g017691mg [Citrus sinensis]
Length=367

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 240/352 (68%), Gaps = 19/352 (5%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTG  SAA G V  PNG+TFFGKPSGR+C GRL+IDFIAE LGLP+
Sbjct  17    CSFPAIYNFGDSNSDTGAVSAAFGRVPFPNGKTFFGKPSGRFCVGRLIIDFIAERLGLPF  76

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             LNAYLDS+  +F+HGANFA +GS+I P        G++P  L+IQ+SQF Q K+R+ ELY
Sbjct  77    LNAYLDSLQPNFQHGANFAASGSTIQPVDGKLFGAGFNPLSLNIQLSQFEQLKERSTELY  136

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+ A T+Q+ K  LPRPE+FSK+LYT D GQNDL    +     Q   SIP I+D F+ A
Sbjct  137   NQ-AKTSQI-KSNLPRPEDFSKALYTLDSGQNDLQFWLESMREEQVKASIPNIIDHFALA  194

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + +LY EGAR FWIHNTGPIGCLP  V        N D+NGC    N VAQEFN+QLK R
Sbjct  195   IEKLYQEGARKFWIHNTGPIGCLPSMVIKYPPKPGNADQNGCIRPFNEVAQEFNKQLKDR  254

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMAN  969
             V +LRAQL  AV   VD+YSAKY +++ A  HGF  PF +CC         C +   +  
Sbjct  255   VSRLRAQLHDAVLIYVDIYSAKYTLITEAKKHGFVSPFEYCCGNWREHDAECWEKVIVNG  314

Query  970   ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               V    C+DPS++ISWDG+HY+EAAN  +A  IM  GSFSDPP  +  AC+
Sbjct  315   TKVGAAICNDPSKYISWDGIHYTEAANHWIANRIM-DGSFSDPPGSIPNACK  365



>ref|XP_006483961.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Citrus sinensis]
Length=392

 Score =   353 bits (905),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 238/351 (68%), Gaps = 19/351 (5%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTG  SAA G V  PNG+TFFGKPSGR+C GRL+IDFIAE LGLP+
Sbjct  42    CSFPAIYNFGDSNSDTGAVSAAFGRVPFPNGKTFFGKPSGRFCVGRLIIDFIAERLGLPF  101

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             LNAYLDS+  +F+HGANFA +GS+I P        G++P  L+IQ+SQF Q K+R+ ELY
Sbjct  102   LNAYLDSLQPNFQHGANFAASGSTIQPVDGKLFGAGFNPLSLNIQLSQFEQLKERSTELY  161

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+ A T+Q+ K  LPRPE+FSK+LYT D GQNDL    +     Q   SIP I+D F+ A
Sbjct  162   NQ-AKTSQI-KSNLPRPEDFSKALYTLDSGQNDLQFWLESMREEQVKASIPNIIDHFALA  219

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + +LY EGAR FWIHNTGPIGCLP  V        N D+NGC    N VAQEFN+QL  R
Sbjct  220   IEKLYQEGARKFWIHNTGPIGCLPSMVIKYPPKPGNADQNGCIRPFNEVAQEFNKQLTDR  279

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMAN  969
             V +LRAQL  AV   VD+YSAKY +++ A  HGF  PF +CC         C +   +  
Sbjct  280   VSRLRAQLHDAVLIYVDIYSAKYTLITEAKKHGFVSPFEYCCGNWREHDAKCWEKVILNG  339

Query  970   ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               V    C+DPS++ISWDG+HY+EAAN  +A  IM  GSFSDPP  +  AC
Sbjct  340   TKVGAAICNDPSKYISWDGIHYTEAANHWIANRIM-DGSFSDPPGSIPNAC  389



>gb|KEH24834.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=697

 Score =   361 bits (927),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 245/346 (71%), Gaps = 13/346 (4%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +C +PA+YNFGDSNSDTG   A    V+ PNG +FFG  SGR  DGRL+IDFI E L LP
Sbjct  36    KCVYPAIYNFGDSNSDTGTVYATFTGVQSPNGISFFGNISGRASDGRLIIDFITEELKLP  95

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG-  471
             YL+AYL+S+G+++R+GANFA  G+SI PGGYSPF L +Q+SQFI FK  T  L+N+L+  
Sbjct  96    YLSAYLNSVGSNYRYGANFAVGGASIRPGGYSPFHLGLQVSQFILFKSHTKILFNQLSNN  155

Query  472   -TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
              T    K  LP PE+FSK+LYT DIGQNDL++GF++++  Q  +SIP+I+ + SQA+ QL
Sbjct  156   RTEPPLKSGLPGPEDFSKALYTIDIGQNDLAYGFRHTSEEQVQRSIPEILSQLSQAVKQL  215

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlql  828
             Y EGAR FWIHNTGPIGCLP +    +    N+D NGC    N++AQEFN++LK +V  L
Sbjct  216   YNEGARVFWIHNTGPIGCLPFNYFSYEHKKGNLDANGCVKPQNKIAQEFNKKLKDQVSYL  275

Query  829   raqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVY  981
             R +L QA FT VDMY AKY ++SNA S GF     FCC         CG  K++ N TV 
Sbjct  276   RRKLLQAKFTYVDMYKAKYELISNARSRGFVSLLDFCCGSYTGYRINCG-TKEIINGTVN  334

Query  982   GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEA  1119
              +PC++PS+HI WDG+HYS+ AN ++A  I++ GSFSDPP P+  A
Sbjct  335   RNPCTNPSQHIIWDGIHYSQRANQLIAEKIIH-GSFSDPPVPIGNA  379


 Score =   323 bits (829),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 226/325 (70%), Gaps = 8/325 (2%)
 Frame = +1

Query  154   NSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSF  333
             N+ TG   A    V+PPNG +FFG  SGR  DGRL+ID I E L LPYL+AYL+S+G+++
Sbjct  378   NAYTGTIYATYTSVQPPNGISFFGNISGRASDGRLIIDSITEELKLPYLSAYLNSVGSNY  437

Query  334   RHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAG--TNQVYKDVLPRP  507
             RHGANFA +G+SI P GY  F L +Q+SQFI FK  T  L+N+L+   T    K  LPRP
Sbjct  438   RHGANFAVSGASIRPRGYHLFNLGLQVSQFILFKSHTKILFNQLSNNRTEPSLKSGLPRP  497

Query  508   EEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNT  687
             E+FSK+LYT DIGQNDL+HGFQY++  Q  +SIP+I+  FSQ++ QLY EGAR FWIHNT
Sbjct  498   EDFSKALYTIDIGQNDLAHGFQYTSEEQVQRSIPEILSNFSQSVKQLYNEGARVFWIHNT  557

Query  688   GPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVD  867
             GPIGCLP +  Y    H  VD N C  + N++A+EFN++LK +V QLR +L QA FT VD
Sbjct  558   GPIGCLPFN--YYTYKHKKVDANDCVKSQNKIAKEFNKKLKDQVSQLRKELLQAKFTYVD  615

Query  868   MYSAKYAVVSNAGSHGFQDPFTFCCCGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAA  1047
             MY AK+ ++SNA S GF     FC    N    N TV   PC++PS++ISWDG+HYS+ A
Sbjct  616   MYKAKHELISNAKSQGFVSRLDFC---HNLYGINGTVNRYPCTNPSQYISWDGIHYSQRA  672

Query  1048  NLILARSIMYGGSFSDPPRPVAEAC  1122
             N ++A  I++ GSFS P  P+  AC
Sbjct  673   NQLIAEKIIH-GSFSHPQVPIGNAC  696



>ref|XP_002271320.2| PREDICTED: GDSL esterase/lipase At5g14450 [Vitis vinifera]
Length=392

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 201/363 (55%), Positives = 247/363 (68%), Gaps = 24/363 (7%)
 Frame = +1

Query  91    IGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDF  270
             +G GLP   C FPA+YNFGDSNSDTGG SAA   +  P GE FF KP+GR  DGR++IDF
Sbjct  31    VGMGLPS--CGFPAIYNFGDSNSDTGGISAAFLPISAPYGENFFHKPAGRDSDGRVLIDF  88

Query  271   IAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPG-------GYSPFFLDIQISQFIQ  429
             IAE+LGLPYL+AYLDSIG ++RHGANFAT GS+IL         G SPFFLD+QISQF Q
Sbjct  89    IAEHLGLPYLSAYLDSIGANYRHGANFATGGSTILRPNETIYQYGISPFFLDMQISQFDQ  148

Query  430   FKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIP  609
             FK RT +LY +    +   +D LPRPE+F K+LYTFDIGQNDLS GF+ S   Q   SIP
Sbjct  149   FKARTRDLYIQAKSPSD--RDKLPRPEDFPKALYTFDIGQNDLSVGFRQS-YGQLRASIP  205

Query  610   KIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKD-NHNNVDKNGCAATHNRVA  786
              I++KF+ A+  LY EGAR FWIHNTGPIGCLP++V Y ++     +D+ GC    N +A
Sbjct  206   DIVNKFTAAVQHLYQEGARTFWIHNTGPIGCLPVAVMYIRNPPPGMLDQYGCNKAQNEIA  265

Query  787   QEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------  942
              EFN+QLK  V++LRAQL QA  T VD+Y+AKY ++S+A   GF DP   CC        
Sbjct  266   VEFNKQLKDGVMRLRAQLPQASITYVDLYAAKYGLISDAKGQGFVDPLKICCGNRVNDYN  325

Query  943   --CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAE  1116
               CG+   +    VYG  C+ PS +ISWDGVHYS+AAN   A  I+  GS SD   P+A+
Sbjct  326   VWCGQKAIINGTEVYGSSCASPSAYISWDGVHYSQAANHWFANHIL-NGSLSDSSLPIAQ  384

Query  1117  ACR  1125
             AC 
Sbjct  385   ACH  387



>ref|XP_002300062.1| hypothetical protein POPTR_0001s35620g [Populus trichocarpa]
 gb|EEE84867.1| hypothetical protein POPTR_0001s35620g [Populus trichocarpa]
Length=384

 Score =   350 bits (898),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 192/358 (54%), Positives = 241/358 (67%), Gaps = 21/358 (6%)
 Frame = +1

Query  106   PQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENL  285
             P  RC FPA+YNFGDSNSDTGG SAA   +  P GE FF KP+GR  DGRL+IDFIAE L
Sbjct  28    PVPRCEFPAIYNFGDSNSDTGGISAAFVPISAPYGEAFFHKPAGRDSDGRLIIDFIAERL  87

Query  286   GLPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRT  444
              LPYL+AYL+SIGT++RHGANFAT GS       +I   G SPF LD+QI QF QFK RT
Sbjct  88    KLPYLSAYLNSIGTNYRHGANFATGGSTIRRQNETIFEYGISPFALDMQIVQFDQFKART  147

Query  445   IELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDK  624
              +LYN++  T    K  LPR EEFSK+LYTFDIGQNDLS GF+  +  Q   ++P I+++
Sbjct  148   TDLYNQVKSTPDAEK--LPRAEEFSKALYTFDIGQNDLSVGFRKMSFDQLRAAMPDIVNQ  205

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNr  801
              + A+  LY +G R FWIHNTGPIGCLP+++ Y  +     +D++GC    N +A EFN 
Sbjct  206   LASAVQHLYEQGGRAFWIHNTGPIGCLPVNLFYVSNPAPGYLDEHGCVKAQNEMAIEFNS  265

Query  802   qlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGK  951
             +LK R+++L+A+L +A  T VD+YSAKY ++SNA + GF DP   CC          CG 
Sbjct  266   KLKERIVRLKAELPEAAITYVDVYSAKYGLISNAKNLGFADPLKVCCGYHVNFDHIWCGN  325

Query  952   NKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               K+ +  VYG  C DPS  ISWDGVHYS+AAN  +A      GS +DPP PV +ACR
Sbjct  326   KGKVNDSVVYGASCKDPSVFISWDGVHYSQAANQWVADHTQ-NGSLTDPPIPVTQACR  382



>emb|CBI34838.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   348 bits (893),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 245/360 (68%), Gaps = 24/360 (7%)
 Frame = +1

Query  100   GLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAE  279
             GLP   C FPA+YNFGDSNSDTGG SAA   +  P GE FF KP+GR  DGR++IDFIAE
Sbjct  2     GLPS--CGFPAIYNFGDSNSDTGGISAAFLPISAPYGENFFHKPAGRDSDGRVLIDFIAE  59

Query  280   NLGLPYLNAYLDSIGTSFRHGANFATAGSSILPG-------GYSPFFLDIQISQFIQFKK  438
             +LGLPYL+AYLDSIG ++RHGANFAT GS+IL         G SPFFLD+QISQF QFK 
Sbjct  60    HLGLPYLSAYLDSIGANYRHGANFATGGSTILRPNETIYQYGISPFFLDMQISQFDQFKA  119

Query  439   RTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIM  618
             RT +LY +    +   +D LPRPE+F K+LYTFDIGQNDLS GF+ S   Q   SIP I+
Sbjct  120   RTRDLYIQAKSPSD--RDKLPRPEDFPKALYTFDIGQNDLSVGFRQS-YGQLRASIPDIV  176

Query  619   DKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKD-NHNNVDKNGCAATHNRVAQEF  795
             +KF+ A+  LY EGAR FWIHNTGPIGCLP++V Y ++     +D+ GC    N +A EF
Sbjct  177   NKFTAAVQHLYQEGARTFWIHNTGPIGCLPVAVMYIRNPPPGMLDQYGCNKAQNEIAVEF  236

Query  796   NrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------C  945
             N+QLK  V++LRAQL QA  T VD+Y+AKY ++S+A   GF DP   CC          C
Sbjct  237   NKQLKDGVMRLRAQLPQASITYVDLYAAKYGLISDAKGQGFVDPLKICCGNRVNDYNVWC  296

Query  946   GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             G+   +    VYG  C+ PS +ISWDGVHYS+AAN   A  I+  GS SD   P+A+AC 
Sbjct  297   GQKAIINGTEVYGSSCASPSAYISWDGVHYSQAANHWFANHIL-NGSLSDSSLPIAQACH  355



>ref|XP_009617551.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X2 [Nicotiana 
tomentosiformis]
Length=363

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 238/346 (69%), Gaps = 38/346 (11%)
 Frame = +1

Query  124   FPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLN  303
             FPA+YNFGDSNSDTGG+SAA  EV+PPN                      A+ L L YL+
Sbjct  36    FPAIYNFGDSNSDTGGKSAAFHEVQPPN----------------------ADRLDLQYLS  73

Query  304   AYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQV  483
             AYLDSIG  FR+GANFAT GSSILPGGYSPF+L IQISQF+QFKKR I L + L  TN  
Sbjct  74    AYLDSIGADFRNGANFATVGSSILPGGYSPFYLGIQISQFLQFKKRII-LLSDLTITNSK  132

Query  484   Y---KDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYG  654
             +   K  +P+P++FSK+LY FDIGQNDLS+GFQ+++ +Q   SIP+I+D F+QA++QLY 
Sbjct  133   WSSSKVNIPKPDDFSKALYIFDIGQNDLSYGFQHTHEAQVRASIPQILDNFTQAIHQLYT  192

Query  655   EGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlra  834
             EGARNFWIHNTGPIGCLP S+         +D  GC  + N VA+EFN+QLK R+  LR 
Sbjct  193   EGARNFWIHNTGPIGCLPYSLISYPLKPQGLDAIGCVESQNEVAREFNKQLKNRISHLRK  252

Query  835   qlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMANETVYG  984
             +L  +  T VD+YSAKY ++S +   GF DP  FCC          CG+   + N T YG
Sbjct  253   ELTHSAITYVDIYSAKYKLISTSKKQGFGDPMKFCCGWYNNGYEVACGQT-TVVNGTEYG  311

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               CSDP+++ISWDG+HY++AAN+ LA SI+  GSFSDPP P+ ++C
Sbjct  312   KACSDPTKYISWDGIHYTDAANVWLANSIL-NGSFSDPPVPIEQSC  356



>ref|XP_011003110.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Populus euphratica]
 ref|XP_011005552.1| PREDICTED: GDSL esterase/lipase At5g14450 [Populus euphratica]
 ref|XP_011005553.1| PREDICTED: GDSL esterase/lipase At5g14450 [Populus euphratica]
Length=385

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 240/354 (68%), Gaps = 21/354 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +  P GE FF KP+GR  DGR++IDFIAE L LPY
Sbjct  33    CEFPAIYNFGDSNSDTGGISAAFVPISAPYGEAFFHKPAGRDSDGRVIIDFIAERLKLPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIGT++RHGANFAT GS       +I   G SPF LD+QI QF QFK RT +LY
Sbjct  93    LSAYLNSIGTNYRHGANFATGGSTIRRQNETIFEYGISPFALDMQIVQFDQFKARTTDLY  152

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N++  T    K  LPR EEFSK+LYTFDIGQNDLS GF+  +  Q   ++P I+++ + A
Sbjct  153   NQVKSTPDAEK--LPRAEEFSKALYTFDIGQNDLSVGFRKMSFDQLRAAMPDIVNQLASA  210

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNH-NNVDKNGCAATHNRVAQEFNrqlka  813
             +  LY +G R FWIHNTGPIGCLP+++ Y  +     +D++GC    N +A EFN +LK 
Sbjct  211   VQHLYEQGGRAFWIHNTGPIGCLPVNLFYVSNPAPGYLDEHGCVKAQNEMAIEFNSKLKE  270

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             R+++L+A+L +A  T VD+YSAKY ++SNA + GF DP   CC          CG   K+
Sbjct  271   RIVRLKAELPEAAITYVDVYSAKYGLISNAKNLGFADPLKVCCGYHVNFDHIWCGNKGKV  330

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              +  VYG  C DPS  ISWDGVHYS+AAN  +A      GS +DPP PVA+ACR
Sbjct  331   NDSVVYGASCKDPSVFISWDGVHYSQAANQWVADHTQ-NGSLTDPPIPVAQACR  383



>ref|XP_011101808.1| PREDICTED: GDSL esterase/lipase At5g14450 [Sesamum indicum]
Length=398

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 242/363 (67%), Gaps = 30/363 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   + PP G ++F +P+GR  DGRL+IDFIAE+LGLPY
Sbjct  35    CDFPAIYNFGDSNSDTGGISAAFWPIPPPYGVSYFHRPAGRNSDGRLIIDFIAEHLGLPY  94

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L++YLDSIGT+FRHGANFAT GS       SI   G SPF LDIQ  QF QFK RT ELY
Sbjct  95    LSSYLDSIGTNFRHGANFATGGSTIRMQNESIFENGISPFSLDIQTMQFDQFKARTSELY  154

Query  457   N----KLAGTNQVYKD-----VLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIP  609
             +    KL   N ++ D      LPRP+EFS++LYTFDIGQND++ GF+   + Q   +IP
Sbjct  155   HQSELKLMQDN-IFLDPSSARKLPRPKEFSRALYTFDIGQNDIAAGFRKLTMPQLRAAIP  213

Query  610   KIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAY--NKDNHNNVDKNGCAATHNRV  783
              I+DKF  A+ +LY  GAR FWIHNTGPIGCLP ++ Y  N       DK GC  +HN +
Sbjct  214   DIVDKFGAAITRLYQHGARAFWIHNTGPIGCLPAAMFYVSNPSKPGFFDKYGCIRSHNAI  273

Query  784   AQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------  942
             A EFNRQLKARV  LRA+L  A  T VD+YSAKY ++SN   +GF+DPF  CC       
Sbjct  274   ALEFNRQLKARVNTLRAELPHAALTYVDIYSAKYHLISNTKIYGFRDPFKICCGHHKNNI  333

Query  943   ---CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVA  1113
                CG+   +    + G  C  P+  ISWDGVHYS+AAN  +A  I   GSFSDPP P+A
Sbjct  334   HVWCGQRVVINGSEIVGAACGSPAACISWDGVHYSQAANHWIANRIA-NGSFSDPPMPIA  392

Query  1114  EAC  1122
              AC
Sbjct  393   HAC  395



>ref|XP_006438237.1| hypothetical protein CICLE_v10031879mg [Citrus clementina]
 gb|ESR51477.1| hypothetical protein CICLE_v10031879mg [Citrus clementina]
Length=369

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 193/350 (55%), Positives = 238/350 (68%), Gaps = 20/350 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTG  SAA G V  PNG+TFFGKPSGR+C GRL+IDFIAE LGLP+
Sbjct  17    CSFPAIYNFGDSNSDTGAVSAAFGRVPFPNGKTFFGKPSGRFCVGRLIIDFIAERLGLPF  76

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             LNAYLDS+  +F+HGANFA +GS+I P        G++P  L+IQ+SQF Q K+R+ ELY
Sbjct  77    LNAYLDSLQPNFQHGANFAASGSTIQPVDGKLFGAGFNPLSLNIQLSQFEQLKERSTELY  136

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+ A T+Q+ K  LPRPE+FSK+LYT D GQNDL    +     Q   SIP I+D F+ A
Sbjct  137   NQ-AKTSQI-KSNLPRPEDFSKALYTLDSGQNDLQFWLESMREEQVKASIPNIIDHFALA  194

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + +LY EGAR FWIHNTGPIGCLP  V        N D+NGC    N VAQEFN+QL+  
Sbjct  195   IEKLYQEGARKFWIHNTGPIGCLPSMVIKYPPKPGNADQNGCIRPFNEVAQEFNKQLRDT  254

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMAN  969
             V +LRAQL  AV   VD+YSAK+ +++ A  HGF  PF +CC         C + K + N
Sbjct  255   VSRLRAQLHDAVLIYVDIYSAKFTLITEAKKHGFVSPFEYCCGNWREHDAKCWE-KVIVN  313

Query  970   ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEA  1119
              T     C+DPS++ISWDG+HY+E AN  +A  IM  GSFSDPP  +  A
Sbjct  314   GTFGAAICNDPSKYISWDGIHYTEYANHWIANGIM-DGSFSDPPGSIPNA  362



>ref|XP_010554006.1| PREDICTED: GDSL esterase/lipase At3g27950 [Tarenaya hassleriana]
Length=373

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 187/349 (54%), Positives = 233/349 (67%), Gaps = 14/349 (4%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFG+ +GR+ DGRL+IDFI+ENL L
Sbjct  24    KKCDFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSAGRHSDGRLIIDFISENLTL  83

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPGG--YSPFFLDIQISQFIQFKKRTIELYNKL  465
             PYL  YLDS+G  +R+GANFAT G+ I P G  +SPF L  Q+ QF+ FK RTI LY++ 
Sbjct  84    PYLTPYLDSVGAYYRYGANFATGGACIRPSGGCFSPFHLGTQVVQFLHFKTRTISLYSRT  143

Query  466   AGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQ  645
              G   + K+VL RP +FSK+LYTFDIGQND++ GF  S   Q   SIP+I+  F+ A+  
Sbjct  144   NGKTPLCKNVLARPNDFSKALYTFDIGQNDITIGFTNSTEEQLKASIPEIIGNFTNAIQI  203

Query  646   LYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlq  825
             LY EGAR FWIHNTGP GCLP  +    D     D+ GC    N  A EFNRQLK R+ +
Sbjct  204   LYKEGARYFWIHNTGPAGCLPYVLKSFPDTPR--DRYGCVKPLNNGAIEFNRQLKNRISE  261

Query  826   lraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETV  978
             L+ QL  AVFT VD+YSAKY ++S A S GF DPF +CC         CGK        +
Sbjct  262   LKKQLTYAVFTYVDVYSAKYTLISKAKSLGFADPFDYCCVGAIGRGMGCGKTILQNGTEL  321

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             +   C +P+ +ISWDG+H +E AN+ +A  I+  GS SD P P  EACR
Sbjct  322   FSISCKNPASYISWDGIHLTETANMWVANRIL-NGSLSDLPNPTREACR  369



>ref|XP_006470214.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Citrus sinensis]
Length=383

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 190/369 (51%), Positives = 248/369 (67%), Gaps = 29/369 (8%)
 Frame = +1

Query  82    VNGIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLV  261
             V+G+   LP   C FPA+YNFGDSNSDTGG SAA   +R P+GE FF KP+GR  DGRL+
Sbjct  21    VSGVTNKLPP--CEFPAIYNFGDSNSDTGGISAAFEPIRAPHGEGFFHKPAGRDSDGRLI  78

Query  262   IDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQ  420
             +DFIAE++ LPYL AYL+S+GT+FRHGANFAT GS       +I   G SPFFL +QI+Q
Sbjct  79    VDFIAESVKLPYLGAYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQ  138

Query  421   FIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQ  600
             F QFK RT ELY++    +   +D LPR E+F+K++YTFDIGQNDLS GF+  +  Q   
Sbjct  139   FNQFKARTKELYDEAKIASD--RDKLPRQEDFAKAMYTFDIGQNDLSVGFRKMSFDQLRA  196

Query  601   SIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN----VDKNGCAA  768
             +IP I+++ + A+  +Y +G R FWIHNTGPIGCLP +  Y   NHN     +D++GC  
Sbjct  197   AIPDIVNQLASAVQNIYQQGGRAFWIHNTGPIGCLPTNFFY---NHNPPPGFLDEHGCVK  253

Query  769   THNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--  942
               N +A EFNRQLK RV++LR +L +A  T VD+Y+ KY ++SNA + G+ DPF  CC  
Sbjct  254   DQNNMAVEFNRQLKERVIKLRTELPEAAITYVDVYATKYELISNAKTLGYADPFKVCCGY  313

Query  943   --------CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDP  1098
                     CG    +    VYG  C DPS+ ISWDGVHY++AAN  +A   +Y GS +DP
Sbjct  314   HENYHHVWCGNKATINKTEVYGASCEDPSKSISWDGVHYTQAANQWVANHTLY-GSLTDP  372

Query  1099  PRPVAEACR  1125
             P P+ +AC 
Sbjct  373   PIPITQACH  381



>gb|AFK35005.1| unknown [Lotus japonicus]
Length=382

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 185/344 (54%), Positives = 238/344 (69%), Gaps = 14/344 (4%)
 Frame = +1

Query  127   PAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNA  306
             PAVYNFGDSNSDTG   AA   ++ P G +FFG  SGR  DGRL+IDFI E L +PYL+A
Sbjct  40    PAVYNFGDSNSDTGVVYAAFAGLQSPGGISFFGNLSGRASDGRLIIDFITEELEIPYLSA  99

Query  307   YLDSIGTSFRHGANFATAGSSILPG-GYSPFFLDIQISQFIQFKKRTIELYNKLAG--TN  477
             YL+SIG+++RHGANFA  G+SI P  G+SPF+L +Q++QFIQ +     L N+ +   T 
Sbjct  100   YLNSIGSNYRHGANFAAGGASIRPVYGFSPFYLGMQVAQFIQLQSHIENLLNQFSSNRTE  159

Query  478   QVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGE  657
               +K  LPRPE+FSK+LYT DIGQNDL  G  +++  + L+SIP++M  F+  +  LY  
Sbjct  160   PPFKSYLPRPEDFSKALYTIDIGQNDLGFGLMHTSEEEVLRSIPEMMRNFTYDVQVLYDV  219

Query  658   GARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlraq  837
             GAR F IHNTGPIGCLP S  + +    N+D NGC   HN++AQEFNRQLK +V QLR  
Sbjct  220   GARVFRIHNTGPIGCLPTSSIFYEPKKGNLDANGCVIPHNKIAQEFNRQLKDQVFQLRRN  279

Query  838   lqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYGDP  990
             L +A FT VD+Y+AKY ++SNA   GF +P   CC         CGK K + N TVYG+P
Sbjct  280   LPKAKFTYVDVYTAKYELISNASKQGFVNPLEVCCGSYYGYRIDCGK-KAVVNGTVYGNP  338

Query  991   CSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             C +PS+HISWDGVHY++AAN  +A+ I   GS SDPP P+ +AC
Sbjct  339   CKNPSQHISWDGVHYTQAANKWVAKHIR-DGSLSDPPVPIGQAC  381



>ref|XP_007031628.1| Esterase, putative isoform 2 [Theobroma cacao]
 gb|EOY02554.1| Esterase, putative isoform 2 [Theobroma cacao]
Length=383

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 242/362 (67%), Gaps = 23/362 (6%)
 Frame = +1

Query  94    GGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFI  273
             G  LP   C FPA+YNFGDSNSDTGG SAA   +R P GE FF KP+GR  DGRL+IDFI
Sbjct  25    GANLPP--CEFPAIYNFGDSNSDTGGISAAFEPIRAPYGEAFFHKPAGRDSDGRLIIDFI  82

Query  274   AENLGLPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQF  432
             AE + LPYL+AYL+S+G +FRHGANFAT GS       +I   G SPF LD+QI QF QF
Sbjct  83    AERVQLPYLHAYLNSLGANFRHGANFATGGSTIRRQNETIFEYGISPFALDMQIVQFDQF  142

Query  433   KKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPK  612
             K RTIE+YN+    ++  KD LPRPE+F+K+LYTFDIGQNDLS GF+  +  Q   ++P 
Sbjct  143   KARTIEMYNQAKDPSE--KDKLPRPEDFAKALYTFDIGQNDLSVGFRKMSFDQLRAAMPD  200

Query  613   IMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQ  789
             I+++   A+  LY +G R FWIHNTGPIGCLP++  Y ++     +D+ GC    N +A 
Sbjct  201   IINQLGSAVQHLYQQGGRTFWIHNTGPIGCLPVNSFYLRNPEPGYLDQYGCVKGQNDMAM  260

Query  790   EFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------  942
             EFNRQLK R+++LR +L +A  T VD+Y+AKY+++SNA + G  DP   CC         
Sbjct  261   EFNRQLKDRIIKLRTELPEASITHVDVYTAKYSMISNAKNLGLADPLKVCCGYHVNYDHV  320

Query  943   -CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEA  1119
              CG    + N  VYG  C +PS  ISWDGVHYS+AAN  +A   +  GS +DPP P+ +A
Sbjct  321   WCGNKATINNTEVYGGSCKNPSVFISWDGVHYSQAANQFVADHTL-NGSLADPPIPITQA  379

Query  1120  CR  1125
             C 
Sbjct  380   CH  381



>ref|XP_006446637.1| hypothetical protein CICLE_v10015586mg [Citrus clementina]
 gb|ESR59877.1| hypothetical protein CICLE_v10015586mg [Citrus clementina]
Length=383

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 191/369 (52%), Positives = 247/369 (67%), Gaps = 29/369 (8%)
 Frame = +1

Query  82    VNGIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLV  261
             V+G+   LP   C FPA+YNFGDSNSDTGG SAA   +R P+GE FF KP+GR  DGRL+
Sbjct  21    VSGVTNKLPP--CEFPAIYNFGDSNSDTGGISAAFEPIRAPHGEGFFHKPAGRDSDGRLI  78

Query  262   IDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQ  420
             IDFIAE++ LPYL+AYL+S+GT+FRHGANFAT GS       +I   G SPFFL +QI+Q
Sbjct  79    IDFIAESVKLPYLSAYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQ  138

Query  421   FIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQ  600
             F QFK RT ELY++    +    D LPR E+F+K+LYTFDIGQNDLS GF+  +  Q   
Sbjct  139   FNQFKARTKELYDEAKIASDT--DKLPRQEDFAKALYTFDIGQNDLSVGFRKMSFDQLRA  196

Query  601   SIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN----VDKNGCAA  768
             +IP I+++ + A+  +Y +G R FWIHNTGPIGCLP +  Y   NHN     +D++GC  
Sbjct  197   AIPDIVNQLASAVQNIYQQGGRAFWIHNTGPIGCLPTNFFY---NHNPPPGFLDEHGCVK  253

Query  769   THNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--  942
               N +A EFNRQLK RV++LR +L +A  T VD+Y+ KY ++SNA + G+ DPF  CC  
Sbjct  254   DQNNMAVEFNRQLKERVIKLRTELPEAAITYVDVYATKYELISNAKTLGYADPFKVCCGY  313

Query  943   --------CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDP  1098
                     CG    +    VYG  C DPS+ ISWDGVHY++A N  +A   +Y GS +DP
Sbjct  314   HENYDHVWCGNKATINKTEVYGASCEDPSKSISWDGVHYTQAVNQWVANHTLY-GSLTDP  372

Query  1099  PRPVAEACR  1125
             P P+ +AC 
Sbjct  373   PIPITQACH  381



>ref|XP_009121660.1| PREDICTED: GDSL esterase/lipase At5g14450 [Brassica rapa]
Length=389

 Score =   342 bits (877),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 238/356 (67%), Gaps = 21/356 (6%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             QR C FPA+YNFGDSNSDTGG SAA   +R P G+ FF KP+GR  DGRL IDFIAE +G
Sbjct  34    QRTCTFPAIYNFGDSNSDTGGISAAFEPIRAPYGQGFFHKPAGRDSDGRLTIDFIAERVG  93

Query  289   LPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI+QF QFK R+ 
Sbjct  94    LPYLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSA  153

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKF  627
             EL++++   ++  ++ LPR EEF+K+LYTFDIGQNDLS GF+  +V Q   +IP I+   
Sbjct  154   ELFSQIKIRSE--REKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHL  211

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrq  804
             + A+  +Y +G R FWIHNTGP GCLP+++ Y        +DK+GC    N +A EFNR+
Sbjct  212   ASAVRNIYQQGGRTFWIHNTGPFGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRK  271

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK  V+ LR +L +A  T VD+YSAKY ++SN    GF +P   CC          CG  
Sbjct  272   LKETVINLRKELTRAAITYVDVYSAKYEMMSNPKKLGFANPLKVCCGYHEKYDHIWCGTK  331

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+ N  +YG PC +P+  +SWDGVHY+EAAN  +A   + GG  +DPP P+  AC
Sbjct  332   GKVNNTEIYGAPCRNPATAVSWDGVHYTEAANKHVADRTL-GGFLTDPPVPITRAC  386



>ref|XP_004298997.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   342 bits (878),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 238/353 (67%), Gaps = 20/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTG  SA    +  P G TFFGKPSGR  DGRL+IDFIA+ LGLP+
Sbjct  43    CHFPAIYNFGDSNSDTGALSAVFYRLPSPYGNTFFGKPSGRISDGRLMIDFIAQKLGLPF  102

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G +FRHGANFA  GS+ILP       G +SP  LDIQ  QF Q K R  E+ 
Sbjct  103   LSAYLDSVGANFRHGANFAIGGSTILPLDGRMFEGRFSPISLDIQFRQFAQLKARVKEVI  162

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++    +      +PRPE+FSK+LYT DIGQND+  G ++  V Q L SI  +  K +  
Sbjct  163   SQ--DKSSYVSATIPRPEDFSKALYTVDIGQNDIHAGLRWKTVDQVLASISDMTAKLALT  220

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + QLY +G R FWIHNTGP+GCLP+ +A+ +   +++D++ C  ++N VAQEFNRQLK +
Sbjct  221   IEQLYQQGGRIFWIHNTGPLGCLPLVLAHTQPEPSDLDQSDCLKSYNEVAQEFNRQLKEK  280

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMAN  969
             VL L A+L  AV T VD+Y+AKY ++S A  +GF DP   CC         CG N   AN
Sbjct  281   VLDLLAKLSDAVLTYVDIYTAKYTLISEAEKYGFIDPVGQCCGSQGDSPHHCGLNATTAN  340

Query  970   ET-VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              T V+G  CS+PS++ISWD VHYS+AAN  +A+ ++  GSFSDPP  + EACR
Sbjct  341   GTEVFGGSCSNPSKYISWDSVHYSDAANEWVAKRVI-EGSFSDPPVSITEACR  392



>ref|XP_007031630.1| Esterase, putative [Theobroma cacao]
 gb|EOY02556.1| Esterase, putative [Theobroma cacao]
Length=382

 Score =   342 bits (876),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 237/353 (67%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C F +VYNFGDSNSDTGG SAA     PP+GETFFG+P+GR  DGRL+IDFIAE+LGLP+
Sbjct  29    CNFRSVYNFGDSNSDTGGGSAAFYPAGPPSGETFFGRPAGRGSDGRLIIDFIAEHLGLPH  88

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+ YLDSIGTS+RHGANFA  GS+I P        G SPF L+IQ  Q+ QFK RT  LY
Sbjct  89    LSPYLDSIGTSYRHGANFAIGGSTIRPQNESMSLNGVSPFSLNIQFIQYNQFKARTSYLY  148

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+       Y+  LPRP++FS++LY  DIGQND++ GF+  N S+   S+P I+++ ++A
Sbjct  149   NQ--AKKNYYRKHLPRPQDFSQALYVIDIGQNDMAAGFRLKNDSEFHASMPDIVEQLTKA  206

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             +  LY +GAR FWIHNTGPIGCLP+++ Y+    + +DK GC  + N  A EFNRQLK R
Sbjct  207   VQNLYDQGARTFWIHNTGPIGCLPVTLHYHL-KPDELDKQGCLKSQNDFAIEFNRQLKVR  265

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMA  966
             V++LR +L  A  T VDMY+AKY ++  A   GF D    CC          CG   ++ 
Sbjct  266   VIKLRTELPDAALTYVDMYAAKYELIGKAKQQGFVDAAEICCGFHEDDIHVYCGNKMQLN  325

Query  967   NETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                +Y   C DPS++ISWDGVHY+EAAN  +A  I+  GSFSDPP P+  AC 
Sbjct  326   GTEIYAGSCEDPSKYISWDGVHYTEAANHWIANHII-NGSFSDPPLPITHACH  377



>gb|KDP46394.1| hypothetical protein JCGZ_10234 [Jatropha curcas]
Length=389

 Score =   342 bits (876),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 188/355 (53%), Positives = 241/355 (68%), Gaps = 22/355 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +R P GE FF KP+GR  DGRL+IDFIAE L LPY
Sbjct  36    CKFPAIYNFGDSNSDTGGISAAFEPIRAPYGEAFFHKPAGRDSDGRLIIDFIAETLKLPY  95

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIGT++RHGANFAT GS       +I   G SPF LD+QI QF QFK RT +LY
Sbjct  96    LSAYLNSIGTNYRHGANFATGGSTIRRQNETIFEYGISPFSLDMQIVQFDQFKSRTADLY  155

Query  457   NKLA-GTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQ  633
             N++   T++  K  LPRP+EF+K+LYTFDIGQNDLS GF+  ++ Q   ++P I+++ + 
Sbjct  156   NEVKNNTHEAGK--LPRPDEFAKALYTFDIGQNDLSVGFRKMSIDQLRAAMPDIINQLAT  213

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
             A+  LY +G R+FWIHNTGPIGCLP+++ Y +      +D++GC    N +A EFN +LK
Sbjct  214   AVQHLYQQGGRSFWIHNTGPIGCLPVNLFYVSNPPAGYLDEHGCIKAQNDMAVEFNSKLK  273

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKK  960
              RV++LRA+L +A  T VD+Y+AKY ++SNA + G  DP   CC          CG    
Sbjct  274   ERVVKLRAELPEAAITYVDVYAAKYGLISNAKNLGMADPLKVCCGYHVKFDHIWCGNKGS  333

Query  961   MANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             + N  VYG  C DPS  ISWDGVHY+EAAN  +A      GS +DPP P+  AC 
Sbjct  334   VNNSEVYGASCKDPSLFISWDGVHYTEAANQWVADHTQ-NGSLTDPPIPITHACH  387



>ref|XP_006446639.1| hypothetical protein CICLE_v10015574mg [Citrus clementina]
 gb|ESR59879.1| hypothetical protein CICLE_v10015574mg [Citrus clementina]
Length=385

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/357 (53%), Positives = 242/357 (68%), Gaps = 27/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +R P GE FF KP+GR  DGRL+IDFIAE++ LPY
Sbjct  33    CEFPAIYNFGDSNSDTGGISAAFEPIRVPYGEGFFHKPAGRDSDGRLIIDFIAESVKLPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+GT+FRHGANFAT GS       +I   G SPFFL +QI+QF QFK RT ELY
Sbjct  93    LSAYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQFNQFKARTKELY  152

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++    +    D LPR E+F+K+LYTFDIGQNDLS GF+  +  Q   +IP I+++ + A
Sbjct  153   DEAKIASDT--DKLPRQEDFAKALYTFDIGQNDLSVGFRKMSFDQLRAAIPDIVNQLASA  210

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN----VDKNGCAATHNRVAQEFNrq  804
             +  +Y +G R FWIHNTGPIGCLP +  Y   NHN     +D++GC    N +A EFNRQ
Sbjct  211   VQNIYHQGGRAFWIHNTGPIGCLPTNFFY---NHNPPPGYLDEHGCVKDQNNMAVEFNRQ  267

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK R+++LR +L +A  T VD+Y+ KY ++SNA + G+ DPF  CC          CG  
Sbjct  268   LKERIIKLRTELPEAAITYVDVYATKYELISNAKALGYADPFKVCCGYHENYDHVWCGNK  327

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               + N  VYG  C DPS+ ISWDGVHY++AAN  +A   +Y GS +DPP P+ +AC 
Sbjct  328   ATINNTEVYGASCKDPSKSISWDGVHYTQAANQWVANHTLY-GSLTDPPLPITQACH  383



>emb|CDY09855.1| BnaC09g43060D [Brassica napus]
Length=390

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 181/356 (51%), Positives = 238/356 (67%), Gaps = 21/356 (6%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             QR C FPA+YNFGDSNSDTGG SAA   +R P G+ FF KP+GR  DGRL IDFIAE +G
Sbjct  35    QRTCAFPAIYNFGDSNSDTGGISAAFEPIRAPYGQGFFHKPAGRDSDGRLTIDFIAERVG  94

Query  289   LPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI+QF QFK R+ 
Sbjct  95    LPYLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSA  154

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKF  627
             EL++++   ++  ++ LPR EEF+K+LYTFDIGQNDLS GF+  +V Q   +IP I+   
Sbjct  155   ELFSQIKIRSE--REKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHL  212

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrq  804
             + A+  +Y +G R FWIHNTGP GCLP+++ Y        +DK+GC    N +A EFNR+
Sbjct  213   ASAVRNIYQQGGRTFWIHNTGPFGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRK  272

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK  ++ LR +L +A  T VD+YSAKY ++SN    GF +P   CC          CG  
Sbjct  273   LKETIINLRKELTRAAITYVDVYSAKYEMMSNPKRLGFANPLKVCCGYHEKYDHIWCGTK  332

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+ N  +YG PC +P+  +SWDGVHY+EAAN  +A    +GG  +DPP P+  AC
Sbjct  333   GKVNNTEIYGAPCRNPATAVSWDGVHYTEAANKHVADRT-HGGLLTDPPVPITRAC  387



>ref|XP_009771352.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X1 [Nicotiana 
sylvestris]
Length=399

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 190/353 (54%), Positives = 239/353 (68%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   ++ P GE+FF +P+GR  DGRL+IDFIAE+L LPY
Sbjct  44    CNFPAIYNFGDSNSDTGGISAAFQPIQAPYGESFFHRPAGRLSDGRLLIDFIAEHLRLPY  103

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L AYLDSIG++FRHGANFAT GS       +I   G SPF LD+QI QF +FK RT ELY
Sbjct  104   LIAYLDSIGSNFRHGANFATGGSTIRRQNQTIFQSGISPFSLDVQIMQFHRFKARTEELY  163

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +    ++  K  LPRP EFSK+LYT DIGQ DL+ GF+  +  Q   +I  I+++FS A
Sbjct  164   RQAIDLSE--KKKLPRPREFSKALYTLDIGQTDLAVGFRQMSNIQLRAAISDIINQFSAA  221

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNV-DKNGCAATHNRVAQEFNrqlka  813
             + +LY +GAR FWIHNTGPIGCLP +  Y ++    V D  GC  + N++A EFNRQLKA
Sbjct  222   VMRLYQQGARAFWIHNTGPIGCLPTATLYLRNPKPGVLDNYGCLKSQNKMALEFNRQLKA  281

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             R+  LRA+L  A  T VD+Y+AKY ++SNA S GF +P   CC          CG+   +
Sbjct  282   RIRTLRAELGHADITYVDVYAAKYELISNANSQGFMEPHKICCGLHEGNTHVWCGQKAIV  341

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 V+G  C +PS +ISWDGVHYS+AAN  +A  I+  GSFSDPP P+  AC
Sbjct  342   RGAEVFGGACVNPSIYISWDGVHYSQAANHWIANQIL-NGSFSDPPIPITHAC  393



>ref|XP_003624763.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES80981.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=395

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 182/360 (51%), Positives = 239/360 (66%), Gaps = 28/360 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R+C FPA++NFGDSNSDTGG SAA G+   P GE+FF  P GRYCDGRL++DFIAE LGL
Sbjct  37    RKCEFPAIFNFGDSNSDTGGLSAAFGQPGYPYGESFFHHPVGRYCDGRLLVDFIAEKLGL  96

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP--------GGYSPFFLDIQISQFIQFKKRTI  447
             PYLNAYLD++G++F HGANFATAGS+I P        GG+SPF LD+Q +QF  F++RT 
Sbjct  97    PYLNAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFTQFNDFQRRTQ  156

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
                NK      +YK +LP+ E FS++LYTFDIGQNDL+ G F   +++Q    +P ++D+
Sbjct  157   FFRNK----GGIYKTLLPKAEYFSRALYTFDIGQNDLASGYFHNMSINQVKAYVPDVLDQ  212

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F   +  +Y  G R+FWIHNTGP+GCLP  +  +K   + VDK GCA  +N VA+ FN +
Sbjct  213   FKNTIKNIYAHGGRSFWIHNTGPVGCLPYIIELHKVTSDKVDKAGCAIPYNEVAKFFNHE  272

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V+QLR +L  A  T VD+YSAKY+++S A  HGF++P   CC             C
Sbjct  273   LKQAVVQLRKKLPSAAITYVDVYSAKYSLISQAYRHGFKEPLRACCGHGGKYNYNLHIGC  332

Query  946   GKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G   K+   E + G PC DPS  ++WDGVH ++AAN  +   I+  GS SDPP P+  AC
Sbjct  333   GAKVKIDGKEILIGKPCKDPSVVVNWDGVHLTQAANKWVFEQIV-DGSLSDPPIPLNMAC  391



>ref|XP_002521491.1| Esterase precursor, putative [Ricinus communis]
 gb|EEF40981.1| Esterase precursor, putative [Ricinus communis]
Length=411

 Score =   341 bits (874),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 238/359 (66%), Gaps = 21/359 (6%)
 Frame = +1

Query  100   GLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAE  279
              LP   C FPA+YNFGDSNSDTGG SAA   +R P GE FF KP+GR  DGRL+IDFIAE
Sbjct  53    ALPLPPCEFPAIYNFGDSNSDTGGISAAFEPIRAPYGEAFFHKPAGRDSDGRLIIDFIAE  112

Query  280   NLGLPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKK  438
              L LPYL+AYL+SIGT++RHGANFAT GS       +I   G SPF LD+QI QF QFK 
Sbjct  113   RLKLPYLSAYLNSIGTNYRHGANFATGGSTIRRQNETIYEYGISPFALDMQIVQFDQFKS  172

Query  439   RTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIM  618
             RT +LYN++ GT +  K  LPRPEEF+K+LYTFDIGQNDLS GF+  +  Q   ++P I+
Sbjct  173   RTADLYNQVKGTPEAEK--LPRPEEFAKALYTFDIGQNDLSVGFRKMSFDQLRAAMPDII  230

Query  619   DKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEF  795
             ++ + A+  +Y +G R FWIHNTGPIGCLP+++ Y  +     +D+ GC    N +A EF
Sbjct  231   NQLATAVQHIYQQGGRAFWIHNTGPIGCLPVNLFYVSNPPPGYLDELGCVKAQNEMAVEF  290

Query  796   NrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------C  945
             N +LK RV +LRA+L +A  T VD+++AKY ++ +A + G  DP   CC          C
Sbjct  291   NSKLKERVTRLRAELPEAAITYVDVHAAKYELIRDAKTLGLADPLKVCCGYHVKFDHIWC  350

Query  946   GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G    + N  VYG PC DPS  +SWDGVHYS+ AN  +A      GS +DPP P+  AC
Sbjct  351   GNKGVVNNTDVYGAPCKDPSVFVSWDGVHYSQFANQWVADHTQ-NGSLADPPIPIIHAC  408



>ref|XP_009771353.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   340 bits (872),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 190/353 (54%), Positives = 238/353 (67%), Gaps = 23/353 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   ++ P GE+FF +P+GR  DGRL+IDFIAE+L LPY
Sbjct  44    CNFPAIYNFGDSNSDTGGISAAFQPIQAPYGESFFHRPAGRLSDGRLLIDFIAEHLRLPY  103

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L AYLDSIG++FRHGANFAT GS       +I   G SPF LD+QI QF +FK RT ELY
Sbjct  104   LIAYLDSIGSNFRHGANFATGGSTIRRQNQTIFQSGISPFSLDVQIMQFHRFKARTEELY  163

