BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83073_g1_i1 len=1402 path=[1:0-1401]

Length=1402
                                                                      Score     E

ref|XP_009796351.1|  PREDICTED: S-adenosylmethionine decarboxylas...    464   1e-157   
ref|XP_009618361.1|  PREDICTED: S-adenosylmethionine decarboxylas...    456   1e-154   
emb|CDP02875.1|  unnamed protein product                                448   3e-151   
gb|EYU37130.1|  hypothetical protein MIMGU_mgv1a008734mg                425   1e-142   
ref|XP_010268432.1|  PREDICTED: S-adenosylmethionine decarboxylas...    420   4e-140   
gb|KGN61070.1|  hypothetical protein Csa_2G036680                       419   5e-140   
ref|XP_004144715.1|  PREDICTED: S-adenosylmethionine decarboxylas...    417   1e-138   
ref|XP_004163988.1|  PREDICTED: S-adenosylmethionine decarboxylas...    417   1e-138   
ref|XP_011079446.1|  PREDICTED: S-adenosylmethionine decarboxylas...    411   6e-137   
ref|XP_008452459.1|  PREDICTED: S-adenosylmethionine decarboxylas...    410   7e-136   
ref|XP_010277986.1|  PREDICTED: S-adenosylmethionine decarboxylas...    405   1e-134   
gb|KDO62315.1|  hypothetical protein CISIN_1g035670mg                   404   3e-134   
ref|XP_006453539.1|  hypothetical protein CICLE_v10010502mg             400   8e-133   
ref|XP_010687660.1|  PREDICTED: S-adenosylmethionine decarboxylas...    399   6e-132   
ref|XP_007013911.1|  S-adenosylmethionine decarboxylase proenzyme...    397   3e-131   
ref|XP_010656641.1|  PREDICTED: S-adenosylmethionine decarboxylas...    393   1e-129   
emb|CAN76946.1|  hypothetical protein VITISV_017165                     395   4e-129   Vitis vinifera
ref|XP_008793521.1|  PREDICTED: S-adenosylmethionine decarboxylas...    391   5e-129   
ref|XP_010687659.1|  PREDICTED: S-adenosylmethionine decarboxylas...    393   6e-129   
gb|KDP38736.1|  hypothetical protein JCGZ_04089                         390   7e-129   
ref|XP_010105415.1|  S-adenosylmethionine decarboxylase proenzyme       390   7e-129   
ref|XP_002324514.2|  hypothetical protein POPTR_0018s11040g             391   7e-129   Populus trichocarpa [western balsam poplar]
gb|KCW78797.1|  hypothetical protein EUGRSUZ_C00232                     392   9e-129   
ref|XP_010047048.1|  PREDICTED: S-adenosylmethionine decarboxylas...    391   7e-128   
gb|AAL16065.1|AF420239_1  S-adenosyl-L-methionine decarboxylase         388   7e-128   Dendrobium crumenatum
ref|XP_011018087.1|  PREDICTED: S-adenosylmethionine decarboxylas...    384   3e-126   
ref|XP_010929198.1|  PREDICTED: S-adenosylmethionine decarboxylas...    384   9e-126   
ref|XP_010904594.1|  PREDICTED: S-adenosylmethionine decarboxylas...    382   1e-125   
gb|KCW78796.1|  hypothetical protein EUGRSUZ_C00232                     382   1e-125   
gb|AGR89928.1|  S-adenosyl-L-methionine decarboxylase                   381   3e-125   
ref|XP_006647495.1|  PREDICTED: S-adenosylmethionine decarboxylas...    379   5e-124   
ref|XP_004953064.1|  PREDICTED: S-adenosylmethionine decarboxylas...    378   1e-123   
ref|XP_002446740.1|  hypothetical protein SORBIDRAFT_06g021540          377   2e-123   Sorghum bicolor [broomcorn]
gb|ACV52081.1|  S-adenosylmethionine decarboxylase 3                    377   3e-123   Sorghum bicolor [broomcorn]
gb|ADC45379.1|  S-adenosylmethionine decarboxylase                      376   7e-123   
ref|XP_010235689.1|  PREDICTED: S-adenosylmethionine decarboxylas...    375   1e-122   
ref|NP_001047404.1|  Os02g0611200                                       375   1e-122   Oryza sativa Japonica Group [Japonica rice]
gb|AGT16271.1|  S-adenosylmethionine decarboxylase                      375   1e-122   
ref|XP_009401295.1|  PREDICTED: S-adenosylmethionine decarboxylas...    374   5e-122   
ref|XP_009403328.1|  PREDICTED: S-adenosylmethionine decarboxylas...    373   5e-122   
ref|XP_002534009.1|  s-adenosylmethionine decarboxylase, putative       370   8e-122   Ricinus communis
ref|NP_001105713.1|  S-adenosylmethionine decarboxylase proenzyme       373   8e-122   Zea mays [maize]
ref|XP_008794388.1|  PREDICTED: S-adenosylmethionine decarboxylas...    373   9e-122   
gb|EEE57355.1|  hypothetical protein OsJ_07492                          375   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148939.1|  S-adenosylmethionine decarboxylase proenzyme       373   1e-121   Zea mays [maize]
ref|XP_009410197.1|  PREDICTED: S-adenosylmethionine decarboxylas...    372   1e-121   
gb|ACG40518.1|  S-adenosylmethionine decarboxylase proenzyme            372   2e-121   Zea mays [maize]
ref|XP_004976106.1|  PREDICTED: S-adenosylmethionine decarboxylas...    374   2e-121   
ref|XP_009401296.1|  PREDICTED: S-adenosylmethionine decarboxylas...    374   3e-121   
ref|NP_001053213.1|  Os04g0498600                                       371   4e-121   Oryza sativa Japonica Group [Japonica rice]
sp|A2XV58.2|DCAM_ORYSI  RecName: Full=S-adenosylmethionine decarb...    370   1e-120   Oryza sativa Indica Group [Indian rice]
gb|ABO32298.1|  S-adenosylmethionine decarboxylase                      370   1e-120   Saccharum officinarum [noble cane]
gb|AEL33693.1|  S-adenosyl methionine decarboxylase                     370   1e-120   
gb|EMS45151.1|  S-adenosylmethionine decarboxylase proenzyme            370   2e-120   
emb|CAD41510.3|  OSJNBa0029H02.4                                        371   2e-120   
gb|ABJ15728.1|  S-adenosylmethionine decarboxylase                      369   2e-120   Triticum monococcum [einkorn wheat]
ref|XP_002462403.1|  hypothetical protein SORBIDRAFT_02g025110          369   3e-120   Sorghum bicolor [broomcorn]
gb|EAY94718.1|  hypothetical protein OsI_16495                          370   4e-120   Oryza sativa Indica Group [Indian rice]
gb|AAX76987.1|  S-adenosylmethionine decarboxylase                      369   5e-120   Oryza sativa Indica Group [Indian rice]
ref|XP_008808772.1|  PREDICTED: S-adenosylmethionine decarboxylas...    370   5e-120   
gb|AAO43186.1|  S-adenosylmethionine decarboxylase                      367   5e-120   Narcissus pseudonarcissus
gb|AGZ61932.1|  S-adenosylmethionine decarboxylase                      368   8e-120   
ref|XP_004956866.1|  PREDICTED: S-adenosylmethionine decarboxylas...    367   1e-119   
ref|XP_002452433.1|  hypothetical protein SORBIDRAFT_04g025720          367   1e-119   Sorghum bicolor [broomcorn]
gb|EAY86651.1|  hypothetical protein OsI_08032                          375   2e-119   Oryza sativa Indica Group [Indian rice]
gb|ACT53876.1|  S-adenosylmethionine decarboxylase                      367   2e-119   Saccharum officinarum [noble cane]
gb|ADD70015.1|  S-adenosyl-L-methionine decarboxylase 2                 367   3e-119   Leymus chinensis
gb|AHJ14569.1|  S-adenosyl methionine decarboxylase 2                   367   3e-119   
emb|CAC09496.2|  H0711G06.2                                             365   5e-119   
dbj|BAK00199.1|  predicted protein                                      365   6e-119   
gb|AAD17232.1|  S-adenosylmethionine decarboxylase precursor            365   1e-118   Triticum aestivum [Canadian hard winter wheat]
sp|Q42829.1|DCAM_HORCH  RecName: Full=S-adenosylmethionine decarb...    364   2e-118   Hordeum chilense
gb|EMS62883.1|  S-adenosylmethionine decarboxylase proenzyme            363   3e-118   
gb|AGL46977.1|  S-adenosylmethionine decarboxylase                      364   5e-118   
gb|ACV52078.1|  S-adenosylmethionine decarboxylase 1                    363   5e-118   Sorghum bicolor [broomcorn]
gb|EMT10641.1|  S-adenosylmethionine decarboxylase proenzyme            363   5e-118   
ref|XP_010914049.1|  PREDICTED: S-adenosylmethionine decarboxylas...    362   8e-118   
gb|ADC45378.1|  S-adenosylmethionine decarboxylase 2                    363   8e-118   
gb|EAZ09149.1|  hypothetical protein OsI_31419                          361   3e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_010240071.1|  PREDICTED: S-adenosylmethionine decarboxylas...    363   3e-117   
ref|XP_006660640.1|  PREDICTED: S-adenosylmethionine decarboxylas...    361   4e-117   
gb|EMT11715.1|  S-adenosylmethionine decarboxylase proenzyme            361   4e-117   
gb|AHJ14567.1|  S-adenosyl methionine decarboxylase 1                   360   7e-117   
gb|ADE92938.1|  S-adenosylmethionine decarboxylase                      360   1e-116   
gb|AHJ14566.1|  S-adenosyl methionine decarboxylase 1                   359   2e-116   
ref|NP_001149266.1|  LOC100282888                                       359   2e-116   Zea mays [maize]
gb|AHJ14568.1|  S-adenosyl methionine decarboxylase 1                   359   2e-116   
ref|NP_001063217.1|  Os09g0424300                                       358   7e-116   Oryza sativa Japonica Group [Japonica rice]
gb|ACL53872.1|  unknown                                                 357   1e-115   Zea mays [maize]
ref|XP_008652738.1|  PREDICTED: S-adenosylmethionine decarboxylas...    357   5e-115   
gb|ADW83722.1|  S-adenosylmethionine decarboxylase 2                    353   1e-114   
dbj|BAJ96795.1|  predicted protein                                      354   2e-114   
ref|XP_006878657.1|  hypothetical protein AMTR_s00011p00266060          352   7e-114   
ref|XP_009390538.1|  PREDICTED: S-adenosylmethionine decarboxylas...    352   9e-114   
gb|ADD70012.1|  S-adenosyl-L-methionine decarboxylase 1                 352   1e-113   Leymus chinensis
ref|XP_010238180.1|  PREDICTED: S-adenosylmethionine decarboxylas...    353   2e-113   
ref|NP_001149694.1|  S-adenosylmethionine decarboxylase proenzyme       350   5e-113   Zea mays [maize]
gb|KDP24344.1|  hypothetical protein JCGZ_25640                         349   5e-113   
gb|ADU02193.1|  S-adenosylmethionine decarboxylase                      350   8e-113   
sp|Q43820.1|DCAM_PEA  RecName: Full=S-adenosylmethionine decarbox...    347   2e-112   Pisum sativum [garden pea]
gb|EMT07332.1|  S-adenosylmethionine decarboxylase proenzyme            351   3e-112   
sp|Q9M4D8.1|DCAM_VICFA  RecName: Full=S-adenosylmethionine decarb...    346   1e-111   Vicia faba [broad bean]
gb|AAM44307.1|AF512545_1  S-adenosylmethionine decarboxylase            346   1e-111   Citrus x microcarpa [golden lime]
gb|ABY55856.1|  S-adenosylmethionine decarboxylase 3                    345   2e-111   Solanum lycopersicum
ref|XP_004490299.1|  PREDICTED: S-adenosylmethionine decarboxylas...    345   2e-111   
ref|XP_003550675.1|  PREDICTED: S-adenosylmethionine decarboxylas...    345   2e-111   
gb|ADH95190.1|  S-adenosylmethionine decarboxylase                      343   9e-111   
sp|Q42679.1|DCAM_CATRO  RecName: Full=S-adenosylmethionine decarb...    343   1e-110   Catharanthus roseus [chatas]
ref|XP_004490298.1|  PREDICTED: S-adenosylmethionine decarboxylas...    344   2e-110   
ref|XP_010325052.1|  PREDICTED: S-adenosylmethionine decarboxylas...    342   3e-110   
ref|XP_006573201.1|  PREDICTED: S-adenosylmethionine decarboxylas...    340   1e-109   
gb|EMS50405.1|  S-adenosylmethionine decarboxylase proenzyme            343   2e-109   
gb|KEH16884.1|  S-adenosylmethionine decarboxylase proenzyme            340   2e-109   
ref|XP_010257836.1|  PREDICTED: S-adenosylmethionine decarboxylas...    342   2e-109   
ref|XP_006408415.1|  hypothetical protein EUTSA_v10022357mg             339   4e-109   
gb|AGZ90156.1|  S-adenosylmethionine decarboxylase                      339   4e-109   
gb|EYU44271.1|  hypothetical protein MIMGU_mgv1a008754mg                339   6e-109   
gb|KHN13794.1|  S-adenosylmethionine decarboxylase proenzyme            339   6e-109   
sp|Q9M6K1.1|DCAM_IPOBA  RecName: Full=S-adenosylmethionine decarb...    339   7e-109   Ipomoea batatas [batate]