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +    +   K  LPRP EFSK+LYT DIGQ DL+ GF+  +  Q   +I  I+++FS A
Sbjct  164   RQ----DLSEKKKLPRPREFSKALYTLDIGQTDLAVGFRQMSNIQLRAAISDIINQFSAA  219

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNV-DKNGCAATHNRVAQEFNrqlka  813
             + +LY +GAR FWIHNTGPIGCLP +  Y ++    V D  GC  + N++A EFNRQLKA
Sbjct  220   VMRLYQQGARAFWIHNTGPIGCLPTATLYLRNPKPGVLDNYGCLKSQNKMALEFNRQLKA  279

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             R+  LRA+L  A  T VD+Y+AKY ++SNA S GF +P   CC          CG+   +
Sbjct  280   RIRTLRAELGHADITYVDVYAAKYELISNANSQGFMEPHKICCGLHEGNTHVWCGQKAIV  339

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 V+G  C +PS +ISWDGVHYS+AAN  +A  I+  GSFSDPP P+  AC
Sbjct  340   RGAEVFGGACVNPSIYISWDGVHYSQAANHWIANQIL-NGSFSDPPIPITHAC  391



>dbj|BAK03632.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   340 bits (871),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 246/370 (66%), Gaps = 32/370 (9%)
 Frame = +1

Query  88    GIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVID  267
             G+G G     C FPAV+NFGDSNSDTGG SAA G   PPNG TFFG P+GRYCDGRLV+D
Sbjct  30    GVGAG---ADCHFPAVFNFGDSNSDTGGLSAAFGAAPPPNGRTFFGMPAGRYCDGRLVVD  86

Query  268   FIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFI  426
             FIAENLG+PYL+AYL+SIG++F  GANFATAGS+I          G+SP  LD+Q  +F 
Sbjct  87    FIAENLGIPYLSAYLNSIGSNFSQGANFATAGSTISRQNTSLFLSGFSPISLDVQSWEFE  146

Query  427   QFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQ  600
             QF  R+  +YN   G   +Y+++LP+ E F+++LYTFDIGQNDL+ G+ ++N++  Q + 
Sbjct  147   QFINRSQFVYNNKGG---IYRELLPKAEYFTQALYTFDIGQNDLTAGY-FANMTTDQVIA  202

Query  601   SIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNR  780
             SIP++M++ +  +  ++G G RNFWIH+TGPIGCLP ++ +  D     D  GC+ T+N+
Sbjct  203   SIPELMERIASIIKSVHGLGGRNFWIHSTGPIGCLPYALIHRPDIAAVKDNVGCSVTYNK  262

Query  781   VAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC------  942
             VAQ FN++LK  V +LR     A FT VD+Y+AKY ++S A + GF DP   CC      
Sbjct  263   VAQLFNQRLKETVARLRKTYPDAAFTYVDVYAAKYKLISQASNLGFDDPLLTCCGHDAGP  322

Query  943   --------CGKNKKMANE-TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSD  1095
                     CG    +  +  V G  C DPSR +SWDG+H++EAAN  +   I+ GG  SD
Sbjct  323   YNLDPKVGCGGKVLVKGKWVVLGKSCDDPSRRVSWDGIHFTEAANKFVFDQIVSGG-LSD  381

Query  1096  PPRPVAEACR  1125
             PP P+ +ACR
Sbjct  382   PPVPLRQACR  391



>ref|XP_009771354.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform X3 [Nicotiana 
sylvestris]
Length=394

 Score =   339 bits (870),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 190/353 (54%), Positives = 237/353 (67%), Gaps = 26/353 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   ++ P GE+FF +P+GR  DGRL+IDFIAE+L LPY
Sbjct  44    CNFPAIYNFGDSNSDTGGISAAFQPIQAPYGESFFHRPAGRLSDGRLLIDFIAEHLRLPY  103

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L AYLDSIG++FRHGANFAT GS       +I   G SPF LD+QI QF +FK RT ELY
Sbjct  104   LIAYLDSIGSNFRHGANFATGGSTIRRQNQTIFQSGISPFSLDVQIMQFHRFKARTEELY  163

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +        K  LPRP EFSK+LYT DIGQ DL+ GF+  +  Q   +I  I+++FS A
Sbjct  164   RQ-------EKKKLPRPREFSKALYTLDIGQTDLAVGFRQMSNIQLRAAISDIINQFSAA  216

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNV-DKNGCAATHNRVAQEFNrqlka  813
             + +LY +GAR FWIHNTGPIGCLP +  Y ++    V D  GC  + N++A EFNRQLKA
Sbjct  217   VMRLYQQGARAFWIHNTGPIGCLPTATLYLRNPKPGVLDNYGCLKSQNKMALEFNRQLKA  276

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             R+  LRA+L  A  T VD+Y+AKY ++SNA S GF +P   CC          CG+   +
Sbjct  277   RIRTLRAELGHADITYVDVYAAKYELISNANSQGFMEPHKICCGLHEGNTHVWCGQKAIV  336

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 V+G  C +PS +ISWDGVHYS+AAN  +A  I+  GSFSDPP P+  AC
Sbjct  337   RGAEVFGGACVNPSIYISWDGVHYSQAANHWIANQIL-NGSFSDPPIPITHAC  388



>gb|KGN59717.1| hypothetical protein Csa_3G840430 [Cucumis sativus]
Length=379

 Score =   339 bits (869),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 234/356 (66%), Gaps = 21/356 (6%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA+YNFGDSNSDTGG SAA      P G+TFF K +GR CDGRL+IDFIA+ L L
Sbjct  27    RACNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFHKTAGRGCDGRLIIDFIAKQLEL  86

Query  292   PYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+AYL+SIGT+FRHGANFAT GS       S+   G SPF LDIQ+ QF QFK RTI+
Sbjct  87    PYLSAYLNSIGTNFRHGANFATGGSTIRRQNESVFENGISPFSLDIQVVQFRQFKNRTID  146

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
              Y  +   +   +  LP PEEFSK+L+T DIGQNDLS GF+     Q  ++IP I+++F+
Sbjct  147   RY--VEAIDDSIRSTLPVPEEFSKALFTIDIGQNDLSAGFRKMTNDQFRKAIPDIINEFA  204

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISV-AYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
              A+  LY EGAR FW+HNTGPIGC+P+++ + +     ++D+NGC    N  A EFNRQL
Sbjct  205   TAVEDLYKEGARAFWVHNTGPIGCIPVAIRSVSNPKEGDLDRNGCVKEQNDAALEFNRQL  264

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNK  957
             K RV++LRA L  A    VD+Y+AK  +++NA   GF +    CC          CG  K
Sbjct  265   KERVVKLRANLLDASLVYVDVYAAKIKLIANAKEEGFMEKGAICCGYHEGLNHVWCGNRK  324

Query  958   KMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              +    VY   C DPS+ ISWDGVHY+EAAN  +A  I+  GSFSDP  P+  ACR
Sbjct  325   TINGSEVYAGSCEDPSKFISWDGVHYTEAANQWIANQIV-KGSFSDPQVPIMHACR  379



>ref|XP_004158356.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cucumis sativus]
Length=357

 Score =   337 bits (865),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 233/356 (65%), Gaps = 21/356 (6%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA+YNFGDSNSDTGG SAA      P G+TFF K +GR CDGRL+IDFIA+ L L
Sbjct  5     RACNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFHKTAGRGCDGRLIIDFIAKQLEL  64

Query  292   PYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+AYL+SIGT+FRHGANFAT GS       S+   G SPF LDIQ+ QF QFK RTI+
Sbjct  65    PYLSAYLNSIGTNFRHGANFATGGSTIRRQNESVFENGISPFSLDIQVIQFRQFKNRTID  124

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
              Y  +   +   +  LP PEEFSK+L+T DIGQNDLS GF+     Q  ++IP I+ +F+
Sbjct  125   RY--VEAIDDSIRSTLPVPEEFSKALFTIDIGQNDLSAGFRKMTNDQFRKAIPDIISEFA  182

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISV-AYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
              A+  LY EGAR FW+HNTGPIGC+P+++ + +     ++D+NGC    N  A EFNRQL
Sbjct  183   TAVEDLYKEGARAFWVHNTGPIGCIPVAIRSVSNPKEGDLDRNGCVKEQNDAALEFNRQL  242

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNK  957
             K RV++LRA L  A    VD+Y+AK  +++NA   GF +    CC          CG  K
Sbjct  243   KERVVKLRANLLDASLVYVDVYAAKIKLIANAKEEGFMEKGAICCGYHEGLNHVWCGNRK  302

Query  958   KMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              +    VY   C DPS+ ISWDGVHY+EAAN  +A  I+  GSFSDP  P+  ACR
Sbjct  303   TINGSEVYAGSCEDPSKFISWDGVHYTEAANQWIANQIV-KGSFSDPQVPIMHACR  357



>ref|XP_008341370.1| PREDICTED: GDSL esterase/lipase At5g14450 [Malus domestica]
Length=382

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 235/353 (67%), Gaps = 20/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   ++PPNGE FF KP+GR  DGRLVIDFIAE L LPY
Sbjct  29    CSFPAIYNFGDSNSDTGGISAAFEPIKPPNGEAFFHKPAGRAADGRLVIDFIAERLKLPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+GT++RHGANFAT GS       +I   G SPF LD+Q +QF+QFK RT +LY
Sbjct  89    LSAYLNSLGTNYRHGANFATGGSTIRRPNETIFENGISPFSLDMQTAQFLQFKARTADLY  148

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +    +Q  +  LP P++F+K+LYTFDIGQNDLS GF+  +  Q    +P I+++ + A
Sbjct  149   RQAKNPSQ--RSALPNPZDFAKALYTFDIGQNDLSSGFRKLSFDQLRAQLPDIVNQLATA  206

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlka  813
             ++++Y EG R FWIHNTGP+GCLPI + YN +     +D +GC    N +A EFNRQL+ 
Sbjct  207   VHRIYEEGGRTFWIHNTGPVGCLPIQLFYNLNPPPGFLDDHGCVXAQNNIAVEFNRQLRD  266

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             RV +LRA+L  A  T VD+++AKY ++  A + GF +P   CC          CG     
Sbjct  267   RVTKLRAELPXAAITYVDVFAAKYGLIGTAKTEGFAEPMKVCCGYHVKYDHVWCGNKGSA  326

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             +   VYG  C +PS  ISWDGVHY++ AN  +A  I+ G   S+P  P+ +AC
Sbjct  327   SGREVYGASCQNPSAFISWDGVHYTQGANQWVANRILNGSPSSNPAIPITQAC  379



>ref|XP_006470213.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Citrus sinensis]
Length=383

 Score =   337 bits (865),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 240/357 (67%), Gaps = 27/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +R P GE FF KP+GR  DGRL++DFIAE++ LPY
Sbjct  31    CEFPAIYNFGDSNSDTGGISAAFEPIRVPYGEGFFHKPAGRDSDGRLIVDFIAESVKLPY  90

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L AYL+S+GT+FRHGANFAT GS       +I   G SPFFL +QI+QF QFK RT ELY
Sbjct  91    LGAYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQFNQFKARTKELY  150

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++    +   +D LPR E+F+K+LYTFDIGQNDLS GF+  +  Q   ++P I+++ + A
Sbjct  151   DEAKIASD--RDKLPRQEDFAKALYTFDIGQNDLSVGFRKMSFDQLRAALPSIVNQLASA  208

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN----VDKNGCAATHNRVAQEFNrq  804
             +  +Y +G R FWIHNTGPIGCLP +  Y   NHN     +D +GC    N +A EFNRQ
Sbjct  209   VQNIYQQGGRAFWIHNTGPIGCLPTNFFY---NHNPPPGYLDDHGCVKDQNNMAVEFNRQ  265

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK RV++LR +L +A  T VD+Y+ KY ++ NA + G+ DPF  CC          CG  
Sbjct  266   LKERVIKLRTELPEAAITYVDVYATKYDLIGNAKTLGYADPFKVCCGYHENYDHVWCGNK  325

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               + N  VYG  C DPS+ ISWDGVHY++AAN  +A   +Y GS +DPP P+ +AC 
Sbjct  326   ATINNTEVYGASCKDPSKSISWDGVHYTQAANQWVANHTLY-GSLTDPPIPITQACH  381



>dbj|BAG09557.1| acetylcholinesterase [Macroptilium atropurpureum]
Length=382

 Score =   337 bits (863),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 239/353 (68%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SA+   +  P GE FF KPSGR CDGRL+IDFIAE L LPY
Sbjct  30    CTFPAIYNFGDSNSDTGGISASFVPIPAPYGEGFFHKPSGRDCDGRLIIDFIAEKLNLPY  89

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+GT++RHGANFAT GS       +I   G SPF LDIQI QF QFK RT +LY
Sbjct  90    LSAYLNSLGTNYRHGANFATGGSTIRRQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  149

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +   + +  +  LP PEEF+K+LYTFDIGQNDLS GF+  N  Q  +S+P I+++ + A
Sbjct  150   EEAKTSFE--RSRLPVPEEFAKALYTFDIGQNDLSVGFRKMNFDQIRESMPDILNQLANA  207

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlka  813
             +  +Y +G R+FWIHNT P GC+P+ + Y  +  +  +D+ GC    N +A EFN+Q+K 
Sbjct  208   VKNIYQQGGRSFWIHNTSPFGCMPVQLFYKHNIPSGYLDQYGCVKDQNEMATEFNKQMKD  267

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             R+++LR +L +A  T VD+Y+AKYA++SN  + GF DP   CC          CG     
Sbjct  268   RIIKLRTELPEAAITYVDVYAAKYALISNTKTEGFVDPMKICCGYHVNDTHIWCGNLGSA  327

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               + V+G  C +PS++ISWD VHY+EAAN  +A  I+  GSF+DPP P+ +AC
Sbjct  328   DGKDVFGSACENPSQYISWDSVHYAEAANHWVANRIL-NGSFTDPPTPITQAC  379



>gb|EMT15425.1| GDSL esterase/lipase [Aegilops tauschii]
Length=396

 Score =   337 bits (864),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 239/360 (66%), Gaps = 28/360 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG SAA G   PPNG TFFG P+GRYCDGRLVIDFIAENLG+PY
Sbjct  37    CHFPAVFNFGDSNSDTGGLSAAFGAAPPPNGRTFFGMPAGRYCDGRLVIDFIAENLGIPY  96

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+G++F  GANFATAGS+I          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  97    LSAYLNSVGSNFSQGANFATAGSTISRQNTSLFLSGFSPISLDVQSWEFEQFINRSQFVY  156

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKIMDKFS  630
             N   G   +Y+++LP+ E FS++LYTFDIGQND++ G+ ++N++  Q +  IP++M++ +
Sbjct  157   NNKGGG--IYRELLPKAEYFSQALYTFDIGQNDITAGY-FANMTTEQVVAFIPELMERLT  213

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  ++G G RNFWIH+TGPIGCLP ++    D     DK GC+ T+N+VAQ FN++LK
Sbjct  214   SIIQNVHGFGGRNFWIHSTGPIGCLPYALIRRPDIAAVKDKVGCSVTYNKVAQLFNQRLK  273

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CG  948
               V +LR     A FT VD+Y+AKY ++S A   GF DP   CC              CG
Sbjct  274   ETVARLRKTYPDAAFTYVDVYAAKYKLISQASKLGFDDPLLTCCGHDAGPYNFDPKVGCG  333

Query  949   KNKKMANE-TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                 +  +  V G  C DP R +SWDGVH++EAAN  +   I+ GG  SDPP P+ +ACR
Sbjct  334   GKVLVKGKWVVLGKSCDDPGRRVSWDGVHFTEAANKFVFNQIV-GGGLSDPPMPLRQACR  392



>gb|KDO49031.1| hypothetical protein CISIN_1g016659mg [Citrus sinensis]
Length=385

 Score =   337 bits (863),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 241/357 (68%), Gaps = 27/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +R P GE FF KP+GR  DGRL+IDFIAE++ LPY
Sbjct  33    CEFPAIYNFGDSNSDTGGISAAFEPIRVPYGEGFFHKPAGRDSDGRLIIDFIAESVKLPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L++YL+S+GT+FRHGANFAT GS       +I   G SPFFL +QI+QF QFK RT ELY
Sbjct  93    LSSYLNSLGTNFRHGANFATGGSTIGKPNETIYEYGISPFFLGMQITQFNQFKARTKELY  152

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++    +   +D LPR E+F+K+LYTFDIGQNDLS GF+  +  Q   ++P I+++ + A
Sbjct  153   DEAKIASD--RDKLPRQEDFAKALYTFDIGQNDLSVGFRKMSFDQLRVALPNIVNQLASA  210

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN----VDKNGCAATHNRVAQEFNrq  804
             +  +Y +G R FWIHNTGPIGCLP +  Y   NHN     +D +GC    N +A EFNRQ
Sbjct  211   VQNIYQQGGRAFWIHNTGPIGCLPTNFFY---NHNPPPGYLDDHGCVKDQNNMAVEFNRQ  267

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK RV++LR +L +A  T VD+Y+ KY ++ NA + G+ DPF  CC          CG  
Sbjct  268   LKERVIKLRTELPEAAVTYVDVYATKYDLIGNAKTLGYADPFKVCCGYHENYDHVWCGNK  327

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               + N  VYG  C DPS+ ISWDGVHY++AAN  +A   +Y GS +DPP P+ +AC 
Sbjct  328   ATINNTEVYGASCKDPSKSISWDGVHYTQAANQWVANHTLY-GSLTDPPIPITQACH  383



>emb|CDP13238.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 180/352 (51%), Positives = 237/352 (67%), Gaps = 17/352 (5%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             + C FPA++NFGDSNSDTG  SAA G V  PNG TFFG+PSGRYCDGRL++DF+AE L +
Sbjct  50    KDCHFPAIFNFGDSNSDTGAVSAAFGRVPFPNGITFFGRPSGRYCDGRLIVDFLAEELEM  109

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+AYLDSIG +FRHGAN+A +G++I          G++P  L +Q+SQF QF  RT E
Sbjct  110   PYLSAYLDSIGANFRHGANYAASGTTIHLTDAQLYGAGFNPLSLSVQLSQFEQFTARTRE  169

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
             LYN+    + +  + LP PE+FS+++YT DIGQNDL          Q    I  I+D+FS
Sbjct  170   LYNQSKTASII--NTLPDPEDFSRAIYTVDIGQNDLHFALTTMKDKQVQAFISGIIDQFS  227

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
              ++  LY  GAR FWIHNTGPIGCLP  V  +     N D+NGC  ++N+VAQ+FN +L+
Sbjct  228   WSIENLYRNGARAFWIHNTGPIGCLPFFVIPHPPKPGNTDQNGCIISYNQVAQQFNNELR  287

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------CGKNKKMAN  969
              RV +LR QLQ A    VD+YSAKY+++SNA  +GF  P   CC       CG  + +  
Sbjct  288   VRVSRLRDQLQDASIIYVDIYSAKYSLISNAKKYGFPLPLQSCCGKIGIVDCGYKEMVNG  347

Query  970   ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               V+GD C++PS +ISWDG+HY+EAAN  +A  I+  GSFS+P   +AEAC+
Sbjct  348   TEVHGDSCNEPSTYISWDGIHYTEAANKWVASKIL-DGSFSEPKVSIAEACQ  398



>ref|XP_007159263.1| hypothetical protein PHAVU_002G223300g [Phaseolus vulgaris]
 gb|ADR66028.1| acetylcholinesterase [Afgekia filipes]
 gb|ESW31257.1| hypothetical protein PHAVU_002G223300g [Phaseolus vulgaris]
Length=382

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 236/356 (66%), Gaps = 27/356 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SA+   +  P GE FF KPSGR CDGRL+IDFIAE L LPY
Sbjct  30    CSFPAIYNFGDSNSDTGGISASFVPIPAPYGEGFFHKPSGRDCDGRLIIDFIAEKLNLPY  89

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+GT++RHGANFAT GS       +I   G SPF LDIQI QF QFK RT +LY
Sbjct  90    LSAYLNSLGTNYRHGANFATGGSTIRKQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  149

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +      + +  LP PEEFSK+LYTFDIGQNDLS GF+  N  Q  +S+P I+++ + A
Sbjct  150   EE--AKTPLERSKLPVPEEFSKALYTFDIGQNDLSVGFRKMNFDQIRESMPDIVNQLANA  207

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHN----NVDKNGCAATHNRVAQEFNrq  804
             +  +Y +G R+FWIHNT P GC+P+ + Y    HN     +D+ GC    N +A EFN+ 
Sbjct  208   VKNIYEQGGRSFWIHNTSPFGCMPVQLFY---KHNIPIGYLDQYGCVKDQNEMATEFNKH  264

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK R+++LR +L QA  T VD Y+AKYA++SN  + GF DP   CC          CG  
Sbjct  265   LKDRIIKLRTELPQAAITYVDAYAAKYALISNTKTEGFVDPMKICCGYHVNDTHIWCGNL  324

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                  + V+G  C +PS++ISWD VHY+EAAN  +A  I+  GSF+DPP P+ +AC
Sbjct  325   GSADGKDVFGSACENPSQYISWDSVHYAEAANHWVANRIL-NGSFTDPPTPITQAC  379



>ref|XP_008230503.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X2 [Prunus 
mume]
Length=382

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 196/390 (50%), Positives = 257/390 (66%), Gaps = 31/390 (8%)
 Frame = +1

Query  13    MEIWKRILVFEmmlmslglmgclVNGIGG-GLPQRRCWFPAVYNFGDSNSDTGGRSAALG  189
             ME+WK ++       S   +   V G GG  LP   C FPA+YNFGDSNSDTGG SAA  
Sbjct  1     MELWKLLVA------SGFFLASWVLGAGGENLPV--CSFPAIYNFGDSNSDTGGISAAFE  52

Query  190   EVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-  366
              +R P GE FF KP+GR  DGRL+IDFIAE L LPYL+AYL+S+GT++RHGANFAT GS 
Sbjct  53    PIRAPYGEAFFHKPAGRDSDGRLIIDFIAERLRLPYLSAYLNSLGTNYRHGANFATGGST  112

Query  367   ------SILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSL  528
                   +I   G SPF LD+Q +QF+QFK R+ ELY +    N   +  LP P++F+K+L
Sbjct  113   IRRPNETIYEYGISPFSLDMQTTQFLQFKARSAELYRE--AKNPSDRSTLPNPQDFAKAL  170

Query  529   YTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLP  708
             YTFDIGQNDLS GF+  +  Q   ++P I+++ + A+ ++Y +G R+FWIHNTGPIGCLP
Sbjct  171   YTFDIGQNDLSVGFRKLSFDQIRAALPDILNQLATAVRRIYEQGGRSFWIHNTGPIGCLP  230

Query  709   ISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKY  885
             +++ YN +     +D +GC    N +A EFNRQLK RV++LRA+L QA  T VD+Y+AKY
Sbjct  231   VNLFYNLNPPPGYLDDHGCVKGQNDIAIEFNRQLKDRVIKLRAELPQAAITYVDVYAAKY  290

Query  886   AVVSNAGSHGFQDPFTFCC----------CGKNKKMAN-ETVYGDPCSDPSRHISWDGVH  1032
              ++S+A + GF DP   CC          CG NK M N   VYG  C  PS +ISWDGVH
Sbjct  291   GLISSAKTEGFADPMKVCCGYHVKYDHVWCG-NKGMVNGSEVYGPSCQTPSSYISWDGVH  349

Query  1033  YSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             Y++ AN  +A  I+ G   S+PP P+ +AC
Sbjct  350   YTQGANQWVANHILNGSLSSNPPTPITQAC  379



>ref|XP_009370349.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Pyrus x bretschneideri]
Length=382

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 234/353 (66%), Gaps = 20/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   ++PPNGE FF KP+GR  DGRLVIDFIAE L LPY
Sbjct  29    CSFPAIYNFGDSNSDTGGISAAFEPIKPPNGEAFFNKPAGRAADGRLVIDFIAERLKLPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+GT++RHGANFAT GS       +I   G SPF LD+Q +QF+QFK RT +LY
Sbjct  89    LSAYLNSLGTNYRHGANFATGGSTVRRPNETIFENGISPFSLDMQTAQFLQFKARTADLY  148

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +    +Q  +  LP P++F+K+LYTFDIGQNDLS GF+  +  Q    +P I+ + + A
Sbjct  149   RQAKNPSQ--RSALPNPQDFAKALYTFDIGQNDLSAGFRKLSFDQLRAQLPDIVSQLAIA  206

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlka  813
             ++++Y EG R FWIHNTGP+GCLPI + YN +     +D +GC    N +A EFNRQL+ 
Sbjct  207   VHRIYEEGGRTFWIHNTGPVGCLPIQLFYNLNPPRGFLDDHGCVKAQNDIAVEFNRQLRD  266

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             RV +LRA+L QA  T VD+++AKY ++  A + GF +P   CC          CG     
Sbjct  267   RVTKLRAELPQAAITYVDVFAAKYGLIGTAKTEGFAEPMKVCCGYHVKYDHVWCGNKGSA  326

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             +   VYG  C +PS  ISWDG+HY++ AN  +A  I+ G   S P  P+ +AC
Sbjct  327   SGREVYGASCQNPSAFISWDGIHYTQGANQWVANRILNGSPSSIPAIPITQAC  379



>gb|KFK33714.1| hypothetical protein AALP_AA5G050500 [Arabis alpina]
Length=382

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 228/352 (65%), Gaps = 16/352 (5%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
              + C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFGK  GR+ DGRL+IDFI ENL 
Sbjct  30    HKSCNFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGKSQGRHSDGRLIIDFITENLT  89

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYN-  459
             LPYL  YLDS+G ++RHGANFAT GS + P    +S F L  Q+SQFI FK RT+ LYN 
Sbjct  90    LPYLTPYLDSVGANYRHGANFATGGSCVRPTVACFSQFHLGTQVSQFIHFKSRTLSLYNQ  149

Query  460   -KLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              K +G     K+VL RP++FSK+LYTFDIGQNDL+ GFQ     Q   +IP I++ F+ A
Sbjct  150   TKASGKTPFCKEVLARPKDFSKALYTFDIGQNDLAIGFQNMTEEQLKATIPNIIENFTIA  209

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             L  LY EGAR F IHNTGP GCLP  +          D+ GC    N VA EFN+QLK +
Sbjct  210   LKLLYKEGARFFSIHNTGPTGCLPYLL--KSFTATPRDQYGCLVPLNNVAIEFNKQLKNK  267

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMAN  969
             + +L  +L  ++FT VD+YSAKY +++ +   GF DPF +CC         CGK      
Sbjct  268   ISELNKELPSSLFTYVDVYSAKYNLITKSKKFGFVDPFDYCCVGAVGRGMGCGKTIFPNG  327

Query  970   ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               +Y   C +    ISWDG+HY+E AN+++A  I+  GS SDPP P  +AC+
Sbjct  328   TELYSSSCQNRKNFISWDGIHYTETANMLVANQIL-DGSISDPPLPTQKACK  378



>ref|XP_007215529.1| hypothetical protein PRUPE_ppa007107mg [Prunus persica]
 gb|EMJ16728.1| hypothetical protein PRUPE_ppa007107mg [Prunus persica]
Length=382

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 196/391 (50%), Positives = 256/391 (65%), Gaps = 31/391 (8%)
 Frame = +1

Query  13    MEIWKRILVFEmmlmslglmgclVNGIGG-GLPQRRCWFPAVYNFGDSNSDTGGRSAALG  189
             ME+WK ++       S   +   V G GG  LP   C FPA+YNFGDSNSDTGG SAA  
Sbjct  1     MELWKLLVA------SGFFLASWVLGAGGENLPA--CSFPAIYNFGDSNSDTGGISAAFE  52

Query  190   EVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-  366
              +R P GE FF KP+GR  DGRL+IDFIAE L LPYL+AYL+S+GT++RHGANFAT GS 
Sbjct  53    PIRAPYGEAFFHKPAGRDSDGRLIIDFIAERLRLPYLSAYLNSLGTNYRHGANFATGGST  112

Query  367   ------SILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSL  528
                   +I   G SPF LD+Q +QF+QFK R+ ELY +    +   +  LP P++F+K+L
Sbjct  113   IRRPNETIYEYGISPFSLDMQTTQFLQFKARSAELYRQAKDPSD--RSTLPNPQDFAKAL  170

Query  529   YTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLP  708
             YTFDIGQNDLS GF+  +  Q   ++P I+ + + A+ ++Y +G R+FWIHNTGPIGCLP
Sbjct  171   YTFDIGQNDLSVGFRKLSFDQIRAALPDILSQLATAVRRIYEQGGRSFWIHNTGPIGCLP  230

Query  709   ISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKY  885
             +++ YN +     +D +GC    N +A EFNRQLK RV++LRA+L QA  T VD+Y+AKY
Sbjct  231   VNLFYNLNPPPGYLDDHGCVKGQNDMAIEFNRQLKDRVIKLRAELPQAAITYVDVYAAKY  290

Query  886   AVVSNAGSHGFQDPFTFCC----------CGKNKKMAN-ETVYGDPCSDPSRHISWDGVH  1032
              ++SNA + GF DP   CC          CG NK M N   VYG  C  PS +ISWDGVH
Sbjct  291   GLISNAKTEGFADPMKVCCGYHVKYDHVWCG-NKGMVNGSEVYGPSCQTPSSYISWDGVH  349

Query  1033  YSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             Y++ AN  +A  I+ G   S PP P+ +AC+
Sbjct  350   YTQGANQWVANHILDGSLSSTPPTPITQACQ  380



>ref|XP_010430826.1| PREDICTED: GDSL esterase/lipase At3g27950 [Camelina sativa]
Length=375

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 225/347 (65%), Gaps = 14/347 (4%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFG+  GR+ DGRL+IDFI ENL LPY
Sbjct  28    CKFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSVGRHSDGRLIIDFITENLTLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             L  YLDS+G ++RHGANFAT GS I P    +SPF L  Q+SQFI FK RT+ LY++  G
Sbjct  88    LTPYLDSVGANYRHGANFATGGSCIRPTVACFSPFHLGTQVSQFIHFKTRTLSLYSQTKG  147

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
                  K VL RP++FSK+LYT DIGQNDL+ GFQ     Q   +IP I++ F+ AL  LY
Sbjct  148   KTPFCKGVLARPKDFSKALYTLDIGQNDLAVGFQNMTEEQLKATIPTIIENFTIALKLLY  207

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR F IHNTGP GCLP  +          D+ GC    N VA EFN+QLK ++ +L 
Sbjct  208   KEGARFFSIHNTGPTGCLPYLLKSFPATPR--DQYGCLKPLNNVAIEFNKQLKNKITELN  265

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
              +L  ++FT VD+YSAKY ++  A + G  DPF +CC         CGK        +Y 
Sbjct  266   KELPSSLFTYVDVYSAKYNLIIKAKNLGVVDPFDYCCVGAIGRGMGCGKTIFPNGTGLYS  325

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               C  P+  ISWDG+HY+E AN+++A  I+  GS SDPP P  +AC+
Sbjct  326   TSCKSPTNFISWDGIHYTETANMLVANRIL-DGSISDPPLPTQKACK  371



>ref|XP_008782097.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Phoenix dactylifera]
Length=382

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 236/357 (66%), Gaps = 29/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+N GDSNSDTGG SA  G +  P GE+ FGKP+GRY DGRL+IDFIAE+LGLPY
Sbjct  26    CHFPAVFNLGDSNSDTGGLSATFGPLTYPYGESLFGKPAGRYSDGRLIIDFIAESLGLPY  85

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             ++AYLDS+GT+F HGANFATA S+ILP       GGYSPF LD+Q+ QF+QFK R+  +Y
Sbjct  86    ISAYLDSMGTNFSHGANFATALSTILPQNITLSQGGYSPFSLDVQLKQFLQFKSRSQMIY  145

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+      +YKD++P+ E FS++LYTFDIGQNDL+  F + N S T + IP  + +FS+ 
Sbjct  146   NE----GGIYKDLIPKEEYFSRALYTFDIGQNDLT-AFYFLNES-TEEYIPNALKEFSRV  199

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             +  +Y EG R+FWIHNTGP+GCLP  +       +++D  GCA  +N++AQEFNR L   
Sbjct  200   IKSIYEEGGRSFWIHNTGPLGCLPYVLVQGHLAPSDLDSAGCAIRYNKLAQEFNRMLNDT  259

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CGKN  954
             V QLR  L  A FT+VDMYS KY +VS A   GF  PF  CC              CG  
Sbjct  260   VAQLRKDLPLAAFTLVDMYSIKYLLVSQATKQGFVLPFRACCGYGGGVYNYNSNIRCGDM  319

Query  955   KKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+     + G  C +P + I+WDGVHY+EAAN  +   I   G+FSDP  P++ AC
Sbjct  320   AKVNGTMILLGKSCRNPRKRINWDGVHYTEAANRWVFNQISR-GAFSDPAMPLSMAC  375



>ref|XP_003547701.1| PREDICTED: GDSL esterase/lipase At5g14450 isoform 1 [Glycine 
max]
 gb|KHN27565.1| GDSL esterase/lipase [Glycine soja]
Length=382

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/353 (52%), Positives = 236/353 (67%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAVYNFGDSNSDTGG SA+   +  P GE FF KPSGR CDGRL++DFIAE L LPY
Sbjct  30    CTFPAVYNFGDSNSDTGGISASFVPIPAPYGEGFFHKPSGRDCDGRLIVDFIAEKLNLPY  89

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+GT++RHGANFAT GS       +I   G SPF LDIQI QF QFK RT +LY
Sbjct  90    LSAYLNSLGTNYRHGANFATGGSTIRKQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  149

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +    ++  K  LP PEEFSK+LYTFDIGQNDLS GF+  N  Q  +S+P I+++ + A
Sbjct  150   EEAKAPHE--KSKLPVPEEFSKALYTFDIGQNDLSVGFRKMNFDQIRESMPDILNQLANA  207

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKD-NHNNVDKNGCAATHNRVAQEFNrqlka  813
             +  +Y +G R FWIHNT P GC+P+ + Y  +     +D+ GC    N +A EFN+QLK 
Sbjct  208   VKNIYQQGGRYFWIHNTSPFGCMPVQLFYKHNIPEGYLDQYGCVKDQNVMATEFNKQLKD  267

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             RV++LR +L +A  T VD+Y+AKYA++SN    GF DP   CC          CG     
Sbjct  268   RVIKLRTELPEAAITYVDVYAAKYALISNTKKEGFVDPMKICCGYHVNDTHIWCGNLGTD  327

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               + V+G  C +PS++ISWD VHY+EAAN  +A  I+  GS++DPP P+ +AC
Sbjct  328   NGKDVFGSACENPSQYISWDSVHYAEAANHWVANRIL-NGSYTDPPTPITQAC  379



>ref|XP_009371742.1| PREDICTED: GDSL esterase/lipase At5g14450 [Pyrus x bretschneideri]
Length=382

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 186/389 (48%), Positives = 247/389 (63%), Gaps = 29/389 (7%)
 Frame = +1

Query  13    MEIWKRILVFEmmlmslglmgclVNGIGG-GLPQRRCWFPAVYNFGDSNSDTGGRSAALG  189
             ME WK +L       S   +   V  +GG  LP   C FPA+YNFGDSNSDTGG SAA  
Sbjct  1     MEFWKLLLA------SGFFLASWVLAVGGQNLPP--CSFPAIYNFGDSNSDTGGISAAFE  52

Query  190   EVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-  366
              ++PPNGE FF KP+GR  DGRLV+DFIAE L LPYL+AYL+S+GT++RHGANFAT GS 
Sbjct  53    PIKPPNGEAFFHKPAGRAADGRLVMDFIAERLKLPYLSAYLNSLGTNYRHGANFATGGST  112

Query  367   ------SILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSL  528
                   +I   G SPF LD+Q +QF+QFK RT +LY +    +Q  +  LP P++F+K+L
Sbjct  113   IRRPNETIFENGISPFSLDMQTAQFLQFKARTADLYRQAKNPSQ--RSALPNPQDFAKAL  170

Query  529   YTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLP  708
             Y FDIGQNDLS GF+  +  Q    +P I+++ + A++++Y EG R FWIHNTGP+GCLP
Sbjct  171   YMFDIGQNDLSAGFRKLSFDQLRAQLPDIVNQLAIAVHRIYEEGGRTFWIHNTGPVGCLP  230

Query  709   ISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKY  885
             I + YN +     +D +GC    N +A EFNRQL+ RV +LR +L QA  T VD+++AKY
Sbjct  231   IQLFYNLNPARGFLDDHGCVKAQNDIAVEFNRQLRDRVTKLRTELPQAAITYVDVFAAKY  290

Query  886   AVVSNAGSHGFQDPFTFCC----------CGKNKKMANETVYGDPCSDPSRHISWDGVHY  1035
              ++  A + GF +P   CC          CG     +   VYG  C +PS  ISWDG+HY
Sbjct  291   GLIGTAKTEGFAEPMKVCCGYHVKYDHVWCGNKGSASGREVYGASCQNPSAFISWDGIHY  350

Query  1036  SEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             ++ AN  +A  I+ G   S P  P+ +AC
Sbjct  351   TQGANQWVANRILNGSPSSIPAIPITQAC  379



>ref|XP_004304671.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Fragaria vesca 
subsp. vesca]
Length=383

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 194/389 (50%), Positives = 254/389 (65%), Gaps = 28/389 (7%)
 Frame = +1

Query  13    MEIWKRILVFEmmlmslglmgclVNGIGGG-LPQRRCWFPAVYNFGDSNSDTGGRSAALG  189
             MEIWK++++    L         V G+ G  LP   C FPA+YNFGDSNSDTGG SAA  
Sbjct  1     MEIWKQLVLLPCGLFLTLW----VLGVSGATLPS--CSFPAIYNFGDSNSDTGGISAAFE  54

Query  190   EVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-  366
              +R P GE FF KP+GR  DGRL+IDFIAE L LPYL+AYL+S+GT+++HGANFAT GS 
Sbjct  55    PIRTPYGEGFFRKPAGRDSDGRLIIDFIAEGLKLPYLSAYLNSLGTNYKHGANFATGGST  114

Query  367   ------SILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSL  528
                   +I   G SPF LD+Q +QF+QFK RT +L+ +    N   +  LP P++F+K+L
Sbjct  115   IRRPNETIFENGISPFSLDMQTAQFLQFKSRTADLFRQ--AKNPYERSRLPNPQDFAKAL  172

Query  529   YTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLP  708
             YTFDIGQNDLS GF+  +  Q    IP I+++ + A+ ++Y +G R FWIHNTGPIGCLP
Sbjct  173   YTFDIGQNDLSAGFRKLSFDQLRAQIPDIVNQLATAVRRIYEQGGRAFWIHNTGPIGCLP  232

Query  709   ISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKY  885
             I++ YN +     VD++GC    N +A EFNRQLK RV++LRA+L QA  T VD Y+AKY
Sbjct  233   INLFYNLNPAPGYVDEHGCVKGQNDMAIEFNRQLKDRVIKLRAELPQAAITYVDAYAAKY  292

Query  886   AVVSNAGSHGFQDPFTFCC----------CGKNKKMANETVYGDPCSDPSRHISWDGVHY  1035
              ++SNA + GF DP   CC          CG    +    VYG  C + S  ISWDGVHY
Sbjct  293   GLISNAKNEGFVDPMKVCCGYHVRYDHVWCGNKAIVNGREVYGASCGNASSAISWDGVHY  352

Query  1036  SEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             ++AAN  +A  I+  G+ S+PP P+ +AC
Sbjct  353   TQAANQWVANHIL-NGALSNPPIPITQAC  380



>ref|XP_008344421.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Malus domestica]
Length=404

 Score =   335 bits (858),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 188/362 (52%), Positives = 240/362 (66%), Gaps = 24/362 (7%)
 Frame = +1

Query  97    GGLPQRR----CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVI  264
             G +PQ++    C FPA+YNFGDSNSDTG  SA    +  P G TFFGKPSGR+ DGR++I
Sbjct  41    GLVPQKKSRSACQFPAMYNFGDSNSDTGSFSATFYRLPSPYGYTFFGKPSGRFSDGRIII  100

Query  265   DFIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQF  423
             DFIA+ LG P+L+AYL+SIG +FR GANFA   S+I P        GYSP  L++Q+SQF
Sbjct  101   DFIAQKLGFPFLSAYLNSIGANFRCGANFAIVASTIQPLDVRTFGDGYSPISLNVQLSQF  160

Query  424   IQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS  603
              QFK R  E + +        K  LPR E+FSK+LYT DIGQNDLS G  +    Q L++
Sbjct  161   AQFKARVNEFFPR--DERSYVKAGLPRAEDFSKALYTLDIGQNDLSAGLSWKTADQLLEN  218

Query  604   IPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRV  783
             +  I  + +  + QLY +GAR FWIHNTGP+GCLP ++AY      ++D+NGC   +N V
Sbjct  219   VSSITAQLALTIEQLYQQGARVFWIHNTGPLGCLPSTLAYKMAEPGDLDQNGCLKRYNEV  278

Query  784   AQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------  942
              QEFNRQLK RVL+LRA+L +AVFT +D+Y+AKY ++S A  +GF  P   CC       
Sbjct  279   CQEFNRQLKERVLKLRAKLSEAVFTYIDVYAAKYTLISEAEKYGFTSPLAQCCGSYGDVP  338

Query  943   --CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAE  1116
               CG  K + N T  G PCS+PS+HI+WDG HYS+AAN  LA  IM  G+FSDPP  + E
Sbjct  339   VRCGV-KAIVNGTEVGGPCSNPSQHINWDGGHYSDAANEWLATRIM-DGAFSDPPVSITE  396

Query  1117  AC  1122
             AC
Sbjct  397   AC  398



>gb|EYU44795.1| hypothetical protein MIMGU_mgv1a008122mg [Erythranthe guttata]
Length=384

 Score =   334 bits (857),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 186/353 (53%), Positives = 236/353 (67%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C F A+YNFGDSNSDTG  SAA      P G  FFG+PSGR  DGRL+IDFIAE LGLPY
Sbjct  32    CDFQAIYNFGDSNSDTGATSAAFWPTPRPYGVNFFGRPSGRNSDGRLLIDFIAEKLGLPY  91

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+ YLDSIGT+FRHGANFAT  S       SI   G SPF LDIQ  QF+QFK RT ELY
Sbjct  92    LSPYLDSIGTNFRHGANFATGVSTIRRQNESIFENGISPFSLDIQTMQFLQFKSRTSELY  151

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++        +  LPRP++FS+SLYTFDIGQNDL+ GF+   + Q    IP I+D+F+ A
Sbjct  152   HQ--ARTPFNRSKLPRPKDFSRSLYTFDIGQNDLTAGFRKLTMPQLRAEIPNIVDQFAAA  209

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKD-NHNNVDKNGCAATHNRVAQEFNrqlka  813
             + +LY +GAR FWIHNTGP+GCLP +  Y +  N +  DK GC  +HN +A EFN+QLK+
Sbjct  210   VIRLYQQGARAFWIHNTGPVGCLPAASMYIRTPNPDFFDKYGCVKSHNDIAVEFNKQLKS  269

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             RV  LRA+L +A    VD+YSAKY +++NA ++GF D    CC          CG+ + +
Sbjct  270   RVRLLRAELPRASLIYVDIYSAKYQLITNAKTYGFGDSMRICCGYHKRNVHVWCGQRQMI  329

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 V+G      +R +SWDGVHYS+AAN  +A  ++Y GS+SDPP P++ AC
Sbjct  330   NGSMVFGGARGSHARCVSWDGVHYSQAANNWVANHVLY-GSYSDPPMPLSRAC  381



>ref|XP_009359196.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Pyrus x bretschneideri]
Length=404

 Score =   335 bits (858),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 242/363 (67%), Gaps = 26/363 (7%)
 Frame = +1

Query  97    GGLPQRR----CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVI  264
             G +PQ++    C FPA+YNFGDSNSDTG  SA    +  P G TFFGKPSGR+ DGR++I
Sbjct  41    GLVPQKKSCSACQFPAMYNFGDSNSDTGSFSATFYRLPSPYGYTFFGKPSGRFSDGRIII  100

Query  265   DFIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQF  423
             DFIA+ LG P+L+AYL+SIG +F  GANFA   S+I P       GGYSP  L++Q+SQF
Sbjct  101   DFIAQKLGFPFLSAYLNSIGANFHCGANFAIGASTIQPLDVRTFGGGYSPISLNVQLSQF  160

Query  424   IQFKKRTIELYNKLAGTNQVYKDV-LPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQ  600
              QFK R  EL+ +     + Y +  LPR E+FSK+LYT DIGQNDLS G  +    Q L+
Sbjct  161   AQFKARVNELFPR---DERSYVNAGLPRAEDFSKALYTLDIGQNDLSAGLSWKTADQLLE  217

Query  601   SIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNR  780
             ++  I  + +  + QLY +GAR FWIHNTGP+GCLP ++AY      ++DKNGC   +N 
Sbjct  218   NVSSITAQLALTIEQLYQQGARVFWIHNTGPLGCLPSTLAYKMAEPGDLDKNGCLKRYNE  277

Query  781   VAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC------  942
             V QEFNRQLK RVL+LRA+L +AV T VD+Y+AKY ++S A  +GF  P   CC      
Sbjct  278   VCQEFNRQLKERVLKLRAKLSEAVLTYVDIYAAKYTLISEAEKYGFTSPLAQCCGSYGDV  337

Query  943   ---CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVA  1113
                CG  K + N T  G PCS+PS+HI+WDG HYS+AAN  LA  IM  G+FSDPP  + 
Sbjct  338   PVRCGV-KAIVNGTEVGGPCSNPSQHINWDGGHYSDAANEWLATRIM-DGAFSDPPVSIT  395

Query  1114  EAC  1122
             EAC
Sbjct  396   EAC  398



>ref|XP_010502802.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Camelina sativa]
Length=375

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 227/347 (65%), Gaps = 14/347 (4%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFG+  GR+ DGRL+IDFI ENL LPY
Sbjct  28    CKFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSVGRHSDGRLIIDFITENLTLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             L  YLDS+G ++RHGANFAT GS I P    +SPF L  Q+SQFI FK RT+ LYN+  G
Sbjct  88    LTPYLDSVGANYRHGANFATGGSCIRPTVACFSPFHLGTQVSQFIHFKTRTLSLYNQTKG  147

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
              +   K VL RP++FSK+LYT DIGQNDL+ GFQ     Q   +IP I++ F+ AL  LY
Sbjct  148   KSPFCKGVLARPKDFSKALYTLDIGQNDLAVGFQNMTEEQLKATIPTIIENFTIALKLLY  207

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR F IHNTGP GCLP  +          D+ GC    N VA EFN+QLK ++ +L 
Sbjct  208   KEGARFFSIHNTGPAGCLPYLLKSFPATPQ--DQYGCLKPLNNVAVEFNKQLKYKISELN  265

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
              +L  ++FT +D+Y+AKY ++  A + G  DPF +CC         CGK        +Y 
Sbjct  266   KELPSSLFTYIDVYTAKYNLIIKAINLGVVDPFDYCCVRAIGRGMGCGKTIFPNGTELYS  325

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               C +P+  ISW+G+HY+E AN+++A  I+  GS SDPP P  +AC+
Sbjct  326   TSCKNPTYFISWNGIHYTETANMLIANRIL-DGSISDPPLPTQKACK  371



>ref|XP_008464935.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X1 [Cucumis 
melo]
Length=383

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 186/355 (52%), Positives = 237/355 (67%), Gaps = 22/355 (6%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA+YNFGDSNSDTGG SAA      P G+TFF K +GR CDGRL+IDF A++L L
Sbjct  27    RACNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFHKTAGRGCDGRLIIDFFAKHLEL  86

Query  292   PYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+AYL+SIGT+FRHGANFAT GS       S+   G SPF LDIQ+ QF QFK RTI+
Sbjct  87    PYLSAYLNSIGTNFRHGANFATGGSTIRRQNESVFENGVSPFPLDIQVVQFRQFKNRTID  146

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
              Y ++ G+    +  LP PEEFSK+L+T DIGQNDLS GF+     Q  ++IP I+++F+
Sbjct  147   RYVEVDGS---IRSSLPVPEEFSKALFTIDIGQNDLSAGFRKMTNDQFQKAIPDIINEFA  203

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISV-AYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
              A+  LY EG R FW+HNTGPIGC+P+++ + +K N  ++D+NGC    N  A EFNRQL
Sbjct  204   TAVEDLYKEGGRAFWVHNTGPIGCIPVAIRSISKPNPGDLDQNGCVKYQNNAALEFNRQL  263

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNK  957
             K RV++LRA+L  A    VD+Y+AK  +++NA   GF +    CC          CG  K
Sbjct  264   KERVVKLRAKLSNAFIVYVDVYAAKIKLIANAKEEGFMEKGAICCGYHEGVDHVWCGNKK  323

Query  958   KMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              +    VY   C DPS+ ISWDGVHY+EAAN  +A  I+  GSFSDP  P+  AC
Sbjct  324   IINGSEVYAGSCKDPSKFISWDGVHYTEAANQWIANQIV-DGSFSDPQVPIIHAC  377



>gb|AGZ15410.1| acetylcholinesterase [Phaseolus vulgaris]
Length=382

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 236/356 (66%), Gaps = 27/356 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SA+   +  P GE FF KPSGR CDGRL+IDFIA+ L LPY
Sbjct  30    CSFPAIYNFGDSNSDTGGISASFVPIPAPYGEGFFHKPSGRDCDGRLIIDFIADKLNLPY  89

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             ++AYL+S+GT++RHGANFAT GS       +I   G SPF LDIQI QF QFK RT +LY
Sbjct  90    ISAYLNSLGTNYRHGANFATGGSTIRKQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  149

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +      + +  LP PEEFSK+LYTFDIGQNDLS GF+  N  Q  +S+P I+++ + A
Sbjct  150   EE--AKTPLERSKLPVPEEFSKALYTFDIGQNDLSVGFRKMNFDQIRESMPDIVNQLANA  207

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHN----NVDKNGCAATHNRVAQEFNrq  804
             +  +Y +G R+FWIHNT P GC+P+ + Y    HN     +D+ GC    N +A EFN+ 
Sbjct  208   VKNIYEQGGRSFWIHNTSPFGCMPVQLFY---KHNIPIGYLDQYGCVKDQNEMATEFNKH  264

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK R+++LR +L QA  T VD Y+AKYA++SN  + GF DP   CC          CG  
Sbjct  265   LKDRIIKLRTELPQAAITYVDAYAAKYALISNTKTEGFVDPMKICCGYHVNDTHIWCGNL  324

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                  + V+G  C +PS++ISWD VHY+EAAN  +A  I+  GSF+DPP P+ +AC
Sbjct  325   GSADGKDVFGSACENPSQYISWDSVHYAEAANHWVANRIL-NGSFTDPPTPITQAC  379



>ref|XP_003627819.1| GDSL esterase/lipase [Medicago truncatula]
 gb|ABE87642.1| Lipolytic enzyme, G-D-S-L [Medicago truncatula]
 gb|AET02295.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=372

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 181/355 (51%), Positives = 239/355 (67%), Gaps = 18/355 (5%)
 Frame = +1

Query  106   PQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENL  285
             P ++C +PA+YNFGDSNSDTG   A    V  PNG +FFG  SGR CDGRL++DFI+E L
Sbjct  20    PSKKCVYPAIYNFGDSNSDTGAGYATTAAVEYPNGISFFGSISGRCCDGRLILDFISEEL  79

Query  286   GLPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKL  465
              LPYL++YL+S+G+++RHGANFA A + I P       L +Q+SQFI FK  T  L+++L
Sbjct  80    ELPYLSSYLNSVGSNYRHGANFAVASAPIRPIFSGLTNLGLQVSQFILFKSHTKILFDQL  139

Query  466   AG--TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKIMDKFSQ  633
             +   T    +  LPR E+FSK++YT DIGQND+S+G Q  N S  +  +SIP I+ +F+Q
Sbjct  140   SDKRTEPPLRSGLPRIEDFSKAIYTIDIGQNDISYGLQKPNSSEEEVKRSIPDILSQFTQ  199

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAY--NKDNHNNVDKNGCAATHNRVAQEFNrql  807
             A+ +LY +GAR FWIHNTGPIGC+P    +  +K+  +N+D NGC   HN +AQE+NRQL
Sbjct  200   AVQRLYNQGARVFWIHNTGPIGCIPYYYFFYPHKNEKSNLDANGCVKPHNELAQEYNRQL  259

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNK  957
             K +V QLR     A FT VD+Y+ KY ++SNA S GF +P  FCC          CGK K
Sbjct  260   KDQVFQLRRMFPLAKFTYVDVYTVKYTLISNARSQGFMNPLEFCCGSYQGNEIHYCGK-K  318

Query  958   KMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              + N T YG  C DPS +ISWDG+HYS+AAN  + + I+  GSFSDPP  +  AC
Sbjct  319   SIKNGTFYGFACDDPSTYISWDGIHYSQAANEWIVKQIL-SGSFSDPPVSLGNAC  372



>ref|XP_003554066.1| PREDICTED: GDSL esterase/lipase At3g26430 [Glycine max]
Length=393

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 240/361 (66%), Gaps = 28/361 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C FPA++NFGDSNSDTGG SAA G+  PP+GE++F  P+GRYCDGRL++DF+A+ LGL
Sbjct  35    KQCHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGESYFHHPAGRYCDGRLIVDFLAKKLGL  94

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP--------GGYSPFFLDIQISQFIQFKKRTI  447
             PYL+A+LDS+G+++ HGANFATAGS+I P        GG+SPF LD+Q +QF  F++RT 
Sbjct  95    PYLSAFLDSVGSNYSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFNQFSDFQRRTQ  154

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
               +NK      VYK +LP+ E+FS++LYTFDIGQNDL+ G F   +  Q    +P ++ +
Sbjct  155   FFHNK----GGVYKTLLPKAEDFSQALYTFDIGQNDLASGYFHNMSTDQVKAYVPDVLAQ  210

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F   +  +Y  G R+FW+HNTGP+GCLP  +  +    + VDK GCA  +N VA+ FN +
Sbjct  211   FKNVIKYVYNHGGRSFWVHNTGPVGCLPYIMDLHPVKPSLVDKAGCATPYNEVAKFFNSK  270

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V+QLR +L  A  T VD+YS KY+++S    HGF++P   CC             C
Sbjct  271   LKEVVVQLRKELPLAAITYVDVYSVKYSLISQPKKHGFEEPLRACCGHGGKYNYNLHIGC  330

Query  946   G-KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G K K    E + G PC DPS  ++WDGVHY++AAN  +   I + GSFSDPP P+  AC
Sbjct  331   GAKIKAHGKEILVGKPCKDPSVWVNWDGVHYTQAANKWVFDQI-FDGSFSDPPIPLNMAC  389

Query  1123  R  1125
              
Sbjct  390   H  390



>gb|KHN34622.1| GDSL esterase/lipase [Glycine soja]
Length=385

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 240/361 (66%), Gaps = 28/361 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C FPA++NFGDSNSDTGG SAA G+  PP+GE++F  P+GRYCDGRL++DF+A+ LGL
Sbjct  27    KQCHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGESYFHHPAGRYCDGRLIVDFLAKKLGL  86

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP--------GGYSPFFLDIQISQFIQFKKRTI  447
             PYL+A+LDS+G+++ HGANFATAGS+I P        GG+SPF LD+Q +QF  F++RT 
Sbjct  87    PYLSAFLDSVGSNYSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFNQFSDFQRRTQ  146

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
               +NK      VYK +LP+ E+FS++LYTFDIGQNDL+ G F   +  Q    +P ++ +
Sbjct  147   FFHNK----GGVYKTLLPKAEDFSQALYTFDIGQNDLASGYFHNMSTDQVKAYVPDVLAQ  202

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F   +  +Y  G R+FW+HNTGP+GCLP  +  +    + VDK GCA  +N VA+ FN +
Sbjct  203   FKNVIKYVYNHGGRSFWVHNTGPVGCLPYIMDLHPVKPSLVDKAGCATPYNEVAKFFNSK  262

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V+QLR +L  A  T VD+YS KY+++S    HGF++P   CC             C
Sbjct  263   LKEVVVQLRKELPLAAITYVDVYSVKYSLISQPKKHGFEEPLRACCGHGGKYNYNLHIGC  322

Query  946   G-KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G K K    E + G PC DPS  ++WDGVHY++AAN  +   I + GSFSDPP P+  AC
Sbjct  323   GAKIKAHGKEILVGKPCKDPSVWVNWDGVHYTQAANKWVFDQI-FDGSFSDPPIPLNMAC  381

Query  1123  R  1125
              
Sbjct  382   H  382



>ref|XP_010929893.1| PREDICTED: alpha-L-fucosidase 3 [Elaeis guineensis]
Length=384

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 236/358 (66%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G   PPNGETFFG P GRYCDGRL+IDFIA++LGLPY
Sbjct  29    CDFPAIFNFGDSNSDTGGLSAAFGPAPPPNGETFFGMPMGRYCDGRLIIDFIAQSLGLPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             LNAYLDS+GT+F HGANFATAGS+I          G+SPF LD+Q  QF QFK R+   Y
Sbjct  89    LNAYLDSVGTNFSHGANFATAGSTIRRQNETLFQSGFSPFSLDVQSWQFSQFKTRSQLAY  148

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
              +      V+KD+LP  + FS++LYTFDIGQNDL+ G+  +  ++ +++ IP +++KF+ 
Sbjct  149   ER----GGVFKDLLPTEDFFSRALYTFDIGQNDLTSGYFDNMTTEEVKAYIPDVLNKFTI  204

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +YG+G R FWIHNTGP GCLP  +         V+K GC +  N VA+ FN +LK 
Sbjct  205   VVKNIYGQGGRFFWIHNTGPFGCLPYVLDRLLLTAAQVNKVGCGSPFNDVAKLFNTKLKD  264

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V QLR  L  AVFT VD+YS KY ++S+A  HGF+ P   CC             CG  
Sbjct  265   TVYQLRTDLPLAVFTYVDIYSVKYELISHANKHGFEHPLLTCCGHGGKYNYNVHLGCGGK  324

Query  955   KKMAN-ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               + N E + G  C DPS+ I WDGVHY+EAAN  +   I+  G+FSDPP P+  AC+
Sbjct  325   IIVNNTEILVGKSCEDPSKRICWDGVHYTEAANKWVFDQIV-EGNFSDPPIPLRMACQ  381



>ref|XP_010089185.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB37456.1| GDSL esterase/lipase [Morus notabilis]
Length=384

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 233/354 (66%), Gaps = 22/354 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   + PP GETFF +P+GR CDGRL+IDFIA++LGLPY
Sbjct  31    CDFPAIYNFGDSNSDTGGGSAAFYPMAPPCGETFFHRPAGRGCDGRLLIDFIAKHLGLPY  90

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+ YLDSIG +FRHGANFAT GS+I          G SPF LDIQ++QF QFK RT   Y
Sbjct  91    LSPYLDSIGANFRHGANFATGGSTIRRQNESFFLNGVSPFSLDIQVAQFTQFKSRTGWFY  150

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+   ++   +  LPRPE+FSK+LY FDIGQNDL+ GF+     +    IP I+++F+ A
Sbjct  151   NQDKKSSN--RSNLPRPEDFSKALYIFDIGQNDLAAGFRTMTNEKLKAEIPDIINQFATA  208

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN--VDKNGCAATHNRVAQEFNrqlk  810
             +  LY +GAR FWIHNTGPIGCL +++ Y  D      VD  GC    N +A+EFNRQLK
Sbjct  209   IQNLYQQGARAFWIHNTGPIGCLAVTLHYLHDPLPTGYVDHLGCVKFQNDMAREFNRQLK  268

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKK  960
              RV  LR +L  A  T VD+Y+AKY +++NA   GF D  + CC          CG   K
Sbjct  269   LRVNDLREELPLATLTYVDLYAAKYELLANAKQQGFLDKASICCGYHEDNDHVWCGNKGK  328

Query  961   MANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             +    +Y   C DPS +ISWDGVHY+EAAN  +A  I   G+FS+P  P+  AC
Sbjct  329   INGSEIYAGSCEDPSLYISWDGVHYTEAANRWIANDIR-NGTFSEPQVPITNAC  381



>ref|XP_010100370.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB82504.1| GDSL esterase/lipase [Morus notabilis]
Length=781

 Score =   344 bits (883),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 189/350 (54%), Positives = 231/350 (66%), Gaps = 19/350 (5%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG+SAA   +  PNG+TFF KPSGRYCDG++++DFIAENL LPY
Sbjct  59    CNFPAIFNFGDSNSDTGGKSAAFHRLPSPNGDTFFHKPSGRYCDGKVILDFIAENLSLPY  118

Query  298   LNAYLDSIGTSFRHGANFATAGSS-------ILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             + AYLDSIG +FR GANFAT GS+       I   G+SP  L+IQ+ QF QFK RT EL+
Sbjct  119   VGAYLDSIGANFRRGANFATGGSTIQHVDTKIFGAGFSPISLEIQLLQFKQFKARTDELF  178

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +   T+   K  LPRPE+FSK+LY+ DIGQNDL  G +     Q   S P I    +  
Sbjct  179   KE--ATSSYVKTSLPRPEDFSKALYSLDIGQNDLHAGLKSMTEEQLKGSFPDITSMLAWT  236

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             + +LY  GAR FWIHNTGPIGCLP SV +      N+DKNGC  + N VA EFNR LK R
Sbjct  237   VKELYQLGARTFWIHNTGPIGCLPYSVIHFPPKRENMDKNGCVKSQNEVAMEFNRLLKQR  296

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMAN  969
             V QLR +L  AV T VD+YSAKY+++S A   GF DP  +CC         CGK   +  
Sbjct  297   VSQLRVELPDAVLTYVDIYSAKYSLISQAKKLGFGDPLGYCCGHYGDHYVQCGKKATVNG  356

Query  970   ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEA  1119
               V G+ CSDPS +ISWDGVHYS +AN  +A  I+  GS SDPP  + +A
Sbjct  357   TEVVGNACSDPSVYISWDGVHYSHSANKWVAHQIL-DGSLSDPPISITQA  405


 Score =   320 bits (820),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 228/357 (64%), Gaps = 27/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SA  G+ RPP+GE++F +P GRYCDGRL++DFIAE+ GL Y
Sbjct  423   CKFPAIFNFGDSNSDTGGLSAVFGQARPPHGESYFRRPVGRYCDGRLIVDFIAESFGLQY  482

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G++F HGANFATAGS+I P        G+SP  LD+Q ++F  F  R+    
Sbjct  483   LSAYLDSVGSNFTHGANFATAGSTIRPQNTTLRQSGFSPISLDVQWNEFYDFHNRSQTTR  542

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKFSQ  633
              K      V++ +LP+ E+FS +LYTFDIGQNDL+ G F     S+    IP ++++F  
Sbjct  543   QK----GGVFRSLLPKAEDFSSALYTFDIGQNDLTAGYFLNMTTSEVRAYIPDVLNQFKN  598

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +YG+G R FWIHNTGP GCLP  +         +DK GCA   N VA+ FN  LK 
Sbjct  599   VVKYIYGQGGRYFWIHNTGPFGCLPYVLDRLPLTPAQIDKAGCAIPFNEVARFFNYGLKE  658

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C-GK  951
              V+QLR +L  A  T VD+YSAKYA++S    HGF++    CC             C GK
Sbjct  659   VVVQLRKELPLAAITYVDVYSAKYAIISQPKKHGFKETLRACCGHGGKYNYNRNIGCGGK  718

Query  952   NKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K    E + G PC+DPS  ++WDGVHYS+AAN  +   I+ GGS SDPP P+  AC
Sbjct  719   IKVHGKEILIGKPCNDPSVWVNWDGVHYSQAANKAIFDQIV-GGSLSDPPIPLEMAC  774



>ref|XP_003624771.1| GDSL esterase/lipase [Medicago truncatula]
Length=386

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/360 (49%), Positives = 235/360 (65%), Gaps = 37/360 (10%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R+C FPA++NFGDSNSDTGG SAA G+   P GE+FF  P GRYCDGRL++DFIAE LGL
Sbjct  37    RKCEFPAIFNFGDSNSDTGGLSAAFGQPGYPYGESFFHHPVGRYCDGRLLVDFIAEKLGL  96

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP--------GGYSPFFLDIQISQFIQFKKRTI  447
             PYLNAYLD++G++F HGANFATAGS+I P        GG+SPF LD+Q +QF  F++   
Sbjct  97    PYLNAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFTQFNDFQR---  153

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
                        +YK +LP+ E FS++LYTFDIGQNDL+ G F   +++Q    +P ++D+
Sbjct  154   ----------GIYKTLLPKAEYFSRALYTFDIGQNDLASGYFHNMSINQVKAYVPDVLDQ  203

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F   +  +Y  G R+FWIHNTGP+GCLP  +  +K   + VDK GCA  +N VA+ FN +
Sbjct  204   FKNTIKNIYAHGGRSFWIHNTGPVGCLPYIIELHKVTSDKVDKAGCAIPYNEVAKFFNHE  263

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V+QLR +L  A  T VD+YSAKY+++S A  HGF++P   CC             C
Sbjct  264   LKQAVVQLRKKLPSAAITYVDVYSAKYSLISQAYRHGFKEPLRACCGHGGKYNYNLHIGC  323

Query  946   GKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G   K+   E + G PC DPS  ++WDGVH ++AAN  +   I+  GS SDPP P+  AC
Sbjct  324   GAKVKIDGKEILIGKPCKDPSVVVNWDGVHLTQAANKWVFEQIV-DGSLSDPPIPLNMAC  382



>ref|XP_008804229.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Phoenix dactylifera]
Length=383

 Score =   332 bits (851),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 235/358 (66%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G   PPNGETFFG P+GRY DGRL+IDFIA++LGLPY
Sbjct  28    CDFPAIFNFGDSNSDTGGLSAAFGPAPPPNGETFFGMPAGRYSDGRLIIDFIAQSLGLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+GT+F HGANFATAGS+I         GG+SPF LD+Q  QF QFK R+   Y
Sbjct  88    LSAYLDSVGTNFSHGANFATAGSTIRRQNKTLFQGGFSPFSLDVQSWQFSQFKSRSQLAY  147

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
              +      V+KD+LP  + FS++LYTFDIGQNDL+ G+  +  ++ +++ +P +++KF+ 
Sbjct  148   KR----GGVFKDLLPTEDYFSRALYTFDIGQNDLTSGYFDNMTTEEVKAYVPDVLNKFTI  203

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +YG+G R FWIHNTGP GCLP  +         VD+ GC A  N VA+ FN +LK 
Sbjct  204   VVKNIYGQGGRFFWIHNTGPFGCLPYVLDRLLLTAAQVDRVGCGAPFNEVAKLFNVKLKK  263

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V QLR  L  AVFT VD+YS KY ++S A  HGF+ P   CC             CG  
Sbjct  264   TVNQLRKDLPLAVFTYVDVYSVKYELISQANKHGFEHPLVTCCGHGGKYNYNAHLGCGGK  323

Query  955   KKMAN-ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               + N E + G  C DPS+   WDGVHY+EAAN  +   I+  G+FSDPP P+  AC+
Sbjct  324   ITVNNTEILVGKSCEDPSKRTCWDGVHYTEAANKWVFDQIV-EGAFSDPPIPLRMACK  380



>ref|XP_011097365.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Sesamum indicum]
Length=381

 Score =   332 bits (850),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 235/353 (67%), Gaps = 23/353 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA G + PP G++FF +P+GR  DGRL+IDFIAE+LGLPY
Sbjct  31    CDFPAIYNFGDSNSDTGGISAAFGRIPPPYGQSFFPRPAGRASDGRLIIDFIAEHLGLPY  90

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L++YLDSIGT+FRHGANFA  GS       +I   G SPF LDIQI  F  FK R  E+Y
Sbjct  91    LSSYLDSIGTNFRHGANFAAGGSAIRRQNEAIFESGISPFSLDIQIVHFDGFKVRNTEIY  150

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++    N   +   P+P+EFS++LYTFDIGQNDL  GF+  +  Q   +IP I+++ + A
Sbjct  151   HR--ARNLSDRRQGPQPQEFSRALYTFDIGQNDLVAGFRQLSTPQLRAAIPDIVNQLAAA  208

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             +  LY +GAR FWIHNTGP+GCLP +  Y +      DK+GC    N +A EFNRQLKAR
Sbjct  209   VTHLYQQGARAFWIHNTGPVGCLPAATLYIRK--AKTDKHGCNKDQNGMALEFNRQLKAR  266

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMA  966
             V +LRA+L QA    VD+YSAKY ++SN  ++GF DP   CC          CG+   + 
Sbjct  267   VSKLRAELPQAALVYVDVYSAKYHLISNTKTYGFMDPLKICCGHHDSNIHVWCGQRTSVN  326

Query  967   NETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPP-RPVAEAC  1122
                V G  C  P  +ISWDG+HYS+AAN  +A  I+  GSFSDPP  P+ +AC
Sbjct  327   GSEVLGVSCGSPDSYISWDGIHYSQAANQWIANHIL-NGSFSDPPLTPITQAC  378



>ref|XP_006852386.1| hypothetical protein AMTR_s00049p00231360 [Amborella trichopoda]
 gb|ERN13853.1| hypothetical protein AMTR_s00049p00231360 [Amborella trichopoda]
Length=377

 Score =   331 bits (849),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 230/353 (65%), Gaps = 22/353 (6%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +C FPA++NFGDSNSDTG  SAA  EV+ PNGETFFG+ +GR CDGRL++DFIAE L + 
Sbjct  28    KCEFPAIFNFGDSNSDTGAISAAFQEVQFPNGETFFGEAAGRLCDGRLIVDFIAEKLKVA  87

Query  295   YLNAYLDSIGTSFRHGANFATAGSSI-------LP-GGYSPFFLDIQISQFIQFKKRTIE  450
             Y+NAYLDS+G+ F+HGANFAT+ S+I        P GG+SPF L IQ++QF QFK R+  
Sbjct  88    YVNAYLDSVGSRFKHGANFATSASTIHTYNNTSFPRGGFSPFSLGIQLNQFTQFKSRSNR  147

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
             LY+         +   P P++FS++LYTFDIGQNDL+  F   +  Q    I  I+ +F+
Sbjct  148   LYHH----ENPLRMHFPGPDDFSRALYTFDIGQNDLNVAFAIKSDDQAKAFISGIIGEFT  203

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
             QA+  LY +GAR FWIHNTGP GCLP SV       +N+DK GC    N VA EFN QLK
Sbjct  204   QAIQYLYEQGARAFWIHNTGPAGCLPSSVINYPLKPHNLDKYGCVQPKNEVAHEFNSQLK  263

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKM  963
               V Q+R QL  A  T VD+YSAKY +++ A   GF DPF FCC         CG+   +
Sbjct  264   RAVSQIRKQLPLAALTYVDVYSAKYTLITQAKELGFVDPFVFCCGLAGNINIGCGRKAII  323

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 V G  C+DP  H+SWDGVHY+ AAN  ++  I+  G +SDPP P+ EAC
Sbjct  324   NGTQVIGGSCADPLSHVSWDGVHYTHAANRWISNHIL-NGHYSDPPIPITEAC  375



>ref|XP_010029093.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Eucalyptus grandis]
 gb|KCW55935.1| hypothetical protein EUGRSUZ_I01728 [Eucalyptus grandis]
Length=388

 Score =   332 bits (850),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 237/357 (66%), Gaps = 27/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +  P G  FF KP+GR CDGRL++DFIAE L LPY
Sbjct  36    CRFPAMYNFGDSNSDTGGISAAFDPIPSPYGAGFFHKPAGRDCDGRLIVDFIAEKLKLPY  95

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+GT++RHGANFAT GS       +I   G SPF LD+QI Q+ QFK+RT ELY
Sbjct  96    LSAYLNSLGTNYRHGANFATGGSTIRRQNETIFEFGISPFSLDMQIVQYDQFKRRTAELY  155

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++    ++  K  LP  EEF+++LYTFDIGQNDLS GF+  +  Q   ++P I++K + A
Sbjct  156   SQAKDASE--KSKLPVQEEFAQALYTFDIGQNDLSVGFRKLSSDQLKAALPDIVNKLASA  213

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN----VDKNGCAATHNRVAQEFNrq  804
             +  +Y  G R+FWIHNTGPIGCLP++  Y   NHN     +D +GC  T N +A EFNRQ
Sbjct  214   VQNIYRNGGRSFWIHNTGPIGCLPVNFFY---NHNPPAGYLDDHGCVKTQNEMAVEFNRQ  270

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK RV++LR +L +A  T VD+Y+AK+ ++ N  S GF DPF  CC          CG  
Sbjct  271   LKERVIKLRQELPEAAITYVDVYAAKFGLIGNYKSEGFVDPFKVCCGYHENYDHIWCGNK  330

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               +    V+G  C DP+  ISWDGVHYSEA N  +A  I+  GS SDPP PV +AC 
Sbjct  331   GSVNGTDVFGGSCKDPATSISWDGVHYSEATNHWVANRIL-NGSLSDPPIPVTQACH  386



>ref|XP_008230502.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X1 [Prunus 
mume]
Length=383

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 196/391 (50%), Positives = 257/391 (66%), Gaps = 32/391 (8%)
 Frame = +1

Query  13    MEIWKRILVFEmmlmslglmgclVNGIGG-GLPQRRCWFPAVYNFGDSNSDTGGRSAALG  189
             ME+WK ++       S   +   V G GG  LP   C FPA+YNFGDSNSDTGG SAA  
Sbjct  1     MELWKLLVA------SGFFLASWVLGAGGENLPV--CSFPAIYNFGDSNSDTGGISAAFE  52

Query  190   EVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-  366
              +R P GE FF KP+GR  DGRL+IDFIAE L LPYL+AYL+S+GT++RHGANFAT GS 
Sbjct  53    PIRAPYGEAFFHKPAGRDSDGRLIIDFIAERLRLPYLSAYLNSLGTNYRHGANFATGGST  112

Query  367   ------SILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSL  528
                   +I   G SPF LD+Q +QF+QFK R+ ELY +    N   +  LP P++F+K+L
Sbjct  113   IRRPNETIYEYGISPFSLDMQTTQFLQFKARSAELYRE--AKNPSDRSTLPNPQDFAKAL  170

Query  529   YTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLP  708
             YTFDIGQNDLS GF+  +  Q   ++P I+++ + A+ ++Y +G R+FWIHNTGPIGCLP
Sbjct  171   YTFDIGQNDLSVGFRKLSFDQIRAALPDILNQLATAVRRIYEQGGRSFWIHNTGPIGCLP  230

Query  709   ISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKY  885
             +++ YN +     +D +GC    N +A EFNRQLK RV++LRA+L QA  T VD+Y+AKY
Sbjct  231   VNLFYNLNPPPGYLDDHGCVKGQNDIAIEFNRQLKDRVIKLRAELPQAAITYVDVYAAKY  290

Query  886   AVVSNAGSH-GFQDPFTFCC----------CGKNKKMAN-ETVYGDPCSDPSRHISWDGV  1029
              ++S+A +  GF DP   CC          CG NK M N   VYG  C  PS +ISWDGV
Sbjct  291   GLISSAKTEAGFADPMKVCCGYHVKYDHVWCG-NKGMVNGSEVYGPSCQTPSSYISWDGV  349

Query  1030  HYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             HY++ AN  +A  I+ G   S+PP P+ +AC
Sbjct  350   HYTQGANQWVANHILNGSLSSNPPTPITQAC  380



>ref|XP_006395388.1| hypothetical protein EUTSA_v10004399mg [Eutrema salsugineum]
 gb|ESQ32674.1| hypothetical protein EUTSA_v10004399mg [Eutrema salsugineum]
Length=380

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 226/350 (65%), Gaps = 14/350 (4%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
              + C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFG+ +GR+ DGRL+IDFI ENL 
Sbjct  30    HKSCNFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSAGRHSDGRLIIDFITENLT  89

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNK  462
             LPYL  YLDS+G ++RHGANFAT GS I P    +S F L  Q+SQFI FK RT+ LYN+
Sbjct  90    LPYLTPYLDSVGANYRHGANFATGGSCIRPTVACFSQFHLGTQVSQFIHFKTRTLSLYNQ  149

Query  463   LAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALY  642
               G     K V+ RP++FS++LYTFDIGQNDL+ GFQ     Q   +IP I + F+ A+ 
Sbjct  150   TKGKTPFCKGVIARPKDFSRALYTFDIGQNDLAIGFQNMTEEQLKATIPGITESFTIAIK  209

Query  643   QLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvl  822
              LY EGAR F IHNTGP GCLP  +          D+ GC    N VA EFN+QLK ++ 
Sbjct  210   LLYKEGARFFSIHNTGPTGCLPYILKSFPVTPR--DRYGCLEPLNNVAMEFNKQLKNKIS  267

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANET  975
             +L  +   ++FT VD+YSAKY +++ A + GF DPF +CC         CGK        
Sbjct  268   ELNKEFPSSLFTYVDVYSAKYNLITRAKNLGFVDPFDYCCVGAVGRGMGCGKTIFPNGTE  327

Query  976   VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             +Y   C +P+  ISWDG+HYSE  N+++A  I+  GS S P  P+ +AC+
Sbjct  328   LYSSSCKNPTNFISWDGIHYSETLNMLVANRIL-DGSISYPSLPIQKACK  376



>ref|XP_009386685.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 231/358 (65%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G V PPNGETFFG P GRYCDGRL+IDFIA++LGLP+
Sbjct  30    CAFPAIFNFGDSNSDTGGLSAAFGAVPPPNGETFFGAPVGRYCDGRLIIDFIAQDLGLPF  89

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             LNAYLDS+GT+F HGANFATAGS+I          GYSPF LD+Q  QF QFK R+    
Sbjct  90    LNAYLDSVGTNFSHGANFATAGSTIRRQNTTLFQTGYSPFSLDVQSWQFTQFKSRSQRAS  149

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQ-SIPKIMDKFSQ  633
              K A    V+K +LP  E FS++LYT D+GQNDL+ G+  +  ++ ++ +IP I+ KF+ 
Sbjct  150   KKGA----VFKHLLPPLEYFSRALYTLDVGQNDLTAGYVSNMTTEEVKATIPDILTKFTD  205

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +YG G R FWIHNTGP GCLP  +         VD  GC A  N VA+ FN +LK 
Sbjct  206   VIKAVYGLGGRFFWIHNTGPFGCLPYVLDRYPLRAPEVDHVGCGAPFNEVARLFNLKLKE  265

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V+QLR +  +AVFT VD+Y+ KY ++S A +HGF+ P   CC             CG  
Sbjct  266   TVMQLRKRFPRAVFTYVDVYTVKYTLISQARTHGFEHPLVACCGHGGKYNYDIHWGCGAT  325

Query  955   KKMANETVY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               + +  V     C DPS+ I WDG HY+EAAN  +   I+  G+FSDPP PV  ACR
Sbjct  326   AVVNHTKVLISKSCEDPSKRICWDGYHYTEAANRWVYDQIV-KGAFSDPPIPVTMACR  382



>ref|XP_008379194.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Malus domestica]
Length=382

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 186/390 (48%), Positives = 246/390 (63%), Gaps = 29/390 (7%)
 Frame = +1

Query  13    MEIWKRILVFEmmlmslglmgclVNGIGG-GLPQRRCWFPAVYNFGDSNSDTGGRSAALG  189
             ME WK +L       S   +   V  +GG  LP   C FPA+YNFGDSNSDTGG SAA  
Sbjct  1     MEFWKLLLA------SGFFLAFWVLAVGGQSLPP--CSFPAIYNFGDSNSDTGGISAAFE  52

Query  190   EVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-  366
              ++ P GE FF KP+GR  DGRL+IDF+AE L LPYL+AYL+S+GT++RHGANFAT GS 
Sbjct  53    PIKAPYGEAFFHKPAGRDADGRLIIDFLAERLKLPYLSAYLNSLGTNYRHGANFATGGST  112

Query  367   ------SILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSL  528
                   +I   G SPF LD+Q +QF+QFK RT +LY++    N   +  LP P EF+++L
Sbjct  113   IRRPNETIFQYGISPFSLDMQTAQFLQFKARTADLYSQ--AKNPSERSALPDPREFAEAL  170

Query  529   YTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLP  708
             YTFDIGQNDLS GF+  +  Q    +P I+++ + A++++Y EG R FWIHNTGP+GCLP
Sbjct  171   YTFDIGQNDLSMGFRKLSFDQFRAELPDIVNQLAIAVHRIYEEGGRTFWIHNTGPVGCLP  230

Query  709   ISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKY  885
             + + YN +     +D +GC    N +A EFN QL+  V++LRA+L QA  T VD+Y+AKY
Sbjct  231   VQLFYNLNPPXGYLDDHGCVKAQNDIAVEFNTQLRDXVIKLRAELPQAAITYVDVYAAKY  290

Query  886   AVVSNAGSHGFQDPFTFCC----------CGKNKKMANETVYGDPCSDPSRHISWDGVHY  1035
              ++  A + GF DP   CC          CG    +    VYG  C +PS  ISWDGVHY
Sbjct  291   GLIGTAKTEGFADPMKVCCGYHVGYDHIWCGNKGSVNGSDVYGASCQNPSAFISWDGVHY  350

Query  1036  SEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             +E AN  +A  I+ G   S+P  P+ +AC 
Sbjct  351   TEGANQWVANRILNGSPSSNPAIPITQACH  380



>ref|XP_004491984.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X1 [Cicer 
arietinum]
Length=385

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 236/356 (66%), Gaps = 27/356 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +  P G+ FF KPSGR  DGR+++DFIAE L LPY
Sbjct  28    CDFPAIYNFGDSNSDTGGISAAFQPIPSPYGDGFFHKPSGRDSDGRVILDFIAEKLNLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+GT+++HGANFAT GS       +I   G SPF LDIQI QF QFK RT  LY
Sbjct  88    LSAYLNSLGTNYKHGANFATGGSTIRRQNETIFEYGISPFSLDIQIVQFNQFKTRTKLLY  147

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +    N V +  LP PEEFSK+LYTFDIGQNDLS GF+  N  Q   S+P I+++ + A
Sbjct  148   QE--AKNSVERSKLPVPEEFSKALYTFDIGQNDLSVGFRKMNFDQIRVSMPDIVNQLASA  205

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHN----NVDKNGCAATHNRVAQEFNrq  804
             +  +Y +G R+FWIHNTGPIGCLP++  Y    HN     +D+ GC   HN +A EFN+Q
Sbjct  206   VKNIYQQGGRSFWIHNTGPIGCLPVNQFY---KHNLPVGYLDQYGCVNDHNVMAVEFNKQ  262

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK RV+++R +L +A  T VD+Y+AKY ++SN  + GF DP   CC          CG  
Sbjct  263   LKDRVVKMRTELPEAAITYVDVYAAKYGLISNTKNEGFVDPMNICCGYHVNDTHIWCGNL  322

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                  + VYG  C  PS ++SWDGVHY+EAAN  +A  I+  G+F+DP  P++ AC
Sbjct  323   GSANGKDVYGTSCEKPSMYVSWDGVHYAEAANRWVANRIL-NGNFTDPSTPISHAC  377



>ref|XP_010514503.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Camelina sativa]
Length=375

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 225/347 (65%), Gaps = 14/347 (4%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFG+  GR+ DGRL+IDFI ENL LPY
Sbjct  28    CKFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSVGRHSDGRLIIDFITENLTLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             L  YLDS+G ++RHGANFAT GS I P    +SPF L  Q+SQFI FK RT+ LYN+  G
Sbjct  88    LTPYLDSVGANYRHGANFATGGSCIRPTVACFSPFHLGTQVSQFIHFKTRTLSLYNQTKG  147

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
              +   + VL RP++FSK+LY  DIGQNDL+ GFQ     Q   +IP I++ F+ AL  LY
Sbjct  148   KSPFCRGVLARPKDFSKALYILDIGQNDLAVGFQNMTEEQLKATIPTIIENFTIALKLLY  207

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR F IHNTGP GCLP  +          D+ GC    N VA EFN+QLK ++ +L 
Sbjct  208   KEGARFFSIHNTGPTGCLPYLLKSFPATPR--DQYGCLKPLNNVAVEFNKQLKYKISELN  265

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
              +L  ++FT +D+Y+AKY ++  A + G  DPF +CC         CGK        +Y 
Sbjct  266   KELPSSLFTYIDVYTAKYNLIIKAINIGVVDPFDYCCVGAIGRGMGCGKTIFPNGTELYS  325

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               C +P+  ISWDG+HY+E AN+++A  I+  GS SD P P  +AC+
Sbjct  326   TSCKNPTNFISWDGIHYTETANMLIANRIL-DGSISDSPLPTQKACK  371



>ref|XP_004493252.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Cicer arietinum]
Length=391

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 241/361 (67%), Gaps = 28/361 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C F A++NFGDSNSDTGG SAA G+  PP GE+FF  P GRYCDGRL+IDFIAE LG 
Sbjct  33    KKCDFSAIFNFGDSNSDTGGLSAAFGQPGPPFGESFFHHPVGRYCDGRLIIDFIAEKLGH  92

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP--------GGYSPFFLDIQISQFIQFKKRTI  447
             PYLNAYLD++G++F HGANFATAGS+I P        GG+SPF LD+Q +QF  F++RT 
Sbjct  93    PYLNAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFNQFNDFQRRTQ  152

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
                NK     +++K +LP+ E+FS++LYTFDIGQNDL+ G F   +++Q    +P ++ +
Sbjct  153   IFRNK----GEIFKTLLPKAEDFSRALYTFDIGQNDLTSGYFHNMSINQVRAYVPDVLAQ  208

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F   +  +Y  G R+FW+HNTGP+GCLP  +  +K   ++ DK GCA  +N VAQ FN +
Sbjct  209   FKIIIKNVYVRGGRSFWVHNTGPVGCLPYIIDLHKVKADDFDKAGCAIPYNEVAQFFNHE  268

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK+ V+QLR +L  A  T VD+YSAKY+++S+   HGF++P   CC             C
Sbjct  269   LKSAVVQLRKKLPLAAITYVDVYSAKYSLISHPKKHGFEEPLRGCCGHGGKYNYNLHIGC  328

Query  946   GKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G   K+   E + G  C DPS  ++WDGVHY++A N  +   I+  GS+SDPP P+ +AC
Sbjct  329   GAKVKINGKEILIGKACKDPSVWVNWDGVHYTQAGNKWVFDQIV-DGSYSDPPIPLNKAC  387

Query  1123  R  1125
              
Sbjct  388   H  388



>ref|XP_008464936.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X2 [Cucumis 
melo]
Length=382

 Score =   329 bits (844),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 235/355 (66%), Gaps = 23/355 (6%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA+YNFGDSNSDTGG SAA      P G+TFF K +GR CDGRL+IDF A++L L
Sbjct  27    RACNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFHKTAGRGCDGRLIIDFFAKHLEL  86

Query  292   PYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+AYL+SIGT+FRHGANFAT GS       S+   G SPF LDIQ+ QF QFK RTI+
Sbjct  87    PYLSAYLNSIGTNFRHGANFATGGSTIRRQNESVFENGVSPFPLDIQVVQFRQFKNRTID  146

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
              Y +    +   +  LP PEEFSK+L+T DIGQNDLS GF+     Q  ++IP I+++F+
Sbjct  147   RYVE----DGSIRSSLPVPEEFSKALFTIDIGQNDLSAGFRKMTNDQFQKAIPDIINEFA  202

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISV-AYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
              A+  LY EG R FW+HNTGPIGC+P+++ + +K N  ++D+NGC    N  A EFNRQL
Sbjct  203   TAVEDLYKEGGRAFWVHNTGPIGCIPVAIRSISKPNPGDLDQNGCVKYQNNAALEFNRQL  262

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNK  957
             K RV++LRA+L  A    VD+Y+AK  +++NA   GF +    CC          CG  K
Sbjct  263   KERVVKLRAKLSNAFIVYVDVYAAKIKLIANAKEEGFMEKGAICCGYHEGVDHVWCGNKK  322

Query  958   KMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              +    VY   C DPS+ ISWDGVHY+EAAN  +A  I+  GSFSDP  P+  AC
Sbjct  323   IINGSEVYAGSCKDPSKFISWDGVHYTEAANQWIANQIV-DGSFSDPQVPIIHAC  376



>ref|XP_008365369.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Malus domestica]
Length=382

 Score =   329 bits (844),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 187/390 (48%), Positives = 246/390 (63%), Gaps = 29/390 (7%)
 Frame = +1

Query  13    MEIWKRILVFEmmlmslglmgclVNGIGG-GLPQRRCWFPAVYNFGDSNSDTGGRSAALG  189
             ME WK +L       S   +   V  +GG  LP   C FPA+YNFGDSNSDTGG SAA  
Sbjct  1     MEFWKPLLA------SGFFLAFWVLAVGGQSLPP--CSFPAIYNFGDSNSDTGGISAAFE  52

Query  190   EVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-  366
              ++ P GE FF KP+GR  DGRL+IDF+AE L LPYL+AYL+S+GT++RHGANFAT GS 
Sbjct  53    PIKAPYGEAFFHKPAGRDADGRLIIDFLAERLKLPYLSAYLNSLGTNYRHGANFATGGST  112

Query  367   ------SILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSL  528
                   +I   G SPF LD+Q +QF+QFK RT +LY +    N   +  LP P EF+++L
Sbjct  113   IRRPNETIFQYGISPFSLDMQTAQFLQFKARTADLYXQ--AKNPSERSALPDPREFAEAL  170

Query  529   YTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLP  708
             YTFDIGQNDLS GF+  +  Q    +P I+++ + A++++Y EG R FWIHNTGP+GCLP
Sbjct  171   YTFDIGQNDLSMGFRKLSFDQFRAELPDIVNQLAXAVHRIYEEGGRTFWIHNTGPVGCLP  230

Query  709   ISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKY  885
             + + YN +     +D +GC    N +A EFN QL+ RV++LRA+L QA  T VD+Y+AKY
Sbjct  231   VQLFYNLNPPPGYLDDHGCVKAQNDIAVEFNTQLRDRVIKLRAELPQAAITYVDVYAAKY  290

Query  886   AVVSNAGSHGFQDPFTFCC----------CGKNKKMANETVYGDPCSDPSRHISWDGVHY  1035
              ++  A + GF DP   CC          CG    +    VYG  C +PS  ISWDGVHY
Sbjct  291   GLIGTAKTEGFADPMKVCCGYHVGYDHIWCGNKGSVNGSDVYGASCQNPSAFISWDGVHY  350

Query  1036  SEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             +E AN  +A  I+ G   S+P  P+ +AC 
Sbjct  351   TEGANQWVANRILNGSPSSNPAIPITQACH  380



>gb|KEH22102.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=381

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 235/353 (67%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +  P G+ FF KP GR  DGR+++DFIAE L LPY
Sbjct  29    CSFPAIYNFGDSNSDTGGISAAFVPIPSPYGQGFFHKPFGRDSDGRVILDFIAEKLKLPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+GT++RHGANFAT GS       +I   G SPF LDIQI QF QFK RT +LY
Sbjct  89    LSAYLNSLGTNYRHGANFATGGSTIRKQNETIFQYGISPFSLDIQIVQFNQFKARTKQLY  148

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
              +    N + +  LP PEEF+K+LYTFDIGQNDLS GF+  N  Q  +++P I+++ + A
Sbjct  149   QE--ANNSLERSKLPVPEEFAKALYTFDIGQNDLSVGFRKMNFDQIRETMPDIVNQLASA  206

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKD-NHNNVDKNGCAATHNRVAQEFNrqlka  813
             +  +Y +G R+FWIHNTGPIGC+P+++ Y  D      D+ GC    N +A EFN++LK 
Sbjct  207   VKNIYEQGGRSFWIHNTGPIGCMPVNLFYKHDVPAGYFDQYGCVKDQNTIAVEFNKKLKD  266

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             RV++LR +L +A  T VD+Y+AKY ++SN  + GF DP   CC          CG     
Sbjct  267   RVVKLRTELPEAAITYVDVYAAKYGLISNTKNEGFVDPMKICCGYHVNDTHIWCGNLGTA  326

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               + VYG  C  PS ++SWDGVHY+EAAN  +A  I+  G+F+DP  P+ +AC
Sbjct  327   NGKDVYGTSCEKPSMYVSWDGVHYAEAANHWVADRIL-NGTFTDPATPILQAC  378



>ref|XP_007161910.1| hypothetical protein PHAVU_001G107900g [Phaseolus vulgaris]
 gb|ESW33904.1| hypothetical protein PHAVU_001G107900g [Phaseolus vulgaris]
Length=390

 Score =   329 bits (844),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 172/361 (48%), Positives = 240/361 (66%), Gaps = 28/361 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C FPA++NFGDSNSDTGG SAA G+  PP G+++F  P+GRYCDGRL++DFIA+ LG 
Sbjct  32    KKCHFPAIFNFGDSNSDTGGLSAAFGQPGPPQGDSYFHHPAGRYCDGRLIVDFIAKKLGK  91

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP--------GGYSPFFLDIQISQFIQFKKRTI  447
             PYLNA+LDS+G+++ HGANFATAGS+I P        GG+SPF LD+Q +QF  F++R+ 
Sbjct  92    PYLNAFLDSVGSNYSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFNQFSDFQRRSQ  151

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
                NK      VYK +LP+ E+FS++LYTFDIGQNDL+ G F   +  Q    +P ++D+
Sbjct  152   FFRNK----GGVYKTLLPKAEDFSQALYTFDIGQNDLTSGYFHNMSTDQVKAYVPDVLDQ  207

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F   +  +Y  G R+FW+HNTGP+GCLP  +  +    + VDK GC+  +N VA+ FNR+
Sbjct  208   FKNVIKYVYNHGGRSFWVHNTGPVGCLPYIMDLHPVKPSLVDKAGCSTPYNEVAKFFNRE  267

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V++LR +L  A  T VD+Y+ KY+++S+   HGF++P   CC             C
Sbjct  268   LKEVVVKLRKELPLAAITYVDVYAVKYSLISHPKKHGFEEPLRACCGHGGKYNYNLHTGC  327

Query  946   GKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G   K+   E + G PC DPS  ++WDGVHY++AAN  +   I+  G+FSDPP P+  AC
Sbjct  328   GAKIKIRGKEILVGKPCKDPSVWVNWDGVHYTQAANKWVLEQIV-DGAFSDPPIPLNMAC  386

Query  1123  R  1125
              
Sbjct  387   H  387



>ref|XP_010420084.1| PREDICTED: GDSL esterase/lipase At5g14450 [Camelina sativa]
Length=389

 Score =   329 bits (844),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 235/356 (66%), Gaps = 21/356 (6%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             Q +C FPA+YNFGDSNSDTGG SAA   VR P G+ FF +P+GR  DGRL IDFIAE L 
Sbjct  34    QPKCSFPAIYNFGDSNSDTGGISAAFEPVRDPYGQGFFHRPAGRDSDGRLTIDFIAERLE  93

Query  289   LPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI+QF QFK R+ 
Sbjct  94    LPYLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSA  153

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKF  627
             +L+ ++   ++  ++ LPR EEF+K+LYTFDIGQNDLS GF+  +V Q   +IP I+   
Sbjct  154   QLFTQI--KSRYDREKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHL  211

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrq  804
             + A+  +Y +G R FW+HNTGP+GCLP+++ Y        +DK+GC    N +A EFNR+
Sbjct  212   ASAVRNIYQQGGRTFWVHNTGPLGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRK  271

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK  V+ LR +L QA  T VD+Y+AKY ++SN    GF +P   CC          CG  
Sbjct  272   LKETVINLRKELTQAAITYVDVYAAKYEMMSNPKKLGFANPLKVCCGYHQKYDHIWCGNK  331

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+ N  +YG  C +P+  +SWDGVHY+EAAN  +A   +  G  +DPP PV  AC
Sbjct  332   GKVNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTL-SGLLTDPPVPVIRAC  386



>gb|ACG38411.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=396

 Score =   329 bits (844),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 231/358 (65%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG S+  G   PPNG TFFG P+GRYCDGRLVIDFIAE+LGL +
Sbjct  38    CHFPAVFNFGDSNSDTGGLSSLFGAAPPPNGRTFFGMPAGRYCDGRLVIDFIAESLGLTH  97

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIG++F  GANFATAGSSI          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  98    LSAYLNSIGSNFTQGANFATAGSSIRRQNTSLFLSGFSPISLDVQFWEFEQFINRSQLVY  157

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
             N   G   +YK++LPR E FS++LYTFDIGQND++  +  +N ++ +++ IP +M++ + 
Sbjct  158   NNKGG---IYKEILPRAEYFSQALYTFDIGQNDITSSYFVNNTTEEVEAIIPDLMERLTS  214

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y  G R FWIHNTGP+GCLP ++ +  D     D  GC+ T+N+VAQ FN +LK 
Sbjct  215   IIQSVYSRGGRYFWIHNTGPLGCLPYALLHRPDLATPADGTGCSVTYNKVAQRFNLRLKE  274