ref|XP_011099087.1|  PREDICTED: S-adenosylmethionine decarboxylas...    340   8e-109   
ref|XP_007215554.1|  hypothetical protein PRUPE_ppa007294mg             339   8e-109   
ref|XP_006602987.1|  PREDICTED: S-adenosylmethionine decarboxylas...    338   9e-109   
gb|ABO77440.1|  S-adenosylmethionine decarboxylase                      338   1e-108   Medicago falcata [sickle alfalfa]
sp|Q96471.1|DCAM_IPONI  RecName: Full=S-adenosylmethionine decarb...    338   2e-108   Ipomoea nil [qian niu]
gb|ADD91750.1|  S-adenosylmethionine decarboxylase proenzyme            337   2e-108   
ref|XP_002282704.1|  PREDICTED: S-adenosylmethionine decarboxylas...    337   2e-108   Vitis vinifera
emb|CDP00521.1|  unnamed protein product                                337   3e-108   
emb|CAN66014.1|  hypothetical protein VITISV_041154                     337   3e-108   Vitis vinifera
gb|ADD91751.1|  S-adenosylmethionine decarboxylase proenzyme            336   5e-108   
ref|XP_008353516.1|  PREDICTED: S-adenosylmethionine decarboxylas...    337   7e-108   
ref|XP_010660529.1|  PREDICTED: S-adenosylmethionine decarboxylas...    337   8e-108   
gb|ADF81048.1|  S-adenosylmethionine decarboxylase                      336   8e-108   
ref|XP_006367530.1|  PREDICTED: S-adenosylmethionine decarboxylas...    335   1e-107   
ref|XP_009373729.1|  PREDICTED: S-adenosylmethionine decarboxylas...    336   1e-107   
ref|XP_006845442.1|  hypothetical protein AMTR_s00019p00109640          336   2e-107   
gb|ADF81049.1|  S-adenosylmethionine decarboxylase                      335   2e-107   
gb|AAS45435.1|  S-adenosylmethionine decarboxylase                      335   3e-107   Brassica juncea [brown mustard]
emb|CDY57536.1|  BnaA05g33510D                                          334   3e-107   
ref|XP_009622584.1|  PREDICTED: S-adenosylmethionine decarboxylas...    335   3e-107   
ref|XP_006585825.1|  PREDICTED: S-adenosylmethionine decarboxylas...    334   3e-107   
dbj|BAP47514.1|  S-adenosylmethionine decarboxylase                     334   4e-107   
ref|XP_002882231.1|  S-adenosylmethionine decarboxylase                 334   4e-107   
ref|XP_011077597.1|  PREDICTED: S-adenosylmethionine decarboxylas...    334   4e-107   
ref|XP_011008996.1|  PREDICTED: S-adenosylmethionine decarboxylas...    336   4e-107   
ref|NP_001236931.1|  S-adenosylmethionine decarboxylase                 333   5e-107   
ref|XP_008243751.1|  PREDICTED: S-adenosylmethionine decarboxylas...    333   5e-107   
ref|XP_008362232.1|  PREDICTED: S-adenosylmethionine decarboxylas...    334   6e-107   
ref|XP_006430871.1|  hypothetical protein CICLE_v10013866mg             333   7e-107   
ref|XP_002314904.2|  S-adenosylmethionine decarboxylase family pr...    333   7e-107   Populus trichocarpa [western balsam poplar]
emb|CDY71278.1|  BnaAnng36830D                                          333   7e-107   
ref|XP_007225621.1|  hypothetical protein PRUPE_ppa007732mg             333   8e-107   
ref|XP_004304166.1|  PREDICTED: S-adenosylmethionine decarboxylas...    334   8e-107   
gb|KGN57743.1|  hypothetical protein Csa_3G271360                       333   1e-106   
ref|XP_010654269.1|  PREDICTED: S-adenosylmethionine decarboxylas...    333   1e-106   
ref|XP_008230354.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    335   1e-106   
gb|EPS62258.1|  s-adenosylmethionine decarboxylase proenzyme            333   1e-106   
ref|XP_002525956.1|  s-adenosylmethionine decarboxylase, putative       333   1e-106   Ricinus communis
ref|XP_011070874.1|  PREDICTED: S-adenosylmethionine decarboxylas...    332   2e-106   
dbj|BAF75727.1|  S-adenosylmethionine decarboxylase                     333   2e-106   Triticum turgidum [cone wheat]
gb|KDO58885.1|  hypothetical protein CISIN_1g039582mg                   332   2e-106   
emb|CAD98785.2|  S-adenosylmethionine decarboxylase proenzyme           332   3e-106   Vitis vinifera
sp|Q9SDM8.1|DCAM3_BRAJU  RecName: Full=S-adenosylmethionine decar...    332   3e-106   Brassica juncea [brown mustard]
gb|ADG57793.1|  S-adenosyl-l-methionine decarboxylase 3-2               332   3e-106   
emb|CDX74257.1|  BnaA03g27900D                                          332   4e-106   
ref|XP_009118044.1|  PREDICTED: S-adenosylmethionine decarboxylas...    332   4e-106   
ref|XP_010463654.1|  PREDICTED: S-adenosylmethionine decarboxylas...    332   4e-106   
ref|XP_009147351.1|  PREDICTED: S-adenosylmethionine decarboxylas...    332   4e-106   
ref|XP_009764781.1|  PREDICTED: S-adenosylmethionine decarboxylas...    332   5e-106   
emb|CDP02379.1|  unnamed protein product                                331   5e-106   
gb|EYU28926.1|  hypothetical protein MIMGU_mgv1a008898mg                331   5e-106   
gb|ACZ73828.1|  S-adenosylmethionine decarboxylase                      331   6e-106   Olea europaea
gb|AGV68760.1|  S-adenosylmethionine decarboxylase                      331   6e-106   
dbj|BAC55114.1|  S-adenosylmethionine decarboxylase                     332   7e-106   Malus domestica [apple tree]
ref|NP_186896.1|  conserved peptide upstream open reading frame 9       331   7e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003631339.1|  PREDICTED: S-adenosylmethionine decarboxylas...    332   8e-106   
gb|AAL06846.1|  AT3g02470/F16B3_10                                      331   1e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AGI02585.1|  S-adenosylmethionine decarboxylase                      331   1e-105   
ref|XP_009134671.1|  PREDICTED: S-adenosylmethionine decarboxylas...    330   2e-105   
ref|XP_007153542.1|  hypothetical protein PHAVU_003G044200g             329   2e-105   
ref|XP_010549939.1|  PREDICTED: S-adenosylmethionine decarboxylas...    330   3e-105   
emb|CDX91992.1|  BnaC03g32940D                                          330   3e-105   
ref|XP_006299023.1|  hypothetical protein CARUB_v10015160mg             331   4e-105   
ref|XP_009588870.1|  PREDICTED: S-adenosylmethionine decarboxylas...    331   4e-105   
gb|ADG57791.1|  S-adenosyl-l-methionine decarboxylase 3-1               329   5e-105   
ref|XP_007045669.1|  S-adenosylmethionine decarboxylase proenzyme       328   6e-105   
emb|CDY71710.1|  BnaAnng38530D                                          330   8e-105   
ref|XP_010525150.1|  PREDICTED: S-adenosylmethionine decarboxylas...    328   1e-104   
gb|ADQ37302.1|  putative S-adenosyl methionine decarboxylase            329   1e-104   
emb|CAA69073.1|  S-adenosylmethionine decarboxylase                     328   1e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KEH21805.1|  S-adenosylmethionine decarboxylase proenzyme            328   1e-104   
emb|CDY43235.1|  BnaC05g48280D                                          331   1e-104   
gb|ABK95104.1|  unknown                                                 328   1e-104   Populus trichocarpa [western balsam poplar]
gb|KEH17677.1|  S-adenosylmethionine decarboxylase proenzyme            328   2e-104   
gb|AEI98604.1|  S-adenosylmethionine decarboxylase                      327   2e-104   
ref|XP_006338297.1|  PREDICTED: S-adenosylmethionine decarboxylas...    327   2e-104   
ref|XP_004491770.1|  PREDICTED: S-adenosylmethionine decarboxylas...    327   3e-104   
ref|XP_002305295.2|  S-adenosylmethionine decarboxylase family pr...    327   3e-104   Populus trichocarpa [western balsam poplar]
ref|XP_009625495.1|  PREDICTED: S-adenosylmethionine decarboxylas...    328   3e-104   
gb|KHG07410.1|  S-adenosylmethionine decarboxylase proenzyme            326   4e-104   
gb|AGT80621.1|  S-adenosylmethionine decarboxylase                      325   9e-104   
dbj|BAB83763.1|  S-adenosylmethionine decarboxylase                     325   1e-103   Phaseolus lunatus
gb|AAB17665.1|  S-adenosylmethionine decarboxylase                      325   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461582.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    327   1e-103   
gb|KEH20218.1|  S-adenosylmethionine decarboxylase proenzyme            325   1e-103   
sp|Q96555.1|DCAM_DATST  RecName: Full=S-adenosylmethionine decarb...    325   1e-103   Datura stramonium [common thornapple]
ref|XP_010528023.1|  PREDICTED: S-adenosylmethionine decarboxylas...    325   1e-103   
sp|O04009.1|DCAM_TOBAC  RecName: Full=S-adenosylmethionine decarb...    325   1e-103   Nicotiana tabacum [American tobacco]
ref|XP_011008131.1|  PREDICTED: S-adenosylmethionine decarboxylas...    325   1e-103   
sp|O80402.1|DCAM_NICSY  RecName: Full=S-adenosylmethionine decarb...    325   2e-103   Nicotiana sylvestris
ref|NP_001275865.1|  S-adenosylmethionine decarboxylase                 325   2e-103   
gb|KDP31452.1|  hypothetical protein JCGZ_11828                         325   2e-103   
gb|AIS20829.1|  SAMDC3                                                  325   2e-103   
ref|XP_009356498.1|  PREDICTED: S-adenosylmethionine decarboxylas...    324   2e-103   
ref|XP_009801145.1|  PREDICTED: S-adenosylmethionine decarboxylas...    327   2e-103   
ref|XP_006395646.1|  hypothetical protein EUTSA_v10004463mg             325   2e-103   
ref|XP_010091687.1|  S-adenosylmethionine decarboxylase proenzyme       324   3e-103   
ref|XP_006437789.1|  hypothetical protein CICLE_v10033607mg             328   4e-103   
ref|XP_011021158.1|  PREDICTED: S-adenosylmethionine decarboxylas...    323   6e-103   
gb|AAB88854.1|  S-adenosylmethionine decarboxylase                      323   6e-103   Nicotiana tabacum [American tobacco]
gb|AAR84406.1|  S-adenosylmethionine decarboxylase                      323   7e-103   Daucus carota [carrots]
ref|XP_007033429.1|  S-adenosylmethionine decarboxylase proenzyme...    323   1e-102   
ref|XP_007139351.1|  hypothetical protein PHAVU_008G022100g             322   1e-102   
gb|KHG30390.1|  S-adenosylmethionine decarboxylase proenzyme            323   1e-102   
gb|ABK25576.1|  unknown                                                 323   1e-102   Picea sitchensis
gb|AGL95795.1|  S-adenosylmenthionine decarboxylase                     322   2e-102   
gb|AGV54395.1|  S-adenosylmethionine decarboxylase                      322   2e-102   
ref|XP_002514534.1|  s-adenosylmethionine decarboxylase, putative       322   2e-102   Ricinus communis
gb|KDO70175.1|  hypothetical protein CISIN_1g0194112mg                  320   2e-102   
ref|XP_010681340.1|  PREDICTED: S-adenosylmethionine decarboxylas...    322   3e-102   
ref|XP_007033428.1|  S-adenosylmethionine decarboxylase proenzyme...    323   5e-102   
gb|ABW21886.1|  putative S-adenosylmethionine decarboxylase proen...    320   5e-102   Solanum peruvianum [Peruvian tomato]
gb|AAZ85237.1|  putative S-adenosylmethionine decarboxylase proen...    320   7e-102   Solanum chmielewskii
ref|XP_004233654.1|  PREDICTED: S-adenosylmethionine decarboxylas...    322   8e-102   
gb|ADV29193.1|  S-adenosylmethionine decarboxylase proenzyme            320   8e-102   
sp|Q9AXE3.1|DCAM_DAUCA  RecName: Full=S-adenosylmethionine decarb...    320   9e-102   Daucus carota [carrots]
gb|AAZ85232.1|  putative S-adenosylmethionine decarboxylase proen...    320   1e-101   Solanum chmielewskii
sp|Q39677.1|DCAM2_DIACA  RecName: Full=S-adenosylmethionine decar...    321   1e-101   Dianthus caryophyllus [carnation]
ref|XP_006288009.1|  hypothetical protein CARUB_v10001243mg             320   1e-101   
gb|ABW21889.1|  putative S-adenosylmethionine decarboxylase proen...    319   1e-101   Solanum peruvianum [Peruvian tomato]
sp|Q39676.1|DCAM1_DIACA  RecName: Full=S-adenosylmethionine decar...    320   1e-101   Dianthus caryophyllus [carnation]
gb|ADV29203.1|  S-adenosylmethionine decarboxylase proenzyme            319   2e-101   