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CGK  951
              V  LR     A FT VD+Y+AKY ++S A   GF DP   CC              CG 
Sbjct  275   TVASLRKTHPDAAFTYVDVYTAKYKLISQAKKLGFDDPLLTCCGYGGGRYNLDLSVGCGG  334

Query  952   NKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K++     V G  C +PS+ +SWDGVH++EAAN  +   I+  G+ SDPP  + +AC
Sbjct  335   KKQVNGTSVVVGKSCENPSKRVSWDGVHFTEAANKFVFDQIV-AGALSDPPVALRQAC  391



>gb|ACJ85056.1| unknown [Medicago truncatula]
Length=381

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 230/346 (66%), Gaps = 27/346 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R+C FPA++NFGDSNSDTGG SAA G+   P GE+FF  P GRYCDGRL++DFIAE LGL
Sbjct  37    RKCEFPAIFNFGDSNSDTGGLSAAFGQPGYPYGESFFHHPVGRYCDGRLLVDFIAEKLGL  96

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP--------GGYSPFFLDIQISQFIQFKKRTI  447
             PYLNAYLD++G++F HGANFATAGS+I P        GG+SPF LD+Q +QF  F++RT 
Sbjct  97    PYLNAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFTQFNDFQRRTQ  156

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
                NK      +YK +LP+ E FS++LYTFDIGQNDL+ G F   +++Q    +P ++D+
Sbjct  157   FFRNK----GGIYKTLLPKAEYFSRALYTFDIGQNDLASGYFHNMSINQVKAYVPDVLDQ  212

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F   +  +Y  G R+FWIHNTGP+GCLP  +  +K   + VDK GCA  +N VA+ FN +
Sbjct  213   FKNTIKNIYAHGGRSFWIHNTGPVGCLPYIIELHKVTSDKVDKAGCAIPYNEVAKFFNHE  272

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V+QLR +L  A  T VD+YSAKY+++S A  HGF++P   CC             C
Sbjct  273   LKQAVVQLRKKLPSAAITYVDVYSAKYSLISQAYRHGFKEPLRACCGHGGKYNYNLHIGC  332

Query  946   GKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYG  1080
             G   K+   E + G PC DPS  ++WDGVH ++AAN  +   I+ G
Sbjct  333   GAKVKIDGKEILIGKPCKDPSVVVNWDGVHLTQAANKWVFEQIVDG  378



>gb|KHG01562.1| hypothetical protein F383_21105 [Gossypium arboreum]
Length=380

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 242/363 (67%), Gaps = 25/363 (7%)
 Frame = +1

Query  94    GGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFI  273
             G  LP   C FPA+YNFGDSNSDTGG SAA   +R P G  +F KPSGR  DGRL+IDFI
Sbjct  22    GANLPP--CQFPAIYNFGDSNSDTGGISAAFEPIRAPYGVPYFHKPSGRDSDGRLIIDFI  79

Query  274   AENLGLPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQF  432
             AE L LPYL+AYL+S+G +FRHGANFAT GS       +I   G SPF LD+QI QF QF
Sbjct  80    AERLKLPYLHAYLNSLGANFRHGANFATGGSTIRRPNETIYEYGISPFGLDMQIIQFEQF  139

Query  433   KKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPK  612
             K R  E+YN+    ++  KD LPRPE+F+K+LYTFDIGQNDLS GF+  +  Q   +IP 
Sbjct  140   KARATEMYNQAKDPSE--KDKLPRPEDFTKALYTFDIGQNDLSVGFRKLSFDQLRAAIPD  197

Query  613   IMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQ  789
             I+++ + A++ LY +G R+FWIHNTGPIGCLP++  Y  +     VD+ GC    N +A 
Sbjct  198   IINQLASAVHHLYEQGGRSFWIHNTGPIGCLPVNFFYILNPEPGYVDQYGCVKKQNEMAM  257

Query  790   EFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------  942
             EFNRQLK RV++LR +L +A  T+VD+Y+AK A++ NA + G  DP   CC         
Sbjct  258   EFNRQLKDRVIKLRTELPEASVTLVDVYTAKIAMIGNAKNLGMADPLKPCCGYHVNYDHV  317

Query  943   -CGKNKKMANET-VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAE  1116
              CG NK + N+T V+G  C +PS  +SWDGVHY++AAN  +A   +  GS SDP  PV  
Sbjct  318   WCG-NKAIINKTEVFGVSCKNPSMFVSWDGVHYTQAANQYVADRTL-NGSLSDPAIPVTL  375

Query  1117  ACR  1125
             AC 
Sbjct  376   ACH  378



>gb|EAZ04511.1| hypothetical protein OsI_26662 [Oryza sativa Indica Group]
Length=391

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 230/359 (64%), Gaps = 27/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG SA  G   PPNG TFFG P GRYCDGRLVIDFIAE+LGLPY
Sbjct  32    CRFPAVFNFGDSNSDTGGLSATFGAAPPPNGRTFFGMPVGRYCDGRLVIDFIAESLGLPY  91

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIG++F  GANFATAGSSI          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  92    LSAYLNSIGSNFTQGANFATAGSSIRRQNTSLFLSGFSPISLDVQSWEFEQFINRSQFVY  151

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS-QTLQSIPKIMDKFSQ  633
             N   G   +Y+++LP+ E FS++LYTFDIGQND++ GF  +  S Q +  IP +M++ + 
Sbjct  152   NNKGG---IYRELLPKAEYFSQALYTFDIGQNDITTGFFINMTSEQVIAYIPDLMERLTN  208

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +YG G R FWIHNTGPIGCLP ++ +  D     D +GC+  +N VAQ FN++LK 
Sbjct  209   IIQNVYGLGGRYFWIHNTGPIGCLPYAMVHRPDLAVVKDGSGCSVAYNEVAQLFNQRLKE  268

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------C-G  948
              V +LR     A FT VD+YSAKY ++S+A   G  DP   CC              C G
Sbjct  269   TVGRLRKTHADAAFTYVDVYSAKYKLISDAKKLGMDDPMLTCCGYGGGRYNFDDRVGCGG  328

Query  949   KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K K      V G  C DP + +SWDGVH++EAAN  +   I  GG  SDPP P+ +AC+
Sbjct  329   KVKVNGTWVVAGKSCDDPLKRVSWDGVHFTEAANKFVFDQIA-GGKLSDPPVPLRQACQ  386



>ref|NP_001060129.1| Os07g0586200 [Oryza sativa Japonica Group]
 dbj|BAC80100.1| putative early nodulin 8 precursor [Oryza sativa Japonica Group]
 dbj|BAF22043.1| Os07g0586200 [Oryza sativa Japonica Group]
 gb|EAZ40467.1| hypothetical protein OsJ_24920 [Oryza sativa Japonica Group]
 dbj|BAG93621.1| unnamed protein product [Oryza sativa Japonica Group]
Length=391

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 229/359 (64%), Gaps = 27/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG SA  G   PPNG TFFG P GRYCDGRLVIDFIAE+LGLPY
Sbjct  32    CRFPAVFNFGDSNSDTGGLSATFGAAPPPNGRTFFGMPVGRYCDGRLVIDFIAESLGLPY  91

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIG++F  GANFATAGSSI          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  92    LSAYLNSIGSNFTQGANFATAGSSIRRQNTSLFLSGFSPISLDVQSWEFEQFINRSQFVY  151

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS-QTLQSIPKIMDKFSQ  633
             N   G   +Y+++LP+ E FS++LYTFDIGQND++ GF  +  S Q +  IP +M++ + 
Sbjct  152   NNKGG---IYRELLPKAEYFSQALYTFDIGQNDITTGFFINMTSEQVIAYIPDLMERLTN  208

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +YG G R FWIHNTGPIGCLP ++ +  D     D +GC+  +N VAQ FN++LK 
Sbjct  209   IIQNVYGLGGRYFWIHNTGPIGCLPYAMVHRPDLAVVKDGSGCSVAYNEVAQLFNQRLKE  268

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------C-G  948
              V  LR     A FT VD+YSAKY ++S+A   G  DP   CC              C G
Sbjct  269   TVGHLRKTHADAAFTYVDVYSAKYKLISDAKKLGMDDPMLTCCGYGGGRYNFDDRVGCGG  328

Query  949   KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K K      V G  C DP + +SWDGVH++EAAN  +   I  GG  SDPP P+ +AC+
Sbjct  329   KVKVNGTWVVAGKSCDDPLKRVSWDGVHFTEAANKFVFDQIA-GGKLSDPPVPLRQACQ  386



>ref|XP_010551928.1| PREDICTED: GDSL esterase/lipase At5g14450 [Tarenaya hassleriana]
Length=383

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 236/353 (67%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +R P G++FF +PSGR  DGRL IDFIAE LGLPY
Sbjct  31    CSFPAIYNFGDSNSDTGGISAAFEPIRSPYGQSFFREPSGRDSDGRLTIDFIAERLGLPY  90

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+G +FR+GANFAT GS       +I   G SPF LD+Q+ QF QFK R+ +L 
Sbjct  91    LSAYLNSLGANFRNGANFATGGSTIRRQNETIFQYGISPFSLDMQVVQFDQFKARSAQLL  150

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++    ++  +D LPR E+FSK+LYTFDIGQND+S GF+  +  Q   ++P I+ +F+ A
Sbjct  151   SQ--SKSRAERDKLPRQEDFSKALYTFDIGQNDISVGFRTMSFDQLKATLPDIVSQFASA  208

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlka  813
             +  +Y  G R+FW+HNTGP GCLP+++ Y  +     +D++GC    N+++ EFNR LK 
Sbjct  209   VRSIYERGGRSFWVHNTGPFGCLPVNMFYMGNPPPGYLDEHGCVKAQNQMSMEFNRLLKE  268

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
              V++LR++L +A  T VD+YSAKY ++SN  S GF DP   CC          CG   K+
Sbjct  269   AVIKLRSELTEAAITYVDVYSAKYEMISNPKSRGFADPLKVCCGYHEKFDHIWCGNKGKV  328

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              +  +YG  C  P+  +SWDGVHY+EAAN  +A   +  GS +DPP PV  AC
Sbjct  329   NSTEIYGGSCPKPAAAVSWDGVHYTEAANKYVADRTL-NGSLTDPPVPVTRAC  380



>ref|XP_008464934.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cucumis melo]
Length=377

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 239/353 (68%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FP ++NFGDSNSDTG  SAA   +R P G+ FF KPSGR  DGRL+IDFIAE L LPY
Sbjct  25    CNFPVIFNFGDSNSDTGAISAAFEPIRWPYGDVFFNKPSGRDSDGRLIIDFIAEKLRLPY  84

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+G +FRHGANFAT GS       +I   G SPFFLD+Q++QF QFK R+ +LY
Sbjct  85    LSAYLNSLGANFRHGANFATGGSTVRKPNETIYEYGISPFFLDMQVTQFEQFKARSNDLY  144

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+    N   ++ L RPE++SK+LYTFDIGQNDL+ GF+  ++ Q   ++P I+++F+ A
Sbjct  145   NQ--AKNPYDREKLTRPEDYSKALYTFDIGQNDLAVGFRKLSIDQLRAALPDIVNQFASA  202

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNV-DKNGCAATHNRVAQEFNrqlka  813
             + ++Y  G R+FWIHNTGP GCLP++  YN +    + D++GC    N ++ E N QLKA
Sbjct  203   IQRIYKLGGRSFWIHNTGPFGCLPVNQFYNLNPPPGILDEHGCIKAQNDISMELNNQLKA  262

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             ++ +LRA+L  A  T VD+Y+AKYA++SN  + GF +P   CC          CG    +
Sbjct  263   KLDKLRAELPDAAITYVDVYAAKYALISNGKTQGFPEPLKVCCGYHVRYDHVWCGTKAPI  322

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 V+GD C + ++++SWDGVHYSEAAN  +A  I+  G+ S PP P+ +AC
Sbjct  323   NGRLVFGDACENRAQYVSWDGVHYSEAANHFVANHIL-NGALSSPPIPITQAC  374



>ref|XP_004141116.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cucumis sativus]
 gb|KGN59716.1| hypothetical protein Csa_3G840420 [Cucumis sativus]
Length=377

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 238/353 (67%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FP ++NFGDSNSDTG  SAA   +R P G+ FF KPSGR  DGRL+IDFIAE L LPY
Sbjct  25    CNFPVIFNFGDSNSDTGAISAAFEPIRWPYGDVFFNKPSGRDSDGRLIIDFIAEKLRLPY  84

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+G +FRHGANFAT GS       +I   G SPFFLD+Q++QF QFK R+ +LY
Sbjct  85    LSAYLNSLGANFRHGANFATGGSTVRKPNETIYEYGISPFFLDMQVTQFEQFKARSNDLY  144

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+    N   ++ L RPE++SK+LYTFDIGQNDL+ GF+  ++ Q   ++P I ++F+ A
Sbjct  145   NQ--AKNPYDREKLTRPEDYSKALYTFDIGQNDLAVGFRKLSIDQLRAALPDIANQFASA  202

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNV-DKNGCAATHNRVAQEFNrqlka  813
             + ++Y  G R+FWIHNTGP GCLP++  YN +    + D++GC    N ++ E N QLKA
Sbjct  203   IQRIYKLGGRSFWIHNTGPFGCLPVNQFYNLNPPPGILDEHGCIKAQNDISMELNNQLKA  262

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             ++ +LRA+L  A  T VD+Y+AKYA++SN  + GF +P   CC          CG    +
Sbjct  263   KLDKLRAELPDAAITYVDVYAAKYALISNGKTQGFPEPLKVCCGYHVRYDHVWCGTKAPI  322

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 V+GD C + ++++SWDGVHYSEAAN  +A  I+  GS S PP P+ +AC
Sbjct  323   NGSLVFGDACENRAQYVSWDGVHYSEAANHFVASHIL-SGSLSSPPIPITQAC  374



>ref|XP_007044830.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY00662.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=389

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 180/364 (49%), Positives = 239/364 (66%), Gaps = 29/364 (8%)
 Frame = +1

Query  103   LPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAEN  282
             L ++ C FPA++NFGDSNSDTGG SAA G+  PPNGE+FFG P+GRY DGRLVIDFIA++
Sbjct  28    LARKPCHFPAIFNFGDSNSDTGGLSAAFGQAGPPNGESFFGGPAGRYSDGRLVIDFIAQS  87

Query  283   LGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKR  441
             LGLPYL+A+LDS+GT+F HGANFATAGS+I P        G+SP  L++Q  +F  F  R
Sbjct  88    LGLPYLSAFLDSVGTNFTHGANFATAGSTIRPQNTTLQQSGFSPISLNVQYYEFHDFLVR  147

Query  442   TIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKI  615
             + ++  K  G   VY+ +LP+ E+FS +LYTFDIGQNDL+ G+ +SN+S  +    +P +
Sbjct  148   S-QVVRKRGG---VYETLLPKEEDFSNALYTFDIGQNDLTAGY-FSNMSTEEVKAYVPDV  202

Query  616   MDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEF  795
             +++F   +  +YG+G R FWIHNTGP+GCLP  +         +D+NGCA+  N VAQ F
Sbjct  203   LNQFQTIIQYIYGQGGRYFWIHNTGPVGCLPYVMERIPVLAGQIDENGCASPFNEVAQFF  262

Query  796   NrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-----------  942
             N  LK  V QLR  L  A  T VD+YS KY+++S    HGF  P   CC           
Sbjct  263   NLGLKKTVEQLRKDLPLAAITYVDVYSVKYSLISQGRKHGFVQPLRTCCGHGGKYNYNKN  322

Query  943   --C-GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVA  1113
               C GK  K   E + G PC DPS +++WDGVH+++AAN  +   I+  GSFSDPP P+ 
Sbjct  323   LGCGGKISKHGKEVLVGAPCKDPSTYVNWDGVHFTQAANQYIFEHIV-NGSFSDPPIPLN  381

Query  1114  EACR  1125
              AC+
Sbjct  382   MACQ  385



>ref|XP_006657897.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Oryza brachyantha]
Length=383

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 229/351 (65%), Gaps = 20/351 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG SA  G   PPNG TFFG P GRYCDGRLVIDFIAENLG+PY
Sbjct  33    CRFPAVFNFGDSNSDTGGLSATFGAAPPPNGRTFFGMPVGRYCDGRLVIDFIAENLGIPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIG++F  GANFATAGSSI          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  93    LSAYLNSIGSNFTQGANFATAGSSIRRQNTSLFLSGFSPISLDVQSWEFEQFINRSQFVY  152

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKIMDKFS  630
             N   G   +Y+ +LP+ E FS++LYTFDIGQND++ GF + N++  Q +  IP +M++ +
Sbjct  153   NNKGG---IYRQLLPKSEYFSQALYTFDIGQNDITTGF-FMNMTPEQVIAYIPDLMERLT  208

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  +YG G R FWIHNTGPIGCL  ++++  D     D  GC+  +N+VAQ FN++LK
Sbjct  209   TIIQNIYGLGGRYFWIHNTGPIGCLRYAMSHRPDLAVVKDGAGCSVAYNKVAQLFNQRLK  268

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC------CGKNKKMANE  972
               V  LR     A FT VD+YSAKY ++S A   GF DP   CC      CG   ++   
Sbjct  269   EAVASLRKTRPDAAFTYVDVYSAKYKLISEAKKLGFDDPQLPCCGDDNVGCGGKAEVNGT  328

Query  973   TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              V G  C +P R +SWDGVH +EAAN  +   I+  G  SDPP P+ +AC+
Sbjct  329   WVVGKSCDNPLRRVSWDGVHLTEAANRFVFDQIV-AGKLSDPPVPLRQACQ  378



>ref|XP_010453569.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Camelina sativa]
Length=391

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 235/356 (66%), Gaps = 21/356 (6%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             Q +C FPA+YNFGDSNSDTGG SAA   +R P G+ FF +P+GR  DGRL IDFIAE L 
Sbjct  36    QPKCSFPAIYNFGDSNSDTGGISAAFEPIRDPYGQGFFHRPAGRDSDGRLTIDFIAERLE  95

Query  289   LPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI+QF QFK R+ 
Sbjct  96    LPYLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSA  155

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKF  627
             +L+ ++   ++  ++ LPR EEF+K+LYTFDIGQNDLS GF+  +V Q   +IP I+   
Sbjct  156   QLFTQI--KSRYDREKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHL  213

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrq  804
             + A+  +Y +G R FW+HNTGP+GCLP+++ Y        +DK+GC    N +A EFNR+
Sbjct  214   ASAVRNIYQQGGRTFWVHNTGPLGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRK  273

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK  V+ LR +L QA  T VD+Y+AKY ++SN    GF +P   CC          CG  
Sbjct  274   LKETVINLRKELTQAAITYVDVYAAKYEMMSNPKKLGFANPLKVCCGYHEKYDHIWCGNK  333

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+ N  +YG  C +P+  +SWDGVHY+EAAN  +A   +  G  +DPP P+  AC
Sbjct  334   GKVNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTL-SGLLTDPPVPIIRAC  388



>gb|EYU34754.1| hypothetical protein MIMGU_mgv11b006645mg [Erythranthe guttata]
Length=385

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/353 (52%), Positives = 231/353 (65%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA G + PP G+ FF  P+GR  DGRL+IDFIAE LGLPY
Sbjct  33    CNFPAIYNFGDSNSDTGGMSAAFGPIPPPYGQDFFHGPAGRESDGRLIIDFIAEYLGLPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+GT+FRHGANFA  GS       +I   G SPF LDIQ++ F QFK RT ELY
Sbjct  93    LSAYLDSLGTNFRHGANFAAGGSTIRRQNETIYENGISPFSLDIQVTNFDQFKSRTSELY  152

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++        K  LPRP EFS++LYTFDIGQND+  GF+   + Q   ++P I++ F+ +
Sbjct  153   HR--AKKPFDKSQLPRPREFSRALYTFDIGQNDILDGFRKLTMPQLKAALPDIVEHFASS  210

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlka  813
             +  LY +GARNFWIHNTGP+GCLP +  Y  +      D  GC  +HN +  EFN+QLK+
Sbjct  211   IIHLYEKGARNFWIHNTGPLGCLPAATLYITNPKPGFFDNYGCIKSHNSMVIEFNKQLKS  270

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             R+ +LR QL++A    VD+YSAKY ++SN   +GF DP   CC          CG+   +
Sbjct  271   RIDKLRKQLRRASIIYVDVYSAKYHLISNTKYYGFTDPLKICCGRHENNFDVWCGQTMII  330

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 + G  CS P+ +ISWDGVHYS+AAN  +A  I+  GS SDP   V  AC
Sbjct  331   NGSEIIGVSCSSPASYISWDGVHYSQAANQWVANHIL-NGSLSDPLFDVTHAC  382



>ref|NP_196949.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9LY84.1|GDL76_ARATH RecName: Full=GDSL esterase/lipase At5g14450; AltName: Full=Extracellular 
lipase At5g14450; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB87784.1| early nodule-specific protein-like [Arabidopsis thaliana]
 dbj|BAC43003.1| putative early nodule-specific protein [Arabidopsis thaliana]
 gb|AAO63402.1| At5g14450 [Arabidopsis thaliana]
 gb|AED92036.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/356 (50%), Positives = 233/356 (65%), Gaps = 21/356 (6%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             Q  C FPA+YNFGDSNSDTGG SAA   +R P G+ FF +P+GR  DGRL IDFIAE LG
Sbjct  34    QPTCTFPAIYNFGDSNSDTGGISAAFEPIRDPYGQGFFHRPTGRDSDGRLTIDFIAERLG  93

Query  289   LPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI+QF QFK R+ 
Sbjct  94    LPYLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSA  153

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKF  627
              L+ ++   ++  ++ LPR EEF+K+LYTFDIGQNDLS GF+  +V Q   +IP I++  
Sbjct  154   LLFTQIK--SRYDREKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVNHL  211

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrq  804
             + A+  +Y +G R FW+HNTGP GCLP+++ Y        +DK+GC    N +A EFNR+
Sbjct  212   ASAVRNIYQQGGRTFWVHNTGPFGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRK  271

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK  V+ LR +L QA  T VD+Y+AKY ++SN    GF +P   CC          CG  
Sbjct  272   LKETVINLRKELTQAAITYVDVYTAKYEMMSNPKKLGFANPLKVCCGYHEKYDHIWCGNK  331

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+ N  +YG  C +P   +SWDGVHY+EAAN  +A   +  G  +DPP P+  AC
Sbjct  332   GKVNNTEIYGGSCPNPVMAVSWDGVHYTEAANKHVADRTL-NGLLTDPPVPITRAC  386



>ref|XP_010912877.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Elaeis guineensis]
Length=382

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 232/357 (65%), Gaps = 29/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+N GDSNSDTGG SA  G +  P GETFF KP+GRY DGRL+IDFIAE+LGLPY
Sbjct  26    CHFPAVFNLGDSNSDTGGLSATFGPLTYPYGETFFRKPAGRYSDGRLIIDFIAESLGLPY  85

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             ++AYLDS+GT+F HGANFATA S+ILP       GGYSPF LD+Q+ QF QFK R+  +Y
Sbjct  86    ISAYLDSMGTNFSHGANFATALSTILPQNITLSQGGYSPFSLDVQLKQFSQFKSRSRMIY  145

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+      VYKDV+P+ E FS++LYTFDIGQNDL+  +  +  ++  + IP  + +FS+ 
Sbjct  146   NE----GGVYKDVMPKEEYFSQALYTFDIGQNDLTALYFLNKSAE--ECIPNALKEFSKV  199

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkar  816
             +  +Y  G R+FWIHNTGP+GCLP  +       + +D  GCA  +N++AQ+FNR L   
Sbjct  200   VESIYKRGGRSFWIHNTGPLGCLPYVLVQLPLEASELDSAGCAIRYNKLAQKFNRLLNDT  259

Query  817   vlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CGKN  954
             V QLR  L  A FT+VD+YS KY ++S A   GF+ P   CC              CG  
Sbjct  260   VTQLRKDLSLAAFTLVDIYSVKYLLISQARKQGFKLPLRACCGHGGGMYNYNSNFRCGDT  319

Query  955   KKMANETVY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+   T+  G  C +P + ISWDG HY+EAAN  +   I   G+FSDP  P++ AC
Sbjct  320   VKVNGTTILVGKSCKNPWKRISWDGAHYTEAANRWVFHQISR-GAFSDPAIPLSMAC  375



>ref|XP_002463099.1| hypothetical protein SORBIDRAFT_02g037820 [Sorghum bicolor]
 gb|EER99620.1| hypothetical protein SORBIDRAFT_02g037820 [Sorghum bicolor]
Length=398

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 230/358 (64%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG S+  G   PPNG TFFG P+GRYCDGRLVIDFIAE+LGL +
Sbjct  40    CHFPAVFNFGDSNSDTGGLSSLFGAAPPPNGRTFFGMPAGRYCDGRLVIDFIAESLGLTH  99

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIG++F  GANFATAGSSI          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  100   LSAYLNSIGSNFTQGANFATAGSSIRRQNTSLFVSGFSPISLDVQFWEFEQFINRSQLVY  159

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
             N   G   +Y+ +LPR E FS++LYTFDIGQND++ G+  +N ++ +++ IP +M++ + 
Sbjct  160   NNKGG---IYRQILPRAEYFSQALYTFDIGQNDITSGYFVNNSTEEVEAIIPDLMERLTS  216

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y  G R FWIHNTGP+GCLP ++ +  D     D  GC+ T+N+VAQ FN +LK 
Sbjct  217   IIQSVYARGGRYFWIHNTGPLGCLPYALLHRPDLATPADGTGCSVTYNKVAQLFNLRLKE  276

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------C-G  948
              V  LR     A FT VD+Y+AKY ++S A   GF DP   CC              C G
Sbjct  277   TVASLRKTHPDAAFTYVDVYTAKYKLISQAKKLGFDDPLLTCCGYGGGRYNLDLSIGCGG  336

Query  949   KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             K +      V G+ C DPS+ +SWDGVH++EAAN  +   I+  G  SDPP  + +AC
Sbjct  337   KMQVNGTSVVVGNSCEDPSKRVSWDGVHFTEAANKFVFDQIV-AGVLSDPPVALRQAC  393



>ref|XP_009415970.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 233/359 (65%), Gaps = 30/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G   PP+GETFFG P+GRYCDGRL+IDFIA+ LGLP+
Sbjct  26    CAFPAIFNFGDSNSDTGGLSAAFGPAPPPHGETFFGAPAGRYCDGRLIIDFIAQGLGLPF  85

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             LNAYLDS+ T+F HGANFATAGS+I          GYSPF LD+Q  Q+ QFK R+   Y
Sbjct  86    LNAYLDSVATNFSHGANFATAGSTIQRQNTTLFQTGYSPFSLDVQSWQYAQFKSRSQIAY  145

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQ-SIPKIMDKFSQ  633
              K      V+KD LP  + FSK+LYTFDIGQNDL+ G+  +  +  ++ +IP I++KF+ 
Sbjct  146   KK-----GVFKDELPPEDYFSKALYTFDIGQNDLTSGYVSNMTTDEVKATIPDILNKFTV  200

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +YG+G R FWIHNTGP GCLP  +         VD  GC A  N VAQ FN +LK 
Sbjct  201   VIKGVYGQGGRFFWIHNTGPFGCLPYVLDRYPIRAPEVDHVGCGAPFNDVAQLFNAKLKE  260

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V QLR  L QAVFT VD+Y+ KY+++S A  H F+ P   CC             CG +
Sbjct  261   TVAQLRKDLPQAVFTYVDVYTIKYSLISQAKKHSFEHPLVACCGHGGKYNYNIHWGCG-S  319

Query  955   KKMAN--ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K + N  E + G  C DP + I WDGVHY+EAAN  +   I+  G+FSDPP P+  AC+
Sbjct  320   KVIVNGTEVLVGKACRDPLKRICWDGVHYTEAANKWVYDQIV-EGAFSDPPVPLRMACQ  377



>ref|XP_009406370.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Musa acuminata 
subsp. malaccensis]
Length=411

 Score =   327 bits (839),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 230/358 (64%), Gaps = 28/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PPNGETFF KP+GRYCDGR++IDFIA +LGLP 
Sbjct  56    CAFPAIFNFGDSNSDTGGLSAAFGQAPPPNGETFFRKPAGRYCDGRVIIDFIANSLGLPR  115

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             LNAYLDSIGT+F HGANFATAGS+I P        G+SPF LD+Q  QF QFK R+    
Sbjct  116   LNAYLDSIGTNFSHGANFATAGSTIRPQNTTLFQSGFSPFSLDVQTWQFSQFKSRSQSFL  175

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQ-SIPKIMDKFSQ  633
             ++      ++KD LP+ E FS++LYTFDIGQNDL+ G+  +  S+ ++ SIP I+DKFS 
Sbjct  176   DQ-----GLFKDQLPKKEYFSRALYTFDIGQNDLTAGYFSNMTSEEVKASIPDIVDKFSM  230

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+  +Y  G R FW+HNTGP GCL   +         VD+ GC +  N VAQ FN +L+ 
Sbjct  231   AVKSIYWGGGRFFWVHNTGPFGCLAYVLDRLLLRAPEVDRFGCGSPFNEVAQLFNTKLEE  290

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V QLR  L  AVFT VD+YS KY ++S+A  HGF+ P   CC             CG  
Sbjct  291   AVAQLREDLPLAVFTFVDVYSVKYELISHATKHGFELPLVACCGHGGKYNYNANNGCGST  350

Query  955   KKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               +   E V G  C DPS+ I WDGVHY+EAAN  +   I   G FS P  P+  AC+
Sbjct  351   ITVNGTEVVIGKSCKDPSKRIIWDGVHYTEAANRWVFDQIA-EGKFSVPHTPLRMACK  407



>ref|XP_010678671.1| PREDICTED: GDSL esterase/lipase At5g14450 [Beta vulgaris subsp. 
vulgaris]
Length=383

 Score =   326 bits (836),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 184/354 (52%), Positives = 232/354 (66%), Gaps = 22/354 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C F A+YNFGDSNSDTGG SAA   +  P G+TFF KP+GR  DGRL+IDFIAE +GLPY
Sbjct  30    CKFAAMYNFGDSNSDTGGISAAFQPISWPYGQTFFNKPAGRDSDGRLLIDFIAEQVGLPY  89

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIG +F HGANFAT GS       +I   G SPF LD+QI  + QFK RT +LY
Sbjct  90    LSAYLNSIGANFSHGANFATGGSTIRRQNETIFQYGISPFSLDVQIWHYDQFKSRTKDLY  149

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N++    +  + +LPRPE+FSK+LYTFDIGQNDLS  F+  N  Q   +IP I+ +FS A
Sbjct  150   NQVKSPFE--RSLLPRPEDFSKALYTFDIGQNDLSVAFRTMNDEQLRATIPNIISQFSTA  207

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlka  813
             +  LY +GAR+FWIHNTGPIGCLP+S+ Y  +     +D+ GC    N +A EFN+QLK 
Sbjct  208   VQHLYEQGARSFWIHNTGPIGCLPVSLFYITNPKPGFLDEYGCIKGQNDMAIEFNKQLKV  267

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
              V+QLR +L +A  T VD+YSAKY ++S   S G+ DP   CC          CG+    
Sbjct  268   AVIQLRTKLPEAALTYVDLYSAKYGLISKTKSQGWADPMKVCCGYHEKDGHVWCGQKGVT  327

Query  964   AN-ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              N  TV G  C  P  H+SWDGVH++E AN   A  I+  GS SDPP  ++ AC
Sbjct  328   TNGTTVLGAACKKPELHVSWDGVHHTEGANRWFANHIL-NGSLSDPPISISHAC  380



>ref|XP_006399957.1| hypothetical protein EUTSA_v10013537mg [Eutrema salsugineum]
 gb|ESQ41410.1| hypothetical protein EUTSA_v10013537mg [Eutrema salsugineum]
Length=447

 Score =   328 bits (841),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 233/356 (65%), Gaps = 21/356 (6%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             Q +C FPA+YNFGDSNSDTGG SAA   +R P G+ FF +P+GR  DGRL IDFIAE + 
Sbjct  92    QPKCTFPAIYNFGDSNSDTGGISAAFEPIRAPYGQGFFHQPAGRDSDGRLTIDFIAERVE  151

Query  289   LPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI+QF QFK R+ 
Sbjct  152   LPYLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSA  211

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKF  627
             +L+ +     +  ++ LPR EEF+K+LYTFDIGQNDLS GF+  +  Q   +IP I+   
Sbjct  212   QLFKQ--TKIRFEREKLPRQEEFAKALYTFDIGQNDLSVGFRTMSFDQLKATIPDILSHL  269

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrq  804
             + A+  +Y +G R FW+HNTGP GCLP+++ Y  +     +DK+GC    N +A EFNR+
Sbjct  270   ASAIRNIYQQGGRTFWVHNTGPFGCLPVNMFYMGNPAPGYLDKSGCVKAQNEMAMEFNRK  329

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK  V+ LR +L +A  T VD+Y+AKY ++SN    GF  P   CC          CG  
Sbjct  330   LKETVINLRKELAKAAITYVDVYAAKYEMMSNPKKLGFATPLKVCCGYHEKYDHIWCGNK  389

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+ N  +YG  CS+P+  +SWDGVHY+EAAN  +A   + GG  +DPP P+  AC
Sbjct  390   GKVNNTEIYGGSCSNPAMAVSWDGVHYTEAANKHVADRTL-GGLLTDPPVPITRAC  444



>ref|XP_007031627.1| Esterase, putative isoform 1 [Theobroma cacao]
 gb|EOY02553.1| Esterase, putative isoform 1 [Theobroma cacao]
Length=406

 Score =   327 bits (837),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 191/385 (50%), Positives = 244/385 (63%), Gaps = 46/385 (12%)
 Frame = +1

Query  94    GGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFI  273
             G  LP   C FPA+YNFGDSNSDTGG SAA   +R P GE FF KP+GR  DGRL+IDFI
Sbjct  25    GANLPP--CEFPAIYNFGDSNSDTGGISAAFEPIRAPYGEAFFHKPAGRDSDGRLIIDFI  82

Query  274   --------------AENLGLPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYS  390
                           AE + LPYL+AYL+S+G +FRHGANFAT GS       +I   G S
Sbjct  83    EQGLITGLVSPLVAAERVQLPYLHAYLNSLGANFRHGANFATGGSTIRRQNETIFEYGIS  142

Query  391   PFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGF  570
             PF LD+QI QF QFK RTIE+YN+    ++  KD LPRPE+F+K+LYTFDIGQNDLS GF
Sbjct  143   PFALDMQIVQFDQFKARTIEMYNQAKDPSE--KDKLPRPEDFAKALYTFDIGQNDLSVGF  200

Query  571   QYSNVSQTLQSIPKIMDKFSQAL--------YQ-LYGEGARNFWIHNTGPIGCLPISVAY  723
             +  +  Q   ++P I+++   A+        YQ LY +G R FWIHNTGPIGCLP++  Y
Sbjct  201   RKMSFDQLRAAMPDIINQLGSAVQLISMLYEYQHLYQQGGRTFWIHNTGPIGCLPVNSFY  260

Query  724   NKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSN  900
              ++     +D+ GC    N +A EFNRQLK R+++LR +L +A  T VD+Y+AKY+++SN
Sbjct  261   LRNPEPGYLDQYGCVKGQNDMAMEFNRQLKDRIIKLRTELPEASITHVDVYTAKYSMISN  320

Query  901   AGSHGFQDPFTFCC----------CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAAN  1050
             A + G  DP   CC          CG    + N  VYG  C +PS  ISWDGVHYS+AAN
Sbjct  321   AKNLGLADPLKVCCGYHVNYDHVWCGNKATINNTEVYGGSCKNPSVFISWDGVHYSQAAN  380

Query  1051  LILARSIMYGGSFSDPPRPVAEACR  1125
               +A   +  GS +DPP P+ +AC 
Sbjct  381   QFVADHTL-NGSLADPPIPITQACH  404



>gb|KEH24835.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=362

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/348 (50%), Positives = 228/348 (66%), Gaps = 24/348 (7%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
               C +PA+YNFGDSNSDTG   A     +PPNG +F G  SGR  DGRL+ID+I E L +
Sbjct  27    HECVYPAIYNFGDSNSDTGTAYATFLCNQPPNGISF-GNISGRASDGRLIIDYITEELKV  85

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPG-GYSPFFLDIQISQFIQFKKRTIELYNKLA  468
             PYL+AYL+S+G+++R+GANFA  G+SI PG G+SPF L +Q+ QFIQFK  T  L+N   
Sbjct  86    PYLSAYLNSVGSNYRYGANFAAGGASIRPGSGFSPFHLGLQVDQFIQFKSHTRILFNN--  143

Query  469   GTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQL  648
             GT    K  LPRPE+F  +LYT DIG NDL+ GF +++  Q   S P+I+  FS+A+ QL
Sbjct  144   GTEPSLKSGLPRPEDFCTALYTIDIGLNDLASGFLHASEEQVQMSFPEILGHFSKAVKQL  203

Query  649   YGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlql  828
             Y  GAR FWIHN GP+GCLP +   N++    +D NGC  + N++ QE N +LK ++ QL
Sbjct  204   YNVGARVFWIHNVGPVGCLPFNYYTNQNKKGILDANGCVESQNKITQELNNKLKDQLCQL  263

Query  829   raqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMANETV  978
             R +L  A FT VDMY AKY ++SNA S GF     FCC          CG N        
Sbjct  264   RKELVHAKFTYVDMYKAKYELISNAKSQGFVSLIDFCCGSYTGNYGVNCGMNT-------  316

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               +PC +PS+HISWDG+HYS+ AN ++A  I++ GSFSDPP P+  AC
Sbjct  317   --NPCRNPSQHISWDGIHYSQRANQLIAEKIIH-GSFSDPPVPIGNAC  361



>ref|NP_001266613.1| alpha-L-fucosidase 2 precursor [Zea mays]
 gb|ACF87430.1| unknown [Zea mays]
 gb|ACG36839.1| alpha-L-fucosidase 2 precursor [Zea mays]
Length=396

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 231/358 (65%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG S+  G   PPNG TFFG P+GRYCDGRLVIDFIAE+LGL +
Sbjct  38    CHFPAVFNFGDSNSDTGGLSSLFGAAPPPNGRTFFGMPAGRYCDGRLVIDFIAESLGLTH  97

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIG++F  GANFATAGSSI          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  98    LSAYLNSIGSNFTQGANFATAGSSIRRQNTSLFLSGFSPISLDVQFWEFEQFINRSQLVY  157

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
             N   G   +Y+++LPR E FS++LYTFDIGQND++  +  +N ++ +++ IP +M++ + 
Sbjct  158   NNKGG---IYREILPRAEYFSQALYTFDIGQNDITSSYFVNNTTEEVEAIIPDLMERLTS  214

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y  G R FWIHNTGP+GCLP ++ +  D     D  GC+ T+N+VAQ FN +LK 
Sbjct  215   IIQSVYSRGGRYFWIHNTGPLGCLPYALLHRPDLAIPADGTGCSVTYNKVAQLFNLRLKE  274

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CGK  951
              V  LR     A FT VD+Y+AKY ++S A   GF DP   CC              CG 
Sbjct  275   TVASLRKTHPDAAFTYVDVYTAKYKLISQANKLGFDDPLLTCCGYGGGRYNLDLSVGCGG  334

Query  952   NKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K++     V G  C +PS+ +SWDGVH++EAAN  +   I+  G+ SDPP  + +AC
Sbjct  335   KKQVNGTSVVVGKSCENPSKRVSWDGVHFTEAANKFVFDQIV-AGALSDPPVALRQAC  391



>ref|XP_004173555.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g14450-like 
[Cucumis sativus]
Length=377

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 237/353 (67%), Gaps = 21/353 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FP ++NFGDSNSDTG  SAA   +R P G+ FF KPSGR  DGRL+IDFIAE L LPY
Sbjct  25    CNFPVIFNFGDSNSDTGAISAAFEPIRWPYGDVFFNKPSGRDSDGRLIIDFIAEKLRLPY  84

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+G +FRHGANFAT GS       +I   G SPF LD+Q++QF QFK R+ +LY
Sbjct  85    LSAYLNSLGANFRHGANFATGGSTVRKPNETIYEYGISPFXLDMQVTQFEQFKARSNDLY  144

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+    N   ++ L RPE++SK+LYTFDIGQNDL+ GF+  ++ Q   ++P I ++F+ A
Sbjct  145   NQ--AKNPYDREKLTRPEDYSKALYTFDIGQNDLAVGFRKLSIDQLRAALPDIANQFASA  202

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNV-DKNGCAATHNRVAQEFNrqlka  813
             + ++Y  G R+FWIHNTGP GCLP++  YN +    + D++GC    N ++ E N QLKA
Sbjct  203   IQRIYKLGGRSFWIHNTGPFGCLPVNQFYNLNPPPGILDEHGCIKAQNDISMELNNQLKA  262

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             ++ +LRA+L  A  T VD+Y+AKYA++SN  + GF +P   CC          CG    +
Sbjct  263   KLDKLRAELPDAAITYVDVYAAKYALISNGKTQGFPEPLKVCCGYHVRYDHVWCGTKAPI  322

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 V+GD C + ++++SWDGVHYSEAAN  +A  I+  GS S PP P+ +AC
Sbjct  323   NGSLVFGDACENRAQYVSWDGVHYSEAANHFVASHIL-SGSLSSPPIPITQAC  374



>ref|XP_006289899.1| hypothetical protein CARUB_v10003515mg [Capsella rubella]
 gb|EOA22797.1| hypothetical protein CARUB_v10003515mg [Capsella rubella]
Length=394

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 234/356 (66%), Gaps = 21/356 (6%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             Q +C FPA+YNFGDSNSDTGG SAA   +R P G+ FF +P+GR  DGRL IDFIAE L 
Sbjct  39    QPKCTFPAIYNFGDSNSDTGGISAAFEPIRDPYGQGFFHRPAGRDSDGRLTIDFIAERLE  98

Query  289   LPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI+QF QFK R+ 
Sbjct  99    LPYLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSA  158

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKF  627
             +++ ++   ++  ++ LPR EEFSK+LYTFDIGQNDLS GF+  +V Q   +IP I+   
Sbjct  159   QIFTQI--KSRYDREKLPRQEEFSKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHL  216

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrq  804
             + A+  +Y +G R FW+HNTGP+GCLP+++ Y        +D +GC    N +A EFNR+
Sbjct  217   ASAVQNIYQQGGRTFWVHNTGPLGCLPVNMFYMGTPAPGYLDNSGCVKAQNEMAMEFNRK  276

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK  V+ LR +L QA  T VD+Y+AKY +++N    GF +P   CC          CG  
Sbjct  277   LKETVINLRKELTQAAITYVDVYAAKYEMMNNPKKLGFANPLKVCCGYHEKYDHIWCGNK  336

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+ N  +YG  C +P+  +SWDGVHY+EAAN  +A   +  G  +DPP P+  AC
Sbjct  337   GKVNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTL-SGLLTDPPVPITRAC  391



>ref|NP_001105800.1| uncharacterized protein LOC606473 precursor [Zea mays]
 dbj|BAD89850.1| hypothetical protein [Zea mays]
Length=394

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 230/358 (64%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG S+  G   PPNG TFFG P+GRYCDGRLVIDFIAE+LGL +
Sbjct  36    CHFPAVFNFGDSNSDTGGLSSLFGAAPPPNGRTFFGMPAGRYCDGRLVIDFIAESLGLTH  95

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIG++F  GANFATAGSSI          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  96    LSAYLNSIGSNFTQGANFATAGSSIRRQNTSLFLSGFSPISLDVQFWEFEQFINRSQLVY  155

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
             N   G   +Y+++LPR E FS++LYTFDIGQND++  +  +N ++ +++ IP +M++ + 
Sbjct  156   NNKGG---IYREILPRAEYFSQALYTFDIGQNDITSSYFVNNTTEEVEAIIPDLMERLTS  212

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y  G R FWIHNTGP+GCLP ++ +  D     D  GC+ T+N+V Q FN +LK 
Sbjct  213   IIQSVYSRGGRYFWIHNTGPLGCLPYALLHRPDLATPADGTGCSVTYNKVPQLFNLRLKE  272

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CGK  951
              V  LR     A FT VD+Y+AKY ++S A   GF DP   CC              CG 
Sbjct  273   TVASLRKTHPDAAFTYVDVYTAKYKLISQAKKLGFDDPLLTCCGYGGGRYNLDLSVGCGG  332

Query  952   NKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K++     V G  C +PS+ +SWDGVH++EAAN  +   I+  G+ SDPP  + +AC
Sbjct  333   KKQVNGTSVVVGKSCENPSKRVSWDGVHFTEAANKFVFDQIV-AGALSDPPVALRQAC  389



>gb|KFK25684.1| hypothetical protein AALP_AA8G145800 [Arabis alpina]
Length=389

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 230/356 (65%), Gaps = 21/356 (6%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             Q  C FPA+YNFGDSNSDTGG SAA   +R P GE FF K  GR  DGRL IDFIAE +G
Sbjct  34    QPTCTFPAIYNFGDSNSDTGGISAAFEPIRAPYGERFFHKADGRDSDGRLTIDFIAERVG  93

Query  289   LPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI QF QFK R+ 
Sbjct  94    LPYLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIVQFDQFKARSA  153

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKF  627
              L+ +    ++  ++ LPR EEF+K+LYTFDIGQNDLS GF+  +  Q   +IP I+  F
Sbjct  154   LLFTQTK--SRFEREKLPRQEEFAKALYTFDIGQNDLSVGFRTMSYDQLKATIPDIVSHF  211

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrq  804
             + A+  +Y +GAR FW+HNTGP GCLP+++ Y        +D+ GC    N +A EFNR+
Sbjct  212   ASAVRNIYQQGARTFWVHNTGPFGCLPVNMFYMGTPAPGYLDRFGCVKAQNEMAMEFNRK  271

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK  V+ LR +L +A  T VD+Y+AKY ++SN    GF +P   CC          CG  
Sbjct  272   LKETVINLRKELSKAAITYVDVYTAKYEMMSNPKKLGFANPLKVCCGYHEKYDHIWCGNK  331

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+ N  +YG  C++P+  +SWDGVHY+EAAN  +A   +  G  +DPP P+  AC
Sbjct  332   GKVNNTEIYGGSCTNPAMAVSWDGVHYTEAANKHVADRTL-SGVLTDPPVPITRAC  386



>ref|XP_002871620.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47879.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=386

 Score =   324 bits (831),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 233/356 (65%), Gaps = 21/356 (6%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             Q  C FPA+YNFGDSNSDTGG SAA   +R P G+ FF +P+GR  DGRL IDFIAE L 
Sbjct  31    QPTCTFPAIYNFGDSNSDTGGISAAFEPIRDPYGQGFFHRPAGRDSDGRLTIDFIAERLE  90

Query  289   LPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI+QF QFK R+ 
Sbjct  91    LPYLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSA  150

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKF  627
             +L++++   ++  ++ LPR EEF+K+LYTFDIGQNDLS GF+  +V Q   +IP I+   
Sbjct  151   QLFSQIK--SRYDREKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHL  208

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrq  804
             + A+  +Y +G R FW+HNTGP GCLP+++ Y        +DK+GC    N +A EFNR+
Sbjct  209   ASAVRNIYQQGGRTFWVHNTGPFGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRK  268

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK  V+ LR +L QA    VD+Y+AKY ++SN    GF +P   CC          CG  
Sbjct  269   LKETVINLRKELTQAAIIYVDVYTAKYEMMSNPKKLGFANPLKVCCGYHEKYDHIWCGNK  328

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K+ N  +YG  C +P+  +SWDGVHY+EAAN  +A   +  G  +DPP P+  AC
Sbjct  329   GKVNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTL-SGLLTDPPVPIIRAC  383



>ref|XP_004141199.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cucumis sativus]
Length=352

 Score =   323 bits (827),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 229/356 (64%), Gaps = 26/356 (7%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA+YNFGDSNSDTGG SAA      P G+TFF K +GR CD     DFIA+ L L
Sbjct  5     RACNFPAIYNFGDSNSDTGGISAAFYPTILPCGQTFFHKTAGRGCD-----DFIAKQLEL  59

Query  292   PYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+AYL+SIGT+FRHGANFAT GS       S+   G SPF LDIQ+ QF QFK RTI+
Sbjct  60    PYLSAYLNSIGTNFRHGANFATGGSTIRRQNESVFENGISPFSLDIQVVQFRQFKNRTID  119

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
              Y  +   +   +  LP PEEFSK+L+T DIGQNDLS GF+     Q  ++IP I+++F+
Sbjct  120   RY--VEAIDDSIRSTLPVPEEFSKALFTIDIGQNDLSAGFRKMTNDQFRKAIPDIINEFA  177

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISV-AYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
              A+  LY EGAR FW+HNTGPIGC+P+++ + +     ++D+NGC    N  A EFNRQL
Sbjct  178   TAVEDLYKEGARAFWVHNTGPIGCIPVAIRSVSNPKEGDLDRNGCVKEQNDAALEFNRQL  237

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNK  957
             K RV++LRA L  A    VD+Y+AK  +++NA   GF +    CC          CG  K
Sbjct  238   KERVVKLRANLLDASLVYVDVYAAKIKLIANAKEEGFMEKGAICCGYHEGLNHVWCGNRK  297

Query  958   KMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              +    VY   C DPS+ ISWDGVHY+EAAN  +A  I+  GSFSDP  P+  ACR
Sbjct  298   TINGSEVYAGSCEDPSKFISWDGVHYTEAANQWIANQIV-KGSFSDPQVPIMHACR  352



>ref|XP_007151151.1| hypothetical protein PHAVU_004G022200g [Phaseolus vulgaris]
 gb|ESW23145.1| hypothetical protein PHAVU_004G022200g [Phaseolus vulgaris]
Length=386

 Score =   323 bits (829),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 180/340 (53%), Positives = 224/340 (66%), Gaps = 13/340 (4%)
 Frame = +1

Query  124   FPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLN  303
             + A+YNFGDSNSDTG  SAA   V PPNGE F  K   R CDGRL+IDFI E L +PYL+
Sbjct  38    YSAIYNFGDSNSDTGTFSAAFAMVFPPNGENFPQKLPTRNCDGRLIIDFICEELKMPYLS  97

Query  304   AYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGT--N  477
             AYLDSIG++F +GANFA  GSSI   G+S     +QISQF+QFK RT+ LYN+ + T  +
Sbjct  98    AYLDSIGSNFSYGANFAAGGSSIKQTGFSSITFGLQISQFMQFKSRTMALYNQTSHTRVD  157

Query  478   QVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGE  657
               +K  LP+   FS +LYT DIGQNDLS GF  S+++    +IP I+ +FS  L QL+ E
Sbjct  158   APFKSRLPKSMNFSNALYTIDIGQNDLSFGFMSSDINSIRSTIPDILSQFSLGLQQLFNE  217

Query  658   GARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlraq  837
             GAR FWIHNTGPIGCLP     NK    ++D  GC    N +AQEFN+QLK  V  LR +
Sbjct  218   GARYFWIHNTGPIGCLPRMNLMNKLTPEDLDSAGCRKNENEIAQEFNKQLKDTVFGLRTK  277

Query  838   lqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYGDP  990
             L  A+FT VD+YSAKY ++ NA + GF +P  FCC         CGK KKM N       
Sbjct  278   LANAIFTYVDVYSAKYELIKNARNQGFVNPKKFCCGTSSGIHVDCGK-KKMKNGREEYYK  336

Query  991   CSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPV  1110
             C  PS++ISWDGVHYS+AAN  L+ +++   SFS PP P+
Sbjct  337   CKHPSKYISWDGVHYSQAANRWLS-TLILNASFSHPPLPI  375



>emb|CDY49758.1| BnaA02g29130D [Brassica napus]
Length=385

 Score =   323 bits (829),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 224/353 (63%), Gaps = 14/353 (4%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             ++ C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFG+ +GR+ DGRL+IDFI ENL 
Sbjct  30    RKSCNFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSAGRHSDGRLIIDFITENLT  89

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNK  462
             LPYL  YLDS+G ++RHGANFAT GS I P    +S F L  Q+SQFI FK RT+ LYN+
Sbjct  90    LPYLTPYLDSVGANYRHGANFATGGSCIRPTVACFSQFHLGTQVSQFIHFKTRTLSLYNQ  149

Query  463   LAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALY  642
                     K VL RP++FSK+LYTFDIGQNDL+ GFQ     Q   SIP I++ F+ A+ 
Sbjct  150   TNRKTPFCKGVLARPKDFSKALYTFDIGQNDLAIGFQNMTEEQLKASIPAIIESFTTAIK  209

Query  643   QLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvl  822
              LY EGAR F IHNTGP GCLP  +          D+ GC    N VA EFN+QLK ++ 
Sbjct  210   LLYKEGARFFSIHNTGPTGCLPYLLKSFPATPR--DQYGCLKPLNNVAIEFNKQLKQKIS  267

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANET  975
             +L  +L  ++ T VD+YSAK  ++  A + GF DPF +CC         CGK        
Sbjct  268   ELNKELPSSLLTYVDVYSAKNHLIIKAKNLGFVDPFDYCCVGAVGRGMGCGKTIFPNGTE  327

Query  976   VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR*IE  1134
             +Y   C +    ISWDG+H SE AN+++A  I+  GS S+PP P   AC+  E
Sbjct  328   LYSSSCQNRQNFISWDGIHCSETANMLVANRIL-DGSISNPPLPTQRACKLTE  379



>dbj|BAI23204.1| acetylcholinesterase [Salicornia europaea]
Length=387

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 183/366 (50%), Positives = 233/366 (64%), Gaps = 22/366 (6%)
 Frame = +1

Query  82    VNGIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLV  261
             V G      +  C F  +YNFGDSNSDTGG SAA   +  P G TFF K +GR  DGR++
Sbjct  22    VVGQAAATEKAACKFAGLYNFGDSNSDTGGISAAFEPIPWPYGLTFFKKSAGRDSDGRVL  81

Query  262   IDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQ  420
             +DFIAE +GLPYL+AYL+SIG +F HGANFAT GS       +I   G SPF LD+QI  
Sbjct  82    LDFIAEQVGLPYLSAYLNSIGANFSHGANFATGGSTIRRQNETIFQYGISPFSLDVQIWH  141

Query  421   FIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQ  600
               QFK RT +LY+++    +  + +LPR E+FSK+LYTFDIGQNDLS  F+  N  Q   
Sbjct  142   HDQFKSRTKDLYDQVKSPFE--RSLLPRHEDFSKALYTFDIGQNDLSVAFRTMNDEQLRA  199

Query  601   SIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHN  777
             +IP I+ +FS A+  LY +GAR+FWIHNTGPIGCLP+S+ Y        +DKNGC    N
Sbjct  200   TIPNIISQFSSAVEHLYKQGARSFWIHNTGPIGCLPVSLFYITNPKQGYLDKNGCIKGQN  259

Query  778   RVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-----  942
              +A EFN+QLK  V +LR QL +A  T VD+YSAKY ++S   S G+ DP   CC     
Sbjct  260   DMAIEFNKQLKETVTKLRMQLPEAALTYVDLYSAKYGLISKTKSEGWADPMKVCCGYHEK  319

Query  943   -----CGKNKKMAN-ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPR  1104
                  CG+   + N  TV+G  C +P  H+SWDGVH++E AN   A  I + GS SDPP 
Sbjct  320   DGHVWCGQKGVITNGSTVFGAACKNPELHVSWDGVHHTEGANHWFANQI-FNGSLSDPPV  378

Query  1105  PVAEAC  1122
             P++ AC
Sbjct  379   PLSHAC  384



>ref|XP_002530042.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF32342.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=390

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 240/376 (64%), Gaps = 33/376 (9%)
 Frame = +1

Query  91    IGGGLPQRR------CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDG  252
             +   LP+ R      C FPA++NFGDSNSDTGG SAA G+  PPNG TFF  P+GR+ DG
Sbjct  19    LASSLPKSRASQKSSCHFPAIFNFGDSNSDTGGLSAAFGQAPPPNGHTFFHHPAGRFSDG  78

Query  253   RLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQ  411
             RL+IDFIAE+LGLPYL+AYLDS+G++F HGANFATAGS+I P        GYSPF LD+Q
Sbjct  79    RLIIDFIAESLGLPYLSAYLDSVGSNFSHGANFATAGSTIRPQNTTMSQSGYSPFSLDVQ  138

Query  412   ISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYS-NVS  588
             + Q++ F +R+ +  N+      V++ +LP  + FS +LYTFDIGQNDL+ G++ +  V 
Sbjct  139   LVQYLDFHRRSQDYRNR----GGVFETLLPGADYFSNALYTFDIGQNDLTAGYKLNLTVE  194

Query  589   QTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAA  768
             Q    +P I+  FS  +  +Y +G R+FWIHNTGP+GCLP S+         +DK GCA 
Sbjct  195   QVKAFVPDIISHFSNTIKVVYAQGGRSFWIHNTGPVGCLPYSLDRFLITAAQIDKYGCAT  254

Query  769   THNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--  942
               N V+Q FN++LK  V+QLR  L QA  T VD+YS KY +++     GF++PF  CC  
Sbjct  255   PFNEVSQYFNKRLKEAVVQLRKDLSQAAITYVDVYSLKYTLITQGKKFGFKNPFIACCGH  314

Query  943   -----------CGKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGS  1086
                        CG  + + A E +  + C DPS  + WDGVH++EAAN  + + ++  GS
Sbjct  315   GGKYNYNTYARCGAKRIVNAKELIIANSCKDPSVSVIWDGVHFTEAANRWIFQQVV-NGS  373

Query  1087  FSDPPRPVAEACR*IE  1134
              SDPP P+  AC  +E
Sbjct  374   VSDPPIPLNMACPTVE  389



>ref|XP_010492254.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Camelina sativa]
Length=389

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 232/354 (66%), Gaps = 21/354 (6%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +C FPA+YNFGDSNSDTGG SAA   +R P G+ FF +P+GR  DGRL IDFIAE L LP
Sbjct  36    KCSFPAIYNFGDSNSDTGGISAAFEPIRDPYGQGFFHRPAGRDSDGRLTIDFIAERLELP  95

Query  295   YLNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIEL  453
             YL+AYL+S+G++FRHGANFAT GS       +I   G SPF LD+QI+QF QFK R+ +L
Sbjct  96    YLSAYLNSLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSAQL  155

Query  454   YNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQ  633
             + ++   ++  ++ LPR EEF+K+LYTFDIGQNDLS GF+  +V Q   +IP I+   + 
Sbjct  156   FTQI--KSRYDREKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPDIVSHLAS  213

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
             A+  +Y +G + FW+HNTGP GCLP+++ Y        +DK GC    N +A EFNR+LK
Sbjct  214   AVRNIYQQGGKTFWVHNTGPFGCLPVNMFYMGTPAPGYLDKYGCVKAQNEMAMEFNRKLK  273

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKK  960
               V+ LR +L QA  T VD+Y+AKY ++SN    GF +P   CC          CG   K
Sbjct  274   ETVINLRKELTQAAITYVDVYAAKYEMMSNPKKLGFANPLKVCCGYHEKYDHIWCGNKGK  333

Query  961   MANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             + N  +YG  C +P+  +SWDGVHY+EAAN  +A   +  G  +DPP P+  AC
Sbjct  334   VNNTEIYGGSCPNPAMAVSWDGVHYTEAANKHVADRTL-SGLLTDPPVPINRAC  386



>gb|KCW59732.1| hypothetical protein EUGRSUZ_H02485 [Eucalyptus grandis]
Length=403

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 234/353 (66%), Gaps = 24/353 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +  P G +FFGKPSGR+ DG++VIDF+AE LGLP+
Sbjct  55    CRFPAIYNFGDSNSDTGGLSAAFYWLPSPYGNSFFGKPSGRFSDGQVVIDFMAEKLGLPF  114

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G+ + HGANFAT GS+I            SP  LD+Q+ QF QFK RT EL+
Sbjct  115   LSAYLDSVGSDYLHGANFATGGSTIQRIDGRAFDARLSPISLDLQLLQFQQFKARTNELF  174

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             +    +       LP P +FS +LYT DIGQNDL  GF++    Q   SIP I  +F+  
Sbjct  175   SDGVTSR------LPLPGDFSNALYTLDIGQNDLHLGFKFMTEEQARASIPNITHQFASV  228

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISV-AYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             + +LY EGAR FWIHNTGPIGC+P++    +    + VD  GC  +HN +AQEFNRQLK 
Sbjct  229   VEKLYQEGARAFWIHNTGPIGCIPLTARRISAMQPDKVDGIGCVKSHNEIAQEFNRQLKE  288

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMA  966
             RV+ LRA+L  AV T VDMYSAK+ ++S A  HGF DP  +CC         CG    + 
Sbjct  289   RVIDLRAKLTDAVLTYVDMYSAKFMLISEAKQHGFTDPLRYCCGHNGDNVVPCGMKMAVD  348

Query  967   NETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                V GD CSDPS+HISWDG+HYS AANL +A  I+  GSFSDPP  + EACR
Sbjct  349   GVEVSGDSCSDPSQHISWDGIHYSHAANLWIANKIL-DGSFSDPPVAITEACR  400



>ref|XP_004958162.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Setaria italica]
Length=402

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 174/360 (48%), Positives = 233/360 (65%), Gaps = 29/360 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG S+  G   PPNG TFFG P+GRY DGRLVIDFIAE+LG+P+
Sbjct  44    CHFPAIFNFGDSNSDTGGLSSLFGAAPPPNGRTFFGMPAGRYSDGRLVIDFIAESLGIPH  103

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+SIG++F  GANFATAGSSI          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  104   LSAYLNSIGSNFTQGANFATAGSSIRRQNTSLFLSGFSPISLDVQSWEFEQFINRSQFVY  163

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
             +   G   +Y+ +LPR E FS++LYTFDIGQND++  +  +N ++ +++ IP +M++ + 
Sbjct  164   SNKGG---IYRALLPRAEYFSQALYTFDIGQNDITSSYFVNNTTEEVEAIIPDLMERLTF  220

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y  G R FWIHNTGP+GCLP ++ +  D     D  GC+ T+N+VAQ FN +LK 
Sbjct  221   IIQTVYSRGGRYFWIHNTGPLGCLPYALLHRPDLAAPTDGAGCSVTYNKVAQLFNLRLKE  280

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CGK  951
              V  LR     A FT VD+Y+AKY ++S A   GF DP   CC              CG 
Sbjct  281   TVASLRKTHPDAAFTYVDVYTAKYKLISEAKKLGFDDPLLTCCGYGGGRYNFDLNIGCG-  339

Query  952   NKKMANET--VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              KK  N T  V G  C+DPS+ +SWDGVH++EAAN  +   I+  G+ SDPP P+  AC+
Sbjct  340   GKKQVNGTWVVVGKSCADPSKRVSWDGVHFTEAANKFVFDQIV-AGALSDPPVPLKRACQ  398



>ref|XP_006604953.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Glycine max]
Length=381

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 182/340 (54%), Positives = 223/340 (66%), Gaps = 17/340 (5%)
 Frame = +1

Query  124   FPAVYNFGDSNSDTGGRSAALGEVRPPNGETF-FGKPSGRYCDGRLVIDFIAENLGLPYL  300
             + A+YNFGDSNSDTG  SAA   V PPNGE+F       R CDGRL+IDFI E L LPYL
Sbjct  37    YSAIYNFGDSNSDTGTFSAAFTMVYPPNGESFPRNHLPTRNCDGRLIIDFITEELKLPYL  96

Query  301   NAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQ  480
             +AYLDSIG+++ +GANFA  GSSI P G+SP F  +QISQF QFK RT+ LYN+ +   +
Sbjct  97    SAYLDSIGSNYNYGANFAAGGSSIRPTGFSPVFFGLQISQFTQFKSRTMALYNQSSHNRE  156

Query  481   --VYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYG  654
                +K  LP+  +FS +LYT DIGQNDLS GF  S+      +IP I+ +FSQ L +LY 
Sbjct  157   DAPFKSRLPKSMDFSNALYTIDIGQNDLSFGFMSSDPQSVRSTIPDILSQFSQGLQKLYN  216

Query  655   EGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlra  834
             EGAR FWIHNTGPIGCLP +   NK    ++D  GC    N +AQEFN+QLK  V +LR 
Sbjct  217   EGARFFWIHNTGPIGCLPRASVENKPRPEDLDSTGCRKMENEIAQEFNKQLKDIVFELRK  276

Query  835   qlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCCCGKN-----------KKMANETVY  981
             +L  A FT VD+YSAKY ++ NA + GF +P  FCC   N            K   E  Y
Sbjct  277   KLPTAKFTNVDVYSAKYELIKNARNQGFINPKKFCCGTTNVIHVDCGKKKINKNGKEEYY  336

Query  982   GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPP  1101
                C  PS++ISWDGVHYSEAAN  LA +++  GSFSDPP
Sbjct  337   K--CKHPSKYISWDGVHYSEAANRWLA-TLILNGSFSDPP  373



>ref|XP_006852380.1| hypothetical protein AMTR_s00049p00229270 [Amborella trichopoda]
 gb|ERN13847.1| hypothetical protein AMTR_s00049p00229270 [Amborella trichopoda]
Length=388

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 182/365 (50%), Positives = 236/365 (65%), Gaps = 27/365 (7%)
 Frame = +1

Query  97    GGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIA  276
             G     +C FPA++NFGDSNSDTGG SAA G+  PPNGE+FF  P+GRY DGRLVIDF A
Sbjct  25    GAHSSTQCHFPAIFNFGDSNSDTGGLSAAFGQAPPPNGESFFHHPAGRYSDGRLVIDFAA  84

Query  277   ENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFK  435
             ++ GLPYL+AYLDS+GT+F HGANFATAGS+I P        GYSP  LD+Q+ QF QFK
Sbjct  85    QSFGLPYLSAYLDSVGTNFSHGANFATAGSTIRPQNTTLTQTGYSPISLDVQLFQFEQFK  144

Query  436   KRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPK  612
              R+   + +  G   V++++LP+   FS++LYTFDIGQNDL+ G FQ   V Q   S+P 
Sbjct  145   SRS-GYFRQQGG---VFEELLPKQSYFSEALYTFDIGQNDLTAGLFQNLTVEQVKASVPD  200

Query  613   IMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQE  792
             I++KFS A+  +Y +G R FWIHNTGP+GCL   +         VD  GCA   N +AQ 
Sbjct  201   ILEKFSTAIKNVYWQGGRYFWIHNTGPVGCLAYVIDRLPILVPQVDMAGCATPFNHLAQY  260

Query  793   FNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------  942
             FN+ LK  V+QLR+ L  A FT VD+YS KY ++S A  +GF +P   CC          
Sbjct  261   FNQLLKETVIQLRSDLPDATFTYVDVYSVKYQLISGARKYGFGNPLRACCGHGGKYNYNR  320

Query  943   ---CGKN-KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPV  1110
                CG    K   + V G  C++PS+ I WDGVHY++AAN  +   I+  G+FSDPP P+
Sbjct  321   YFGCGSAIYKDGQKVVIGKSCNNPSKAIIWDGVHYTQAANQWVFNKIV-DGTFSDPPTPL  379

Query  1111  AEACR  1125
             ++AC 
Sbjct  380   SQACH  384



>ref|XP_002282372.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Vitis vinifera]
Length=388

 Score =   321 bits (823),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 238/365 (65%), Gaps = 27/365 (7%)
 Frame = +1

Query  106   PQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENL  285
             P   C FPAV+NFGDSNSDTGG SAA G+   PNGET+FG P+GR+ DGRL+IDFIAE+L
Sbjct  28    PLSPCSFPAVFNFGDSNSDTGGLSAAFGQAPSPNGETYFGAPAGRFSDGRLIIDFIAESL  87

Query  286   GLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRT  444
             GLPYL+AYLD++G++F HGANFATAGS+I P        GYSP  L++Q  +F  F+ R+
Sbjct  88    GLPYLSAYLDALGSNFSHGANFATAGSTIRPQNTTMAQSGYSPISLNVQFVEFSDFRNRS  147

Query  445   IELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMD  621
              +++    G   V++++LP+ E+F+ +LYTFDIGQNDL+ G++ +  ++ +++ +P ++D
Sbjct  148   -QIFRNRGG---VFQELLPKEEDFAAALYTFDIGQNDLTAGYKLNMTTEQVKAYVPDLLD  203

Query  622   KFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNr  801
               S  +  ++  GAR+FWIHNTGP+GC P  +         VDK+GCA+ +N VAQ FN 
Sbjct  204   SLSNIIKYVHARGARSFWIHNTGPVGCYPYVMDRFPITAAQVDKHGCASPYNEVAQYFNS  263

Query  802   qlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------  942
             +LK  V QLR  L +A  T VD+YS KY ++S A   GF DPF  CC             
Sbjct  264   RLKGAVAQLRKDLPEAAITYVDVYSVKYRLISQARKQGFMDPFKVCCGHGGKYNYNQAFK  323

Query  943   CGKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEA  1119
             CG   K+   E V    C +P   ISWDGVH++EAAN  +   I+  GSFSDPP P+  A
Sbjct  324   CGAKIKVGGKEVVIAKSCENPRVRISWDGVHFTEAANKWIFDRIV-DGSFSDPPIPLRMA  382

Query  1120  CR*IE  1134
             C  ++
Sbjct  383   CHRVD  387



>ref|XP_008230934.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Prunus mume]
Length=387

 Score =   321 bits (823),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 234/353 (66%), Gaps = 23/353 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +  P GETFF +P+GR CDGRL+IDFIA++LGLPY
Sbjct  34    CDFPAIYNFGDSNSDTGGISAAFYPMASPCGETFFHRPAGRGCDGRLMIDFIAKHLGLPY  93

Query  298   LNAYLDSIGTSFRHGANFATAGSSIL-------PGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+ YLDS+ ++FRHGANFAT G++I+         G SPF LDIQI+Q+ Q K RT  LY
Sbjct  94    LSPYLDSLESNFRHGANFATGGATIIRYNESWFQNGVSPFSLDIQIAQYQQLKSRTTSLY  153

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+     Q ++   PR ++FSK+LY FDIGQND++ G +  +  Q    IP I+++ + A
Sbjct  154   NR--AKKQPHR--FPRVDDFSKALYIFDIGQNDVAAGIRKMSDEQFQAQIPDIINQLATA  209

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             +  LY +GAR FWIHNTGPIGCL +++ Y +  + + VD+ GC    N +A++FNR LK 
Sbjct  210   IRNLYDQGARTFWIHNTGPIGCLAVTLHYLHNPSPDYVDRRGCVKFQNDMARQFNRALKQ  269

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             +V QLR +L  A  T V++++AKY ++SNA  HGF D    CC          CG    +
Sbjct  270   KVFQLRKELLLAAITHVNVFAAKYKLLSNAKKHGFLDKTRICCGYHEDSNHVYCGNKGII  329

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 VY   C DPS +ISWDGVHY+EAAN  +A  ++  GSFSDPP P+  +C
Sbjct  330   NGTQVYAGSCEDPSLYISWDGVHYTEAANHWIANQLI-SGSFSDPPLPITNSC  381



>ref|XP_004306388.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Fragaria vesca 
subsp. vesca]
Length=387

 Score =   321 bits (823),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 185/393 (47%), Positives = 250/393 (64%), Gaps = 32/393 (8%)
 Frame = +1

Query  13    MEIWKRILVFEmmlmslglmgclVNGIGG-GLPQRRCWFPAVYNFGDSNSDTGGRSAALG  189
             ME WK++++    L         + G+ G  LP   C+FPA+YNFGDSNSDTGG SAA  
Sbjct  1     MERWKQLVLLPFGLFLAMC----ILGVSGRALPS--CYFPAIYNFGDSNSDTGGISAAFE  54

Query  190   EVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS-  366
              ++ P GE FFGKP+GR  DGRL+IDF AE+L LPY+ AYL+S+GTSFR+GANFAT GS 
Sbjct  55    PIQAPYGEGFFGKPAGRDSDGRLMIDFFAEHLRLPYVTAYLNSLGTSFRYGANFATGGSP  114

Query  367   ----------SILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEF  516
                       +I   G SPF LD+Q +QF+QFK R+ +L+ K        +  LP P++F
Sbjct  115   IRRPKGTIFETIFGFGLSPFSLDMQTTQFLQFKARSADLFQK--ANYFCDRSKLPNPQDF  172

Query  517   SKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPI  696
             +K+LYTFDIGQNDLS GF+  +  Q    IP ++++ + A+  +Y +G R FWIHN GPI
Sbjct  173   AKALYTFDIGQNDLSAGFRKLSFDQLRAEIPDMINQHAAAVRLVYEQGGRAFWIHNAGPI  232

Query  697   GCLPISVAYN-KDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMY  873
             GCLP+ + YN K   + +D++GC    N +A EFNRQLK  V++LRA+L QA  T VD+Y
Sbjct  233   GCLPVGLFYNIKPAPSALDEHGCVKDQNEMAIEFNRQLKDSVIKLRAELPQAAITYVDIY  292

Query  874   SAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMANETVYGDPCSDPSRHISWD  1023
             +AKY ++SNA   GF  P   CC          CG    +    V+G  C + S  ISWD
Sbjct  293   AAKYELISNAKKEGFMAPMKVCCGFHMGNDHVWCGNKATVNGTEVFGGACGNASSVISWD  352

Query  1024  GVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G+HY++AAN  +A  I+  G+ SDPP P+++AC
Sbjct  353   GIHYTQAANKWVANRIL-NGALSDPPLPISQAC  384



>ref|XP_007216389.1| hypothetical protein PRUPE_ppa021457mg, partial [Prunus persica]
 gb|EMJ17588.1| hypothetical protein PRUPE_ppa021457mg, partial [Prunus persica]
Length=368

 Score =   320 bits (820),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 234/353 (66%), Gaps = 23/353 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +  P GETFF +P+GR CDGRL+IDFIA++LGLPY
Sbjct  15    CDFPAIYNFGDSNSDTGGISAAFYPMASPCGETFFHRPAGRGCDGRLMIDFIAKHLGLPY  74

Query  298   LNAYLDSIGTSFRHGANFATAGSSIL-------PGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+ YLDS+ ++FRHGANFAT G++I+         G SPF LDIQI+Q+ Q K RT  LY
Sbjct  75    LSPYLDSLESNFRHGANFATGGATIIRYNESWFQNGVSPFSLDIQIAQYQQLKSRTTSLY  134

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+     Q ++   PR ++FSK+LY FDIGQND++ G +  +  Q    IP I+++ + A
Sbjct  135   NR--AKKQPHR--FPRVDDFSKALYIFDIGQNDVAAGIRKMSDEQFQAQIPDIINQLATA  190

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             +  LY +GAR FWIHNTGPIGCL +++ Y +  + + VD+ GC    N +A++FNR LK 
Sbjct  191   IRNLYDQGARTFWIHNTGPIGCLAVTLHYLHNPSPDYVDRRGCVKFQNDMARQFNRALKQ  250

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             +V QLR +L  A  T V++++AKY ++SNA  HGF D    CC          CG    +
Sbjct  251   KVFQLRKELLLAAITHVNVFAAKYKLLSNAKKHGFLDKTRICCGYHEDSNHVYCGNKGII  310

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 VY   C DPS +ISWDGVHY+EAAN  +A  ++  GSFSDPP P+  +C
Sbjct  311   NGTQVYAGSCEDPSLYISWDGVHYTEAANHWIANQLI-SGSFSDPPLPITNSC  362



>gb|EYU44799.1| hypothetical protein MIMGU_mgv1a008141mg [Erythranthe guttata]
Length=383

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 235/354 (66%), Gaps = 22/354 (6%)
 Frame = +1

Query  115   RCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLP  294
             +C +PA+YNFGDSNSDTGG +AA      P+GET+F +P+GR  DGRL+IDFIA +LGLP
Sbjct  30    KCNYPAIYNFGDSNSDTGGSAAAFYPPALPSGETYFHRPAGRASDGRLIIDFIAGDLGLP  89

Query  295   YLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIEL  453
             YL+ YLDSIG+++RHGANFAT G++++         G SPF L+IQ+  + Q K++T   
Sbjct  90    YLSPYLDSIGSNYRHGANFATGGATVMRPNESWFVNGVSPFNLEIQVEHYTQLKEKTFFF  149

Query  454   YNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQ  633
             Y      N   +  +PRP++FSK+LY  DIGQND++ G +  ++     ++P+I+++F  
Sbjct  150   YKDKKKCN---RKRMPRPKDFSKALYVIDIGQNDVAAGIRKLSIELQKAALPQIVNQFKV  206

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPI-SVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
              L  LY  GARNFW+HNTGPIGCLP+ +V         +DK+GC  + N VA EFN+QLK
Sbjct  207   QLQNLYNRGARNFWVHNTGPIGCLPVATVKVQNPVPGYLDKHGCVKSQNDVALEFNKQLK  266

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKK  960
               ++ LR+QL +AV   VDMYSAKY ++++A + GF+D FT CC          CG    
Sbjct  267   DEIVNLRSQLSEAVIIYVDMYSAKYGLITDAKNQGFEDSFTICCGYHGIGYDVWCGNKGN  326

Query  961   MANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             +    V G  CS+PS  ISWDGVHY+EAAN  +A  I+  GSFSDPP P++ AC
Sbjct  327   VNGSEVTGGSCSNPSAVISWDGVHYTEAANRWIATRIV-SGSFSDPPVPISRAC  379



>ref|XP_004304672.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Fragaria vesca 
subsp. vesca]
Length=388

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 178/354 (50%), Positives = 229/354 (65%), Gaps = 22/354 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG SAA   +  P G+TFF +P+GR  DGRL+IDFIAE LGLPY
Sbjct  35    CEFPAIYNFGDSNSDTGGISAAFYAMPSPYGDTFFNRPAGRGSDGRLIIDFIAEKLGLPY  94

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L++YLDSI ++FRHGANFA+ G++I          G SPF LDIQ  Q+ QFK RT   Y
Sbjct  95    LSSYLDSIRSNFRHGANFASGGATIRRQNESWFDNGVSPFPLDIQFVQYDQFKGRTTTFY  154

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+           LPRPE+FSK+LYTFDIGQNDL+ GF+  +  + L  IP I+++ + A
Sbjct  155   NQAKELFDTQD--LPRPEDFSKALYTFDIGQNDLAAGFRKMSTEKLLAEIPDIVNQLAAA  212

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN--VDKNGCAATHNRVAQEFNrqlk  810
             +  LY  GAR FWIHNTGPIGCL +++ Y  D      +D++GC    N +A++FNR LK
Sbjct  213   IRSLYDRGARAFWIHNTGPIGCLGVTLHYIHDPSPTGYLDRHGCVKFQNDMARQFNRLLK  272

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKK  960
              +V+QLR +L  +  T V++++AKY ++SNA   GF D    CC          CG   K
Sbjct  273   QKVIQLRKELPFSAITYVNVFAAKYKLISNAKKLGFFDKTKICCGYHEDYDHVWCGNKGK  332

Query  961   MANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             +    +Y   C DPS +ISWDGVHY+EAAN  +A  I   GSFSDPP  +  AC
Sbjct  333   INGNEIYAGSCEDPSLYISWDGVHYTEAANHWIANQIA-SGSFSDPPVSITNAC  385



>ref|XP_007031629.1| Esterase, putative [Theobroma cacao]
 gb|EOY02555.1| Esterase, putative [Theobroma cacao]
Length=384

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 180/354 (51%), Positives = 241/354 (68%), Gaps = 23/354 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C F A+YNFGDSNSDTG  SAA+   + PNGETFF KP+GR CDGRL+IDFIAE LGLP+
Sbjct  31    CNFKAIYNFGDSNSDTGAISAAIFPRQWPNGETFFHKPAGRVCDGRLMIDFIAERLGLPF  90

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LDSIG++FR GANFA+ GS+I+P        G SPF L++Q+ Q+ QFK RT +LY
Sbjct  91    LSAFLDSIGSNFRQGANFASGGSTIVPQNKTIAESGLSPFALNVQVFQYDQFKARTTDLY  150

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
                  + + +   LPRP++F ++LY FDIGQND+++G +    +Q L SIP I+ + + A
Sbjct  151   KDKRYSCRSH---LPRPKDFPEALYVFDIGQNDIAYGLRTVGDAQILASIPDIISQLAIA  207

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlka  813
             +  LY +GAR FWIHNTGP GCLP ++   K+     +DK+GC  + N +A+EFNRQLK 
Sbjct  208   VEHLYTQGARTFWIHNTGPSGCLPSTLLGIKNPPPGFLDKHGCVKSQNDIAKEFNRQLKN  267

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
             RV++LRA+L QA  T VD+++AKY ++SN+   GF D    CC          CG    +
Sbjct  268   RVIKLRAELPQAAITYVDIFAAKYGLISNSKQQGFVDAQKICCGYHKNGIDVGCGGILPL  327

Query  964   ANET-VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              N T ++G  C DPS +ISWDGVHY+EAAN  +A  ++  GS SDPP P+  AC
Sbjct  328   PNGTQIFGAACKDPSLYISWDGVHYTEAANRWIANRLI-NGSLSDPPIPITHAC  380



>sp|Q9LII9.1|GDL54_ARATH RecName: Full=GDSL esterase/lipase At3g27950; AltName: Full=Extracellular 
lipase At3g27950; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01482.1| unnamed protein product [Arabidopsis thaliana]
Length=371

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 225/351 (64%), Gaps = 26/351 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTG  SAA+GEV PPNG  FFG+ +GR+ DGRL+IDFI ENL LPY
Sbjct  28    CNFPAVFNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSAGRHSDGRLIIDFITENLTLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             L  YLDS+G ++RHGANFAT GS I P    +SPF L  Q+SQFI FK RT+ LYN+  G
Sbjct  88    LTPYLDSVGANYRHGANFATGGSCIRPTLACFSPFHLGTQVSQFIHFKTRTLSLYNQTNG  147

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
                   + L     FSK+LYT DIGQNDL+ GFQ     Q   +IP I++ F+ AL  LY
Sbjct  148   K----FNRLSHTNYFSKALYTLDIGQNDLAIGFQNMTEEQLKATIPLIIENFTIALKLLY  203

Query  652   GEGARNFWIHNTGPIGCLPISV----AYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarv  819
              EGAR F IHNTGP GCLP  +    A  +D +      GC    N VA EFN+QLK ++
Sbjct  204   KEGARFFSIHNTGPTGCLPYLLKAFPAIPRDPY------GCLKPLNNVAIEFNKQLKNKI  257

Query  820   lqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANE  972
              QL+ +L  + FT VD+YSAKY +++ A + GF DPF +CC         CGK   +   
Sbjct  258   TQLKKELPSSFFTYVDVYSAKYNLITKAKALGFIDPFDYCCVGAIGRGMGCGKTIFLNGT  317

Query  973   TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              +Y   C +    ISWDG+HY+E AN+++A  I+  GS SDPP P  +AC+
Sbjct  318   ELYSSSCQNRKNFISWDGIHYTETANMLVANRIL-DGSISDPPLPTQKACK  367



>ref|XP_011034054.1| PREDICTED: GDSL esterase/lipase At3g26430-like isoform X1 [Populus 
euphratica]
Length=390

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 176/361 (49%), Positives = 234/361 (65%), Gaps = 27/361 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAALG+   PNGET+F  P+GRY DGRL+IDFIAE+LG+PY
Sbjct  33    CDFPAIFNFGDSNSDTGGLSAALGQAPSPNGETYFHHPAGRYSDGRLIIDFIAESLGVPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G++F HGANFATAGS+I P        GYSP  L++Q  Q+  FKKR+  + 
Sbjct  93    LSAYLDSVGSNFSHGANFATAGSTIRPQNTTQSQSGYSPISLNVQSVQYSDFKKRSQTVR  152

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYS-NVSQTLQSIPKIMDKFSQ  633
             ++      +++ ++P+ + FSK+LYT DIGQNDL+ G++ +    Q   S+P ++ +FS 
Sbjct  153   SQ----GGIFETLMPKADYFSKALYTIDIGQNDLTAGYKLNLTTEQVKASVPDMLGQFSN  208

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+ Q+Y  G R+FWIHNTGP+GCLP S+         +DK GCA+  N V+Q FN +LK 
Sbjct  209   AVKQIYAVGGRSFWIHNTGPVGCLPYSLDRFLITAAQIDKYGCASPFNEVSQFFNHRLKE  268

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V+QLR  L QA  T VD+YS KY + + A   GF+ PF  CC             CG  
Sbjct  269   AVVQLRKDLPQAAITYVDIYSLKYTLTTQAKKFGFKQPFVACCGHGGKYNYNSQRRCGAK  328

Query  955   KKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR*I  1131
               +   E V  + C DPS  I WDGVH++EAAN  + + I+  GSFSDPP P+  AC   
Sbjct  329   ITVNGTEVVIANSCKDPSVRIIWDGVHFTEAANKWIFQQIV-NGSFSDPPVPLKMACHRT  387

Query  1132  E  1134
             E
Sbjct  388   E  388



>ref|XP_006292652.1| hypothetical protein CARUB_v10018895mg [Capsella rubella]
 gb|EOA25550.1| hypothetical protein CARUB_v10018895mg [Capsella rubella]
Length=362

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 223/347 (64%), Gaps = 28/347 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFG+ +GR+ DGRL+IDFI ENL LPY
Sbjct  29    CNFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSAGRHSDGRLIIDFITENLTLPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             L  +LDS+G ++RHGANFAT GS I P    +S F L  Q+SQFI FK RT+ LYN    
Sbjct  89    LTPFLDSVGANYRHGANFATGGSCIRPTVSCFSQFHLGTQVSQFIHFKTRTLSLYN----  144

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
                       + ++FSK+LYTFDIGQNDL+ GFQ +   Q   +IP I++ F+ AL  LY
Sbjct  145   ----------QTKDFSKALYTFDIGQNDLAIGFQTTTEEQLKATIPTIIENFTIALKLLY  194

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR F IHNTGP GCLP  +          D+ GC    N VA EFN+QLK ++ +L 
Sbjct  195   KEGARFFSIHNTGPTGCLPYLLKSFPATPR--DQYGCLKPLNNVAVEFNKQLKNKITELN  252

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
              +L  ++FT VD+++AKY ++  A S GF DPF +CC         CGK        +Y 
Sbjct  253   KELPSSLFTYVDVFTAKYNLIIKAKSLGFVDPFDYCCVGAVGRGMGCGKTIFPNGTELYS  312

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               C +P+  ISWDG+HY+E AN+++A+ I+  GS S+PP P  + C+
Sbjct  313   TSCKNPTNFISWDGIHYTETANMLVAKQIL-DGSISNPPLPTQKVCK  358



>ref|XP_004239139.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Solanum lycopersicum]
Length=386

 Score =   319 bits (818),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 230/359 (64%), Gaps = 29/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG SAA G+  PP GET+FG P+GRYCDGRLV+DFIAENLGLPY
Sbjct  32    CHFPAVFNFGDSNSDTGGLSAAFGQAGPPAGETYFGAPAGRYCDGRLVVDFIAENLGLPY  91

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LD++G++F HGANFATAGS+I P        G+SP  L++Q  +F  F  R+  + 
Sbjct  92    LSAFLDALGSNFSHGANFATAGSTIRPQNTTLHQSGFSPISLNVQSYEFNDFLHRSQIIR  151

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKIMDKFS  630
             NK      V+  ++P+ + FS+ LYTFDIGQNDL+ G+ +SN+S  Q    +P ++D+F 
Sbjct  152   NK----GDVFCKLMPKEKHFSEGLYTFDIGQNDLTAGY-FSNMSTDQVRAYVPDVIDQFK  206

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  +Y  G R FWIHNTGP+GCLP  +         VDK GCAA  N VAQ FN +LK
Sbjct  207   TVIQGIYSRGGRYFWIHNTGPVGCLPYVLDRLLITAGQVDKAGCAAPFNEVAQYFNAKLK  266

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG-  948
               V++LR  L  A  T VD+YS KY ++ +A  HGF+ P   CC             CG 
Sbjct  267   EAVIELRKDLPLAALTYVDVYSVKYELIYHANKHGFEHPLQACCGHGGKYNYNINHGCGS  326

Query  949   KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K K    E + G  C  PS+ I+WDGVH++EAAN  + + I+  G +SDPP P+  AC 
Sbjct  327   KIKVKGKEIILGKSCKSPSKRINWDGVHFTEAANKWVFQQIV-NGLYSDPPLPLNMACH  384



>emb|CBI16795.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 238/365 (65%), Gaps = 27/365 (7%)
 Frame = +1

Query  106   PQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENL  285
             P   C FPAV+NFGDSNSDTGG SAA G+   PNGET+FG P+GR+ DGRL+IDFIAE+L
Sbjct  89    PLSPCSFPAVFNFGDSNSDTGGLSAAFGQAPSPNGETYFGAPAGRFSDGRLIIDFIAESL  148

Query  286   GLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRT  444
             GLPYL+AYLD++G++F HGANFATAGS+I P        GYSP  L++Q  +F  F+ R+
Sbjct  149   GLPYLSAYLDALGSNFSHGANFATAGSTIRPQNTTMAQSGYSPISLNVQFVEFSDFRNRS  208

Query  445   IELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMD  621
              +++    G   V++++LP+ E+F+ +LYTFDIGQNDL+ G++ +  ++ +++ +P ++D
Sbjct  209   -QIFRNRGG---VFQELLPKEEDFAAALYTFDIGQNDLTAGYKLNMTTEQVKAYVPDLLD  264

Query  622   KFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNr  801
               S  +  ++  GAR+FWIHNTGP+GC P  +         VDK+GCA+ +N VAQ FN 
Sbjct  265   SLSNIIKYVHARGARSFWIHNTGPVGCYPYVMDRFPITAAQVDKHGCASPYNEVAQYFNS  324

Query  802   qlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------  942
             +LK  V QLR  L +A  T VD+YS KY ++S A   GF DPF  CC             
Sbjct  325   RLKGAVAQLRKDLPEAAITYVDVYSVKYRLISQARKQGFMDPFKVCCGHGGKYNYNQAFK  384

Query  943   CGKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEA  1119
             CG   K+   E V    C +P   ISWDGVH++EAAN  +   I+  GSFSDPP P+  A
Sbjct  385   CGAKIKVGGKEVVIAKSCENPRVRISWDGVHFTEAANKWIFDRIV-DGSFSDPPIPLRMA  443

Query  1120  CR*IE  1134
             C  ++
Sbjct  444   CHRVD  448



>ref|XP_002272185.2| PREDICTED: GDSL esterase/lipase At5g14450-like [Vitis vinifera]
 ref|XP_010660838.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Vitis vinifera]
Length=397

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 236/369 (64%), Gaps = 35/369 (9%)
 Frame = +1

Query  100   GLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAE  279
             GLP   C FPA++NFGDSNSDTGG SAA   +  P GETFF +  GR  DGRL++DFIAE
Sbjct  30    GLPS--CHFPAIFNFGDSNSDTGGMSAAFYPMVWPFGETFFHEAVGRASDGRLMVDFIAE  87

Query  280   NLGLPYLNAYLDSIGTS----------FRHGANFATAGSSIL-------PGGYSPFFLDI  408
             +L LPYL+AYLDS+G+S          FRHGANFAT G++IL         G SPF+LDI
Sbjct  88    HLKLPYLSAYLDSLGSSLRHGRNFGVNFRHGANFATGGATILRPNKTLFESGVSPFYLDI  147

Query  409   QISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS  588
             QI+ F QFK RT  LYN      Q  K  LPRPE+FSK+LY  DIGQND+S G   S   
Sbjct  148   QIAHFDQFKARTTSLYNHAKSAFQRRK--LPRPEDFSKALYILDIGQNDISAGL--SKKE  203

Query  589   QTLQS-IPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCA  765
             +  Q+ IP++++K S A+  LY +GAR FWIHNTGP GCLP+S+ Y  +    +DK GC 
Sbjct  204   EERQAYIPELVNKLSAAVQHLYEQGARAFWIHNTGPFGCLPVSILYAPNPQGTLDKCGCL  263

Query  766   ATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-  942
                N VA EFN+QLK  V++LRA L +A  T VD+Y+AKYA++S+A   GF +P   CC 
Sbjct  264   KYSNGVAMEFNKQLKEAVVKLRADLPEAALTYVDIYAAKYALISDAKKQGFVEPPEKCCG  323

Query  943   ---------CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSD  1095
                      CG+   +    V+   C +PS +ISWDGVHY+EAAN   A+ I+  G  SD
Sbjct  324   KRVNGVDVQCGQKANVNGTEVHAASCKNPSSYISWDGVHYTEAANHWFAKRIIM-GLVSD  382

Query  1096  PPRPVAEAC  1122
                P+A+AC
Sbjct  383   NSIPMAQAC  391



>emb|CBI34837.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   319 bits (818),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 187/370 (51%), Positives = 236/370 (64%), Gaps = 35/370 (9%)
 Frame = +1

Query  100   GLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAE  279
             GLP   C FPA++NFGDSNSDTGG SAA   +  P GETFF +  GR  DGRL++DFIAE
Sbjct  39    GLPS--CHFPAIFNFGDSNSDTGGMSAAFYPMVWPFGETFFHEAVGRASDGRLMVDFIAE  96

Query  280   NLGLPYLNAYLDSIGTS----------FRHGANFATAGSSIL-------PGGYSPFFLDI  408
             +L LPYL+AYLDS+G+S          FRHGANFAT G++IL         G SPF+LDI
Sbjct  97    HLKLPYLSAYLDSLGSSLRHGRNFGVNFRHGANFATGGATILRPNKTLFESGVSPFYLDI  156

Query  409   QISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS  588
             QI+ F QFK RT  LYN      Q  K  LPRPE+FSK+LY  DIGQND+S G   S   
Sbjct  157   QIAHFDQFKARTTSLYNHAKSAFQRRK--LPRPEDFSKALYILDIGQNDISAGL--SKKE  212

Query  589   QTLQS-IPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCA  765
             +  Q+ IP++++K S A+  LY +GAR FWIHNTGP GCLP+S+ Y  +    +DK GC 
Sbjct  213   EERQAYIPELVNKLSAAVQHLYEQGARAFWIHNTGPFGCLPVSILYAPNPQGTLDKCGCL  272

Query  766   ATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-  942
                N VA EFN+QLK  V++LRA L +A  T VD+Y+AKYA++S+A   GF +P   CC 
Sbjct  273   KYSNGVAMEFNKQLKEAVVKLRADLPEAALTYVDIYAAKYALISDAKKQGFVEPPEKCCG  332

Query  943   ---------CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSD  1095
                      CG+   +    V+   C +PS +ISWDGVHY+EAAN   A+ I+  G  SD
Sbjct  333   KRVNGVDVQCGQKANVNGTEVHAASCKNPSSYISWDGVHYTEAANHWFAKRIIM-GLVSD  391

Query  1096  PPRPVAEACR  1125
                P+A+AC 
Sbjct  392   NSIPMAQACH  401



>ref|NP_189434.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE77385.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=361

 Score =   318 bits (814),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 225/351 (64%), Gaps = 36/351 (10%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTG  SAA+GEV PPNG  FFG+ +GR+ DGRL+IDFI ENL LPY
Sbjct  28    CNFPAVFNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSAGRHSDGRLIIDFITENLTLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             L  YLDS+G ++RHGANFAT GS I P    +SPF L  Q+SQFI FK RT+ LYN+   
Sbjct  88    LTPYLDSVGANYRHGANFATGGSCIRPTLACFSPFHLGTQVSQFIHFKTRTLSLYNQ---  144

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
             TN           +FSK+LYT DIGQNDL+ GFQ     Q   +IP I++ F+ AL  LY
Sbjct  145   TN-----------DFSKALYTLDIGQNDLAIGFQNMTEEQLKATIPLIIENFTIALKLLY  193

Query  652   GEGARNFWIHNTGPIGCLPISV----AYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarv  819
              EGAR F IHNTGP GCLP  +    A  +D +      GC    N VA EFN+QLK ++
Sbjct  194   KEGARFFSIHNTGPTGCLPYLLKAFPAIPRDPY------GCLKPLNNVAIEFNKQLKNKI  247

Query  820   lqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANE  972
              QL+ +L  + FT VD+YSAKY +++ A + GF DPF +CC         CGK   +   
Sbjct  248   TQLKKELPSSFFTYVDVYSAKYNLITKAKALGFIDPFDYCCVGAIGRGMGCGKTIFLNGT  307

Query  973   TVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              +Y   C +    ISWDG+HY+E AN+++A  I+  GS SDPP P  +AC+
Sbjct  308   ELYSSSCQNRKNFISWDGIHYTETANMLVANRIL-DGSISDPPLPTQKACK  357



>ref|XP_010110056.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXC25091.1| GDSL esterase/lipase [Morus notabilis]
Length=385

 Score =   318 bits (816),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 227/356 (64%), Gaps = 27/356 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTG  SAA     PPNG TFF  P+GR CDGRLVIDFIA+ LGLPY
Sbjct  34    CEFPAIFNFGDSNSDTGAISAAFYPRPPPNGVTFFHDPAGRVCDGRLVIDFIAKYLGLPY  93