ref|XP_006373494.1|  hypothetical protein POPTR_0017s14280g             320   2e-101   
gb|AAZ85231.1|  putative S-adenosylmethionine decarboxylase proen...    319   2e-101   Solanum lycopersicoides
gb|ADV29165.1|  S-adenosylmethionine decarboxylase proenzyme            319   2e-101   
ref|XP_006348617.1|  PREDICTED: S-adenosylmethionine decarboxylas...    320   2e-101   
gb|AAX56884.1|  putative S-adenosylmethionine decarboxylase proen...    319   2e-101   Solanum peruvianum [Peruvian tomato]
gb|ABW21925.1|  putative S-adenosylmethionine decarboxylase proen...    319   2e-101   Solanum chilense
gb|ABW21912.1|  putative S-adenosylmethionine decarboxylase proen...    319   2e-101   Solanum chilense
emb|CDX69487.1|  BnaA10g18360D                                          320   2e-101   
ref|XP_009121534.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    320   2e-101   
gb|ABW21917.1|  putative S-adenosylmethionine decarboxylase proen...    318   2e-101   Solanum chilense
sp|Q04694.1|DCAM_SOLTU  RecName: Full=S-adenosylmethionine decarb...    319   3e-101   Solanum tuberosum [potatoes]
gb|AAX56886.1|  putative S-adenosylmethionine decarboxylase proen...    318   3e-101   Solanum peruvianum [Peruvian tomato]
gb|ADV29125.1|  S-adenosylmethionine decarboxylase proenzyme            318   3e-101   
sp|Q38IY3.1|DCAM_SOLCI  RecName: Full=S-adenosylmethionine decarb...    319   3e-101   Solanum chilense
gb|AAX56882.1|  putative S-adenosylmethionine decarboxylase proen...    318   3e-101   Solanum peruvianum [Peruvian tomato]
gb|AEO52842.1|  putative S-adenosylmethionine decarboxylase proen...    318   3e-101   
gb|ADV29194.1|  S-adenosylmethionine decarboxylase proenzyme            318   3e-101   
gb|ADV29171.1|  S-adenosylmethionine decarboxylase proenzyme            318   3e-101   
gb|AFV92895.1|  S-adenosylmethionine decarboxylase                      319   3e-101   
gb|AEO52758.1|  putative S-adenosylmethionine decarboxylase proen...    318   4e-101   
gb|ABW21898.1|  putative S-adenosylmethionine decarboxylase proen...    318   4e-101   Solanum chilense
gb|ABW21873.1|  putative S-adenosylmethionine decarboxylase proen...    318   5e-101   Solanum peruvianum [Peruvian tomato]
gb|AAB32507.1|  S-adenosylmethionine decarboxylase                      318   5e-101   Solanum tuberosum [potatoes]
gb|ABY81906.1|  S-adenosylmethionine decarboxylase                      318   5e-101   Vigna radiata [mung bean]
gb|ABW21895.1|  putative S-adenosylmethionine decarboxylase proen...    318   5e-101   Solanum peruvianum [Peruvian tomato]
ref|NP_001234699.1|  S-adenosylmethionine decarboxylase                 318   5e-101   
gb|ABR17745.1|  unknown                                                 319   5e-101   Picea sitchensis
gb|AEO52841.1|  putative S-adenosylmethionine decarboxylase proen...    318   6e-101   
gb|ADV29181.1|  S-adenosylmethionine decarboxylase proenzyme            318   6e-101   
sp|P46255.1|DCAM_SPIOL  RecName: Full=S-adenosylmethionine decarb...    318   6e-101   Spinacia oleracea
gb|ADV29170.1|  S-adenosylmethionine decarboxylase proenzyme            317   7e-101   
gb|ADV29198.1|  S-adenosylmethionine decarboxylase proenzyme            317   7e-101   
gb|ADV29140.1|  S-adenosylmethionine decarboxylase proenzyme            317   7e-101   
sp|O65354.1|DCAM_HELAN  RecName: Full=S-adenosylmethionine decarb...    318   8e-101   Helianthus annuus
gb|ADV29185.1|  S-adenosylmethionine decarboxylase proenzyme            317   8e-101   
gb|ABW21878.1|  putative S-adenosylmethionine decarboxylase proen...    317   9e-101   Solanum peruvianum [Peruvian tomato]
gb|ABY55855.1|  S-adenosylmethionine decarboxylase 2                    318   1e-100   Solanum lycopersicum
gb|ABW21885.1|  putative S-adenosylmethionine decarboxylase proen...    317   1e-100   Solanum peruvianum [Peruvian tomato]
gb|ABW21931.1|  putative S-adenosylmethionine decarboxylase proen...    317   1e-100   
gb|ABW21863.1|  putative S-adenosylmethionine decarboxylase proen...    317   1e-100   
gb|AAX56905.1|  putative S-adenosylmethionine decarboxylase proen...    317   2e-100   
ref|XP_004297173.1|  PREDICTED: S-adenosylmethionine decarboxylas...    317   2e-100   
gb|AEO52817.1|  putative S-adenosylmethionine decarboxylase proen...    317   2e-100   
gb|ABW21876.1|  putative S-adenosylmethionine decarboxylase proen...    317   2e-100   
gb|ABW21887.1|  putative S-adenosylmethionine decarboxylase proen...    316   2e-100   
ref|XP_008339774.1|  PREDICTED: S-adenosylmethionine decarboxylas...    317   2e-100   
ref|NP_001280825.1|  uncharacterized protein LOC103451713               317   2e-100   
gb|ABW21919.1|  putative S-adenosylmethionine decarboxylase proen...    316   2e-100   
gb|KHG10311.1|  S-adenosylmethionine decarboxylase proenzyme            317   2e-100   
dbj|BAF91878.1|  S-adenosylmethionine decarboxylase                     315   2e-100   
ref|XP_008360070.1|  PREDICTED: S-adenosylmethionine decarboxylas...    317   2e-100   
ref|XP_010032594.1|  PREDICTED: S-adenosylmethionine decarboxylas...    317   3e-100   
ref|XP_010320542.1|  PREDICTED: S-adenosylmethionine decarboxylas...    318   3e-100   
gb|ABW21890.1|  putative S-adenosylmethionine decarboxylase proen...    316   3e-100   
emb|CDX70666.1|  BnaC03g07500D                                          316   4e-100   
gb|ABW21915.1|  putative S-adenosylmethionine decarboxylase proen...    315   4e-100   
gb|AAZ85242.1|  putative S-adenosylmethionine decarboxylase proen...    315   5e-100   
gb|ABW21900.1|  putative S-adenosylmethionine decarboxylase proen...    315   6e-100   
gb|ABA03224.1|  S-adenosylmethionine decarboxylase 4                    311   9e-100   
emb|CDY26478.1|  BnaC09g41900D                                          315   1e-99    
ref|XP_010100905.1|  S-adenosylmethionine decarboxylase proenzyme       315   1e-99    
ref|XP_004297172.1|  PREDICTED: S-adenosylmethionine decarboxylas...    317   1e-99    
ref|XP_010904619.1|  PREDICTED: S-adenosylmethionine decarboxylas...    314   2e-99    
ref|XP_010692003.1|  PREDICTED: S-adenosylmethionine decarboxylas...    314   3e-99    
ref|NP_189184.1|  S-adenosylmethionine decarboxylase                    313   3e-99    
sp|O49972.1|DCAM2_BRAJU  RecName: Full=S-adenosylmethionine decar...    314   4e-99    
gb|AFV67665.1|  S-adenosylmethionine decarboxylase                      313   4e-99    
ref|XP_010420276.1|  PREDICTED: S-adenosylmethionine decarboxylas...    313   6e-99    
gb|AEV40469.1|  S-adenosylmethionine decarboxylase                      310   7e-99    
ref|XP_010044331.1|  PREDICTED: S-adenosylmethionine decarboxylas...    312   9e-99    
gb|AEO52839.1|  putative S-adenosylmethionine decarboxylase proen...    312   1e-98    
ref|XP_002871694.1|  adenosylmethionine decarboxylase family protein    312   1e-98    
ref|XP_010492454.1|  PREDICTED: S-adenosylmethionine decarboxylas...    312   1e-98    
gb|AAR15894.1|  S-adenosyl-L-methionine decarboxylase                   312   2e-98    
ref|NP_197099.1|  S-adenosylmethionine decarboxylase proenzyme 2        310   8e-98    
gb|ABU55003.1|  S-adenosylmethionine decarboxylase                      308   1e-97    
gb|ABO32297.1|  S-adenosylmethionine decarboxylase                      306   2e-97    
ref|XP_008811197.1|  PREDICTED: S-adenosylmethionine decarboxylas...    309   2e-97    
gb|KEH21806.1|  S-adenosylmethionine decarboxylase proenzyme            309   4e-97    
sp|Q42613.1|DCAM1_BRAJU  RecName: Full=S-adenosylmethionine decar...    308   5e-97    
ref|XP_006400122.1|  hypothetical protein EUTSA_v10015260mg             308   8e-97    
gb|AAR00210.1|  S-adenosylmethionine decarboxylase                      303   8e-96    
gb|EPS67756.1|  hypothetical protein M569_07018                         306   2e-95    
ref|XP_001776491.1|  predicted protein                                  306   3e-95    
ref|XP_010453744.1|  PREDICTED: S-adenosylmethionine decarboxylas...    304   3e-95    
ref|XP_001776462.1|  predicted protein                                  305   3e-95    
ref|XP_006291363.1|  hypothetical protein CARUB_v10017502mg             303   4e-95    
ref|XP_001775168.1|  predicted protein                                  302   2e-94    
ref|XP_009418028.1|  PREDICTED: S-adenosylmethionine decarboxylas...    296   4e-92    
ref|XP_002977119.1|  hypothetical protein SELMODRAFT_106449             294   5e-92    
ref|XP_002992114.1|  hypothetical protein SELMODRAFT_134821             294   7e-92    
ref|XP_001782581.1|  predicted protein                                  296   9e-92    
emb|CAG28949.1|  S-adenosylmethionine decarboxylase                     288   4e-90    
ref|XP_001757739.1|  predicted protein                                  292   4e-90    
ref|XP_009765510.1|  PREDICTED: S-adenosylmethionine decarboxylas...    284   4e-88    
ref|XP_002876918.1|  adenosylmethionine decarboxylase family protein    283   5e-88    
ref|XP_002979516.1|  hypothetical protein SELMODRAFT_14106              281   1e-87    
ref|XP_010261810.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    283   2e-87    
gb|AER27717.1|  S-adenosylmethionine decarboxylase                      277   1e-86    
gb|KEH21807.1|  S-adenosylmethionine decarboxylase proenzyme            281   1e-86    
ref|XP_002977805.1|  hypothetical protein SELMODRAFT_14131              278   9e-86    
gb|ADW83721.1|  S-adenosylmethionine decarboxylase 1                    275   4e-85    
gb|AER27716.1|  S-adenosylmethionine decarboxylase                      271   5e-84    
gb|ACE97505.1|  S-adenosylmethionine decarboxylase                      259   1e-79    
ref|XP_002973835.1|  hypothetical protein SELMODRAFT_100475             265   1e-79    
gb|ACE97514.1|  S-adenosylmethionine decarboxylase                      258   2e-79    
ref|XP_010430714.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    261   3e-79    
gb|AEW43295.1|  putative S-adenosylmethionine decarboxylase             258   3e-79    
gb|ACE97512.1|  S-adenosylmethionine decarboxylase                      258   3e-79    
gb|ACE97515.1|  S-adenosylmethionine decarboxylase                      258   5e-79    
gb|ACE97491.1|  S-adenosylmethionine decarboxylase                      258   5e-79    
gb|ACE97492.1|  S-adenosylmethionine decarboxylase                      257   7e-79    
gb|ACE97508.1|  S-adenosylmethionine decarboxylase                      257   7e-79    
gb|ACE97499.1|  S-adenosylmethionine decarboxylase                      256   1e-78    
ref|XP_002983556.1|  hypothetical protein SELMODRAFT_118443             262   1e-78    
gb|AFJ04521.1|  s-adenosylmethionine decarboxylase                      258   2e-78    
gb|ACE97495.1|  S-adenosylmethionine decarboxylase                      256   2e-78    
gb|ACE97496.1|  S-adenosylmethionine decarboxylase                      256   2e-78    
gb|ACE97513.1|  S-adenosylmethionine decarboxylase                      256   3e-78    
gb|ACE97520.1|  S-adenosylmethionine decarboxylase                      255   3e-78    
gb|ACE97501.1|  S-adenosylmethionine decarboxylase                      255   4e-78    
gb|ACE97522.1|  S-adenosylmethionine decarboxylase                      255   4e-78    
gb|ACE97507.1|  S-adenosylmethionine decarboxylase                      254   1e-77    
ref|XP_008458531.1|  PREDICTED: S-adenosylmethionine decarboxylas...    256   3e-77    
ref|XP_006290030.1|  hypothetical protein CARUB_v10003664mg             256   6e-77    
ref|XP_004145040.1|  PREDICTED: S-adenosylmethionine decarboxylas...    256   7e-77    