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+ YLDS GT+FRHGANFAT G++I          G SPF LDIQ  Q+  FK RT +LY
Sbjct  94    LSPYLDSFGTNFRHGANFATGGATIRRANDSLFVSGISPFPLDIQTVQYSNFKNRTTKLY  153

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             ++  G     +   PRPEEFSKSL+  DIGQNDLS  F+ ++  +   +IP ++++F   
Sbjct  154   SQ--GRRSANRKNFPRPEEFSKSLFVIDIGQNDLSAIFRNTSKEKVQSAIPDMINQFGVD  211

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNV----DKNGCAATHNRVAQEFNrq  804
             +  LY +GAR FWIHNTGPIGCLP ++    D HN V    D NGC  + N VA+EFNRQ
Sbjct  212   VQFLYQQGARTFWIHNTGPIGCLPSTLF---DIHNPVPGFLDGNGCVKSQNDVAKEFNRQ  268

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKN  954
             LK RV +L+ +L  A  T VDMY+AKY+++S+A   GF +    CC          CG N
Sbjct  269   LKERVNKLKTELPLAAITYVDMYAAKYSLISDAKKQGFFENLNICCGSYKDGIRFYCGNN  328

Query  955   KKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                    ++   C DPS HISWDG+HY+EAAN  +A  I+  G FSD   P+  AC
Sbjct  329   LLKNGTQIFIGACKDPSLHISWDGIHYTEAANRWIANQII-SGYFSDTKIPITHAC  383



>ref|XP_007227131.1| hypothetical protein PRUPE_ppa026073mg, partial [Prunus persica]
 gb|EMJ28330.1| hypothetical protein PRUPE_ppa026073mg, partial [Prunus persica]
Length=369

 Score =   318 bits (814),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 172/361 (48%), Positives = 235/361 (65%), Gaps = 25/361 (7%)
 Frame = +1

Query  103   LPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAEN  282
             L    C FPA++NFGDSNSDTGG SA  G+ RPP+GE++F  P+GRYCDGRLVIDFIA +
Sbjct  8     LASTSCKFPAIFNFGDSNSDTGGFSAVFGQARPPHGESYFHGPAGRYCDGRLVIDFIANS  67

Query  283   LGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKR  441
             LGLP+L+AYLDS+G++F HGANFATA S+I P        G+SP  LD+Q  +F  F  R
Sbjct  68    LGLPFLSAYLDSVGSNFSHGANFATAASTIRPQNTTLHQSGFSPISLDVQYDEFYDFPPR  127

Query  442   TIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYS-NVSQTLQSIPKIM  618
             + ++     G   V++ ++P+ E+FS++LYTFDIGQNDL+ GF ++ + +Q    +P ++
Sbjct  128   S-QIVRSQGG---VFEQLMPKAEDFSRALYTFDIGQNDLAAGFFFNMSTAQVKAYVPDVL  183

Query  619   DKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFN  798
             ++F   +  +Y +G R FWIHNTGP+GCLP  +A      + VDK GCA  +N VAQ FN
Sbjct  184   NQFKSIVKNVYDQGGRYFWIHNTGPVGCLPYVLARLPVLASQVDKAGCATPYNEVAQFFN  243

Query  799   rqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-----------C  945
               LK  V+QLR +L  A  T VD+YSAKY+++S    HGF+ P   CC           C
Sbjct  244   HGLKEVVVQLREELPLAAITYVDIYSAKYSLISQPKKHGFEQPIRACCGLGGKYNNNLHC  303

Query  946   GKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G+  K+   E + G  C DPS  ++WDG HY++AAN  +   I+  GS+SDPP P+  AC
Sbjct  304   GRKIKVHGREILVGKACQDPSLWVNWDGFHYTQAANKRVFDQIV-DGSYSDPPVPLKMAC  362

Query  1123  R  1125
              
Sbjct  363   H  363



>ref|XP_011042393.1| PREDICTED: alpha-L-fucosidase 3-like [Populus euphratica]
Length=387

 Score =   318 bits (816),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 230/359 (64%), Gaps = 29/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SA  G+  PP+GE++F  P+GRYCDGRL+IDFIA++ GLPY
Sbjct  30    CHFPAIFNFGDSNSDTGGLSAVFGQAPPPHGESYFHHPAGRYCDGRLIIDFIAKSFGLPY  89

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G++F HGAN ATAGS+I P        G+SP  LD+Q ++F  F +R+    
Sbjct  90    LSAYLDSVGSNFTHGANIATAGSTIRPQNSTLHQSGFSPISLDVQWNEFYDFHRRS----  145

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNV--SQTLQSIPKIMDKFS  630
               +     VYK +LP+ E+FS +LYTFDIGQNDL+ G+ +SN+  S+    +P ++D+F 
Sbjct  146   QIIRSQGGVYKKLLPKAEDFSHALYTFDIGQNDLTSGY-FSNMTSSEVKAYVPDVLDQFK  204

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  +YG+G RNFWIHNTGP GCL   +     +   VD++GC    N VAQ FNR LK
Sbjct  205   NIVSYIYGQGGRNFWIHNTGPFGCLAYVLERIPISAAEVDRSGCGTPFNEVAQYFNRGLK  264

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGK  951
               V QLR +L  A  T VD+YS KY +VS A  HGF +    CC             CG 
Sbjct  265   RVVFQLRKKLPLAAITYVDVYSVKYKLVSQARKHGFNESLRACCGHGGKYNYNRQLGCGA  324

Query  952   NKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              + +   E + G  C DPS  ISWDGVHY++AAN  +   I+  GSFSDPP P+  AC+
Sbjct  325   KRTVGGREILVGKSCKDPSEWISWDGVHYTQAANKWIFDQIV-DGSFSDPPVPLKMACQ  382



>gb|KHN34166.1| GDSL esterase/lipase [Glycine soja]
Length=381

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 222/340 (65%), Gaps = 17/340 (5%)
 Frame = +1

Query  124   FPAVYNFGDSNSDTGGRSAALGEVRPPNGETF-FGKPSGRYCDGRLVIDFIAENLGLPYL  300
             + A+YNFGDSNSDTG  SAA   V PPNGE+F       R CDGRL+IDFI E L LPYL
Sbjct  37    YSAIYNFGDSNSDTGTFSAAFTMVYPPNGESFPRNHLPTRNCDGRLIIDFITEELKLPYL  96

Query  301   NAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQ  480
             +AYLDSIG+++ +GANFA  GSSI P G+SP F  +QISQF QFK RT+ LYN+ +   +
Sbjct  97    SAYLDSIGSNYNYGANFAAGGSSIRPTGFSPVFFGLQISQFTQFKSRTMALYNQSSHNRE  156

Query  481   --VYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYG  654
                +K  LP+  +FS +LYT DIGQNDLS GF  S+      +IP I+ +FSQ L +LY 
Sbjct  157   DAPFKSRLPKSMDFSNALYTIDIGQNDLSFGFMSSDPQSVRSTIPDILSQFSQGLQKLYN  216

Query  655   EGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlra  834
             EGAR FWIHNTGPIGCLP +   NK    ++D  GC    N +AQEFN+QLK  V +LR 
Sbjct  217   EGARFFWIHNTGPIGCLPRASVENKPRPEDLDSTGCRKMENEIAQEFNKQLKDIVFELRK  276

Query  835   qlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCCCGKN-----------KKMANETVY  981
             +L  A FT VD+YSAKY ++ NA + GF +   FCC   N            K   E  Y
Sbjct  277   KLPTAKFTNVDVYSAKYELIKNARNQGFINLKKFCCGTTNVIHVDCGKKKINKNGKEEYY  336

Query  982   GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPP  1101
                C  PS++ISWDGVHYSEAAN  LA +++  GSFSDPP
Sbjct  337   --KCKHPSKYISWDGVHYSEAANRWLA-TLILNGSFSDPP  373



>ref|XP_009779715.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Nicotiana sylvestris]
 ref|XP_009779716.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Nicotiana sylvestris]
Length=386

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 175/361 (48%), Positives = 230/361 (64%), Gaps = 27/361 (7%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             + +C FPA++NFGDSNSDTGG SAA G+  PP GET+FG P+GRY DGRLVIDFIAE+LG
Sbjct  29    KSKCDFPAIFNFGDSNSDTGGLSAAFGQAGPPAGETYFGAPAGRYSDGRLVIDFIAESLG  88

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTI  447
             LP+L+A+LD++G++F +GANFATAGS+I P        G+SP  L++QI +F  F +R+ 
Sbjct  89    LPHLSAFLDALGSNFSYGANFATAGSTIRPQNTTLHQSGFSPISLNVQIYEFNDFHRRSQ  148

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
              +  K      V+  ++P+ + FS  LYTFDIGQNDL+ G F      Q    +P +MD+
Sbjct  149   IIRCK----GNVFSQLMPKEKHFSHGLYTFDIGQNDLTAGYFLNMTTDQVRAYVPDLMDQ  204

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F   +  +Y +G R FWIHNTGP+GCLP  +         VDK GCA+  N+VAQ FN +
Sbjct  205   FKTVMKDIYDQGGRYFWIHNTGPVGCLPYILDRLLITAAQVDKAGCASPFNKVAQYFNAK  264

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V+QLR  L  A  T VD+YSAKY ++S+A  HGF+ P   CC             C
Sbjct  265   LKETVVQLRKDLPLAALTYVDVYSAKYELISHANKHGFEHPLRACCGHGGKYNYNMKHGC  324

Query  946   G-KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G K K    E + G  C DP+  I+WDGVHY+EAAN  +   I+  GS+SDPP P+  AC
Sbjct  325   GSKIKVKGKEIMLGKSCKDPTVRINWDGVHYTEAANRWVFEKIV-NGSYSDPPLPLNMAC  383

Query  1123  R  1125
              
Sbjct  384   H  384



>gb|KHN27427.1| GDSL esterase/lipase [Glycine soja]
Length=294

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/295 (55%), Positives = 214/295 (73%), Gaps = 13/295 (4%)
 Frame = +1

Query  271   IAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIE  450
             + E L LPYLNAYLDS+G+++RHGANFA  GSSI PGG+SPF L +Q++QF+ FK RT  
Sbjct  1     MTEELKLPYLNAYLDSVGSNYRHGANFAVGGSSIRPGGFSPFPLGLQVAQFLLFKSRTNT  60

Query  451   LYNKLAG--TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDK  624
             L+N+L+   T   +K+ +PRPE+FS++LYTFDIGQNDL+ G Q+++  Q ++SIP+I+++
Sbjct  61    LFNQLSNNRTEPPFKNSVPRPEDFSRALYTFDIGQNDLAFGLQHTSQEQVIKSIPEILNQ  120

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F QA+ QLY  GAR FWIHNTGPIGCLP S  Y +    N+D NGC    N +AQEFNRQ
Sbjct  121   FFQAVQQLYNVGARVFWIHNTGPIGCLPYSYIYYEPKKGNIDANGCVKPQNDLAQEFNRQ  180

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNK  957
             LK +V QLR +   A FT VD+Y+AKY ++SNA + GF  P  FCC         CGK  
Sbjct  181   LKDQVFQLRRKFPLAKFTYVDVYTAKYELISNARNQGFVSPLEFCCGSYYGYHINCGKT-  239

Query  958   KMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              + N TVYG+PC +PS+H+SWDG+HYS+AAN  +A+ I+Y GS SDPP  + +AC
Sbjct  240   AIVNGTVYGNPCKNPSQHVSWDGIHYSQAANQWVAKRILY-GSLSDPPVQIGQAC  293



>ref|XP_010044556.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Eucalyptus grandis]
 gb|KCW86644.1| hypothetical protein EUGRSUZ_B03272 [Eucalyptus grandis]
Length=387

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 236/359 (66%), Gaps = 29/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SA  G+  PP+GET F +P GRY DGRLV+DFIA++ GLPY
Sbjct  30    CDFPAIFNFGDSNSDTGGLSAVFGQAPPPHGETHFRRPVGRYSDGRLVVDFIAQSFGLPY  89

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLD++G++F HGANFATAGS+I P        G+SP  LD+Q ++F +F++R+    
Sbjct  90    LSAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQSGFSPISLDVQFNEFYEFRRRS----  145

Query  457   NKLAGTN-QVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKFS  630
              ++A T   VY+ +LP+ E FS++LYTFDIGQNDL+ G F   + S+    IP ++ +F 
Sbjct  146   -QVARTRGGVYEKLLPKEEVFSRALYTFDIGQNDLTAGYFLNMSTSEVKAYIPDVLGQFK  204

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  +YGEG R FWIHNTGP+GCLP  +       + VD+ GCA+  N VA+ FNR LK
Sbjct  205   NIVSYIYGEGGRYFWIHNTGPVGCLPYVMERIPILVSQVDRAGCASPFNEVARHFNRGLK  264

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG-  948
               V QLR +L  A  T VD+Y+ KYA++S    +GF+ P   CC             CG 
Sbjct  265   EVVTQLRKELPLAAITYVDVYAVKYALISQPEKYGFKQPLRTCCGFGGKYNFNIHMGCGA  324

Query  949   KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K      E + G+ C DPS +++WDGVHY+EAAN  +   I+ GGSFSDPP P+ +AC+
Sbjct  325   KITVRGKEVLVGNSCEDPSVYVNWDGVHYTEAANKQIFDHIV-GGSFSDPPVPLNKACQ  382



>ref|XP_011042394.1| PREDICTED: alpha-L-fucosidase 3-like [Populus euphratica]
Length=387

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 174/359 (48%), Positives = 231/359 (64%), Gaps = 29/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SA  G+  PP+GE++F  P+GRYCDGRL+IDFIA++ GLPY
Sbjct  30    CHFPAIFNFGDSNSDTGGLSAVFGQAPPPHGESYFHHPAGRYCDGRLIIDFIAKSFGLPY  89

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G++F HGA+FATAGS++ P        G+SP  LD+Q ++F  F +R+    
Sbjct  90    LSAYLDSVGSNFTHGASFATAGSTLRPQNSTLHQSGFSPISLDVQWNEFYDFHRRS----  145

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNV--SQTLQSIPKIMDKFS  630
               +     VYK +LP+ E+FS +LYTFDIGQNDL+ G+ +SN+  S+    +P ++D+F 
Sbjct  146   QIIRSQGGVYKKLLPKAEDFSHALYTFDIGQNDLTSGY-FSNMTSSEVKAYVPDVLDQFK  204

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  +YG+G RNFWIHNTGP GCL   +     +   VD +GC A  N VAQ FNR LK
Sbjct  205   NIVSYIYGQGGRNFWIHNTGPFGCLAYVLERIPISAAEVDGSGCGAPFNEVAQYFNRGLK  264

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGK  951
               V QLR +L  A  T VD+YS KY ++S A  HGF +    CC             CG 
Sbjct  265   KVVFQLRKKLPLAAITYVDVYSVKYKLISQARKHGFNESLRACCGHGGKYNYNRQLGCGA  324

Query  952   NKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              + +   E + G  C DPS  ISWDGVHY++AAN  +   I+  GSFSDPP P+  AC+
Sbjct  325   KRTVGGREILVGKSCKDPSEWISWDGVHYTQAANKWIFDQIV-DGSFSDPPVPLKMACQ  382



>ref|XP_008221893.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Prunus mume]
Length=400

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 233/361 (65%), Gaps = 25/361 (7%)
 Frame = +1

Query  103   LPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAEN  282
             L    C FPA++NFGDSNSDTGG SA  G+ RPP+GE++F  P+GRYCDGRLVIDFIA +
Sbjct  39    LASTSCKFPAIFNFGDSNSDTGGFSAVFGQARPPHGESYFHGPAGRYCDGRLVIDFIANS  98

Query  283   LGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKR  441
             LGLP+L+AYLDS+G++F HGANFATA S+I P        G+SP  LD+Q  +F  F  R
Sbjct  99    LGLPFLSAYLDSVGSNFSHGANFATAASTIRPQNTTLHQSGFSPISLDVQYDEFYDFPPR  158

Query  442   TIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYS-NVSQTLQSIPKIM  618
             + ++     G   V++ ++P+ E+FS++LYTFDIGQNDL+ GF ++ + +Q    +P ++
Sbjct  159   S-QIVRSQGG---VFEQLMPKAEDFSRALYTFDIGQNDLAAGFFFNMSTAQVKAYVPDVL  214

Query  619   DKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFN  798
             ++F   +  +Y +G R FWIHNTGP+GCLP  +A      + VDK GCA  +N VAQ FN
Sbjct  215   NQFKSIVKNVYDQGGRYFWIHNTGPVGCLPYVLARLPVLASQVDKAGCATPYNEVAQFFN  274

Query  799   rqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-----------C  945
               LK  V+QLR +L  A  T VD+YSAKY+++S    HGF+ P   CC           C
Sbjct  275   HGLKEVVVQLREELPLAAITYVDIYSAKYSLISQPKKHGFEQPIRACCGQGGKYNNNLHC  334

Query  946   -GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              GK K    E + G  C DPS  ++WDG HY++AAN  +   I+  GSFSDPP P+   C
Sbjct  335   GGKIKVHGREILVGKACQDPSLWVNWDGFHYTQAANKRVFDQIV-DGSFSDPPVPLKMVC  393

Query  1123  R  1125
              
Sbjct  394   H  394



>ref|XP_009129531.1| PREDICTED: GDSL esterase/lipase At3g27950 [Brassica rapa]
Length=574

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 224/353 (63%), Gaps = 14/353 (4%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             ++ C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFG+ +GR+ DGRL+IDFI ENL 
Sbjct  30    RKSCNFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSAGRHSDGRLIIDFITENLT  89

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNK  462
             LPYL  YLDS+G ++RHGANFAT GS I P    +S F L  Q+SQFI FK RT+ LYN+
Sbjct  90    LPYLTPYLDSVGANYRHGANFATGGSCIRPTVACFSQFHLGTQVSQFIHFKTRTLSLYNQ  149

Query  463   LAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALY  642
                     K VL RP++FSK+LYTFDIGQNDL+ GFQ     Q   SIP I++ F+ A+ 
Sbjct  150   TNRKTPFCKGVLARPKDFSKALYTFDIGQNDLAIGFQNMTEEQLKASIPAIIESFTTAIK  209

Query  643   QLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvl  822
              LY EGAR F IHNTGP GCLP  +          D+ GC    N VA EFN+QLK ++ 
Sbjct  210   LLYKEGARFFSIHNTGPTGCLPYLLKSFPATPR--DQYGCLKPLNNVAIEFNKQLKQKIS  267

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANET  975
             +L  +L  ++ T VD+YSAK  ++  A + GF DPF +CC         CGK        
Sbjct  268   ELNKELPSSLLTYVDVYSAKNHLIIKAKNLGFVDPFDYCCVGAVGRGMGCGKTIFPNGTE  327

Query  976   VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR*IE  1134
             +Y   C +    ISWDG+H SE AN+++A  I+  GS S+PP P   AC+  E
Sbjct  328   LYSSSCQNRQNFISWDGIHCSETANMLVANRIL-DGSISNPPLPTQRACKLTE  379



>ref|XP_010100372.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB82506.1| GDSL esterase/lipase [Morus notabilis]
Length=395

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 239/377 (63%), Gaps = 40/377 (11%)
 Frame = +1

Query  97    GGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIA  276
              G+ +  C FPA++NFGDSNSDTGG SAA G+   PNGET+F  PSGR+ DGRLVIDFIA
Sbjct  24    AGVSKSSCRFPAIFNFGDSNSDTGGLSAAFGQAPSPNGETYFHTPSGRFSDGRLVIDFIA  83

Query  277   ENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFK  435
             E+LGLPYL+A+LDS+G++F HGANFATAGS+I P        GYSP  LD+Q  QF  F+
Sbjct  84    ESLGLPYLSAFLDSLGSNFSHGANFATAGSTIRPQNTTISQSGYSPISLDVQFVQFSDFQ  143

Query  436   KRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPK  612
             +R+     K+     ++   LP+ E+FS++LYTFDIGQNDL+ G++ +  ++ +++ +P 
Sbjct  144   RRS----QKIRKQGGLFGTFLPKEEDFSRALYTFDIGQNDLTAGYKLNLSTEQVKAYVPD  199

Query  613   IMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQE  792
             ++ +F+  +  +YG+G R+FW+HNTGP+GCLP  +         VDK+GCA   N VAQ 
Sbjct  200   VLSQFTNVMKGVYGQGGRSFWVHNTGPVGCLPYILDRYLITAAQVDKHGCANPFNDVAQY  259

Query  793   FNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHG-------------FQDPFT  933
             FNR+LK  V QLR +L  A  T VD+YS KY ++S A  +G             F+DP  
Sbjct  260   FNRRLKEAVAQLRKELPLAAITYVDVYSVKYTLISQAKKYGKFLADPPNSDSSRFEDPLV  319

Query  934   FCC-------------CGKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSI  1071
              CC             CG  KK+   E +    C +P+  I+WDGVH++EAAN  +  SI
Sbjct  320   ACCGHGGKYNYNRYIKCGSKKKVNGREIIIAKSCGNPTVKINWDGVHFTEAANKWIFDSI  379

Query  1072  MYGGSFSDPPRPVAEAC  1122
                GSFSDPP P+  +C
Sbjct  380   A-NGSFSDPPNPLKMSC  395



>ref|XP_010248683.1| PREDICTED: GDSL esterase/lipase At3g26430 [Nelumbo nucifera]
Length=383

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 179/360 (50%), Positives = 237/360 (66%), Gaps = 31/360 (9%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PP GET+F  P+GRY DGRLVIDFIAE++GLPY
Sbjct  29    CEFPAIFNFGDSNSDTGGLSAAFGQASPPAGETYFHTPAGRYSDGRLVIDFIAESVGLPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G++F HGANFATAGS+I P        G+SPF L++Q  QF  F +R+    
Sbjct  89    LSAYLDSVGSNFTHGANFATAGSTIRPQNTTLSQSGFSPFSLNVQYYQFHDFHQRS----  144

Query  457   NKLAGTN-QVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKIMDKF  627
              ++A T  +V++ +LP+ E+FS++LY  DIGQNDL+ G+ + N+S  Q    IP ++ +F
Sbjct  145   -QVARTRGEVFQKLLPKAEDFSRALYALDIGQNDLTAGY-FLNMSTDQVRAYIPDVLGQF  202

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
             S  +  +Y +G R+FWIHNTGP+GCLP  +         VDK GCA  +N VAQ FN +L
Sbjct  203   STIIKYIYDQGGRSFWIHNTGPVGCLPYILDRLLVRAPEVDKAGCATPYNEVAQYFNIKL  262

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG  948
             K  V+QLR QL  A  T VD+YS KY+++S A  HGF+   + CC             CG
Sbjct  263   KETVVQLRNQLPLAAITYVDVYSVKYSLISQATKHGFKHSLSACCGHGGKYNYNRNVGCG  322

Query  949   KNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                 M   + + G  C+DPS  I+WDGVHY+EAAN  + + I+  GSFSDPP P+  AC 
Sbjct  323   GKVSMHGKQILLGRSCNDPSVWINWDGVHYTEAANKWVFQQIV-DGSFSDPPIPLKFACH  381



>ref|XP_011097366.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X1 [Sesamum 
indicum]
Length=357

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 227/349 (65%), Gaps = 21/349 (6%)
 Frame = +1

Query  133   VYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYL  312
             +YNFGDSNSDTGG +AA      P+GET++G+P GR  DGRL+IDFIAENLGLPYL+ YL
Sbjct  1     MYNFGDSNSDTGGIAAAFYPPASPSGETYYGRPVGRASDGRLIIDFIAENLGLPYLSPYL  60

Query  313   DSIGTSFRHGANFATAGSSIL-------PGGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             DS+G+S+++GANFAT G++IL         G SPF L+IQ+  F QFK RT  LY +   
Sbjct  61    DSVGSSYQNGANFATGGATILRPNGSWFDSGLSPFNLEIQVEHFTQFKDRTAYLYGQ--A  118

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
              ++  +  LPRPE FS++L+T DIGQND++ G +  +       +P I+ +F   +  LY
Sbjct  119   QDECTRKRLPRPENFSEALFTLDIGQNDVAVGIRSLSYELQQAVVPNILSQFITQVRGLY  178

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlql  828
               GAR FW+HNTGPIGCLP+++A  KD     +D+NGC  + N +A +FN +LK  +++L
Sbjct  179   ERGARTFWVHNTGPIGCLPVAIAKVKDPAPGYLDENGCVKSQNDIALQFNEELKDEIVKL  238

Query  829   raqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKMANETV  978
             RA+L  A    VDMY+AKY +++NA + GF+DPF  CC          CG    +    V
Sbjct  239   RAELSDAAIVYVDMYAAKYELITNAKNQGFEDPFEICCGYHGIGYDVWCGNKGNVNGTEV  298

Query  979   YGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             Y   C DPS+ ISWDGVHY+EAAN  +A  I+  GS SDP  P+  AC 
Sbjct  299   YAGSCEDPSKIISWDGVHYTEAANHWIANRIV-NGSMSDPSIPITSACH  346



>ref|XP_008356441.1| PREDICTED: GDSL esterase/lipase At3g27950-like [Malus domestica]
Length=336

 Score =   315 bits (806),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 166/284 (58%), Positives = 199/284 (70%), Gaps = 22/284 (8%)
 Frame = +1

Query  118  CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
            C FPA+YNFGDSNSDTG  SAA+ EV PPNGETFFGKPSGR  DGRL+IDF AE L +PY
Sbjct  36   CRFPAIYNFGDSNSDTGAISAAISEVPPPNGETFFGKPSGRLSDGRLIIDFFAEKLQIPY  95

Query  298  LNAYLDSIGTSFRHGANFATAGSSILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTN  477
            L+ YLDS+GT+F HGANFAT GSS  PGGYSPF L IQISQFI+FK  +I LY +L  T+
Sbjct  96   LSPYLDSLGTNFLHGANFATGGSSXRPGGYSPFHLGIQISQFIRFKSHSIALYKQLHSTS  155

Query  478  Q----------------------VYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQ  591
            Q                         +  PRPE+F K+LYTFDIGQNDL++G Q+  + +
Sbjct  156  QSSLLNLYYFGHICKLSSSVQSHTSNEDYPRPEDFPKALYTFDIGQNDLAYGIQHGTIQE  215

Query  592  TLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAAT  771
               SIP I+ + SQA+ QLY EGAR FW+HNTGP GCLP SV Y+K    N+DK+GC   
Sbjct  216  VRASIPAILSQLSQAISQLYKEGARFFWVHNTGPQGCLPYSVIYHKSKPGNLDKSGCVKP  275

Query  772  HNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNA  903
             N VAQEFNRQLK  ++ LR+ L  A FT VD+YSAKY ++S+A
Sbjct  276  LNAVAQEFNRQLKNSIMLLRSLLPLAAFTYVDVYSAKYTLISDA  319



>gb|EYU22538.1| hypothetical protein MIMGU_mgv1a008099mg [Erythranthe guttata]
Length=385

 Score =   316 bits (810),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 236/358 (66%), Gaps = 29/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PPNGETFF  P+GR+ DGRL+IDFIAE + LPY
Sbjct  29    CNFPAIFNFGDSNSDTGGLSAAFGQAPPPNGETFFHAPAGRFSDGRLLIDFIAEKMELPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LDSIG++F HGANFATAGS+I P        GYSP  LDIQ  QF  F  R+ ++ 
Sbjct  89    LSAFLDSIGSNFSHGANFATAGSTIRPQNTTISQSGYSPISLDIQRVQFSDFVTRS-QII  147

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYS-NVSQTLQSIPKIMDKFSQ  633
              K  G    ++++LP  + FS++LYTFDIGQNDL+ G++ + +  Q    +P+++++FS 
Sbjct  148   RKKEG---FFRNLLPDEDVFSRALYTFDIGQNDLTAGYKLNLSTDQVKAYVPRVLEQFSD  204

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              + +LYGEG R+FWIHNTGP+GCLP  +         +DK GC+  +N V+Q FN +LK 
Sbjct  205   VIQKLYGEGGRSFWIHNTGPVGCLPYIMDRFLVTAAQIDKYGCSIPYNDVSQYFNLRLKE  264

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V  LR +L  A  T VD+YS KY+++++A   GF+DPF  CC             CG +
Sbjct  265   AVSALRKKLPMAAITYVDVYSVKYSLIAHAKKLGFEDPFVACCGHGGKYNYNRFAKCG-S  323

Query  955   KKMAN--ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             KK+ N  E V    C +P+  I+WDG H++E+AN  +   I+  GSFSDPP P+  AC
Sbjct  324   KKIVNGTEIVIAKSCINPTARINWDGTHFTESANKWIFDQIV-NGSFSDPPLPLNFAC  380



>ref|XP_009611346.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Nicotiana tomentosiformis]
Length=386

 Score =   316 bits (810),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 173/361 (48%), Positives = 230/361 (64%), Gaps = 27/361 (7%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             + +C FPA++NFGDSNSDTGG SAA G+  PP GET+FG P+GRY DGRLVIDFIAE+LG
Sbjct  29    KSKCDFPAIFNFGDSNSDTGGLSAAFGQAGPPAGETYFGSPAGRYSDGRLVIDFIAESLG  88

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTI  447
             LP+L+A+LD++G++F +GANFATAGS+I P        G+SP  L++Q  +F  F +R+ 
Sbjct  89    LPHLSAFLDALGSNFSYGANFATAGSTIRPQNTTLHQSGFSPISLNVQFYEFNDFHRRSQ  148

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
              + +K      V+  ++P+ + FS  LYTFDIGQNDL+ G F      Q    +P +MD+
Sbjct  149   IIRSK----GNVFSQLMPKEKHFSHGLYTFDIGQNDLTAGYFLNMTTDQVRAYVPDLMDQ  204

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F+  +  +Y +G R FWIHNTG +GCLP  +   +     +DK GCA+  N+VAQ FN +
Sbjct  205   FTTVIKDIYDQGGRYFWIHNTGSVGCLPYILDRLQITAAQIDKAGCASPFNKVAQYFNTK  264

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V QLR  L  A  T VD+YSAKY ++S+A  HGF+ P   CC             C
Sbjct  265   LKEAVFQLRKDLPLAALTYVDVYSAKYELISHANKHGFEHPLQACCGHGGKYNYNMKHGC  324

Query  946   G-KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G K K    E + G  C DPS  I+WDGVHY+EAAN  +   I+  GS+SDPP P+  AC
Sbjct  325   GSKIKVKGKEIMLGKSCKDPSVRINWDGVHYTEAANRWVFEKIV-NGSYSDPPLPLNMAC  383

Query  1123  R  1125
              
Sbjct  384   H  384



>ref|XP_011101807.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Sesamum indicum]
Length=380

 Score =   315 bits (808),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 167/354 (47%), Positives = 231/354 (65%), Gaps = 22/354 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C +PA+YNFGDSNSDTGG +AA      P G+T+F +P GR  DGRL+IDFIA +LGLPY
Sbjct  29    CVYPAIYNFGDSNSDTGGIAAAFYPPVLPCGQTYFHRPVGRASDGRLIIDFIAGHLGLPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGSSIL-------PGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+ YLDSIG+++RHGANFAT G++I+         G SPF L+IQ+  + QFK++T   Y
Sbjct  89    LSPYLDSIGSNYRHGANFATGGATIMRPNESWFDNGVSPFCLEIQVEHYTQFKEKTAYFY  148

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
                   N+ +K +LPRP++FSK+L+  DIGQND++   + S+      ++P I  +F+  
Sbjct  149   K---AKNKSFKKMLPRPQDFSKALFIVDIGQNDVAAVLRKSSFELQSAALPNIASQFTAQ  205

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDN-HNNVDKNGCAATHNRVAQEFNrqlka  813
             +  LY  GAR FWIHNTGPIGCLP++    +D     +D++GC    N +A EFNR LK 
Sbjct  206   VQNLYQRGARTFWIHNTGPIGCLPVATVKVQDPVPGYLDEHGCVMNQNEIAIEFNRLLKN  265

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
              +++LR +L +A    VDMY AK+ +++NA + GF+DPF  CC          CG    +
Sbjct  266   EIVELRLKLTEARIIHVDMYRAKHELITNAKNQGFEDPFKICCGHHGIGYDVWCGNKANV  325

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                 V+   C++PS+ ISWDGVHYSEAAN  +A  I+  GSFSDPP P++ AC+
Sbjct  326   NGSEVFAGSCANPSKVISWDGVHYSEAANRWIANHIV-DGSFSDPPIPISRACQ  378



>ref|XP_008221894.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Prunus mume]
Length=391

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 232/363 (64%), Gaps = 27/363 (7%)
 Frame = +1

Query  100   GLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAE  279
              L    C FPA++NFGDSNSDTGG SA  G+ R P+GE++F  P+GRYCDGRLVIDFIA+
Sbjct  28    ALASTSCKFPAIFNFGDSNSDTGGLSAVFGQARSPHGESYFHGPAGRYCDGRLVIDFIAK  87

Query  280   NLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKK  438
             + GLP+L+AYLDS+G++F HGANFATAGS+I P        G+SP  LD+Q ++F  F  
Sbjct  88    SFGLPFLSAYLDSVGSNFSHGANFATAGSTIRPQNTTLRQSGFSPISLDVQYNEFYDFHP  147

Query  439   RTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKI  615
             R+    N+      V+K ++P+ ++FS++LYTFDIGQNDL+ G F   + +Q    +P +
Sbjct  148   RSQVARNR----GGVFKQLMPKAQDFSRALYTFDIGQNDLTAGLFLNMSTTQVKAYVPDV  203

Query  616   MDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEF  795
             +++F   +  +YG+G R FWIHNTGPIGCLP  +         VD  GCA  +N+VAQ F
Sbjct  204   LNQFKNIVKNIYGQGGRYFWIHNTGPIGCLPYVLDRLPVLAAQVDNAGCAIPYNKVAQFF  263

Query  796   NrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-----------  942
             NR LK  V QLR  L  A  T VD+YSAKY+++S    HGF++P   CC           
Sbjct  264   NRGLKQAVFQLRKDLPLAAITYVDVYSAKYSLISQPEKHGFKEPVRACCGHGGKYNYNLH  323

Query  943   --CGKNKKMANET-VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVA  1113
               CG   K+  +  + G  C DPS  ++WDGVHY++AAN  +   I+  GSFSDPP P+ 
Sbjct  324   IGCGGKAKVHGKVKLVGKACQDPSLWVNWDGVHYTQAANKRVFDQIV-DGSFSDPPIPLK  382

Query  1114  EAC  1122
              AC
Sbjct  383   RAC  385



>gb|EYU22539.1| hypothetical protein MIMGU_mgv1a008099mg [Erythranthe guttata]
Length=384

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 234/358 (65%), Gaps = 30/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PPNGETFF  P+GR+ DGRL+IDFIAE + LPY
Sbjct  29    CNFPAIFNFGDSNSDTGGLSAAFGQAPPPNGETFFHAPAGRFSDGRLLIDFIAEKMELPY  88

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LDSIG++F HGANFATAGS+I P        GYSP  LDIQ  QF  F  R+    
Sbjct  89    LSAFLDSIGSNFSHGANFATAGSTIRPQNTTISQSGYSPISLDIQRVQFSDFVTRS----  144

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYS-NVSQTLQSIPKIMDKFSQ  633
              ++      ++++LP  + FS++LYTFDIGQNDL+ G++ + +  Q    +P+++++FS 
Sbjct  145   -QIIRKKGFFRNLLPDEDVFSRALYTFDIGQNDLTAGYKLNLSTDQVKAYVPRVLEQFSD  203

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              + +LYGEG R+FWIHNTGP+GCLP  +         +DK GC+  +N V+Q FN +LK 
Sbjct  204   VIQKLYGEGGRSFWIHNTGPVGCLPYIMDRFLVTAAQIDKYGCSIPYNDVSQYFNLRLKE  263

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V  LR +L  A  T VD+YS KY+++++A   GF+DPF  CC             CG +
Sbjct  264   AVSALRKKLPMAAITYVDVYSVKYSLIAHAKKLGFEDPFVACCGHGGKYNYNRFAKCG-S  322

Query  955   KKMAN--ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             KK+ N  E V    C +P+  I+WDG H++E+AN  +   I+  GSFSDPP P+  AC
Sbjct  323   KKIVNGTEIVIAKSCINPTARINWDGTHFTESANKWIFDQIV-NGSFSDPPLPLNFAC  379



>ref|XP_007224644.1| hypothetical protein PRUPE_ppa026400mg, partial [Prunus persica]
 gb|EMJ25843.1| hypothetical protein PRUPE_ppa026400mg, partial [Prunus persica]
Length=367

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/363 (48%), Positives = 232/363 (64%), Gaps = 27/363 (7%)
 Frame = +1

Query  100   GLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAE  279
              L    C FPA++NFGDSNSDTGG SA  G+ R P+GE++F  P+GRYCDGRLVIDFIA+
Sbjct  4     ALASTSCKFPAIFNFGDSNSDTGGLSAVFGQARSPHGESYFHGPAGRYCDGRLVIDFIAK  63

Query  280   NLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKK  438
             + GLP+L+AYLDS+G++F HGANFATAGS+I P        G+SP  LD+Q ++F  F  
Sbjct  64    SFGLPFLSAYLDSVGSNFSHGANFATAGSTIRPQNTTLRQSGFSPISLDVQYNEFYDFHP  123

Query  439   RTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKI  615
             R+    N+      V+K ++P+ ++FS++LYTFDIGQNDL+ G F   + +Q    +P +
Sbjct  124   RSQVARNR----GGVFKQLMPKAQDFSRALYTFDIGQNDLTAGLFLNMSTTQVKAYVPDV  179

Query  616   MDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEF  795
             +++F   +  +YG+G R FWIHNTGPIGCLP  +         VD  GCA  +N+VAQ F
Sbjct  180   LNQFKNIVKNIYGQGGRYFWIHNTGPIGCLPYVLDRLPVLAAQVDNAGCAIPYNKVAQFF  239

Query  796   NrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-----------  942
             NR LK  V QLR  L  A  T VD+YSAKY+++S    HGF++P   CC           
Sbjct  240   NRGLKQAVFQLRKDLPLAAITYVDVYSAKYSLISQPEKHGFKEPVRACCGHGGKYNYNLH  299

Query  943   --CGKNKKMANET-VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVA  1113
               CG   K+  +  + G  C DPS  ++WDGVHY++AAN  +   I+  GSFSDPP P+ 
Sbjct  300   IGCGGKAKVHGKVKLVGKACQDPSLWVNWDGVHYTQAANKRVFDQIV-DGSFSDPPIPLK  358

Query  1114  EAC  1122
              AC
Sbjct  359   RAC  361



>ref|XP_010556209.1| PREDICTED: alpha-L-fucosidase 3 [Tarenaya hassleriana]
Length=380

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 224/358 (63%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PP+GE+FFG P+GRYCDGRLVIDFIAE L LPY
Sbjct  26    CNFPAIFNFGDSNSDTGGLSAAFGQAGPPHGESFFGGPAGRYCDGRLVIDFIAERLRLPY  85

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             LNA+LD++G++F HGANFATAGS       ++   G+SPF LD+Q +QF  F  R+    
Sbjct  86    LNAFLDAVGSNFSHGANFATAGSPIRQLNTTLRQSGFSPFSLDVQFTQFSNFHNRSQIFR  145

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKFSQ  633
             N      +VY+ +LP  + FS  LYTFDIGQNDL+ G F    V +    +P+I+ +F  
Sbjct  146   NH----GEVYRALLPEADSFSLGLYTFDIGQNDLTAGLFANKTVQEVRADVPEIITQFKN  201

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +YG+G R FWIHNTGP GCL  ++ +     ++ D++GC A  N +AQ FN+ LK 
Sbjct  202   VIKYIYGQGGRYFWIHNTGPFGCLAYAIDHFPVKASDFDEHGCVAPFNELAQHFNKLLKE  261

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V +LR  L +A  T VD+YS K+ +  +A  HGF      CC             CGK 
Sbjct  262   SVTELRNMLPEAAVTYVDVYSVKHELFLHAQGHGFTRSLVSCCGHGGKYNYNKNIWCGKK  321

Query  955   KKMANETVY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K +  + +Y G PC DPSR + WDGVHY++AAN  +   I   G FSDPP  +  AC 
Sbjct  322   KMVRGKEIYIGKPCEDPSRAVIWDGVHYTQAANKFIFEKISI-GKFSDPPVGLNMACH  378



>gb|EYU30623.1| hypothetical protein MIMGU_mgv1a007766mg [Erythranthe guttata]
Length=396

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 231/358 (65%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PPNGE++F  P+GRY DGRLVIDFIAE+LGLPY
Sbjct  42    CHFPAIFNFGDSNSDTGGLSAAFGQAPPPNGESYFHGPAGRYSDGRLVIDFIAESLGLPY  101

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLD++G++F +GANFATAGS+I P        G+SPF L++Q  QF  F++R+  + 
Sbjct  102   LSAYLDALGSNFTNGANFATAGSTIRPQNMTLHQSGFSPFSLNVQYYQFNDFQRRSQYIR  161

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYS-NVSQTLQSIPKIMDKFSQ  633
             N+      V+  +LP  E+FS +LYTFDIGQNDL+ G+ ++    Q  + +P ++D+F  
Sbjct  162   NQ----GGVFARLLPNAEDFSHALYTFDIGQNDLTAGYFFNMTTDQVREYVPDVLDQFKT  217

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y  G R+FWIHNTGP+GCLP  +         VDK GCA   N VA+ +N +LK 
Sbjct  218   VVKYIYDHGGRSFWIHNTGPVGCLPYVMDRVPITAGQVDKVGCATPFNEVARYYNLKLKE  277

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG-K  951
              V+QLR  L  A FT VD+YS KY ++S A  HGF  P   CC             CG K
Sbjct  278   AVVQLRKDLPSAAFTYVDVYSVKYELISQAKKHGFVHPLKACCGHGGKYNFNMHHGCGSK  337

Query  952   NKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              K    E + G  C DP+  I+WDGVHY+EAAN  +   I+  G++SDPP P+ +AC 
Sbjct  338   IKVHGKEIMVGKSCKDPTVAINWDGVHYTEAANKWVFDQIV-SGAYSDPPIPLNKACH  394



>ref|XP_007223009.1| hypothetical protein PRUPE_ppa006817mg [Prunus persica]
 gb|EMJ24208.1| hypothetical protein PRUPE_ppa006817mg [Prunus persica]
Length=394

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/360 (47%), Positives = 237/360 (66%), Gaps = 27/360 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA++NFGDSNSDTGG SAA G+   PNGET+F  PSGRY DGRL+IDFIAE+L L
Sbjct  34    RSCSFPAMFNFGDSNSDTGGLSAAFGQAPYPNGETYFRTPSGRYSDGRLLIDFIAESLRL  93

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILPG-------GYSPFFLDIQISQFIQFKKRTIE  450
             P+L+A+LDS+G++F HGANFATAGS+I P        G SP  LD+Q+ QF+ F+ R+ +
Sbjct  94    PHLSAFLDSVGSNFSHGANFATAGSTIRPPNTTISQIGVSPISLDVQLVQFLDFRTRS-Q  152

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKF  627
             +Y K     +V+  +LP+ E FS++LYTFDIGQNDL+ G++ +  ++ +++ +P ++ + 
Sbjct  153   IYQK---KGEVFGKLLPKKEYFSQALYTFDIGQNDLTAGYKLNLTTEQVKAYVPDVLSQL  209

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
             S A+  +  +G R++WIHNTGP+GCLP  +     N   +DK GCA   N VAQ FN++L
Sbjct  210   SHAIKIVDEQGGRSYWIHNTGPLGCLPYVLDRFLVNPAQIDKYGCADQFNEVAQYFNQRL  269

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG  948
             K  +L L+  L  A  T VD+YS K  +++   ++GF +P   CC             CG
Sbjct  270   KEALLHLKKDLPLAAITYVDVYSVKRTLITQTKTYGFGNPLIACCGHGGKYNYNRYAKCG  329

Query  949   KNKKMAN-ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               K +   ETV    C+DP+  I+WDGVHY+EAAN  + + I+  GSFSDPP P+  ACR
Sbjct  330   TKKTINGIETVIAKSCNDPTVQINWDGVHYTEAANKWIFQQIV-KGSFSDPPNPLKMACR  388



>ref|XP_010682275.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Beta vulgaris 
subsp. vulgaris]
Length=400

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/360 (45%), Positives = 235/360 (65%), Gaps = 26/360 (7%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             +  C FPA++NFGDSNSDTGG SA  G+  PP GETFFG P+GRYCDGRL+IDF+A++LG
Sbjct  41    ENECDFPAIFNFGDSNSDTGGLSAVYGQAPPPYGETFFGAPAGRYCDGRLIIDFLAKSLG  100

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTI  447
             LPYL+AYLDSIGT+F HGANFATAGS++ P        GYSP  LD+Q +++  F+KR+ 
Sbjct  101   LPYLSAYLDSIGTNFSHGANFATAGSTVRPQNTSKSQSGYSPISLDVQFAEYSNFRKRS-  159

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDK  624
             ++  K  G   V+ ++LP+ + F+++LYTFDIGQNDL+ G++ +  S+ +++ IP ++ +
Sbjct  160   QIVRKQGG---VFTELLPKEDYFTRALYTFDIGQNDLTAGYKLNMTSEQVKAYIPDVLHQ  216

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             FS+ +  +YG+G R+FWIHNTGP+GCLP  +         +D++GCA   N V++ +N  
Sbjct  217   FSKVVKGVYGQGGRSFWIHNTGPLGCLPYMLDRFNLTAAQIDQSGCAIPLNEVSRYYNSM  276

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V+QLR  L  A  T VD+YS KY +++ A  +GF+ P   CC             C
Sbjct  277   LKEVVVQLRMDLPLAAITYVDIYSLKYTLITQAKKYGFEKPLVACCGIGGRYNYNNTMRC  336

Query  946   GKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G  + +   + +    C++PS  ++WDG+HY+EAAN  L   I     + DPP  +  AC
Sbjct  337   GSTEMVGGKDILIAKSCNNPSARVNWDGIHYTEAANKWLFDQITRNSLYFDPPISLEMAC  396



>ref|XP_011087101.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Sesamum indicum]
Length=387

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 226/358 (63%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PPNGE++F  P+GRY DGRLVIDFIA++LGLPY
Sbjct  33    CHFPAIFNFGDSNSDTGGLSAAFGQAPPPNGESYFHGPAGRYSDGRLVIDFIAKSLGLPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLD++G++F HGANFATAGS+I P        G+SPF L++Q  QF  F++R+    
Sbjct  93    LSAYLDALGSNFTHGANFATAGSTIRPQNTTLHQSGFSPFSLNVQFYQFNDFQRRS----  148

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKFSQ  633
             + +     VY+ +LP  E FS++LYTFDIGQNDL+ G F      Q    +P ++D+F  
Sbjct  149   HLIRKQGSVYEGLLPEAEVFSRALYTFDIGQNDLTAGYFLNMTTDQVRAYVPDVLDQFKT  208

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y  G R+FWIHNTGP+GCLP  +         VDK GCA   N VA+ FN +LK 
Sbjct  209   VVKSIYEHGGRSFWIHNTGPVGCLPYVMDLLPVTAAQVDKVGCATPFNEVAKYFNLRLKE  268

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V+QLR  L  A  T VD+Y+ KY ++S A  HGF  P   CC             CG  
Sbjct  269   TVVQLRKDLSSAALTYVDVYAVKYDLISQAKKHGFVHPLQACCGHGGKYNYNKHLGCGSK  328

Query  955   KKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              K+   E + G  C DPS  I+WDGVHY++AAN  +   I+  G++SDPP P+  AC 
Sbjct  329   IKVNGEEIMVGKSCKDPSVVINWDGVHYTQAANKWVFDQIV-NGAYSDPPIPLHMACH  385



>ref|XP_006291234.1| hypothetical protein CARUB_v10017365mg, partial [Capsella rubella]
 gb|EOA24132.1| hypothetical protein CARUB_v10017365mg, partial [Capsella rubella]
Length=407

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 176/366 (48%), Positives = 235/366 (64%), Gaps = 27/366 (7%)
 Frame = +1

Query  91    IGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDF  270
             I  G+    C FPA++NFGDSNSDTGG SAA G+   PNG TFF  PSGR+ DGRL+IDF
Sbjct  45    IHPGVCSLSCGFPAIFNFGDSNSDTGGLSAAFGQAPYPNGRTFFHTPSGRFSDGRLIIDF  104

Query  271   IAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQ  429
             IAE LGLPYLNA+LDSIG++F HGANFATAGS++ P       GG SP  LD+Q+ QF  
Sbjct  105   IAEELGLPYLNAFLDSIGSNFSHGANFATAGSTVRPPNTTISQGGASPISLDVQLVQFSD  164

Query  430   FKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-I  606
             F  R+ +L+    G   V+K +LPR E FS++LYTFDIGQNDL+ G + +  +  +++ I
Sbjct  165   FLTRS-QLFRSRGG---VFKQLLPRKEYFSEALYTFDIGQNDLTAGLKVNMTTDQIKAYI  220

Query  607   PKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVA  786
             P+++D+ S A+ ++Y +G R FWIHNT P+GCLP  +       + +DK+GCA   N +A
Sbjct  221   PEVLDQLSNAIRKVYSKGGRRFWIHNTAPLGCLPYVLDRFPVPDSQIDKHGCAIPRNEIA  280

Query  787   QEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------  942
             + +N +LK RV+ LR +L +A FT VD+YS K  +++ A   GF+ PF  CC        
Sbjct  281   RFYNSELKKRVIGLRKELSKASFTYVDIYSIKLTLITQAKKLGFKYPFIACCGYGGKYNF  340

Query  943   -----CG-KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPR  1104
                  CG K      E V    C+D S  +SWDGVH++E AN  + + I   G+FSDPP 
Sbjct  341   TNLIRCGAKVMVKGKEVVLAKSCNDVSFRVSWDGVHFTETANNWIFKQIN-SGAFSDPPL  399

Query  1105  PVAEAC  1122
             PV  AC
Sbjct  400   PVKLAC  405



>gb|KHN29023.1| GDSL esterase/lipase [Glycine soja]
Length=396

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 172/360 (48%), Positives = 233/360 (65%), Gaps = 27/360 (8%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             +  C FPA++N GDSNSDTGG SAA G+  PPNG T+F  P+GR+ DGRL+IDFIAE+ G
Sbjct  29    ESECIFPAIFNLGDSNSDTGGLSAAFGQAPPPNGITYFHSPNGRFSDGRLIIDFIAESSG  88

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTI  447
             L YL AYLDS+ ++F HGANFATAGS++ P        GYSP  LD+Q  QF  FK R+ 
Sbjct  89    LAYLRAYLDSVASNFTHGANFATAGSTVRPQNTTISQSGYSPISLDVQFVQFSDFKTRS-  147

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDK  624
             +L  +  G   V+K++LP+ E FS++LYTFDIGQNDL+ G++ +  ++ +++ IP ++ +
Sbjct  148   KLVRQQGG---VFKELLPKEEYFSQALYTFDIGQNDLTAGYKLNFTTEQVKAYIPDVLGQ  204

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             FS  +  +YGEG R+FWIHNTGP+GCLP  +         +D+ GCA   N VAQ FNR+
Sbjct  205   FSNVIKGVYGEGGRSFWIHNTGPLGCLPYMLDRYPMKPTQMDEFGCAKPFNEVAQYFNRK  264

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V QLR +L  A  T VD+Y+ KY ++S+A  +GF+     CC             C
Sbjct  265   LKEVVEQLRKELPGAAITYVDVYTVKYTLISHAQKYGFEQGVIACCGHGGKYNFNNTERC  324

Query  946   GKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G  K++   E V  + C DPS  I WDG+HY+EAAN  + + I+  GSFSDPP  +  AC
Sbjct  325   GATKRVNGTEIVIANSCKDPSVRIIWDGIHYTEAANKWIFQQIV-NGSFSDPPHSLKRAC  383



>ref|XP_003531330.1| PREDICTED: GDSL esterase/lipase At3g26430 isoform 1 [Glycine 
max]
Length=399

 Score =   314 bits (804),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 172/360 (48%), Positives = 233/360 (65%), Gaps = 27/360 (8%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             +  C FPA++N GDSNSDTGG SAA G+  PPNG T+F  P+GR+ DGRL+IDFIAE+ G
Sbjct  32    ESECIFPAIFNLGDSNSDTGGLSAAFGQAPPPNGITYFHSPNGRFSDGRLIIDFIAESSG  91

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTI  447
             L YL AYLDS+ ++F HGANFATAGS++ P        GYSP  LD+Q  QF  FK R+ 
Sbjct  92    LAYLRAYLDSVASNFTHGANFATAGSTVRPQNTTISQSGYSPISLDVQFVQFSDFKTRS-  150

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDK  624
             +L  +  G   V+K++LP+ E FS++LYTFDIGQNDL+ G++ +  ++ +++ IP ++ +
Sbjct  151   KLVRQQGG---VFKELLPKEEYFSQALYTFDIGQNDLTAGYKLNFTTEQVKAYIPDVLGQ  207

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             FS  +  +YGEG R+FWIHNTGP+GCLP  +         +D+ GCA   N VAQ FNR+
Sbjct  208   FSNVIKGVYGEGGRSFWIHNTGPLGCLPYMLDRYPMKPTQMDEFGCAKPFNEVAQYFNRK  267

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V QLR +L  A  T VD+Y+ KY ++S+A  +GF+     CC             C
Sbjct  268   LKEVVEQLRKELPGAAITYVDVYTVKYTLISHAQKYGFEQGVIACCGHGGKYNFNNTERC  327

Query  946   GKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             G  K++   E V  + C DPS  I WDG+HY+EAAN  + + I+  GSFSDPP  +  AC
Sbjct  328   GATKRVNGTEIVIANSCKDPSVRIIWDGIHYTEAANKWIFQQIV-NGSFSDPPHSLKRAC  386



>ref|XP_010682312.1| PREDICTED: uncharacterized protein LOC104897187 [Beta vulgaris 
subsp. vulgaris]
Length=798

 Score =   325 bits (834),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 233/353 (66%), Gaps = 22/353 (6%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
               C  PAVYNFGDSNSDTG  SAA G V  PNG +FFGKPSGRYCDGRL+IDFIAE LG+
Sbjct  447   EECQIPAVYNFGDSNSDTGCVSAAFGRVPYPNGISFFGKPSGRYCDGRLIIDFIAEKLGV  506

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSI------LPG-GYSPFFLDIQISQFIQFKKRTIE  450
             PYL+AYLD++  +F+HGA+FA +G++I      L G G +P  LD+Q+ QF + K+RT E
Sbjct  507   PYLSAYLDALQANFQHGADFAASGTTIQHVDGKLYGSGLNPLSLDVQLLQFEELKERTSE  566

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
             LY +        K  LP PE+FS +LY FDIGQND+ H        +  +SIP ++ +F+
Sbjct  567   LYEQ-----DNPKGRLPSPEDFSNALYAFDIGQNDIHHALSTMTEDEACKSIPVLITQFA  621

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
              A+ +LY +GAR FWIHNTGPIGCLP  +A +     NVD+ GC  ++N VA+EFNRQLK
Sbjct  622   SAIKKLYDQGARTFWIHNTGPIGCLPYLLAKHPPKPENVDEAGCVKSYNEVAKEFNRQLK  681

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKM  963
              R+ +LR QL  ++   VD+YS K++++S +  +GF +P  +CC         C   + +
Sbjct  682   DRISELRTQLHDSLLVYVDIYSLKFSLISESEKYGFINPLGYCCKHAGNPRLHCWNKETV  741

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 VY  PC +PS++ISWD +HY+EAAN  +A  I + GS+SDPP  +   C
Sbjct  742   NGTAVYAAPCENPSKYISWDSIHYTEAANRWVANRI-FDGSYSDPPTSLTRLC  793


 Score =   322 bits (826),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 179/378 (47%), Positives = 244/378 (65%), Gaps = 22/378 (6%)
 Frame = +1

Query  82    VNGIGGGL-PQ-RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGR  255
             +NG+   L PQ + C  PA+YNFGDSNSDTG  SAA G    PNG TFFGK +GR CDGR
Sbjct  21    LNGVLKLLQPQSKECRIPAIYNFGDSNSDTGSDSAAFGRAPHPNGITFFGKSAGRICDGR  80

Query  256   LVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQI  414
             L++DFIAE LGLP +++YLD+I  +F+HGANFA  G++I P        G +PF L+IQ+
Sbjct  81    LIVDFIAEKLGLPLVSSYLDAIEANFQHGANFAAFGATIQPVDSNLYRSGANPFSLNIQL  140

Query  415   SQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQT  594
             SQF Q K+R+ ELYN +     +    LPRPE+FSK+LY FDIGQND+    +    +Q 
Sbjct  141   SQFHQLKQRSHELYN-IKQAKILNTKALPRPEDFSKALYMFDIGQNDIDLLLKSMTETQA  199

Query  595   LQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATH  774
              +S+P +++  + A+ +L+  GAR FWIHNTGP GCLPI+V     N  N D+ GC  ++
Sbjct  200   RESLPDLINYLALAIKKLHKGGARRFWIHNTGPFGCLPINVKRYPSNTENFDELGCVISY  259

Query  775   NRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--CG  948
             N  AQE+NRQLK +V  LR  LQ ++   VDMYSAK+ ++ +A  +GF DP  +CC  C 
Sbjct  260   NEFAQEYNRQLKEKVSDLRTTLQDSLIVYVDMYSAKHTLIIDAKQNGFVDPLNYCCKDCA  319

Query  949   KN------KKMANETVY---GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPP  1101
             ++      +++  ET        C +PS +ISWDGVHY+EAAN  +A  I + G+FSDP 
Sbjct  320   ESYLPYWKRQIGYETAMVFDATSCDNPSEYISWDGVHYTEAANDWVASRI-FNGTFSDPL  378

Query  1102  RPVAEACR*IELSMQLQW  1155
               +AE+C   +  M + W
Sbjct  379   LSIAESCMKKDFDMMMSW  396



>ref|XP_003562799.2| PREDICTED: uncharacterized protein LOC100833243 [Brachypodium 
distachyon]
Length=851

 Score =   327 bits (837),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 176/359 (49%), Positives = 233/359 (65%), Gaps = 27/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG SA  G   PPNG TFFG P+GRYCDGRLVIDFIAE+LG+PY
Sbjct  32    CHFPAVFNFGDSNSDTGGLSALFGAAPPPNGRTFFGAPAGRYCDGRLVIDFIAESLGIPY  91

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYL+S+G++F  GANFATAGSSI          G+SP  LD+Q  +F QF  R+  +Y
Sbjct  92    LSAYLNSVGSNFSQGANFATAGSSIRRQNTSLFLSGFSPISLDVQSWEFEQFINRSQLVY  151

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKFSQ  633
             N   G   +Y+++LP+ E FS++LYTFDIGQND++ G F      Q +  IP +M++ + 
Sbjct  152   NNKGG---IYRELLPKAEYFSQALYTFDIGQNDITAGYFVNMTTEQVVDFIPDLMERLTS  208

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  ++  G R FWIH+TGPIGCLP ++ +  D     D  GC+  +N+ AQ FN++LK 
Sbjct  209   IIQSVHWLGGRYFWIHSTGPIGCLPYALVHRPDIAEPKDGIGCSVAYNKAAQVFNQRLKE  268

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CGK  951
              V +LR     AVFT VD+Y+AKY ++S A   GF DP   CC              CG 
Sbjct  269   TVARLRKAYPDAVFTYVDVYTAKYKLISQARKLGFDDPLLTCCGHGAGRYNFDQKVGCGG  328

Query  952   NKKMANETVY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               ++   +V  G+ C DPSR +SWDGVH++EAAN  +   I+ GG+ SDPP P+ +ACR
Sbjct  329   KVQVNGTSVLVGNSCDDPSRRVSWDGVHFTEAANKFVFDQIV-GGALSDPPVPLRQACR  386


 Score =   304 bits (778),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/360 (45%), Positives = 225/360 (63%), Gaps = 28/360 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SA    V PP G TFFG P+GRY DGRL IDF+A++LGL Y
Sbjct  492   CDFPAIFNFGDSNSDTGGLSALFSAVLPPYGRTFFGMPAGRYSDGRLTIDFMAQSLGLRY  551

Query  298   LNAYLDSIGTSFRHGANFATAGS-------SILPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDSIG++F  GANFATA +       SI   GYSP  L +Q  +F QF  R+  +Y
Sbjct  552   LSAYLDSIGSNFTQGANFATAAATIRRDNGSIFVQGYSPISLVVQTWEFEQFINRSKFVY  611

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
             + + G   +Y+++LP+P+ FSK+LYTFD+GQNDL+ G+  +  ++ +++ +P +M++F++
Sbjct  612   SNIGG---IYREILPKPDYFSKALYTFDMGQNDLTVGYLTNMTTEQVEAYVPDVMERFAE  668

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y  G R FW+HNT P+GCLP +V +  D     D  GC+   NR AQ FN +L  
Sbjct  669   GIQSVYRLGGRYFWVHNTAPLGCLPYAVVFRPDLAEEKDGAGCSVALNRGAQFFNARLNE  728

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCCCG---------------  948
              V +LRA L  A FT VD+YSAKY ++S A   GF DP    CCG               
Sbjct  729   TVARLRAALPDAAFTYVDVYSAKYKLISQAKKLGFGDPPLRACCGYGGGEYNLDRDIRCG  788

Query  949   -KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              + +      + G  C DPSR ++WDG+H++EA N  +   I+  G  SDPP P+  AC+
Sbjct  789   ARAEVNGTSVLVGKSCEDPSRSVNWDGIHFTEAGNKFVFDQIV-DGVLSDPPVPLRRACQ  847



>ref|XP_010242789.1| PREDICTED: esterase-like isoform X1 [Nelumbo nucifera]
Length=392

 Score =   313 bits (803),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 175/358 (49%), Positives = 230/358 (64%), Gaps = 26/358 (7%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R C FPA++NFGDSNSDTGG SA+    +PPNGETFF  P+GRY DGRL IDF+A++LGL
Sbjct  35    RDCNFPAIFNFGDSNSDTGGLSASYYPTQPPNGETFFHMPAGRYSDGRLTIDFMAQSLGL  94

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+AYL+S+ ++F HGANFATA S I P       GG+SPF+L +Q  QF+QFK R+ +
Sbjct  95    PYLSAYLNSLESNFTHGANFATAASPIRPVKRGLSEGGFSPFYLLVQYWQFMQFKSRS-Q  153

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKF  627
             L  K  G   V+  ++P+ E FS++LYTFDIGQNDL  G F   +V +   S+P I+  F
Sbjct  154   LIKKRGG---VFASLMPKEEYFSQALYTFDIGQNDLGAGFFGNQSVQEVNASVPDIVSNF  210

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
             S+ +  +Y  GAR+FWIHNTGPIGCLP  +       + +DK GCAA +N VAQ FN++L
Sbjct  211   SRDVKLIYDLGARSFWIHNTGPIGCLPYILVNMPITASQIDKAGCAAPYNDVAQYFNKKL  270

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG  948
             K  V+QLR  L  A FT VD+YS KY ++S A  +GF+ P   CC             CG
Sbjct  271   KEAVVQLRKDLPLAAFTYVDVYSVKYLLISQAEKYGFEHPLVACCGYGGKYNYSPTAGCG  330

Query  949   KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                 +    ++   C  PS  + WDG+HY+EAAN  +   I+  G +SDPP P+  AC
Sbjct  331   DTITVNGTRLFVGSCKRPSVRVIWDGIHYTEAANRWVFDRIV-DGKYSDPPLPLRMAC  387



>ref|XP_004504128.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Cicer arietinum]
Length=396

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 232/359 (65%), Gaps = 27/359 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             ++C FPA++NFGDSNSDTG  SAA G+  PPNG TFF  P+GR+ DGRL+IDFIA++LGL
Sbjct  34    KQCSFPAIFNFGDSNSDTGAISAAFGQAPPPNGITFFHTPAGRFSDGRLIIDFIAKSLGL  93

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+AYLDS+G++F +GANFATAGS+I P        GYSP  LD+Q+ Q+  FK R+I 
Sbjct  94    PYLSAYLDSVGSNFSNGANFATAGSTIRPQNTTKSQSGYSPISLDVQLVQYSDFKTRSIR  153

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKF  627
             +  K      V+K +LP+ E FSK+LYTFDIGQNDL+ G++ +  ++ +++ IP ++ +F
Sbjct  154   VRKK----GGVFKKLLPKEEYFSKALYTFDIGQNDLTAGYKLNMTTEQVKAYIPDVLGQF  209

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
             S  +  +YG+G R+FWIHNTGP+GCLP  +     +   +DK GCA   N VAQ FN +L
Sbjct  210   SNVIKSVYGKGGRSFWIHNTGPLGCLPYMLDRYPMSAAQIDKFGCAKPFNEVAQFFNHKL  269

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG  948
             +  V++LR +L +A    VD+Y+ KY ++S+A  +GF+     CC             CG
Sbjct  270   EEAVVELRKELIEATIVYVDVYTVKYTLISHAQKYGFEKGVIACCGDGGKYNFNNVARCG  329

Query  949   KNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               K++     V    C DPS  I WDG+HY+EAAN  +   I   G FSDPP  +   C
Sbjct  330   ATKRVNGKNIVIAKSCEDPSVMIIWDGIHYTEAANKWIFLQIA-NGYFSDPPISLKLTC  387



>ref|XP_002285512.1| PREDICTED: GDSL esterase/lipase At3g26430 [Vitis vinifera]
 emb|CBI16796.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 170/358 (47%), Positives = 231/358 (65%), Gaps = 28/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG SAA G+  PP GET+F  P+GRY DGRL+IDFIAE++GLPY
Sbjct  27    CEFPAVFNFGDSNSDTGGLSAAFGQAGPPAGETYFHAPAGRYSDGRLIIDFIAESVGLPY  86

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LD++G++F HGANFATAGS+I P        G+SP  L++Q  +F  F +R+  + 
Sbjct  87    LSAFLDALGSNFTHGANFATAGSTIRPPNATLSQSGFSPISLNVQWYEFHDFHRRSQIIR  146

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKIMDKFS  630
             N+      V+  ++P+ E FS++LYTFDIGQNDL++G+ +SN+S  Q    +P ++D+F 
Sbjct  147   NR----GGVFSQLMPKEESFSRALYTFDIGQNDLTYGY-FSNMSTDQVRAYVPDVLDQFR  201

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  +Y +G R+FWIHNTGP+GCLP  +         VDK GCA   N VA+ FN +LK
Sbjct  202   TVIKDIYDQGGRSFWIHNTGPVGCLPYVMDRVPITAGQVDKYGCADPFNEVAKYFNLKLK  261

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGK  951
               V +LR +L +A  T VD+YS KY +++ A   GF  P   CC             CG 
Sbjct  262   EMVQKLRQELPEAAITYVDVYSVKYTLITKAKKFGFVQPLRACCGHGGKYNYNIHVGCGG  321

Query  952   NKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               K+  + V    C DPS  I+WDGVH++EAAN  +   I+ GG FSDPP P+  AC+
Sbjct  322   KVKVDGKEVVVGSCKDPSVKINWDGVHFTEAANKWIFDKIV-GGEFSDPPIPLNMACQ  378



>ref|XP_007044829.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY00661.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=385

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 176/368 (48%), Positives = 238/368 (65%), Gaps = 33/368 (9%)
 Frame = +1

Query  103   LPQRR-----CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVID  267
             LP R      C FPA++NFGDSNSDTGG SAA G+   PNGET+F  P GRY DGRLVID
Sbjct  20    LPSRSGSLAPCNFPAIFNFGDSNSDTGGLSAAFGQAPAPNGETYFHAPVGRYSDGRLVID  79

Query  268   FIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFI  426
             FIAE+LGLPYL+AYLDS+G++F HGANFATAGS+I P        G+SP  LD+Q  QF 
Sbjct  80    FIAESLGLPYLSAYLDSVGSNFSHGANFATAGSTIRPQNTTRSQSGFSPISLDVQSVQFS  139

Query  427   QFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-  603
              F +R+ +++NK      V+  +LP+ E FS++LYT DIGQNDL+ G++ +  ++ +++ 
Sbjct  140   DFNRRS-QIFNKQG----VFDKLLPKEEYFSQALYTLDIGQNDLTAGYKLNLTTEQVKAY  194

Query  604   IPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRV  783
             +P+++ +FS A+ ++Y +G R FWIHNTGP+GCLP  +         VDK GCA+  N V
Sbjct  195   VPEVLRQFSDAVKRVYDQGGRAFWIHNTGPVGCLPYVLDRFLITAPQVDKYGCASPFNEV  254

Query  784   AQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------  942
             AQ FNR+LK  V++LR +L  A  T VD+YS KY ++S A   GF+ P   CC       
Sbjct  255   AQYFNRRLKDDVIRLRKELPLAAITYVDVYSVKYTLISQAKKFGFKLPLIACCGHGGKYN  314

Query  943   ------C-GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPP  1101
                   C GK      E +  + C +PS  ++WDG+H++EAAN  +   I   GSFSDPP
Sbjct  315   FNNSVRCGGKITVNGKEILIANSCQNPSVRVNWDGIHFTEAANKWIFEQIA-NGSFSDPP  373

Query  1102  RPVAEACR  1125
              P+  AC+
Sbjct  374   IPLKMACQ  381



>ref|XP_006599078.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Glycine max]
Length=385

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 224/359 (62%), Gaps = 29/359 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             + C F A++NFGDSNSDTG  SAA      P GETFF + +GR  DGRL+IDFIA++LGL
Sbjct  31    QTCDFQAIFNFGDSNSDTGCMSAAFYPAALPYGETFFNEAAGRASDGRLIIDFIAKHLGL  90

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSI------LPGGYSPFFLDIQISQFIQFKKRTIEL  453
             P L+AY+DSIG+S+ HGANFA A S++         G SPF L+IQ++QFIQF  RT + 
Sbjct  91    PLLSAYMDSIGSSYSHGANFAAASSTVRRQNKTFFDGGSPFSLEIQVAQFIQFMTRTAKF  150

Query  454   YNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQ  633
             Y +  G +       PRPE+F+K++YTFDIGQND++   Q      T  +I  I+D+ S 
Sbjct  151   YKQGQGNS------FPRPEDFAKAIYTFDIGQNDIAAALQRMGQENTEAAISDIVDQLSN  204

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPIS----VAYN-KDNHNNVDKNGCAATHNRVAQEFN  798
              L  LY +GAR FWIHNTGPIGCLP+S    +AYN       +D+NGC    N VA+EFN
Sbjct  205   QLIYLYTQGARTFWIHNTGPIGCLPVSMPKHIAYNYTPAEGYLDQNGCVVYANDVAKEFN  264

Query  799   rqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CG  948
             R+L   V++LR     A F  VDM+SAKY ++SNA   GF DP   CC          CG
Sbjct  265   RKLNDTVVKLRTLYLDASFVYVDMFSAKYQLISNAKKEGFVDPSEICCGYHEGGNHFFCG  324

Query  949   KNKKMANET-VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
                   N T +Y   C  PS HISWDGVHY++AAN  +A  I+  GSFS+P  P+  +C
Sbjct  325   NYNATVNGTEIYAGSCKSPSSHISWDGVHYTDAANSWIANRIV-TGSFSNPQLPITRSC  382



>ref|XP_010029090.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Eucalyptus grandis]
 ref|XP_010029091.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Eucalyptus grandis]
 gb|KCW55933.1| hypothetical protein EUGRSUZ_I01727 [Eucalyptus grandis]
Length=390

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 229/363 (63%), Gaps = 21/363 (6%)
 Frame = +1

Query  88    GIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVID  267
              I  GLP   C FPA+YNFGDSNSDTGG SAA   +  P GETFF +P GR  +GRL+ID
Sbjct  28    AIARGLPP--CEFPAIYNFGDSNSDTGGISAAFYPMGSPTGETFFHRPVGRASNGRLIID  85

Query  268   FIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFI  426
             FIAE+LGLPYL+AYLDS+G SFRHGANFAT GS+I          G SPF LDIQ + + 
Sbjct  86    FIAEHLGLPYLSAYLDSLGWSFRHGANFATGGSTIRRQNESFFENGVSPFSLDIQTAHYD  145

Query  427   QFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSI  606
             QF  RT  L+ K A   +  +  LP PE+FSK+LY FDIGQNDL+ GF+     Q   S+
Sbjct  146   QFVARTSYLF-KNARAEKFPRSRLPMPEDFSKALYVFDIGQNDLAAGFRKMTNEQLNASM  204

Query  607   PKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRV  783
             P I+ + + A+  LY +GAR FWIHNTGPIGCLPI++ Y ++     +D+ GC    N +
Sbjct  205   PDIVSQLATAVQHLYQQGARTFWIHNTGPIGCLPITLRYIRNPMPGYLDEIGCVKDQNEM  264

Query  784   AQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------  942
             A EFNRQLK  V+QLR +L +A  T VD+Y+AKY++++N+   GF+     CC       
Sbjct  265   ASEFNRQLKEMVMQLRGELPEAALTYVDVYTAKYSLIANSTRAGFERAGKMCCGYEWEDK  324

Query  943   ---CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVA  1113
                CG+   +    V    C DPS  +SWDGVHY+EAAN  ++  I+ G     P  P+ 
Sbjct  325   HVWCGQKASINGSEVVAGSCEDPSIFVSWDGVHYTEAANRWISEHIISGLLSDRPNVPIT  384

Query  1114  EAC  1122
              AC
Sbjct  385   HAC  387



>ref|XP_010682277.1| PREDICTED: GDSL esterase/lipase At3g26430 [Beta vulgaris subsp. 
vulgaris]
Length=390

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 177/372 (48%), Positives = 237/372 (64%), Gaps = 34/372 (9%)
 Frame = +1

Query  85    NGIGGGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVI  264
             N +GG      C FPA++NFGDSNSDTGG SA  G+  PP+GETFF  P+GRYCDGRL+I
Sbjct  30    NTLGG-----ECKFPAIFNFGDSNSDTGGFSATFGQAGPPHGETFFHSPAGRYCDGRLII  84

Query  265   DFIAENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQF  423
             DFIA++LGLPYL+ YLD++G++F HGANFATAGS+I P        G+SP  L+IQ  +F
Sbjct  85    DFIAQSLGLPYLSGYLDAVGSNFSHGANFATAGSTIRPQNTTLHQSGFSPISLNIQSYEF  144

Query  424   IQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTL  597
               F++R+     K      V+KD+LP+ E FSK+LYTFDIGQNDL+ G+ + N+S  Q  
Sbjct  145   NDFQRRSQTFRQK----GNVFKDLLPKGEYFSKALYTFDIGQNDLTAGY-FLNMSSDQVK  199

Query  598   QSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHN  777
              +IP ++ +F+  +  +Y +G R FWIHNTGP+GCLP  +       + +DK GC    N
Sbjct  200   ANIPDVLGQFTTVVKDIYEKGGRYFWIHNTGPLGCLPYVMDRVAVKSSEIDKVGCTGPCN  259

Query  778   RVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-----  942
             +VAQ FN++LK  V+ LR +L  A  T VD+YS KY ++S+A  +GF+     CC     
Sbjct  260   KVAQVFNQKLKEVVVHLRKKLPHAAITYVDIYSLKYDLISHARKYGFEQSLRACCGHGGK  319

Query  943   --------C-GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSD  1095
                     C GK      + + G  C DPS  I+WDGVHY+EAAN  +   I+  GS+SD
Sbjct  320   YNYNQHVGCGGKVTVKGKQILVGKACKDPSLAINWDGVHYTEAANKWVFDRIV-DGSYSD  378

Query  1096  PPRPVAEACR*I  1131
             PP P+  AC  I
Sbjct  379   PPIPLKMACHKI  390



>ref|XP_006357593.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Solanum tuberosum]
Length=385

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 228/359 (64%), Gaps = 29/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTGG SAA G+  PP GET+FG P+GRYCDGRLVIDFIAE+LG+P+
Sbjct  31    CDFPAVFNFGDSNSDTGGLSAAFGQAGPPAGETYFGAPAGRYCDGRLVIDFIAESLGIPH  90

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LD++G++F HGANFATAGS+I P        G+SP  L++Q  +F  F  R+  + 
Sbjct  91    LSAFLDALGSNFSHGANFATAGSTIRPQNTTLHQSGFSPISLNVQSYEFNDFLHRSQIIR  150

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKIMDKFS  630
             NK      V+  ++P+ + FS+ LYTFDIGQNDL+ G+ ++N+S  Q    +P ++D+F 
Sbjct  151   NK----GDVFSKLMPKEKHFSEGLYTFDIGQNDLTAGY-FNNMSTDQVRAYVPDVIDQFK  205

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  +Y  G R FWIHNTGP+GCLP  +         VDK GCA+  N VAQ FN +LK
Sbjct  206   TVIKGIYSRGGRYFWIHNTGPVGCLPYVLDRLLITAGQVDKAGCASPFNEVAQYFNAKLK  265

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG-  948
               V+QLR  L  A  T VD+YS KY ++  A  HGF+ P   CC             CG 
Sbjct  266   EAVIQLRKDLPLAALTYVDVYSVKYELIYRANKHGFEHPLQACCGHGGKYNFNINHGCGS  325

Query  949   KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K K    E + G  C +PS  I+WDGVH++EAAN  +   I+  G +SDPP P+  AC 
Sbjct  326   KIKVKGKEVILGKSCKNPSERINWDGVHFTEAANKWVFEQIV-NGLYSDPPLPLNMACH  383



>ref|XP_002311760.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE89127.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=390

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 171/361 (47%), Positives = 234/361 (65%), Gaps = 27/361 (7%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+   PNGET+F  P+GRY DGRL++DFIAE+LG+P+
Sbjct  33    CDFPAIFNFGDSNSDTGGLSAAFGQAPSPNGETYFHHPAGRYSDGRLILDFIAESLGVPH  92

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G++F HGANFATAGS+I P        GYSP  L++Q  Q+  FKKR+ ++ 
Sbjct  93    LSAYLDSVGSNFSHGANFATAGSTIRPQNTTQSQSGYSPISLNVQSVQYSDFKKRS-QIV  151

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
                 G   +++ ++P+ + FSK+LYT DIGQNDL+ G++ +  ++ +++ +P ++ +FS 
Sbjct  152   RSQGG---IFETLMPKADYFSKALYTIDIGQNDLTAGYKLNLTTEQVKANVPDMLGQFSN  208

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+ Q+Y  G R+FWIHNTGP+GCLP S+         +DK GCA   N V+Q FN  LK 
Sbjct  209   AVKQIYAVGGRSFWIHNTGPVGCLPYSLDRFLITAAQIDKYGCATPFNEVSQFFNHGLKE  268

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V+QLR  L QA  T VD+YS KY + + A   GF+ PF  CC             CG  
Sbjct  269   AVVQLRKDLPQAAITYVDIYSLKYTLTTQAKKFGFKQPFVACCGHGGKYNYNSQRRCGAK  328

Query  955   KKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR*I  1131
               +   E +  + C DPS  I WDGVH++EAAN  + + I+  GSFSDPP P+  AC   
Sbjct  329   ITVNGTEVLIANSCKDPSVRIIWDGVHFTEAANKWIFQQIV-NGSFSDPPVPLKMACHRT  387

Query  1132  E  1134
             E
Sbjct  388   E  388



>ref|XP_008340092.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Malus domestica]
Length=444

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 242/359 (67%), Gaps = 29/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+   PNGET+F  PSGR+ DGRLVIDFIAE+LGLP+
Sbjct  90    CSFPAIFNFGDSNSDTGGLSAAFGQAPYPNGETYFHVPSGRFSDGRLVIDFIAESLGLPH  149

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LDS+G++F HGANFATAGS+++P       GG SP  LD+Q+ QF  F+ R+ ++Y
Sbjct  150   LSAFLDSMGSNFSHGANFATAGSTVIPPNTTISQGGASPISLDVQLLQFSDFRTRS-QIY  208

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
                   +++++  LP+ E FS++LYTFDIGQND++ G++ +  ++ +++ +P ++ + S 
Sbjct  209   RT---KSELFEKSLPKEEYFSQALYTFDIGQNDITAGYKLNWTAEQVKAYLPYVLTQLSN  265

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+  +Y +G R+FWIHNTGP+GCLP  +     +   ++K GCA   + VA+ FN++LK 
Sbjct  266   AIKSVYDQGGRSFWIHNTGPLGCLPYVLVRFVTDPAQINKYGCADQIDEVAKFFNQRLKE  325

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V+QL+  L  A  T VD+YS KY +++ A  +GF++P   CC             CG  
Sbjct  326   AVVQLKKDLPLAAITYVDVYSVKYTLITQAKKYGFENPLIACCGHGGKYNFDRYAKCGA-  384

Query  955   KKMAN--ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             KKM N  ET+    C DP+  I+WDG H++EAAN  + + I+  GSFSDPP P+  ACR
Sbjct  385   KKMINGTETLIAKSCDDPTVRINWDGTHFTEAANKWIFQQIV-NGSFSDPPNPLKTACR  442



>ref|XP_010320940.1| PREDICTED: GDSL esterase/lipase At3g26430-like isoform X1 [Solanum 
lycopersicum]
Length=384

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 174/361 (48%), Positives = 232/361 (64%), Gaps = 28/361 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C F A++NFGDSNSDTGG SAA G+   PNGETFF  P+GR+ DGRL+IDFIAE L LPY
Sbjct  21    CKFAAIFNFGDSNSDTGGLSAAFGQAPYPNGETFFHAPAGRFSDGRLLIDFIAEGLDLPY  80

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LDSIG++F HGANFATAGS+I P        GYSP  LD+Q  QF  F  R+  + 
Sbjct  81    LSAFLDSIGSNFSHGANFATAGSTIRPQNTTMAQSGYSPISLDVQGVQFSDFHTRSQIIR  140

Query  457   NK---LAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYS-NVSQTLQSIPKIMDK  624
              K   ++ T  V+  +LP  E+FS++LYTFDIGQNDL+ G++ + +  Q    +P ++ +
Sbjct  141   QKGFVISNTGNVFGQLLPNKEDFSQALYTFDIGQNDLTAGYKLNMSTDQVKAYVPDLLSQ  200

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
              S  + ++Y +G R+FWIHNTGP+GCLP  +         VDK GCA   N V++ FN  
Sbjct  201   LSNVIKKVYAKGGRSFWIHNTGPVGCLPYVIDRFMITAAQVDKYGCANPFNEVSKYFNLL  260

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V+QLR +L  A FT VD+YS KY+++ +A   GF++PF  CC             C
Sbjct  261   LKKTVVQLRKELPLAAFTYVDVYSVKYSLIGHAKKLGFENPFLACCGHGGKYNYNRFIKC  320

Query  946   GKNKKMAN--ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEA  1119
             G +KK+ N  E V    C DPS  ++WDG H++EAAN  +   I+  GSFSDPP P++ A
Sbjct  321   G-SKKVVNGKEIVIASSCKDPSVRVNWDGTHFTEAANKWIFDQIV-NGSFSDPPIPLSLA  378

Query  1120  C  1122
             C
Sbjct  379   C  379



>ref|XP_007140963.1| hypothetical protein PHAVU_008G155800g [Phaseolus vulgaris]
 gb|ESW12957.1| hypothetical protein PHAVU_008G155800g [Phaseolus vulgaris]
Length=391

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 225/357 (63%), Gaps = 29/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTG  SAA      P G+T F +  GR  DGRL+IDF+A+NLGL Y
Sbjct  39    CGFPAIFNFGDSNSDTGCMSAAFYPAALPYGQTHFHEAVGRASDGRLIIDFLAKNLGLEY  98

Query  298   LNAYLDSIGTSFRHGANFATAGSSI------LPGGYSPFFLDIQISQFIQFKKRTIELYN  459
             L+AY+DSIG+S+ HGANFA A S+I         G SPF L+IQ++QFIQFK RT +LY 
Sbjct  99    LSAYMDSIGSSYYHGANFAAASSTIRRQNRTFFDGGSPFTLEIQVAQFIQFKTRTAKLYK  158

Query  460   KLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQAL  639
             +  G +       PRPE+FSK+LYTFDIGQND++   Q      +   I  I+D+FS  L
Sbjct  159   QGQGNS------FPRPEDFSKALYTFDIGQNDIAAALQRIGQENSEAVISDIVDQFSNQL  212

Query  640   YQLYGEGARNFWIHNTGPIGCLPISV-AYNKDNHNNV----DKNGCAATHNRVAQEFNrq  804
               LY EGAR FWIHNTGPIGCLP+++  +N  N+  V    D+NGC    N +A++FN +
Sbjct  213   IYLYSEGARTFWIHNTGPIGCLPLAMPIHNAYNYTPVDGYLDQNGCVVYQNDMAKDFNTK  272

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGK-  951
             L   V++LRA    A F  VD++SAKY ++SN    GF +P   CC          CG  
Sbjct  273   LNHTVVKLRALYLDASFVYVDIFSAKYQLISNTKKEGFVNPSEICCGFHEGGNRLFCGNY  332

Query  952   NKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             N  +    +    C DPS HISWDGVHY++AAN  +A  I+  GSFSDPP P+  +C
Sbjct  333   NATINGREIQVGSCQDPSSHISWDGVHYTDAANSWIANRIV-TGSFSDPPLPITRSC  388



>ref|XP_002875415.1| hypothetical protein ARALYDRAFT_484583 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51674.1| hypothetical protein ARALYDRAFT_484583 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   310 bits (795),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 219/347 (63%), Gaps = 28/347 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPAV+NFGDSNSDTG  SAA+GEV PPNG  FFG+ +GR+ DGRL+IDFI ENL LPY
Sbjct  28    CNFPAVFNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSAGRHSDGRLIIDFITENLTLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNKLAG  471
             L  YLDS+G ++RHGANFAT GS I P    +S F L  Q+SQFI FK RT+ LYN+   
Sbjct  88    LTPYLDSVGANYRHGANFATGGSCIRPTLSCFSQFHLGTQVSQFIHFKTRTLSLYNQ---  144

Query  472   TNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLY  651
             TN           +FSK+LYT DIGQNDL+ GFQ     Q   +IP I++ F+ AL  LY
Sbjct  145   TN-----------DFSKALYTLDIGQNDLAIGFQNMTEEQLKATIPAIIENFTIALKLLY  193

Query  652   GEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlr  831
              EGAR F IHNTGP GCLP  +          D  GC    N VA EFN+QLK ++ +L+
Sbjct  194   KEGARFFSIHNTGPTGCLPYLLKAFPATPR--DPYGCLKPLNNVAIEFNKQLKNKINELK  251

Query  832   aqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANETVYG  984
              +L  + FT VD+YSAKY +++ A + GF DPF +CC         CGK        +Y 
Sbjct  252   KELPSSFFTYVDVYSAKYNLITKAKTLGFVDPFDYCCVGAIGRGMGCGKTIFPNGTELYS  311

Query  985   DPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               C +    ISWDG+HY+E AN+++A  I+  GS SDPP P  + C+
Sbjct  312   SSCENRKNFISWDGIHYTETANMLVANRIL-DGSISDPPLPTQKGCK  357



>ref|XP_010044555.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Eucalyptus grandis]
Length=387

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 171/362 (47%), Positives = 235/362 (65%), Gaps = 27/362 (7%)
 Frame = +1

Query  103   LPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAEN  282
             L    C FPA++NFGDSNSDTGG SA  G+   P+GET+F +P+GRY DGRLV+DFIA++
Sbjct  25    LAHASCDFPAIFNFGDSNSDTGGLSAVYGQAPSPHGETYFRQPAGRYSDGRLVVDFIAQS  84

Query  283   LGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKR  441
              GLPYL+AYLD++G++F HGANFAT+GS+I P        GYSP  LD+Q ++F +F++R
Sbjct  85    FGLPYLSAYLDAVGSNFSHGANFATSGSTIRPQNTTFRQTGYSPISLDVQFNEFYEFRRR  144

Query  442   TIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIM  618
             + ++     G   VY+ +LP  E FS++LYTFDIGQNDL+ G+  +  +  +++ IP ++
Sbjct  145   S-QVARSRGG---VYEKLLPTEEVFSRALYTFDIGQNDLTAGYFLNMSTNEVKAYIPDLL  200

Query  619   DKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFN  798
              +F   +  +YGEG R FWIHNTGP GCLP  +       + VD+ GCAA  N VA+ FN
Sbjct  201   GQFKNVVSHIYGEGGRYFWIHNTGPFGCLPYVMERIPILVSQVDRAGCAAPFNEVARHFN  260

Query  799   rqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC------------  942
             R LK  V QLR +L  A  T VD+Y+ KYA++S    +GF+ P   CC            
Sbjct  261   RGLKEVVTQLRKELPLAAITYVDVYAVKYALISKPVKYGFKQPLRACCGHGGKYNFDMHM  320

Query  943   -CGKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAE  1116
              CG    +   E + G+ C DPS +++WDG HY+EAAN  +   I+ GGSFSDPP P+ +
Sbjct  321   GCGSKITVGGKEVLVGNSCKDPSVYVNWDGYHYTEAANKQIFDHIV-GGSFSDPPVPLNK  379

Query  1117  AC  1122
             AC
Sbjct  380   AC  381



>gb|AFK49466.1| unknown [Medicago truncatula]
Length=367

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 165/326 (51%), Positives = 217/326 (67%), Gaps = 27/326 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             R+C FPA++NFGDSNSDTGG SAA G+   P GE+FF  P GRYCDGRL++DFIAE LGL
Sbjct  37    RKCEFPAIFNFGDSNSDTGGLSAAFGQPGYPYGESFFHHPVGRYCDGRLLVDFIAEKLGL  96

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP--------GGYSPFFLDIQISQFIQFKKRTI  447
             PYLNAYLD++G++F HGANFATAGS+I P        GG+SPF LD+Q +QF  F++RT 
Sbjct  97    PYLNAYLDAVGSNFSHGANFATAGSTIRPQNTTLHQTGGFSPFSLDVQFTQFNDFQRRTQ  156

Query  448   ELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDK  624
                NK      +YK +LP+ E FS++LYTFDIGQNDL+ G F   +++Q    +P ++D+
Sbjct  157   FFRNK----GGIYKTLLPKAEYFSRALYTFDIGQNDLASGYFHNMSINQVKAYVPDVLDQ  212

Query  625   FSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrq  804
             F   +  +Y  G R+FWIHNTGP+GCLP  +  +K   + VDK GCA  +N VA+ FN +
Sbjct  213   FKNTIKNIYAHGGRSFWIHNTGPVGCLPYIIELHKVTSDKVDKAGCAIPYNEVAKFFNHE  272

Query  805   lkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------C  945
             LK  V+QLR +L  A  T VD+YSAKY+++S A  HGF++P   CC             C
Sbjct  273   LKQAVVQLRKKLPSAAITYVDVYSAKYSLISQAYRHGFKEPLRACCGHGGKYNYNLHIGC  332

Query  946   GKNKKM-ANETVYGDPCSDPSRHISW  1020
             G   K+   E + G PC DPS  ++W
Sbjct  333   GAKVKIDGKEILIGKPCKDPSVVVNW  358



>ref|NP_001242659.1| uncharacterized protein LOC100805314 precursor [Glycine max]
 gb|ACU20252.1| unknown [Glycine max]
Length=387

 Score =   311 bits (797),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 168/360 (47%), Positives = 228/360 (63%), Gaps = 24/360 (7%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             + C FPA++NFGDSNSDTG  +AA      P GETFF +P GR  DGRL+IDFIA++LG 
Sbjct  28    QHCDFPAIFNFGDSNSDTGCMAAAFYPEVLPYGETFFHEPVGRASDGRLIIDFIAQHLGF  87

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIE  450
             P+L+AY++SIGTS+RHGANFA   S+I         GG +PF  +IQ++QF QFK RT +
Sbjct  88    PFLSAYINSIGTSYRHGANFAAGSSTIRRQKRTVFEGG-TPFTFEIQVAQFNQFKARTRK  146

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFS  630
              +N+ A     ++   PRPE+F+K++YTFDIGQND++      +   +   I  I+D F 
Sbjct  147   FFNQDAQGKNSFRGHFPRPEDFAKAIYTFDIGQNDIAAAINKVDTEDSHAVISDIVDYFE  206

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-----VDKNGCAATHNRVAQEF  795
               +  L G GAR FWIHNTGPIGCLP+++  +   +       +D+NGC    N +A+EF
Sbjct  207   NQVQTLLGLGARTFWIHNTGPIGCLPVAMPVHNAMNTTPGAGYLDQNGCINYQNDMAREF  266

Query  796   NrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------C  945
             N++LK  V++LR Q   A    VDM+SAKY ++SNA   GF DP   CC          C
Sbjct  267   NKKLKNTVVKLRVQFPDASLIYVDMFSAKYELISNANKEGFVDPSGICCGYHQDGYHLYC  326

Query  946   GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             G    +  + ++ D C DPS++ISWDGVHY+EAAN  +A  I+  GSFSDPP  +A +C 
Sbjct  327   GNKAIINGKEIFADTCDDPSKYISWDGVHYTEAANHWIANRIL-NGSFSDPPLSIAHSCH  385



>emb|CBI16797.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   311 bits (796),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 226/358 (63%), Gaps = 28/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SA  G+  PPNGETFF KP+GRY DGRLVIDF+AE LGLPY
Sbjct  28    CDFPAIFNFGDSNSDTGGLSAVYGQAPPPNGETFFHKPAGRYSDGRLVIDFMAERLGLPY  87

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLD++G++F HGANFATAGS+I P        GYSP  L+IQ  +F  F +R+ + Y
Sbjct  88    LSAYLDAVGSNFTHGANFATAGSTIRPQNTTFQQTGYSPISLNIQFYEFNDFHRRS-QTY  146

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKIMDKFS  630
                 G   V++ +LP+ E FS++LYTFDIGQNDL+ G+ + N+S  Q    +P +M++F 
Sbjct  147   RNQGG---VFEKLLPKEEFFSRALYTFDIGQNDLTAGY-FLNMSGDQVRAYVPDLMNQFK  202

Query  631   QALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlk  810
               +  +Y +G R+FWIHNTGP+ CLP  +         VD  GC    N VA+ FN +L 
Sbjct  203   TIIQYVYDQGGRSFWIHNTGPVACLPYILDRLPITAGQVDHIGCVGPVNDVAKYFNTKLN  262

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGK  951
               V++LR Q   A  T VD+YS KY ++S A   GF +P   CC             CG 
Sbjct  263   ETVVELRKQFPLAAITYVDVYSVKYTLISKAKELGFVEPLKACCGPGGKYNYNVKVGCGW  322

Query  952   NKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                +    V G  C DP+  I+WDG+HY+EAAN  +   I+ GG+FSDPP P+A AC 
Sbjct  323   KGVVDGREVEGTSCKDPTVKINWDGIHYTEAANKWVFDQIV-GGAFSDPPVPLAMACH  379



>ref|XP_010044559.1| PREDICTED: GDSL esterase/lipase At3g26430-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW86648.1| hypothetical protein EUGRSUZ_B03275 [Eucalyptus grandis]
Length=395

 Score =   311 bits (797),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 174/349 (50%), Positives = 224/349 (64%), Gaps = 22/349 (6%)
 Frame = +1

Query  124   FPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLN  303
             FP+++NFGDSNSDTGG SAA G+  PPNGET+F +PSGRYCDGRL+IDFIAE+L LP+L+
Sbjct  44    FPSIFNFGDSNSDTGGLSAAFGQAPPPNGETYFHRPSGRYCDGRLLIDFIAEDLRLPHLS  103

Query  304   AYLDSIGTSFRHGANFATAGSSILP-GGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQ  480
             AYLDS+G++F HGANFATAGS+I P  GYSP  L++Q+ +F  F  R+ + +    G   
Sbjct  104   AYLDSVGSNFSHGANFATAGSTIRPQSGYSPIALNVQLVEFSDFLARS-QYFRSQGG---  159

Query  481   VYKDVLPRPEEFSKSLYTFDIGQNDLSHGF-QYSNVSQTLQSIPKIMDKFSQALYQLYGE  657
             V+  +LPR E FS++LY FDIGQNDL+ G  Q   + Q   SIP +M +FS A+ ++Y E
Sbjct  160   VFTRLLPREEYFSRALYMFDIGQNDLTAGLKQNMTIGQIKASIPDVMAQFSDAIKKVYAE  219

Query  658   GARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvlqlraq  837
             G R+ WIHNTGP+GCL I +          D++GC  T N +AQ FN +LK  V  LR +
Sbjct  220   GGRSLWIHNTGPLGCL-IYMMDRFHLEAPEDEHGCLRTLNELAQYFNARLKEAVDSLRTE  278

Query  838   lqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG-KNKKMANET  975
             L  A  T VD+YS KY +++ A  HGFQ PF  CC             CG K      E 
Sbjct  279   LPLAAITYVDVYSVKYNLITQARQHGFQQPFKACCGHGGKYNFNNSRRCGFKVTVEGKEV  338

Query  976   VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             V    C DPS  +SWDG+H++EAAN      I   GS+SDPP  +  AC
Sbjct  339   VIARSCKDPSVRVSWDGIHFTEAANRWFFEQIA-DGSYSDPPVRLNTAC  386