ref|NP_197394.1|  S-adenosylmethionine decarboxylase                    254   2e-76    
ref|XP_004297028.1|  PREDICTED: S-adenosylmethionine decarboxylas...    254   2e-76    
ref|XP_004153549.1|  PREDICTED: S-adenosylmethionine decarboxylas...    254   2e-76    
dbj|BAC81653.1|  S-adenosylmethionine decarboxylase                     249   2e-75    
ref|XP_008793650.1|  PREDICTED: S-adenosylmethionine decarboxylas...    251   2e-75    
ref|XP_010420666.1|  PREDICTED: S-adenosylmethionine decarboxylas...    251   3e-75    
ref|XP_010546901.1|  PREDICTED: S-adenosylmethionine decarboxylas...    249   1e-74    
ref|XP_009126291.1|  PREDICTED: S-adenosylmethionine decarboxylas...    249   1e-74    
ref|XP_010454143.1|  PREDICTED: S-adenosylmethionine decarboxylas...    249   2e-74    
ref|XP_010492932.1|  PREDICTED: S-adenosylmethionine decarboxylas...    249   3e-74    
ref|XP_007147821.1|  hypothetical protein PHAVU_006G157800g             251   3e-74    
ref|XP_003550518.1|  PREDICTED: S-adenosylmethionine decarboxylas...    249   3e-74    
ref|XP_010024449.1|  PREDICTED: S-adenosylmethionine decarboxylas...    248   5e-74    
gb|KHN03415.1|  S-adenosylmethionine decarboxylase proenzyme            248   5e-74    
ref|XP_002873919.1|  BUD2/SAMDC4                                        248   6e-74    
ref|XP_010279141.1|  PREDICTED: S-adenosylmethionine decarboxylas...    247   8e-74    
ref|XP_010105688.1|  S-adenosylmethionine decarboxylase proenzyme 3     247   9e-74    
ref|XP_006400447.1|  hypothetical protein EUTSA_v10013987mg             247   1e-73    
emb|CDX70856.1|  BnaC03g09400D                                          246   3e-73    
ref|XP_010524778.1|  PREDICTED: S-adenosylmethionine decarboxylas...    246   3e-73    
emb|CDX92572.1|  BnaA10g16110D                                          246   5e-73    
gb|KFK34011.1|  hypothetical protein AALP_AA5G090500                    245   6e-73    
ref|XP_003594071.1|  S-adenosylmethionine decarboxylase proenzyme       245   8e-73    
ref|XP_010921966.1|  PREDICTED: S-adenosylmethionine decarboxylas...    244   1e-72    
ref|XP_009131706.1|  PREDICTED: S-adenosylmethionine decarboxylas...    244   2e-72    
ref|XP_003528663.1|  PREDICTED: S-adenosylmethionine decarboxylas...    244   2e-72    
ref|XP_009120934.1|  PREDICTED: S-adenosylmethionine decarboxylas...    246   2e-72    
emb|CDY13929.1|  BnaC09g38970D                                          243   3e-72    
ref|XP_009393359.1|  PREDICTED: S-adenosylmethionine decarboxylas...    243   3e-72    
emb|CDX88906.1|  BnaA03g07430D                                          243   4e-72    
ref|XP_010255822.1|  PREDICTED: S-adenosylmethionine decarboxylas...    243   4e-72    
ref|XP_008811998.1|  PREDICTED: S-adenosylmethionine decarboxylas...    242   7e-72    
ref|XP_007035369.1|  Adenosylmethionine decarboxylase family protein    242   1e-71    
ref|XP_004508338.1|  PREDICTED: S-adenosylmethionine decarboxylas...    240   4e-71    
ref|XP_002516818.1|  s-adenosylmethionine decarboxylase, putative       239   7e-71    
ref|XP_010036128.1|  PREDICTED: S-adenosylmethionine decarboxylas...    240   9e-71    
ref|XP_007154193.1|  hypothetical protein PHAVU_003G097900g             238   2e-70    
ref|XP_004241063.1|  PREDICTED: S-adenosylmethionine decarboxylas...    238   3e-70    
ref|XP_006850850.1|  hypothetical protein AMTR_s00025p00139140          238   4e-70    
emb|CAD20741.1|  S-adenosyl-L-methionine decarboxylase                  233   5e-70    
ref|XP_011011751.1|  PREDICTED: S-adenosylmethionine decarboxylas...    237   7e-70    
emb|CAJ42877.1|  S-adenosyl methionine decarboxylase                    234   8e-70    
ref|XP_002314430.2|  hypothetical protein POPTR_0010s02930g             237   8e-70    
pdb|1MHM|A  Chain A, Crystal Structure Of S-Adenosylmethionine De...    235   1e-69    
ref|XP_011090841.1|  PREDICTED: S-adenosylmethionine decarboxylas...    236   1e-69    
ref|XP_003547228.1|  PREDICTED: S-adenosylmethionine decarboxylas...    236   2e-69    
ref|XP_004486095.1|  PREDICTED: S-adenosylmethionine decarboxylas...    236   3e-69    
ref|XP_006356688.1|  PREDICTED: S-adenosylmethionine decarboxylas...    235   4e-69    
ref|XP_007222179.1|  hypothetical protein PRUPE_ppa007795mg             235   6e-69    
ref|XP_002277316.1|  PREDICTED: S-adenosylmethionine decarboxylas...    234   8e-69    
ref|XP_006489274.1|  PREDICTED: S-adenosylmethionine decarboxylas...    234   9e-69    
emb|CDX78666.1|  BnaA03g05780D                                          233   9e-69    
gb|KDP40067.1|  hypothetical protein JCGZ_02065                         234   9e-69    
ref|XP_006419758.1|  hypothetical protein CICLE_v10005303mg             234   1e-68    
ref|XP_011006075.1|  PREDICTED: S-adenosylmethionine decarboxylas...    233   2e-68    
ref|XP_010931927.1|  PREDICTED: S-adenosylmethionine decarboxylas...    233   2e-68    
gb|KFK38065.1|  hypothetical protein AALP_AA3G065400                    233   2e-68    
ref|XP_003542902.1|  PREDICTED: S-adenosylmethionine decarboxylas...    233   2e-68    
emb|CDO98960.1|  unnamed protein product                                233   2e-68    
ref|XP_008223049.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    233   2e-68    
ref|XP_002312726.1|  hypothetical protein POPTR_0008s20330g             233   2e-68    
ref|XP_011071531.1|  PREDICTED: S-adenosylmethionine decarboxylas...    233   3e-68    
emb|CAN76568.1|  hypothetical protein VITISV_030214                     233   3e-68    
gb|EYU45598.1|  hypothetical protein MIMGU_mgv1a019750mg                232   5e-68    
ref|XP_009602655.1|  PREDICTED: S-adenosylmethionine decarboxylas...    232   5e-68    
ref|XP_004167626.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    232   6e-68    
ref|XP_004134166.1|  PREDICTED: S-adenosylmethionine decarboxylas...    231   1e-67    
ref|XP_008438742.1|  PREDICTED: S-adenosylmethionine decarboxylas...    230   3e-67    
ref|XP_009385076.1|  PREDICTED: S-adenosylmethionine decarboxylas...    230   4e-67    
ref|XP_009352148.1|  PREDICTED: S-adenosylmethionine decarboxylas...    230   4e-67    
ref|XP_009782050.1|  PREDICTED: S-adenosylmethionine decarboxylas...    229   5e-67    
ref|XP_008390797.1|  PREDICTED: S-adenosylmethionine decarboxylas...    229   1e-66    
gb|EPS69535.1|  s-adenosylmethionine decarboxylase proenzyme            228   2e-66    
ref|XP_009339941.1|  PREDICTED: S-adenosylmethionine decarboxylas...    228   2e-66    
emb|CDY47189.1|  BnaAnng08590D                                          227   4e-66    
ref|XP_004229470.1|  PREDICTED: S-adenosylmethionine decarboxylas...    226   6e-66    
ref|XP_009621214.1|  PREDICTED: S-adenosylmethionine decarboxylas...    226   8e-66    
ref|XP_008340886.1|  PREDICTED: S-adenosylmethionine decarboxylas...    226   2e-65    
dbj|BAD97831.1|  S-adenosylmethionine decarboxylase                     221   2e-65    
gb|KDO74922.1|  hypothetical protein CISIN_1g041801mg                   225   2e-65    
ref|XP_003609535.1|  S-adenosylmethionine decarboxylase proenzyme       224   7e-65    
ref|XP_006365286.1|  PREDICTED: S-adenosylmethionine decarboxylas...    222   3e-64    
ref|XP_008618635.1|  adenosylmethionine decarboxylase                   223   3e-64    
dbj|BAE72687.1|  S-adenosylmethionine decarboxylase                     217   4e-64    
gb|KDO25305.1|  adenosylmethionine decarboxylase                        224   4e-64    
ref|XP_009781838.1|  PREDICTED: S-adenosylmethionine decarboxylas...    221   5e-64    
gb|AID66751.1|  S-adenosylmethionine decarboxylase protein              216   9e-64    
gb|AFY06653.1|  s-adenosyl methionine decarboxylase                     217   3e-63    
ref|XP_004963441.1|  PREDICTED: S-adenosylmethionine decarboxylas...    220   3e-63    
gb|AGV09140.1|  S-adenosyl methionine decarboxylase                     212   3e-62    
gb|ADG38373.1|  AT3G02470-like protein                                  209   8e-61    
gb|AEN81738.1|  AT3G02470-like protein                                  209   8e-61    
gb|ADG38371.1|  AT3G02470-like protein                                  208   1e-60    
gb|ADG38369.1|  AT3G02470-like protein                                  208   2e-60    
gb|ADG38370.1|  AT3G02470-like protein                                  207   3e-60    
gb|ADG38368.1|  AT3G02470-like protein                                  207   5e-60    
ref|XP_003082560.1|  S-adenosylmethionine decarboxylase (ISS)           213   6e-60    
gb|ADG38367.1|  AT3G02470-like protein                                  206   2e-59    
emb|CBI26155.3|  unnamed protein product                                209   3e-59    
ref|XP_002957689.1|  hypothetical protein VOLCADRAFT_84198              210   3e-59    
gb|ADG38372.1|  AT3G02470-like protein                                  204   6e-59    
emb|CAB64671.1|  S-adenosylmethionine decarboxylase 1                   201   3e-58    
ref|XP_009845291.1|  S-adenosylmethionine decarboxylase proenzyme       204   5e-57    
gb|EAY96506.1|  hypothetical protein OsI_18408                          203   6e-57    
gb|KCW60900.1|  hypothetical protein EUGRSUZ_H03638                     201   8e-57    
ref|XP_005642931.1|  S-adenosylmethionine decarboxylase                 201   1e-56    
ref|XP_002502359.1|  adenosylmethionine/pyridoxal dependant decar...    212   2e-56    
ref|XP_008878484.1|  S-adenosylmethionine decarboxylase proenzyme       202   2e-56    
gb|EEE62283.1|  hypothetical protein OsJ_17071                          202   3e-56    
gb|AAS90647.1|  putative S-adenosylmethionine decarboxylase             202   3e-56    
gb|KFM24458.1|  S-adenosylmethionine decarboxylase proenzyme            210   3e-56    
gb|ETL44125.1|  S-adenosylmethionine decarboxylase proenzyme            202   4e-56    
ref|XP_004990813.1|  adenosylmethionine decarboxylase 1 isoform 2       199   2e-55    
ref|XP_001693327.1|  S-adenosylmethionine decarboxylase                 200   4e-55    
ref|XP_008903216.1|  S-adenosylmethionine decarboxylase proenzyme       199   4e-55    
gb|ETL97297.1|  S-adenosylmethionine decarboxylase proenzyme            199   4e-55    
emb|CBJ32442.1|  S-Adenosylmethionine decarboxylase                     199   5e-55    
ref|XP_003292450.1|  hypothetical protein DICPUDRAFT_50446              199   5e-55    
gb|AAT67246.1|  S-adenosylmethionine decarboxylase                      192   8e-55    
ref|XP_002909583.1|  S-adenosylmethionine decarboxylase proenzyme...    199   9e-55    
dbj|GAM22020.1|  hypothetical protein SAMD00019534_051950               197   2e-54    
ref|XP_009514391.1|  hypothetical protein PHYSODRAFT_308542             198   2e-54    
ref|XP_008353081.1|  PREDICTED: S-adenosylmethionine decarboxylas...    193   3e-54    
ref|XP_643401.2|  S-adenosylmethionine decarboxylase                    196   6e-54    
emb|CCI40376.1|  unnamed protein product                                192   4e-52    
gb|EFA85685.1|  S-adenosylmethionine decarboxylase                      189   1e-51    
ref|XP_002882990.1|  hypothetical protein ARALYDRAFT_897930             186   8e-51    
ref|XP_009034111.1|  hypothetical protein AURANDRAFT_21325              186   4e-50    
ref|XP_003114618.1|  CRE-SMD-1 protein                                  186   4e-50    
ref|XP_007514813.1|  S-adenosylmethionine decarboxylase                 186   2e-49    
ref|XP_007892936.1|  PREDICTED: S-adenosylmethionine decarboxylas...    182   5e-49    
ref|XP_004357207.1|  S-adenosylmethionine decarboxylase                 182   1e-48    
emb|CBJ28070.1|  S-Adenosylmethionine decarboxylase                     183   1e-48    