>ref|XP_010110055.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXC25090.1| GDSL esterase/lipase [Morus notabilis]
Length=421

 Score =   311 bits (798),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 190/438 (43%), Positives = 251/438 (57%), Gaps = 88/438 (20%)
 Frame = +1

Query  13    MEIWKRILVFEmmlmslglmgclVNGIGGGLPQRR--CWFPAVYNFGDSNSDTGGRSAAL  186
             ME W++ L                 GI GG       C FPA+YNFGDSNSDTGG SAA 
Sbjct  1     MEFWRQFL-----------------GIFGGADSASPTCSFPALYNFGDSNSDTGGISAAF  43

Query  187   GEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPYLNAYLDSIGTSFRHGANFATAGS  366
               ++ P GE FF KPSGR  DGRL+IDFIAE LGLPYL+AYL+S+GTS++HGANFAT GS
Sbjct  44    EPIQAPYGEAFFHKPSGRDSDGRLIIDFIAERLGLPYLSAYLNSLGTSYKHGANFATGGS  103

Query  367   -------SILPGGYSPFFLDIQISQFIQFKKRTIELYNKLAGTNQVYKDVLPRPEEFSKS  525
                    +I   G SPF LD+QI+QF QFK RT +LY +   + +  K  LP  E+F+K+
Sbjct  104   TIRRQNETIFENGISPFSLDMQIAQFNQFKARTRDLYQQAKTSYE--KSRLPNQEDFAKA  161

Query  526   LYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALYQLYGEGARNFWIHNTGPIGCL  705
             LYTFDIGQNDLS GF+  +  Q L +IP I+++ ++A+  +Y +G R+FWIHNT PIGC+
Sbjct  162   LYTFDIGQNDLSVGFRRLSSDQLLAAIPDIVNQLAKAVQNIYQQGGRSFWIHNTSPIGCM  221

Query  706   PISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlkarvlqlraqlqqavFTVVDMYSAK  882
             P++  YN +   + VD+ GC  T N +A EFNRQLK RV++L+++L +A  T VD+Y+AK
Sbjct  222   PVNFFYNLNPPPSYVDQYGCVKTQNDMAVEFNRQLKDRVIKLKSELPEAAITYVDVYAAK  281

Query  883   YAVVSNAGSH------------------------------------------------GF  918
               ++ NA +                                                 GF
Sbjct  282   IRMIGNAKAEDVYGYLVRGIRRDREWLGEGFKILHMTTILIFPKLEGLEERIHPKHKKGF  341

Query  919   QDPFTFCC----------CGKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARS  1068
              DP   CC          CG    +    V+G  C +P+  ISWDGVHY++AAN  +A  
Sbjct  342   SDPLKVCCGYHVKYDHVWCGTKALVNGSAVFGASCENPATSISWDGVHYTQAANQWVANH  401

Query  1069  IMYGGSFSDPPRPVAEAC  1122
             I+  GS SDPP P+ +AC
Sbjct  402   IL-NGSLSDPPTPITQAC  418



>emb|CDP13237.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   310 bits (795),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 234/357 (66%), Gaps = 27/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PP+GE+FF  P+GRYCDGRL+IDFIAE+LGLPY
Sbjct  32    CEFPAIFNFGDSNSDTGGLSAAFGQAGPPHGESFFHGPAGRYCDGRLIIDFIAESLGLPY  91

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LD++G++F HGANFATAGS+I P        G+SP  L++Q  QF  F +R+ ++ 
Sbjct  92    LSAFLDALGSNFTHGANFATAGSTIRPQNTTLQQSGFSPISLNVQFYQFNDFHRRS-QII  150

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
                 G   V+  ++P+ E+FS++LYTFDIGQNDL+ G+  +  +  +++ +P+++D+F  
Sbjct  151   RSQGG---VFGGLMPKAEDFSRALYTFDIGQNDLTSGYFLNMTTDEVRAYVPELLDQFKT  207

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y +G R+FWIHNTGP+GCLP  +         VDK GCA   N VAQ FN +LK 
Sbjct  208   IIKGIYDQGGRSFWIHNTGPVGCLPYVMDRLLITAAQVDKTGCATPFNDVAQYFNWKLKE  267

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG-K  951
              V QLR +L +A  T VD+Y+ KY ++S+A  HGF+ P   CC             CG K
Sbjct  268   AVFQLRKELPKAALTYVDIYTLKYDLISHAKKHGFEHPLRACCGHGGKYNFNAHFGCGSK  327

Query  952   NKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
              K    E +    C DPS  I+WDGVHY++AAN  +   I+  GS+SDP  P+  AC
Sbjct  328   IKVKGKEIMIAGSCKDPSVMINWDGVHYTQAANKWVFDRIV-DGSYSDPVIPLTMAC  383



>ref|XP_009779717.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g26430-like 
[Nicotiana sylvestris]
Length=380

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 233/359 (65%), Gaps = 27/359 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             + C FPA++NFGDSNSDTGG SAA G+   P+GETFF  P+GR+ DGRL+IDFIAE L L
Sbjct  22    KSCHFPAIFNFGDSNSDTGGLSAAFGQAPYPHGETFFHAPAGRFSDGRLLIDFIAEGLDL  81

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+A+LDSIG++F HGANFATAGS+I P        GYSP  LD+Q  QF  F  R+  
Sbjct  82    PYLSAFLDSIGSNFSHGANFATAGSTIRPQNTTMAQSGYSPISLDVQGVQFSDFHTRSQT  141

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKF  627
             +  +L G   ++  +LP+ E+FS++LYTF+IGQNDL+ G++ +  ++ +++ +P ++ + 
Sbjct  142   I--RLKG--NIFGQLLPKEEDFSQALYTFNIGQNDLTAGYRLNMSTEQVKAYVPDLLSQL  197

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
             S  + ++Y +G R+FWIHNTGP+GCLP  +         +DK GCA   N VA  FN QL
Sbjct  198   SNVIKKIYAQGGRSFWIHNTGPVGCLPYDMDRFLITAAQIDKYGCADPFNEVANYFNLQL  257

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG  948
             K  V++LR +L  A  T +D+YS KY+++ +A   GF+DPF  CC             CG
Sbjct  258   KKTVVKLRKELPLAAITYIDVYSVKYSLIGHAEKLGFEDPFLACCGHGGKYNYNRFIKCG  317

Query  949   KNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               K +   E V    C DPS  +SWDG H++EAAN  +   I+  GSFSDPP P++ AC
Sbjct  318   SKKVLNGKEIVIAPSCKDPSVRVSWDGTHFTEAANKWIFDQIV-NGSFSDPPVPLSLAC  375



>ref|XP_002530043.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
 gb|EEF32343.1| Alpha-L-fucosidase 2 precursor, putative [Ricinus communis]
Length=388

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 229/358 (64%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PP+GE++F  P+GRYCDGRL+IDFIAE+L LPY
Sbjct  31    CHFPAIFNFGDSNSDTGGLSAAFGQAPPPHGESYFHHPAGRYCDGRLIIDFIAESLRLPY  90

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDSIG++FRHGANFATAGS++ P        GYSP  LD+Q ++F  F  R+  + 
Sbjct  91    LSAYLDSIGSNFRHGANFATAGSTVRPQNTTLRQSGYSPISLDVQYNEFHDFHTRSQVVR  150

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKFSQ  633
             N+      +YK +LP+ E+FS++LYTFDIGQNDL+ G F   + S+ +  +P+++ +F  
Sbjct  151   NR----GGIYKKLLPKAEDFSRALYTFDIGQNDLTAGYFLNMSTSEVMAYVPEVLSQFKT  206

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              +  +Y EG RNFWIHNTGP GCL   +         +D  GC    N+VAQ +N  LK 
Sbjct  207   LVSYIYYEGGRNFWIHNTGPFGCLAYVLDRIPLPSGEIDGAGCGIPFNKVAQYYNHGLKN  266

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--CGK---NKKM-----  963
              V QLR +   A  T VD+YS KY++ S    HGF +    CC   GK   NKK+     
Sbjct  267   VVAQLRKEFPDAAITYVDIYSLKYSLYSRTRKHGFNESLRACCGHGGKYNYNKKIGCGGK  326

Query  964   ----ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                   + + G  C DPS  I+WDGVHY++AAN  +   I+  GS+SDPP P+  AC+
Sbjct  327   ITVRGKQVLVGKSCDDPSVWINWDGVHYTQAANKWIFEQIV-DGSYSDPPIPLKMACQ  383



>ref|XP_008365370.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X1 [Malus 
domestica]
Length=391

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 174/362 (48%), Positives = 239/362 (66%), Gaps = 25/362 (7%)
 Frame = +1

Query  97    GGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIA  276
             G +   RC FPA+YNFGDSNSDTGG SA+   +  P GETFF +P+GR CDGRL+IDFIA
Sbjct  29    GVIDTSRCDFPAIYNFGDSNSDTGGNSASFYPMVSPCGETFFHRPAGRGCDGRLIIDFIA  88

Query  277   ENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFK  435
             ++L LPYL+ YLDS+ ++FRHGANFA+ GS+I P        G SPF+L+IQI+Q+ QFK
Sbjct  89    KHLXLPYLSPYLDSLESNFRHGANFASGGSTIRPYKEAMFENGVSPFYLEIQIAQYQQFK  148

Query  436   KRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPK  612
              RT  L  +    +    D  P  ++FSK+LYTFD GQNDL+ GF+    S+  ++ I  
Sbjct  149   SRTTTLSKQAKKQS----DRFPIIDDFSKALYTFDTGQNDLAAGFRTKFSSEQFEAEITD  204

Query  613   IMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAY-NKDNHNNVDKNGCAATHNRVAQ  789
             ++++ + A+  LY +GAR FWIHNTGPIGCL ++++Y +  +    D  GC    N +A+
Sbjct  205   MINQHANAVRNLYEQGARTFWIHNTGPIGCLGVTLSYLHXPSPGFXDSQGCDKFQNDMAR  264

Query  790   EFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------  942
             +FNRQL+ +V+QLR +L  +  T VD+++AKY ++SNA  HGF D  + CC         
Sbjct  265   KFNRQLEQKVIQLRKELPLSAITYVDIFAAKYELLSNAKKHGFLDKASICCGYHDENNHV  324

Query  943   -CGKNKKMANET-VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAE  1116
              CG    + N T VY   C DPS +ISWDGVHY+EAAN  +A  I++ GSF+DPP  +  
Sbjct  325   WCGNKGTITNGTQVYAGSCKDPSLYISWDGVHYTEAANCWIADRIVH-GSFTDPPVSIKS  383

Query  1117  AC  1122
             +C
Sbjct  384   SC  385



>gb|KCW86642.1| hypothetical protein EUGRSUZ_B03271 [Eucalyptus grandis]
Length=421

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 171/362 (47%), Positives = 235/362 (65%), Gaps = 27/362 (7%)
 Frame = +1

Query  103   LPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAEN  282
             L    C FPA++NFGDSNSDTGG SA  G+   P+GET+F +P+GRY DGRLV+DFIA++
Sbjct  59    LAHASCDFPAIFNFGDSNSDTGGLSAVYGQAPSPHGETYFRQPAGRYSDGRLVVDFIAQS  118

Query  283   LGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKR  441
              GLPYL+AYLD++G++F HGANFAT+GS+I P        GYSP  LD+Q ++F +F++R
Sbjct  119   FGLPYLSAYLDAVGSNFSHGANFATSGSTIRPQNTTFRQTGYSPISLDVQFNEFYEFRRR  178

Query  442   TIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIM  618
             + ++     G   VY+ +LP  E FS++LYTFDIGQNDL+ G+  +  +  +++ IP ++
Sbjct  179   S-QVARSRGG---VYEKLLPTEEVFSRALYTFDIGQNDLTAGYFLNMSTNEVKAYIPDLL  234

Query  619   DKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFN  798
              +F   +  +YGEG R FWIHNTGP GCLP  +       + VD+ GCAA  N VA+ FN
Sbjct  235   GQFKNVVSHIYGEGGRYFWIHNTGPFGCLPYVMERIPILVSQVDRAGCAAPFNEVARHFN  294

Query  799   rqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC------------  942
             R LK  V QLR +L  A  T VD+Y+ KYA++S    +GF+ P   CC            
Sbjct  295   RGLKEVVTQLRKELPLAAITYVDVYAVKYALISKPVKYGFKQPLRACCGHGGKYNFDMHM  354

Query  943   -CGKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAE  1116
              CG    +   E + G+ C DPS +++WDG HY+EAAN  +   I+ GGSFSDPP P+ +
Sbjct  355   GCGSKITVGGKEVLVGNSCKDPSVYVNWDGYHYTEAANKQIFDHIV-GGSFSDPPVPLNK  413

Query  1117  AC  1122
             AC
Sbjct  414   AC  415



>emb|CDY60176.1| BnaC02g48210D [Brassica napus]
Length=371

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 221/350 (63%), Gaps = 28/350 (8%)
 Frame = +1

Query  109   QRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLG  288
             ++ C FPAVYNFGDSNSDTG  SAA+GEV PPNG  FFG+ +GR+ DGRL+IDFI ENL 
Sbjct  30    RKSCNFPAVYNFGDSNSDTGAISAAIGEVPPPNGVAFFGRSAGRHSDGRLIIDFITENLT  89

Query  289   LPYLNAYLDSIGTSFRHGANFATAGSSILP--GGYSPFFLDIQISQFIQFKKRTIELYNK  462
             LPYL  YLDS+G ++RHGANFAT GS I P    +S F +  Q+SQFI FK RT+ LYN+
Sbjct  90    LPYLTPYLDSVGANYRHGANFATGGSCIRPTVACFSQFHIGTQVSQFIHFKTRTLSLYNQ  149

Query  463   LAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQALY  642
                TN           +FSK+LYTFDIGQNDL+ GFQ     Q   +IP I++ F+ A+ 
Sbjct  150   ---TN-----------DFSKALYTFDIGQNDLAIGFQNMTEEQLKATIPAIIESFTTAIK  195

Query  643   QLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlkarvl  822
              LY EGAR F IHNTGP GCLP  +          D+ GC    N VA EFN+QLK ++ 
Sbjct  196   LLYKEGARFFSIHNTGPTGCLPYLLKSFPATPR--DQYGCLKPLNNVAIEFNKQLKQKIS  253

Query  823   qlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC---------CGKNKKMANET  975
             +L  +L  ++ T VD+YSAK   ++ A + GF DPF +CC         CGK        
Sbjct  254   ELNKELPYSLLTYVDVYSAKSHSITKAKNLGFVDPFDYCCVGAVGRGMGCGKTIFPNGTE  313

Query  976   VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             +Y   C +    ISWDG+HYSE AN+++A  I+  GS S+PP P  +AC+
Sbjct  314   LYSSSCQNRKNFISWDGIHYSETANMLVANRIL-DGSISNPPLPTQKACK  362



>ref|XP_008365371.1| PREDICTED: GDSL esterase/lipase At5g14450-like isoform X2 [Malus 
domestica]
Length=391

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/363 (48%), Positives = 240/363 (66%), Gaps = 27/363 (7%)
 Frame = +1

Query  97    GGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIA  276
             G +   RC FPA+YNFGDSNSDTGG SA+   +  P GETFF +P+GR CDGRL+IDFIA
Sbjct  29    GVIDTSRCDFPAIYNFGDSNSDTGGNSASFYPMVSPCGETFFHRPAGRGCDGRLIIDFIA  88

Query  277   ENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFK  435
             ++L LPYL+ YLDS+ ++FRHGANFA+ GS+I P        G SPF+L+IQI+Q+ QFK
Sbjct  89    KHLXLPYLSPYLDSLESNFRHGANFASGGSTIRPYKEAMFENGVSPFYLEIQIAQYQQFK  148

Query  436   KRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPK  612
              RT  L  +    +    D  P  ++FSK+LYTFD GQNDL+ GF+    S+  ++ I  
Sbjct  149   SRTTTLSKQAKKQS----DRFPIIDDFSKALYTFDTGQNDLAAGFRTKFSSEQFEAEITD  204

Query  613   IMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN--VDKNGCAATHNRVA  786
             ++++ + A+  LY +GAR FWIHNTGPIGCL +++ +N  N +   VD  GC    N +A
Sbjct  205   MINQHANAVRNLYEQGARTFWIHNTGPIGCLAVTL-HNIHNPSPGLVDGQGCDKFQNDMA  263

Query  787   QEFNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------  942
             ++FNRQL+ +V+QLR +L  +  T VD+++AKY ++ NA  HGF D    CC        
Sbjct  264   RQFNRQLEQKVIQLRKELPLSAITYVDVFAAKYELIGNATKHGFLDKANICCGYHEHDDH  323

Query  943   --CGKNKKMANET-VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVA  1113
               CG    ++N T +Y   C DPS +ISWDGVHY+EAAN  +A  I+ GGSFSD P P+ 
Sbjct  324   VWCGNKGIISNGTQIYAGSCEDPSLYISWDGVHYTEAANRWIADQIV-GGSFSDVPVPIT  382

Query  1114  EAC  1122
             ++C
Sbjct  383   DSC  385



>ref|XP_006355000.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Solanum tuberosum]
Length=391

 Score =   309 bits (791),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 228/355 (64%), Gaps = 23/355 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA+YNFGDSNSDTGG +AA   +  P GE++F +P+GR  DGRL+IDFIAE LG+P 
Sbjct  36    CDFPAIYNFGDSNSDTGGIAAAFYPMAAPCGESYFDRPAGRGSDGRLIIDFIAEQLGVPQ  95

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+ YLD++GTS+RHGANFAT G++I          G SPF LD+Q+  + QFK+RT   Y
Sbjct  96    LSPYLDTLGTSYRHGANFATGGATIRRINESWFTNGVSPFPLDVQVEHYTQFKERTTYFY  155

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQ-YSNVSQTLQSIPKIMDKFSQ  633
             N+  G  +  K  L  P EFSK+LYT DIGQND+S  F+   N+ Q    IP I+++F+ 
Sbjct  156   NQ--GKEESDKSRLAIPVEFSKALYTIDIGQNDISAAFRMLPNMEQVRAIIPDIINQFAA  213

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlk  810
              L  LY +GARN WIHNTGPIGCLP+     KD     +D++GC    N +A  FN+ L 
Sbjct  214   QLRDLYKKGARNLWIHNTGPIGCLPVVTVKIKDPAAGYLDEHGCVKDMNDIAIAFNKHLF  273

Query  811   arvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKK  960
               + +LR +LQQA  T VD+Y AKY ++SNA + GF++    CC          CG  K+
Sbjct  274   DMLTKLRIELQQAAITYVDLYKAKYELISNAKNQGFEEASKICCGYHENGEDVWCGNKKR  333

Query  961   MANET-VYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             + N T +Y   C++PS  ISWDGVHY++AAN  +A  I+   S S+P  P+ +AC
Sbjct  334   LNNGTEIYAGSCNNPSTVISWDGVHYTQAANHWIANYIL-NASISNPTLPITKAC  387



>ref|XP_010556339.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g26430 
[Tarenaya hassleriana]
Length=394

 Score =   309 bits (791),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 167/361 (46%), Positives = 230/361 (64%), Gaps = 31/361 (9%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+  PPNG TFF  P+GR+ DGRLV+DFI+E LGLPY
Sbjct  33    CSFPAIFNFGDSNSDTGGLSAAFGQAPPPNGRTFFHSPAGRFSDGRLVVDFISEELGLPY  92

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LDSIG++F HGANFATAGS+I P        G SP  LD+Q+ QF  F  R+  + 
Sbjct  93    LSAFLDSIGSNFSHGANFATAGSTIRPPNSTISQSGASPISLDVQLVQFSDFLARSQRIR  152

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
             N L G   V++ +LP+ + F++ LYTFDIGQNDL+ G++ +   + +++ +P ++ +FS 
Sbjct  153   N-LGG---VFERLLPKEDYFARGLYTFDIGQNDLTAGYKLNMTKEQVKAYVPAVLSQFSD  208

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+ +++ +G R FWIHNTGP+GCLP S+         +D  GCA  +N VA+ FN +L  
Sbjct  209   AIRKVHAKGGRTFWIHNTGPVGCLPYSLVRFPVPPAQIDNYGCAIPYNEVARYFNSKLNE  268

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG--  948
              V+ LR +L +A  T VD+YS KY +++ A + GF+     CC             CG  
Sbjct  269   TVVGLRKELSEAAITYVDVYSVKYTLITQAKTLGFRKALVACCGHGGKYNYNKLIKCGAK  328

Query  949   ---KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEA  1119
                K K    E V    C+D    ++WDGVH++EAAN  +   I  GG+FSDPPRP+  A
Sbjct  329   IKVKGKXXXKERVLAKSCNDVPFRVNWDGVHFTEAANRWIFHQIN-GGAFSDPPRPLKSA  387

Query  1120  C  1122
             C
Sbjct  388   C  388



>ref|XP_010425337.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Camelina sativa]
Length=382

 Score =   308 bits (790),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 169/363 (47%), Positives = 233/363 (64%), Gaps = 27/363 (7%)
 Frame = +1

Query  100   GLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAE  279
             G+    C FPA++NFGDSNSDTGG SAA G+   PNG+TFF  PSGR+ DGRL+IDFIAE
Sbjct  22    GVCSPSCSFPAIFNFGDSNSDTGGLSAAFGQAPFPNGQTFFHSPSGRFSDGRLIIDFIAE  81

Query  280   NLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKK  438
              LGLPYLNA+LDS+G++F HGANFATAGS++ P       GG SP  LD+Q+ QF  F  
Sbjct  82    ELGLPYLNAFLDSMGSNFSHGANFATAGSTVRPPNTTISQGGASPISLDVQLVQFSDFLT  141

Query  439   RTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKI  615
             R+  + N+      V+K +LPR E FS++LYTFD+GQNDL+ G + +  ++ +++ IP++
Sbjct  142   RSQLIRNQ----GGVFKQLLPRKEYFSEALYTFDMGQNDLTAGLKLNMTTEQIKAYIPEV  197

Query  616   MDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEF  795
             +D+FS A+ ++Y +G R FWIHNT P+GCLP  +       + +D +GCA   N +A+ +
Sbjct  198   VDQFSNAIRKVYSKGGRRFWIHNTAPLGCLPYVLDRFPVPASEMDIHGCAIARNEIARFY  257

Query  796   NrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-----------  942
             N +LK RV+ LR +  +A FT VD+YS K  +++ A   GF+ P   CC           
Sbjct  258   NSELKRRVIGLRKEFSKATFTYVDVYSIKLTLITQAKKLGFRYPLIACCGYGGKYNFSNN  317

Query  943   --CG-KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVA  1113
               CG K      E V    C+D S  +SWDG+H++E AN  + + I   G+FSDPP PV 
Sbjct  318   IRCGAKVMVKGKEVVLAKSCNDVSFRVSWDGIHFTETANKWIFQQIN-SGAFSDPPLPVK  376

Query  1114  EAC  1122
              AC
Sbjct  377   FAC  379



>ref|XP_009359342.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g26430-like 
[Pyrus x bretschneideri]
Length=467

 Score =   311 bits (796),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 235/358 (66%), Gaps = 27/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+   PNGET+F  PSGR+ DGRLVIDFIAE LGLP+
Sbjct  113   CSFPAIFNFGDSNSDTGGLSAAFGQAPYPNGETYFHVPSGRFSDGRLVIDFIAEGLGLPH  172

Query  298   LNAYLDSIGTSFRHGANFATAGSSIL-------PGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LDSIG++F HGANFATAGS+++         G SP  LD+Q+ QF  F  R+ ++Y
Sbjct  173   LSAFLDSIGSNFSHGANFATAGSTVIFPNTTISQSGASPISLDVQLLQFSDFHTRS-QIY  231

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
                    ++++  LP+ E FS++LYTFDI QND++ G++ +  ++ +++ +P ++ + S 
Sbjct  232   RT---KGELFEKSLPKEEYFSQALYTFDIAQNDITAGYKLNWTAEQVKAYLPYVLTQLSN  288

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+  +YG+G R+FWIHNTGP+GCLP  +     +   ++K GCA   N VAQ FN++LK 
Sbjct  289   AIKSVYGQGGRSFWIHNTGPLGCLPYVLVRFVTDPAQINKYGCADQINEVAQFFNQRLKE  348

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V+QL+  L  A  T VD+YS KY +++ A  +GF++P   CC             CG  
Sbjct  349   AVVQLKKDLPLAAITYVDVYSVKYTLITQAKKYGFENPLIACCGHGGKYNFDRYAKCGAK  408

Query  955   KKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
             K +   ET+    C DP+  I+WDG H++EAAN  + + I+  GSFSDPP P+  ACR
Sbjct  409   KIINGTETLIAKSCDDPTVRINWDGTHFTEAANKCIFQQIV-NGSFSDPPNPLKTACR  465



>ref|XP_002875320.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51579.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=379

 Score =   308 bits (788),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 230/357 (64%), Gaps = 27/357 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SAA G+   PNG+TFF  PSGR+ DGRL+IDFIAE LGLPY
Sbjct  26    CNFPAIFNFGDSNSDTGGLSAAFGQAPYPNGQTFFHSPSGRFADGRLIIDFIAEELGLPY  85

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             LNA+LDSIG++F HGANFATAGS+I P       GG SP  LD+Q+ QF  F  R+  + 
Sbjct  86    LNAFLDSIGSNFSHGANFATAGSTIRPPNSTISQGGSSPISLDVQLVQFSDFITRSQLIR  145

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQS-IPKIMDKFSQ  633
             N+      V+K +LP+ E FS++LYTFDIGQNDL+ G + +  +  +++ IP ++D+FS 
Sbjct  146   NQ----GGVFKKLLPKKEYFSQALYTFDIGQNDLTSGLKLNMTTDQIKAYIPDVLDQFSN  201

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+ ++Y +G R FWIHNT P+GCLP  +       + +D +GCA   N +A+ +N +LK 
Sbjct  202   AIRKVYSKGGRRFWIHNTAPLGCLPYVLDRFPVPASQIDNHGCAIPRNEIARYYNSELKR  261

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
             RV+ LR +L  A FT VD+YS K  ++++    GF+ P   CC             CG  
Sbjct  262   RVIGLRKELSDAAFTYVDIYSIKLTLITHPKKLGFRYPLVACCGHGGKYNYNKLIKCGAK  321

Query  955   KKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
               +   E V    C+D S  +SWDG+H++E AN  + + I  GG+FSDPP P+  AC
Sbjct  322   VMVEGKEIVLAKSCNDVSFRVSWDGIHFTETANSWIFQKIN-GGAFSDPPIPLKFAC  377



>ref|XP_004239137.1| PREDICTED: GDSL esterase/lipase At3g26430-like isoform X2 [Solanum 
lycopersicum]
Length=377

 Score =   308 bits (788),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 229/358 (64%), Gaps = 29/358 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C F A++NFGDSNSDTGG SAA G+   PNGETFF  P+GR+ DGRL+IDFIAE L LPY
Sbjct  21    CKFAAIFNFGDSNSDTGGLSAAFGQAPYPNGETFFHAPAGRFSDGRLLIDFIAEGLDLPY  80

Query  298   LNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIELY  456
             L+A+LDSIG++F HGANFATAGS+I P        GYSP  LD+Q  QF  F  R+  + 
Sbjct  81    LSAFLDSIGSNFSHGANFATAGSTIRPQNTTMAQSGYSPISLDVQGVQFSDFHTRSQIIR  140

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYS-NVSQTLQSIPKIMDKFSQ  633
              K      V+  +LP  E+FS++LYTFDIGQNDL+ G++ + +  Q    +P ++ + S 
Sbjct  141   QK----GNVFGQLLPNKEDFSQALYTFDIGQNDLTAGYKLNMSTDQVKAYVPDLLSQLSN  196

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
              + ++Y +G R+FWIHNTGP+GCLP  +         VDK GCA   N V++ FN  LK 
Sbjct  197   VIKKVYAKGGRSFWIHNTGPVGCLPYVIDRFMITAAQVDKYGCANPFNEVSKYFNLLLKK  256

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CGKN  954
              V+QLR +L  A FT VD+YS KY+++ +A   GF++PF  CC             CG +
Sbjct  257   TVVQLRKELPLAAFTYVDVYSVKYSLIGHAKKLGFENPFLACCGHGGKYNYNRFIKCG-S  315

Query  955   KKMAN--ETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEAC  1122
             KK+ N  E V    C DPS  ++WDG H++EAAN  +   I+  GSFSDPP P++ AC
Sbjct  316   KKVVNGKEIVIASSCKDPSVRVNWDGTHFTEAANKWIFDQIV-NGSFSDPPIPLSLAC  372



>ref|XP_008446147.1| PREDICTED: GDSL esterase/lipase At3g26430 [Cucumis melo]
Length=386

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 169/364 (46%), Positives = 235/364 (65%), Gaps = 28/364 (8%)
 Frame = +1

Query  103   LPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAEN  282
             L +  C FPAV+NFGDSNSDTGG SA  G+  PPNG ++F  P+GRY DGRL++DFIAE+
Sbjct  24    LAKHPCNFPAVFNFGDSNSDTGGLSAVFGQAPPPNGRSYFPGPAGRYSDGRLIVDFIAES  83

Query  283   LGLPYLNAYLDSIGTSFRHGANFATAGSSIL-------PGGYSPFFLDIQISQFIQFKKR  441
             LGLPYL+AYLD++G +F HGANFATAGS+I          G+SP  L++Q ++F  F++R
Sbjct  84    LGLPYLSAYLDALGANFSHGANFATAGSTIRLQNRTLQQSGFSPISLNVQYNEFYDFRRR  143

Query  442   TIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVS--QTLQSIPKI  615
             +  L N L G   ++K +LP+ E FS++LYTFDIGQNDL+ G+ ++N+S  Q    IP +
Sbjct  144   SQTLRNGLGG---IFKQLLPKEESFSRALYTFDIGQNDLTSGY-FANMSLHQVKLYIPDV  199

Query  616   MDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEF  795
             + +FS+ +  ++ +G R FWIHNTGP+GCLP  +       ++ D+ GCA   N +AQ F
Sbjct  200   LQQFSEIVKWVHSQGGRFFWIHNTGPVGCLPYVLDREPVPASDYDQYGCATPFNDLAQYF  259

Query  796   NrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-----------  942
             NR LK  V++LR  L  +  T VD+YS KYA+VS    +GF+ P   CC           
Sbjct  260   NRGLKQAVMELRKALPDSAITYVDVYSLKYALVSQHKKYGFEYPLRTCCGHGGKYNFNVK  319

Query  943   --CGKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVA  1113
               CG  K +   E + G  C +P  +++WDGVHY++AAN  +   I   GS+SDPP P+ 
Sbjct  320   LGCGGKKTINGKEVLIGKSCKNPEVYVNWDGVHYTQAANKWIFNQIK-DGSYSDPPIPLN  378

Query  1114  EACR  1125
             +AC 
Sbjct  379   KACH  382



>gb|KHG05491.1| hypothetical protein F383_30482 [Gossypium arboreum]
Length=376

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 174/362 (48%), Positives = 226/362 (62%), Gaps = 37/362 (10%)
 Frame = +1

Query  103   LPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAEN  282
             L +  C FPA++NFGDSNSDTGG SAA G+  PPNG ++FG P+GRYCDGRLVIDF+AE+
Sbjct  27    LAKGPCQFPAIFNFGDSNSDTGGLSAAFGQAPPPNGMSYFGHPAGRYCDGRLVIDFLAES  86

Query  283   LGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKR  441
             LGL YL+A+LDS+GT+F HGANFATAGS+I P        G+SP  L++Q  +F  F  R
Sbjct  87    LGLAYLSAFLDSLGTNFTHGANFATAGSTIRPQNTTLHQSGFSPISLNVQFYEFHDFHVR  146

Query  442   TIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIM  618
             + ++  K  G   VY+ +LP+ E+FS +LYTFDIGQNDL+ G F   +V +    +P   
Sbjct  147   S-QIVRKRGG---VYETILPKEEDFSSALYTFDIGQNDLTSGYFLNMSVDEVKAYVPD--  200

Query  619   DKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFN  798
                      +Y  G R FW+HNTGP+GCLP  +         +D+ GCA+  N VAQ FN
Sbjct  201   --------DIYDVGGRYFWLHNTGPVGCLPYVMERIPVLAGQIDRYGCASPFNEVAQFFN  252

Query  799   rqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC------------  942
             + LK  V QLR  L  A  T VD+YS KY+++S   +HGF  P   CC            
Sbjct  253   QGLKKTVQQLRKDLPHAAITYVDVYSVKYSLISQGRNHGFNQPLRTCCGHGGKYNYNKNL  312

Query  943   -C-GKNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAE  1116
              C GK  K   + +   PC DPS H++WDGVH++EAAN  +   I+  GSFSDPPRP+  
Sbjct  313   GCGGKVHKQGKDVLVAAPCQDPSTHVNWDGVHFTEAANRYIFERIV-DGSFSDPPRPLNM  371

Query  1117  AC  1122
             AC
Sbjct  372   AC  373



>ref|XP_010044557.1| PREDICTED: GDSL esterase/lipase At3g26430-like [Eucalyptus grandis]
 gb|KCW86645.1| hypothetical protein EUGRSUZ_B03273 [Eucalyptus grandis]
Length=383

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 170/364 (47%), Positives = 232/364 (64%), Gaps = 27/364 (7%)
 Frame = +1

Query  97    GGLPQRRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIA  276
              G+ Q  C FPA++NFGDSNSDTGG SA  G+   P GET+F  P+GRY DGR+V+DFIA
Sbjct  19    AGMAQASCDFPAMFNFGDSNSDTGGLSAVFGQAPWPEGETYFHSPAGRYTDGRVVVDFIA  78

Query  277   ENLGLPYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFK  435
             E+LGLPYL+AYL+S+G++F HGANFATAGS+I P        G+SP  LD+Q ++F +F 
Sbjct  79    ESLGLPYLSAYLNSVGSNFSHGANFATAGSTIRPQNTTLQQSGFSPISLDVQYNEFYEFH  138

Query  436   KRTIELYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPK  612
              RT     K     +V++ +LP+ E FSK+LYTFDIGQNDL+ G F   + S+    +P 
Sbjct  139   NRTPVARQK----GEVFEKLLPKEEVFSKALYTFDIGQNDLTAGYFMNMSTSEVRAYLPD  194

Query  613   IMDKFSQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQE  792
             ++ +F   +  +Y +G R FWIHNTGP+GCLP  +       + VD  GCA+  N VAQ+
Sbjct  195   VLGQFKNIVSYVYSQGGRFFWIHNTGPVGCLPYVMERVPIMASQVDHVGCASPFNEVAQD  254

Query  793   FNrqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------  942
             FNR LK  V+QLR +L QA  T VD+YS KY+++S+   +GF+ P   CC          
Sbjct  255   FNRGLKEVVMQLRQELPQAAITYVDVYSVKYSLISHPEKYGFKHPLRTCCGHGGRYNYDI  314

Query  943   ---CGKNKKM-ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPV  1110
                CG    +   E +    C +P+ H++WDGVH++EAAN  + + I   G FSDPP P+
Sbjct  315   HMGCGATAMVDGEEVMVAKSCDNPALHVNWDGVHFTEAANRQIFKHIR-SGLFSDPPVPL  373

Query  1111  AEAC  1122
             + AC
Sbjct  374   SSAC  377



>ref|NP_001060128.1| Os07g0586100 [Oryza sativa Japonica Group]
 dbj|BAC80099.1| putative early nodulin 8 precursor [Oryza sativa Japonica Group]
 dbj|BAF22042.1| Os07g0586100 [Oryza sativa Japonica Group]
 dbj|BAG92478.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67491.1| hypothetical protein OsJ_24919 [Oryza sativa Japonica Group]
Length=405

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 226/359 (63%), Gaps = 27/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SA +  V PP G T+FG P+GR+ DGRL IDF+A++LG+ Y
Sbjct  45    CDFPAIFNFGDSNSDTGGLSALIAVVPPPFGRTYFGMPAGRFSDGRLTIDFMAQSLGIRY  104

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPG-------GYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G++F  GANFATA +SI P        G SP  LD+Q SQF QF  R+  +Y
Sbjct  105   LSAYLDSVGSNFSQGANFATAAASIRPANGSIFVSGISPISLDVQTSQFEQFINRSQFVY  164

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKFSQ  633
             + + G   +Y+++LP+ E FS++LYTFDIGQNDL+ G F   +  Q    +P +M++FS 
Sbjct  165   SNIGG---IYREILPKAEYFSRALYTFDIGQNDLTMGYFDNMSTEQVEAYVPDLMERFSA  221

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+ ++Y  G R FW+HNT P+GCL  +V          D  GC+  +N  A+ FN +L+ 
Sbjct  222   AIQKVYSLGGRYFWVHNTAPLGCLTYAVVLLPKLAAPRDDAGCSVAYNAAARFFNARLRE  281

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CGK  951
              V +LRA L  A  T VD+YSAKY ++S A   GF DP   CC              CG 
Sbjct  282   TVDRLRAALPDAALTYVDVYSAKYRLISQAKQLGFGDPLLVCCGYGGGEYNFDRDIRCGG  341

Query  952   NKKMANETVY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               ++   +V  G  C DPSR +SWDGVH++EAAN  +   I+ GG  SDPP P+ +ACR
Sbjct  342   KVEVNGTSVLAGKSCDDPSRSVSWDGVHFTEAANRFVFELIV-GGKLSDPPVPLRQACR  399



>emb|CDP16617.1| unnamed protein product [Coffea canephora]
Length=388

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 232/354 (66%), Gaps = 21/354 (6%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C +PA+YNFGDSNSDTGG +AA   +  P GET+F +P+GR  DGRL+IDFIA++LGLP+
Sbjct  35    CDYPAIYNFGDSNSDTGGIAAAFFPMAAPCGETYFHRPAGRASDGRLIIDFIADHLGLPF  94

Query  298   LNAYLDSIGTSFRHGANFATAGSSI-------LPGGYSPFFLDIQISQFIQFKKRTIELY  456
             L+ YLDS+G++F+HGANFAT G++I          G SPF LDIQ+  + QFK+R+   Y
Sbjct  95    LSPYLDSVGSNFQHGANFATGGATIRRQNESWFETGVSPFPLDIQVEHYTQFKERSAYFY  154

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQA  636
             N+    +   K  LP+PE+FSK+LYTFD GQNDL+  F+  +  +   ++P I+++F++ 
Sbjct  155   NQDKVASD--KSRLPKPEDFSKALYTFDAGQNDLAAAFRKMSWEELRAALPDIVNQFAKQ  212

Query  637   LYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNN-VDKNGCAATHNRVAQEFNrqlka  813
             +  +Y  GAR  WIHNTGPIGCLP S    K+     +D++GC  + N  A EFN QLK 
Sbjct  213   IRGMYERGARAVWIHNTGPIGCLPASTVKVKNPPPGYLDEHGCIKSQNDAAMEFNTQLKE  272

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CGKNKKM  963
              V+QLRA+L  A  T VD+YSAKY ++SNA  HGF++    CC          CG    +
Sbjct  273   TVVQLRAELSGAAITYVDVYSAKYGLISNAKKHGFEEASKICCGIHGLENDVWCGNKGIV  332

Query  964   ANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
                 VYG  C++P   ISWDGVHY+EAAN  +A  ++  GS SDPP P+A AC 
Sbjct  333   NGSEVYGGSCAEPGGIISWDGVHYTEAANKWIANLVL-NGSLSDPPLPIARACH  385



>gb|EEC82351.1| hypothetical protein OsI_26660 [Oryza sativa Indica Group]
Length=405

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 226/359 (63%), Gaps = 27/359 (8%)
 Frame = +1

Query  118   CWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGLPY  297
             C FPA++NFGDSNSDTGG SA +  V PP G T+FG P+GR+ DGRL IDF+A++LG+ Y
Sbjct  45    CDFPAIFNFGDSNSDTGGLSALIAVVPPPFGRTYFGMPAGRFSDGRLTIDFMAQSLGIRY  104

Query  298   LNAYLDSIGTSFRHGANFATAGSSILPG-------GYSPFFLDIQISQFIQFKKRTIELY  456
             L+AYLDS+G++F  GANFATA +SI P        G SP  LD+Q SQF QF  R+  +Y
Sbjct  105   LSAYLDSVGSNFSQGANFATAAASIRPANGSIFVSGISPISLDVQTSQFEQFINRSQFVY  164

Query  457   NKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKFSQ  633
             + + G   +Y+++LP+ E FS++LYTFDIGQNDL+ G F   +  Q    +P +M++FS 
Sbjct  165   SNIGG---IYREILPKAEYFSRALYTFDIGQNDLTMGYFDNMSTEQVEAYVPDLMERFSA  221

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrqlka  813
             A+ ++Y  G R FW+HNT P+GCL  +V          D  GC+  +N  A+ FN +L+ 
Sbjct  222   AIQKVYSLGGRYFWVHNTAPLGCLTYAVVLLPKLAAPRDDAGCSVAYNAAARFFNARLRE  281

Query  814   rvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC--------------CGK  951
              V +LRA L  A  T VD+YSAKY ++S A   GF DP   CC              CG 
Sbjct  282   TVDRLRAALPDAALTYVDVYSAKYRLISQAKQLGFGDPLLVCCGYGGGEYNFDRDIRCGG  341

Query  952   NKKMANETVY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
               ++   +V  G  C DPSR +SWDGVH++EAAN  +   I+ GG  SDPP P+ +ACR
Sbjct  342   KVEVNGTSVLAGKSCDDPSRSVSWDGVHFTEAANRFVFELIV-GGKLSDPPVPLRQACR  399



>dbj|BAD43265.1| ENOD8-like protein [Arabidopsis thaliana]
Length=364

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/345 (48%), Positives = 220/345 (64%), Gaps = 26/345 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
              +C FPA++NFGDSNSDTGG SAA G+  PP+G +FFG P+GRYCDGRLVIDFIAE+LGL
Sbjct  16    HQCHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGSSFFGSPAGRYCDGRLVIDFIAESLGL  75

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+A+LDS+G++F HGANFATAGS I          G+SPF LD+Q  QF  F  R+  
Sbjct  76    PYLSAFLDSVGSNFSHGANFATAGSPIRALNSTLRQSGFSPFSLDVQFVQFYNFHNRSQT  135

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKF  627
             + ++      VYK +LP  + FSK+LYTFDIGQNDL+ G F    V Q    +P+I+ +F
Sbjct  136   VRSR----GGVYKTMLPESDSFSKALYTFDIGQNDLTAGYFANKTVEQVETEVPEIISQF  191

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
               A+  +YG+G R FWIHNTGPIGCL   +    +  ++ D +GC +  N +AQ+FN  L
Sbjct  192   MNAIKNIYGQGGRYFWIHNTGPIGCLAYVIERFPNKASDFDSHGCVSPLNHLAQQFNHAL  251

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG  948
             K  V++LR+ L +A  T VD+YS K+ +  +A  HGF+     CC             CG
Sbjct  252   KQAVIELRSSLSEAAITYVDVYSLKHELFVHAQGHGFKGSLVSCCGHGGKYNYNKGIGCG  311

Query  949   KNKKMANETVY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYG  1080
               K +  + VY G PC +P + + WDGVH+++AAN  +   I  G
Sbjct  312   MKKIVKGKEVYIGKPCDEPDKAVVWDGVHFTQAANKFIFDKIAPG  356



>ref|NP_176949.1| alpha-L-fucosidase 1 [Arabidopsis thaliana]
 sp|Q9FXE5.1|FUCO3_ARATH RecName: Full=Alpha-L-fucosidase 3; AltName: Full=Alpha-1,2-fucosidase; 
Short=AtFXG1; AltName: Full=Alpha-L-fucoside fucohydrolase 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG28886.1|AC008113_2 F12A21.4 [Arabidopsis thaliana]
 gb|AEE34703.1| alpha-L-fucosidase 3 [Arabidopsis thaliana]
Length=372

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 164/345 (48%), Positives = 220/345 (64%), Gaps = 26/345 (8%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
              +C FPA++NFGDSNSDTGG SAA G+  PP+G +FFG P+GRYCDGRLVIDFIAE+LGL
Sbjct  24    HQCHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGSSFFGSPAGRYCDGRLVIDFIAESLGL  83

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSILP-------GGYSPFFLDIQISQFIQFKKRTIE  450
             PYL+A+LDS+G++F HGANFATAGS I          G+SPF LD+Q  QF  F  R+  
Sbjct  84    PYLSAFLDSVGSNFSHGANFATAGSPIRALNSTLRQSGFSPFSLDVQFVQFYNFHNRSQT  143

Query  451   LYNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHG-FQYSNVSQTLQSIPKIMDKF  627
             + ++      VYK +LP  + FSK+LYTFDIGQNDL+ G F    V Q    +P+I+ +F
Sbjct  144   VRSR----GGVYKTMLPESDSFSKALYTFDIGQNDLTAGYFANKTVEQVETEVPEIISQF  199

Query  628   SQALYQLYGEGARNFWIHNTGPIGCLPISVAYNKDNHNNVDKNGCAATHNRVAQEFNrql  807
               A+  +YG+G R FWIHNTGPIGCL   +    +  ++ D +GC +  N +AQ+FN  L
Sbjct  200   MNAIKNIYGQGGRYFWIHNTGPIGCLAYVIERFPNKASDFDSHGCVSPLNHLAQQFNHAL  259

Query  808   karvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC-------------CG  948
             K  V++LR+ L +A  T VD+YS K+ +  +A  HGF+     CC             CG
Sbjct  260   KQAVIELRSSLSEAAITYVDVYSLKHELFVHAQGHGFKGSLVSCCGHGGKYNYNKGIGCG  319

Query  949   KNKKMANETVY-GDPCSDPSRHISWDGVHYSEAANLILARSIMYG  1080
               K +  + VY G PC +P + + WDGVH+++AAN  +   I  G
Sbjct  320   MKKIVKGKEVYIGKPCDEPDKAVVWDGVHFTQAANKFIFDKIAPG  364



>ref|XP_004491983.1| PREDICTED: GDSL esterase/lipase At5g14450-like [Cicer arietinum]
Length=385

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 223/359 (62%), Gaps = 24/359 (7%)
 Frame = +1

Query  112   RRCWFPAVYNFGDSNSDTGGRSAALGEVRPPNGETFFGKPSGRYCDGRLVIDFIAENLGL  291
             + C F A++NFGDSNSDTG  SAA      P G TFF +  GR  DGRL+IDFIA++LGL
Sbjct  29    KPCEFKAIFNFGDSNSDTGCMSAAFYPAILPYGRTFFHEAVGRASDGRLIIDFIAKHLGL  88

Query  292   PYLNAYLDSIGTSFRHGANFATAGSSI------LPGGYSPFFLDIQISQFIQFKKRTIEL  453
             P L+AY++SIGTS+RHGANFA   S+I         G +PF L++QI QF QFK RT + 
Sbjct  89    PLLSAYINSIGTSYRHGANFAAGSSTIRRQNKTFFDGGTPFTLEVQIEQFYQFKTRTGKF  148

Query  454   YNKLAGTNQVYKDVLPRPEEFSKSLYTFDIGQNDLSHGFQYSNVSQTLQSIPKIMDKFSQ  633
             +  L      Y    PRPE+F K++YTFDIGQND++          +  SI  I+D F++
Sbjct  149   F--LKANKSSYTRHFPRPEDFDKAIYTFDIGQNDIADVINKFGKEDSQASISNIVDYFAK  206

Query  634   ALYQLYGEGARNFWIHNTGPIGCLPISV-AYNKDNHNN----VDKNGCAATHNRVAQEFN  798
                 L+  GAR FWIHNTGPIGCLP+++  +N  NH +    +DKNGC    N +A++FN
Sbjct  207   QFQSLHYFGARTFWIHNTGPIGCLPVAMPMHNAKNHISEAGYLDKNGCVNYQNDMAKDFN  266

Query  799   rqlkarvlqlraqlqqavFTVVDMYSAKYAVVSNAGSHGFQDPFTFCC----------CG  948
              +LK  V++LR     A FT VDM+SAKY ++SNA   GF +P   CC          CG
Sbjct  267   EKLKDVVVKLRTMFPDASFTYVDMFSAKYELISNANKQGFVEPSRICCGYHEFGYHVYCG  326

Query  949   KNKKMANETVYGDPCSDPSRHISWDGVHYSEAANLILARSIMYGGSFSDPPRPVAEACR  1125
              N  +  + ++   C DPS++ISWDGVHY+EAAN  +A  I+  GSFSDPP  +  AC 
Sbjct  327   NNATINGKQIFTSSCEDPSKYISWDGVHYTEAANQWIANRIL-DGSFSDPPLLIEHACH  384



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3650421929700