>ref|XP_009796351.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana sylvestris]
Length=382

 Score =   464 bits (1194),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 280/368 (76%), Gaps = 21/368 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEG+EKRLEI+FT PP+F DP G+GLR LTR QLDSILEPA CTIV  L   EFDS
Sbjct  8     SDIGFEGYEKRLEITFTEPPMFTDPNGLGLRALTRSQLDSILEPAGCTIVLHLSNIEFDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKI+LKTCGTT+LLLS+P ILKLA+ LSLGV+SVKYSRGTF+FQNSQ 
Sbjct  68    YVLSESSLFIYPLKIILKTCGTTKLLLSIPRILKLAEELSLGVNSVKYSRGTFIFQNSQS  127

Query  477   APHRSFSEEVAFLNSQFKNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET---TVEICM  647
             APHRSFSEEVAFLNS FKNG A+VLGD  SP RNWHVYVA VG      +T   T+E+CM
Sbjct  128   APHRSFSEEVAFLNSFFKNGHAYVLGDLNSPSRNWHVYVANVGPRKLTNQTDGITLEMCM  187

Query  648   TGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYSTV  824
             TGL REK A+FFK+ G D  EMTKMS I ++IPSH ICDFEF+PCGYSMNG+DGA YSTV
Sbjct  188   TGLKREKTAVFFKKSGEDSCEMTKMSGISEIIPSHEICDFEFEPCGYSMNGIDGATYSTV  247

Query  825   HVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWRGG  1004
             HVTPE+GF+YASYEAMG++   +GLE L+KRVL CFEPAEFSVA+T  G  +R  I+   
Sbjct  248   HVTPEDGFNYASYEAMGLDPGSIGLEPLIKRVLMCFEPAEFSVAITCHG-GSRGDIF---  303

Query  1005  NADVDRYACRFRVTQELPGDGRIDYRCFT---------TNKVASRPSA---LQCWKETEE  1148
              ADV+ Y+C   + Q+LPG G I YRCFT         T  VA+   +    +C KE  E
Sbjct  304   -ADVEGYSCDNCINQDLPGGGYIVYRCFTVIAEAEKGRTVHVATNSDSKMVARCLKELSE  362

Query  1149  EVAVVGGL  1172
                V GG+
Sbjct  363   MAGVGGGV  370



>ref|XP_009618361.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana tomentosiformis]
Length=376

 Score =   456 bits (1174),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 241/372 (65%), Positives = 269/372 (72%), Gaps = 29/372 (8%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEG+EKRLEI+FT PP+F DP G+GLR LTR QLDSILEPA CTIVS L   EFDS
Sbjct  8     SVIGFEGYEKRLEITFTEPPMFTDPNGLGLRALTRSQLDSILEPACCTIVSHLSNTEFDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKI+LKTCGTT+LLLS+P ILKLA+ LSLGVDSVKYSRGTF+FQN Q 
Sbjct  68    YVLSESSLFIYPLKIILKTCGTTKLLLSIPRILKLAEKLSLGVDSVKYSRGTFIFQNYQL  127

Query  477   APHRSFSEEVAFLNSQFKNGVAFVLGDPESPGRNWHVYVAEVGS---GAPAPETTVEICM  647
              PHRSFSEEVAFLN  FKNG A+VLGD  S  RNWHVYVA VG         E  VE+CM
Sbjct  128   TPHRSFSEEVAFLNLFFKNGHAYVLGDLSSLSRNWHVYVANVGPRKLTNRTDEINVEMCM  187

Query  648   TGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYSTV  824
               L REK A+FFK+ G D  EMTKMS I ++IPSH ICDFEF+PCGYSMNG+DGAAYSTV
Sbjct  188   MCLKREKTAVFFKKSGEDFYEMTKMSGISEIIPSHEICDFEFEPCGYSMNGIDGAAYSTV  247

Query  825   HVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWRGG  1004
             HVTPE+GFSYASYEAMG++L  +GLE L+KRVL CFEPAEFSVAVT  G    D      
Sbjct  248   HVTPEDGFSYASYEAMGLDLGSIGLEPLIKRVLTCFEPAEFSVAVTCHGGSQWDIF----  303

Query  1005  NADVDRYACRFRVTQELPGDGRIDYRCFTT-----------------NKVASRPSAL---  1124
              ADVD Y+C   V Q+LPG   I YRCFT                  +K A    ++   
Sbjct  304   -ADVDGYSCDNCVKQDLPGGEYIVYRCFTMAAEAEGGCAVHAAANSDSKTADHSDSMMVA  362

Query  1125  QCWKETEEEVAV  1160
              CWKE  E  AV
Sbjct  363   HCWKELVEAEAV  374



>emb|CDP02875.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   448 bits (1153),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 230/357 (64%), Positives = 271/357 (76%), Gaps = 21/357 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEI+F+ PP+FRDP G GLR LTR QLDSILEPA CTIVS+L  AEFDS
Sbjct  4     SAIGFEGFEKRLEIAFSEPPVFRDPNGQGLRALTRSQLDSILEPACCTIVSQLSNAEFDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F++P KI+LKTCGTT+LLLS+P ILKLAD LSLGV+SVKYSRGTFVFQN+QP
Sbjct  64    YVLSESSLFVFPFKIILKTCGTTKLLLSIPPILKLADSLSLGVNSVKYSRGTFVFQNAQP  123

Query  477   APHRSFSEEVAFLNSQFKNGVAFVLGDPESPGRNWHVYVAEVG---SGAPAPETTVEICM  647
             APHR+FSEEVAFLN+ FK+G  +VL DP    RNWHVYVA+VG   S  P P   +E+CM
Sbjct  124   APHRTFSEEVAFLNAYFKDGSGYVLSDPNFQNRNWHVYVAQVGPLKSDYPKPVFNLEMCM  183

Query  648   TGLSREKAAMFFKRPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYSTVH  827
             TGL  EKAA+FFK   G  +MTKMS I ++IPSH++CD+EF+PCGYSMNG++G+AYSTVH
Sbjct  184   TGLDGEKAAVFFKTSDGYNQMTKMSGISEIIPSHLVCDYEFEPCGYSMNGIEGSAYSTVH  243

Query  828   VTPEEGFSYASYEAMGVEL---SLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD----  986
             VTPE GFSYASYE+MG++    +L GL +LV RVL CF PAEFSVAVT  G   R     
Sbjct  244   VTPEAGFSYASYESMGLDFGSENLGGLGSLVNRVLRCFGPAEFSVAVTCLGGGDRCGEEH  303

Query  987   -KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTN-------KVASRPSALQCW  1133
              + W G   DV+ Y C   V QELPG G + YRCF  +       +V +  S L CW
Sbjct  304   LEFWGG---DVEGYRCETGVRQELPGGGCVFYRCFAASRGGKEECRVGTPKSVLHCW  357



>gb|EYU37130.1| hypothetical protein MIMGU_mgv1a008734mg [Erythranthe guttata]
Length=364

 Score =   425 bits (1092),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 228/360 (63%), Positives = 260/360 (72%), Gaps = 26/360 (7%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEI+F+ PP      G GLR LTR+QLDSILE A CTIVS L   EFDS
Sbjct  4     SAIGFEGFEKRLEIAFSGPP-----NGPGLRALTRNQLDSILELACCTIVSHLSNTEFDS  58

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YPLKI+LKTCGTT+LLLSVP ILKLAD LSL   SV+YSRGTF+FQN+QP
Sbjct  59    YVLSESSLFVYPLKIILKTCGTTKLLLSVPQILKLADSLSLVYRSVRYSRGTFIFQNTQP  118

Query  477   APHRSFSEEVAFLNSQFKNGVAFVLGDPESPGRNWHVYVAEVGSGAPAP--------ETT  632
             APHRSFSEE AFLN+ F+NG  ++LGDP  P RNWHVYVA V    P P           
Sbjct  119   APHRSFSEEAAFLNTYFENGSGYLLGDPSCPNRNWHVYVAAVD---PDPLRGSDYMTGVN  175

Query  633   VEICMTGLSREKAAMFFKR--PGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             +E+CMTGL REKAA+FF     GG G MTKMS I D++P H ICDFEF+PCGYSMN ++G
Sbjct  176   LEMCMTGLDREKAAVFFNSGGGGGGGRMTKMSGIDDILPGHEICDFEFEPCGYSMNAIEG  235

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             AAYSTVHVTPE+GFSYASYEAMG+EL  VG E L+KRVL CF+P EFS+AVT       +
Sbjct  236   AAYSTVHVTPEDGFSYASYEAMGLELGSVGFEPLLKRVLRCFKPEEFSLAVTCQRGGGLE  295

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK-----VASRPSALQCWKETEEE  1151
              IW G   DVD Y C   V Q LPG G + YRCF   +       +  SA+ CWKE  EE
Sbjct  296   NIWFG---DVDGYTCENAVVQPLPGGGWVVYRCFAAEERRCVATTTANSAMHCWKEVAEE  352



>ref|XP_010268432.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nelumbo nucifera]
Length=390

 Score =   420 bits (1079),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 220/369 (60%), Positives = 267/369 (72%), Gaps = 22/369 (6%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             SSAIGFEGFEKRLEI+FT  P+F DP+G+GLR LTR QLDSILEPA CTIV +L  +EFD
Sbjct  15    SSAIGFEGFEKRLEITFTEAPVFVDPQGLGLRALTRAQLDSILEPARCTIVDQLSNSEFD  74

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YPLKI+LKTCGTT+LLLS+P IL+LA+ L+L V SVKYSRG+F+F N+Q
Sbjct  75    SYVLSESSLFVYPLKIILKTCGTTKLLLSIPPILELANSLTLSVYSVKYSRGSFIFPNAQ  134

Query  474   PAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAE-----VGSGAPAPE  626
             PAPH SFSEEVA LN  F N    G A+V GDP  P RNWHVY A               
Sbjct  135   PAPHTSFSEEVAVLNGFFGNLPSGGQAYVTGDPAVPNRNWHVYAASQKPPMSSMNDQTAA  194

Query  627   TTVEICMTGLSREKAAMFFKRPGG--DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
              T+E+CMTGL RE A++FFK+       EMTK++ I D++PSH ICDF+FDPCGYSMN +
Sbjct  195   VTLEMCMTGLDRECASVFFKKSEDYTAKEMTKLAGISDILPSHEICDFDFDPCGYSMNAI  254

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             DG AYST+HVTPE+GFSYASYEAMG++   VGLE L++RVL CF PA+FS+AVT FG  A
Sbjct  255   DGGAYSTIHVTPEDGFSYASYEAMGLDPGSVGLEPLLRRVLRCFRPAQFSIAVTHFGGGA  314

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK------VASRPSALQCWKET  1142
              +  W G +  V+ Y C   V QE+PG G + YRCFT  +       +S  S L CW++ 
Sbjct  315   EE--W-GDDVSVEGYRCENVVKQEMPGGGCVLYRCFTGAEKGCVLFSSSPKSILHCWEDV  371

Query  1143  --EEEVAVV  1163
               EEE+  V
Sbjct  372   VAEEEMESV  380



>gb|KGN61070.1| hypothetical protein Csa_2G036680 [Cucumis sativus]
Length=389

 Score =   419 bits (1078),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/362 (59%), Positives = 264/362 (73%), Gaps = 15/362 (4%)
 Frame = +3

Query  93    AAMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSE  272
             A+  E   S IGFEGFEKRLEI+F+ PP+F+DP G+GLR LTR QLDSILEPA CTIVS 
Sbjct  10    ASAPEQPPSPIGFEGFEKRLEITFSEPPIFQDPEGLGLRALTRTQLDSILEPACCTIVSH  69

Query  273   LFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGT  452
             L  ++FDSYVLSESS+F+YP  I+LKTCGTT+LLLS+P+IL+LAD LSL   SVKYSRGT
Sbjct  70    LSNSDFDSYVLSESSLFVYPRAIILKTCGTTKLLLSIPIILQLADSLSLAAVSVKYSRGT  129

Query  453   FVFQNSQPAPHRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVA-EVGSGAPAP  623
             F+F + QPAPHRSFSEEV  LN  F   +  A+VLGDP  P RNWH+Y A +  S     
Sbjct  130   FIFPDYQPAPHRSFSEEVTALNVYFGHFHSEAYVLGDPAVPNRNWHIYSAVKTHSNVNRM  189

Query  624   E-TTVEICMTGLSREKAAMFFKRPGGDG----EMTKMSRICDVIPSHVICDFEFDPCGYS  788
             +  ++EICMTGL+REKAA+FFK+PGG+     +MTKMS+I ++IP+H+ICDFEFDPCGYS
Sbjct  190   DLVSLEICMTGLNREKAAVFFKKPGGEDSSAEKMTKMSKISEIIPNHIICDFEFDPCGYS  249

Query  789   MNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRF  968
             MNG++GAAYSTVHVTPE+GFSYASYEAMG +   +    LV RVL CF PAEFS+A T  
Sbjct  250   MNGIEGAAYSTVHVTPEDGFSYASYEAMGFDTMELPFSELVNRVLRCFSPAEFSIATT-C  308

Query  969   GVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKV------ASRPSALQC  1130
             G     + W   +ADV+ Y C   V QE+ G   + YR ++ ++       A +   +QC
Sbjct  309   GDGDNSRSWAVDHADVEGYTCENVVKQEMVGGELVVYRTYSVDRRRCVEAPACKTLLMQC  368

Query  1131  WK  1136
             WK
Sbjct  369   WK  370



>ref|XP_004144715.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Cucumis sativus]
Length=434

 Score =   417 bits (1073),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/359 (59%), Positives = 263/359 (73%), Gaps = 15/359 (4%)
 Frame = +3

Query  102   AEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFG  281
             +E   S IGFEGFEKRLEI+F+ PP+F+DP G+GLR LTR QLDSILEPA CTIVS L  
Sbjct  58    SEQPPSPIGFEGFEKRLEITFSEPPIFQDPEGLGLRALTRTQLDSILEPACCTIVSHLSN  117

Query  282   AEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVF  461
             ++FDSYVLSESS+F+YP  I+LKTCGTT+LLLS+P+IL+LAD LSL   SVKYSRGTF+F
Sbjct  118   SDFDSYVLSESSLFVYPRAIILKTCGTTKLLLSIPIILQLADSLSLAAVSVKYSRGTFIF  177

Query  462   QNSQPAPHRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVA-EVGSGAPAPE-T  629
              + QPAPHRSFSEEV  LN  F   +  A+VLGDP  P RNWH+Y A +  S     +  
Sbjct  178   PDYQPAPHRSFSEEVTALNVYFGHFHSEAYVLGDPAVPNRNWHIYSAVKTHSNVNRMDLV  237

Query  630   TVEICMTGLSREKAAMFFKRPGGDG----EMTKMSRICDVIPSHVICDFEFDPCGYSMNG  797
             ++EICMTGL+REKAA+FFK+PGG+     +MTKMS+I ++IP+H+ICDFEFDPCGYSMNG
Sbjct  238   SLEICMTGLNREKAAVFFKKPGGEDSSAEKMTKMSKISEIIPNHIICDFEFDPCGYSMNG  297

Query  798   MDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVP  977
             ++GAAYSTVHVTPE+GFSYASYEAMG +   +    LV RVL CF PAEFS+A T  G  
Sbjct  298   IEGAAYSTVHVTPEDGFSYASYEAMGFDTMELPFSELVNRVLRCFSPAEFSIATT-CGDG  356

Query  978   ARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKV------ASRPSALQCWK  1136
                + W   +ADV+ Y C   V QE+ G   + YR ++ ++       A +   +QCWK
Sbjct  357   DNSRSWAVDHADVEGYTCENVVKQEMVGGELVVYRTYSVDRRRCVEAPACKTLLMQCWK  415



>ref|XP_004163988.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Cucumis sativus]
Length=434

 Score =   417 bits (1073),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/360 (59%), Positives = 263/360 (73%), Gaps = 17/360 (5%)
 Frame = +3

Query  102   AEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFG  281
             +E   S IGFEGFEKRLEI+F+ PP+F+DP G+GLR LTR QLDSILEPA CTIVS L  
Sbjct  58    SEQPPSPIGFEGFEKRLEITFSEPPIFQDPEGLGLRALTRTQLDSILEPACCTIVSHLSN  117

Query  282   AEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVF  461
             ++FDSYVLSESS+F+YP  I+LKTCGTT+LLLS+P+IL+LAD LSL   SVKYSRGTF+F
Sbjct  118   SDFDSYVLSESSLFVYPRAIILKTCGTTKLLLSIPIILQLADSLSLAAVSVKYSRGTFIF  177

Query  462   QNSQPAPHRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPE---  626
              + QPAPHRSFSEEV  LN  F   +  A+VLGDP  P RNWH+Y A V S +       
Sbjct  178   PDYQPAPHRSFSEEVTALNVYFGHFHSEAYVLGDPAVPNRNWHIYSA-VKSHSNVNRMDL  236

Query  627   TTVEICMTGLSREKAAMFFKRPGGDG----EMTKMSRICDVIPSHVICDFEFDPCGYSMN  794
              ++EICMTGL+REKAA+FFK+PGG+     +MTKMS+I ++IP+H+ICDFEFDPCGYSMN
Sbjct  237   VSLEICMTGLNREKAAVFFKKPGGEDSSAEKMTKMSKISEIIPNHIICDFEFDPCGYSMN  296

Query  795   GMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGV  974
             G++GAAYSTVHVTPE+GFSYASYEAMG +   +    LV RVL CF PAEFS+A T  G 
Sbjct  297   GIEGAAYSTVHVTPEDGFSYASYEAMGFDTMELPFSELVNRVLRCFSPAEFSIATT-CGD  355

Query  975   PARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKV------ASRPSALQCWK  1136
                 + W   +ADV+ Y C   V QE+ G   + YR ++ ++       A +   +QCWK
Sbjct  356   GDSSRSWAVDHADVEGYTCENVVKQEMVGGELVVYRTYSVDRRRCVEAPACKTFLMQCWK  415



>ref|XP_011079446.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Sesamum indicum]
Length=372

 Score =   411 bits (1056),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 212/338 (63%), Positives = 249/338 (74%), Gaps = 9/338 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEGFEKRLEI+F+ P +F DP G+GLR L R Q+DSILEPA CTIVS+L  +E DS
Sbjct  4     SPIGFEGFEKRLEITFSEPAMFLDPNGLGLRSLNRAQIDSILEPACCTIVSQLSNSEVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKIV+KTCGTT+LL S+P IL+LA  +SL V SV+YSRGTF+F+N+QP
Sbjct  64    YVLSESSLFIYPLKIVMKTCGTTKLLHSIPQILELAGSISLAVRSVRYSRGTFIFENAQP  123

Query  477   APHRSFSEEVAFLNSQFKNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTV----EIC  644
             APHRSF+EEV FLNS FKNG  ++LGDP  P RNWHVYVAEV S     + TV    E+C
Sbjct  124   APHRSFTEEVDFLNSYFKNGSGYLLGDPSFPNRNWHVYVAEVESEKAVADPTVGVNLEMC  183

Query  645   MTGLSREKAAMFFKRPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYSTV  824
             MTGL REKAA+FFK PG DGEMTK S I ++IPSH ICDFEF+PCGYSMN ++GA+YSTV
Sbjct  184   MTGLDREKAAVFFKNPGTDGEMTKTSGINEIIPSHEICDFEFEPCGYSMNAIEGASYSTV  243

Query  825   HVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWRGG  1004
             HVTPE+GFSYASYEAMG++   V L  L+ RVL CF P EFSVA+T    P        G
Sbjct  244   HVTPEDGFSYASYEAMGLDFGSVELRPLIGRVLRCFRPKEFSVAIT---CPNGSLPEECG  300

Query  1005  NADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPS  1118
               DV+ YA    V + L     + Y CFT       PS
Sbjct  301   --DVEGYALESAVVKPLSSSTCVIYWCFTAGGRVEGPS  336



>ref|XP_008452459.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Cucumis melo]
Length=433

 Score =   410 bits (1055),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 261/360 (73%), Gaps = 17/360 (5%)
 Frame = +3

Query  102   AEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFG  281
             +E   S IGFEGFEKRLEI+F+ PP+F+DP G+GLR LTR QLDSILEPA CTIVS L  
Sbjct  57    SEQPPSPIGFEGFEKRLEITFSEPPIFQDPEGLGLRALTRAQLDSILEPACCTIVSHLSN  116

Query  282   AEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVF  461
             ++FDSYVLSESS+F+YP  I+LKTCGTT+LLLS+P+IL+LAD LSL   SVKYSRGTF+F
Sbjct  117   SDFDSYVLSESSLFVYPRTIILKTCGTTKLLLSIPIILQLADSLSLAAVSVKYSRGTFIF  176

Query  462   QNSQPAPHRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPE---  626
              + QPAPHRSFSEEV  LN  F   +  A+V+GDP  P RNWH+Y A V S +       
Sbjct  177   PDYQPAPHRSFSEEVTALNVYFGHFHSEAYVIGDPAVPNRNWHIYSA-VKSHSNVNRMDL  235

Query  627   TTVEICMTGLSREKAAMFFKRPGGDG----EMTKMSRICDVIPSHVICDFEFDPCGYSMN  794
              ++EICMTGL+REKAA+FFK+PG +     +MTKMS+I ++IP+H+ICDFEFDPCGYSMN
Sbjct  236   VSLEICMTGLNREKAAVFFKKPGEEDSSAEKMTKMSKISEIIPTHIICDFEFDPCGYSMN  295

Query  795   GMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGV  974
             G++G AYSTVHVTPE+GFSYASYEAMG +   +    LV RVL CF PAEFS+A T  G 
Sbjct  296   GIEGTAYSTVHVTPEDGFSYASYEAMGFDAMELPFSELVNRVLRCFSPAEFSIAAT-CGD  354

Query  975   PARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKV------ASRPSALQCWK  1136
                 + W   ++DV+ Y C   V QE+ G   + YR +T ++       A +   +QCWK
Sbjct  355   GDSFRSWAVDHSDVEGYTCENVVKQEMLGGELLVYRTYTVDRRRYVEAPACKTLLMQCWK  414



>ref|XP_010277986.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nelumbo nucifera]
Length=391

 Score =   405 bits (1042),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 216/371 (58%), Positives = 264/371 (71%), Gaps = 25/371 (7%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEI+F+  P+F DP+G+GLR LTR QLDSILEPA CTIV++L  +EFDS
Sbjct  16    SAIGFEGFEKRLEITFSEAPVFVDPQGLGLRALTRAQLDSILEPAKCTIVAQLSNSEFDS  75

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YPLKI+LKTCGTT+LLLS+P IL+LA+ LSL V SVKYSRG+F+F  +QP
Sbjct  76    YVLSESSLFVYPLKIILKTCGTTKLLLSIPPILELANSLSLSVYSVKYSRGSFIFPTAQP  135

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPE-----T  629
             APHR FSEEV+ LN  F N    G A+V+GDP  P RNWHVY A       +        
Sbjct  136   APHRGFSEEVSVLNGFFGNLASGGQAYVIGDPAVPNRNWHVYAACQNPSTSSRNDQTVVV  195

Query  630   TVEICMTGLSREKAAMFFKRPGG--DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
             T+E+CMTGL R++AA+FFK+       EMTK++ I D++PSH ICDF+FDPCGYSMNG+D
Sbjct  196   TLEMCMTGLDRDRAAVFFKKSADYTAKEMTKLAGISDILPSHEICDFDFDPCGYSMNGID  255

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR  983
             G A+ST+HVTPE+GFSYASYEAMG++   VGL  LVKRVL CF PA FS+AVT +G   R
Sbjct  256   GEAFSTIHVTPEDGFSYASYEAMGLDPGSVGLGPLVKRVLGCFGPARFSIAVTCYG---R  312

Query  984   DKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVA-----SRPSALQCWKE---  1139
                W   +  V+ Y C   V QE+PG   + YR FT  +       S  S L CW+E   
Sbjct  313   VDEWE-NDLGVEGYTCEEVVKQEVPGGRCVVYRSFTAIEKGCVVYPSPKSTLHCWEEIAG  371

Query  1140  --TEEEVAVVG  1166
                EE  +VVG
Sbjct  372   LVAEEMESVVG  382



>gb|KDO62315.1| hypothetical protein CISIN_1g035670mg [Citrus sinensis]
Length=376

 Score =   404 bits (1038),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 215/364 (59%), Positives = 260/364 (71%), Gaps = 17/364 (5%)
 Frame = +3

Query  111   LSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEF  290
             ++S IGFEGFEKRLEI+F+P P+F DP G+GLR LTR QLDS L+ A CTIVS+L   EF
Sbjct  9     VASPIGFEGFEKRLEITFSPAPIFTDPSGLGLRALTRSQLDSFLDLAKCTIVSQLSNTEF  68

Query  291   DSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNS  470
             DSYVLSESS+F++P KI+LKTCGTT+LL S+P ILKL+D LSL V SVKYSRG+F+F N 
Sbjct  69    DSYVLSESSLFVFPSKIILKTCGTTKLLSSIPQILKLSDSLSLAVSSVKYSRGSFIFPNY  128

Query  471   QPAPHRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             QP+PH  FSEEV+ LN  F   N  A V+GDP+ P RNWHVY A           T+E+C
Sbjct  129   QPSPHCCFSEEVSTLNEHFGYLNAKAHVIGDPKFPNRNWHVYSASKERSFDG-VVTLEMC  187

Query  645   MTGLSREKAAMFFKR---PGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             MTGL R+KAA+F+K    PGG  EMTKMS I +++PSHVICDFEFDPCGYSMNG+DG A+
Sbjct  188   MTGLDRKKAAVFYKSSSGPGGASEMTKMSGISEILPSHVICDFEFDPCGYSMNGIDGPAF  247

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             STVHVTPE+GFSYASYEA G +L LV  E LVKRVLN F P EFSVAVT     +  + W
Sbjct  248   STVHVTPEDGFSYASYEAAGFDLRLVRFEPLVKRVLNSFAPREFSVAVT---CGSGTQWW  304

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVA----SRPSAL--QCWKE--TEEE  1151
                 ADV+ Y+    V QEL G G + Y+ ++ +  A    S P  +   CWKE   EEE
Sbjct  305   SMEGADVEGYSSETAVKQELAGGGCVVYKTYSVDPNARCAVSAPPKVPKHCWKEVAAEEE  364

Query  1152  VAVV  1163
              ++V
Sbjct  365   SSMV  368



>ref|XP_006453539.1| hypothetical protein CICLE_v10010502mg [Citrus clementina]
 ref|XP_006474062.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Citrus sinensis]
 gb|ESR66779.1| hypothetical protein CICLE_v10010502mg [Citrus clementina]
Length=376

 Score =   400 bits (1029),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 213/364 (59%), Positives = 259/364 (71%), Gaps = 17/364 (5%)
 Frame = +3

Query  111   LSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEF  290
             ++S IGFEGFEKRLEI+F+P P+F DP G+GLR LTR QLDS L+ A CTIVS+L   EF
Sbjct  9     VASPIGFEGFEKRLEITFSPAPIFTDPSGLGLRALTRSQLDSFLDLAKCTIVSQLSNTEF  68

Query  291   DSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNS  470
             DSYVLSESS+F++P KI+LKTCGTT+LL S+P ILKL+D LSL V SVKYSRG+F+F N 
Sbjct  69    DSYVLSESSLFVFPSKIILKTCGTTKLLSSIPQILKLSDSLSLAVSSVKYSRGSFIFPNY  128

Query  471   QPAPHRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             QP+PH  FSEEV+ LN  F   N  A V+GDP+ P RNWHVY A       +   T+E+C
Sbjct  129   QPSPHCCFSEEVSTLNEHFGYLNAKAHVIGDPKFPNRNWHVYSASKERSFDS-VVTLEMC  187

Query  645   MTGLSREKAAMFFKR---PGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             MTGL R+KAA+F+K      G GEMTKMS I +++PSHVICDFEFDPCGYSMNG+DG A+
Sbjct  188   MTGLDRKKAAVFYKSSSGAAGAGEMTKMSGISEILPSHVICDFEFDPCGYSMNGIDGPAF  247

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             STVHVTPE+GFSYASYEA G +L LV  E +VKRVLN F P EFSVAVT     +  + W
Sbjct  248   STVHVTPEDGFSYASYEAAGFDLGLVRFEPVVKRVLNSFAPREFSVAVT---CGSGTQWW  304

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVA----SRPSAL--QCWKE--TEEE  1151
                 ADV+ Y+    V QEL G G + Y+ ++ +  A    S P  +   CWKE   EEE
Sbjct  305   SMEGADVEGYSSETAVKQELAGGGCVVYKTYSVDPNARCAVSAPPKVPNHCWKEVAAEEE  364

Query  1152  VAVV  1163
               +V
Sbjct  365   SGMV  368



>ref|XP_010687660.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Beta vulgaris subsp. vulgaris]
Length=399

 Score =   399 bits (1025),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 212/363 (58%), Positives = 261/363 (72%), Gaps = 23/363 (6%)
 Frame = +3

Query  111   LSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEF  290
             + S IGFEGFEKRLEI+F+ PP+F DP G+GLR LTR QLDSIL+ A CTIVS L  + F
Sbjct  3     IVSGIGFEGFEKRLEITFSNPPIFTDPNGLGLRSLTRSQLDSILDAASCTIVSNLSNSIF  62

Query  291   DSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNS  470
             DSYVLSESS+F+Y  KI+LKTCGTT+LL S+  ILKLA+ + L V SV YSRGTF+F ++
Sbjct  63    DSYVLSESSLFVYTNKIILKTCGTTKLLYSIDSILKLAESVGLTVSSVLYSRGTFIFPDA  122

Query  471   QPAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGA--PAPETT  632
             Q APHRSFSEEV++LN  F N      A+VLGDP +  R+WHVY A   +         T
Sbjct  123   QTAPHRSFSEEVSYLNGYFGNLASGSHAYVLGDPTAKNRSWHVYSASDVTDVEDQTDVVT  182

Query  633   VEICMTGLSREKAAMFFKRPGG-DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             +E+CMTGL++EKA++F+K+ G    EMTKMS I D+IPSHVICDF+FDPCGYSMNG+DG 
Sbjct  183   LEMCMTGLNKEKASVFYKKEGHLAKEMTKMSGIDDIIPSHVICDFDFDPCGYSMNGIDGG  242

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVP-ARD  986
             AYSTVHVTPE+GFSYASYEAMG +  LV  EA+V+R L CF+P+EF++AVT FG   AR+
Sbjct  243   AYSTVHVTPEDGFSYASYEAMGFDPGLVRFEAVVRRALGCFDPSEFTIAVTCFGGGLARE  302

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPS----------ALQCWK  1136
              +  GG  DV+ + CR  V QELPG G I Y+ F    VA  P+          AL CW+
Sbjct  303   WVSMGG-GDVEGFVCRSVVKQELPGGGFIVYKTF----VAETPACVMHAPLPILALPCWE  357

Query  1137  ETE  1145
               E
Sbjct  358   RVE  360



>ref|XP_007013911.1| S-adenosylmethionine decarboxylase proenzyme, putative [Theobroma 
cacao]
 gb|EOY31530.1| S-adenosylmethionine decarboxylase proenzyme, putative [Theobroma 
cacao]
Length=386

 Score =   397 bits (1019),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 208/356 (58%), Positives = 252/356 (71%), Gaps = 18/356 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEGFEKRLEI+F  P +F+D  G+GLR L++ QLDSIL+PA C IVS+L    FDS
Sbjct  12    SPIGFEGFEKRLEITFFDPAIFKDTNGLGLRALSKTQLDSILQPACCNIVSQLSNPNFDS  71

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI+LKTCGTT+LLLS+P IL+L++ LSL V  V YSRGTF+F + QP
Sbjct  72    YVLSESSLFVYPNKIILKTCGTTKLLLSIPSILQLSNSLSLTVSRVNYSRGTFIFPDHQP  131

Query  477   APHRSFSEEVAFLNSQFKNGV--AFVLGDPESPGRNWHVYVAEVGSGAPAPE-----TTV  635
             APHR+FSEEV  +N  F + +  A+++GDP  P R+WHVY A      P  E      T+
Sbjct  132   APHRNFSEEVTAVNEFFTDYITEAYIIGDPRFPTRSWHVYSAVAKCSQPLMEDPRALVTL  191

Query  636   EICMTGLSREKAAMFFKRPGGDG----EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
             E+CMTGL REKA +F+K+ G       EMTK S I D+IPSHVICDF+FDPCGYSMNG++
Sbjct  192   EMCMTGLDREKAGVFYKKSGNGNCSAREMTKTSGIADIIPSHVICDFDFDPCGYSMNGIE  251

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR  983
             G AYSTVHVTPEEGFSYASYEAMG +   V LE LVKRVL CF P EFSVAVT  G  AR
Sbjct  252   GLAYSTVHVTPEEGFSYASYEAMGFDTDSVKLEPLVKRVLTCFCPNEFSVAVTCHGGGAR  311

Query  984   DKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTN--KVASRPSA---LQCWK  1136
                W    ADV+ Y+ R+ V QELPG G + Y  + +   +   R  A   +QCWK
Sbjct  312   --FWAMEGADVEGYSRRYMVKQELPGGGCVVYWTYFSKGERCTLRAPAKLTMQCWK  365



>ref|XP_010656641.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Vitis vinifera]
Length=387

 Score =   393 bits (1009),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 262/359 (73%), Gaps = 21/359 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEGFEKRL+I+F+  P+F DPRG+GLR LTR QLD IL+ A CTIV+ L  +E DS
Sbjct  16    SPIGFEGFEKRLQITFSEAPIFIDPRGLGLRALTRSQLDLILDAACCTIVNHLSNSELDS  75

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI+LKTCGTT+LLLS+P IL+LA+ L L V SVKYSRG+F+F N+QP
Sbjct  76    YVLSESSLFVYPNKIILKTCGTTKLLLSIPPILQLAESLQLTVVSVKYSRGSFIFPNAQP  135

Query  477   APHRSFSEEVAFLNSQFKN--GVAFVLGDPESPGRNWHVYVA--EVGSGAPAPE----TT  632
             APHRSFSEEVA LN  F +    A+V+GDP  P RNWH+Y A  EV       E     T
Sbjct  136   APHRSFSEEVAALNVFFGDLSPKAYVIGDPAIPNRNWHIYSASKEVRRSPLVREEVAVIT  195

Query  633   VEICMTGLSREKAAMFFKRPGGDG---EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
             VE+CMTGL R+KA++FFK+ G +    EMTK+S I DV+P+HVICDFEFDPCGYSMNG++
Sbjct  196   VEMCMTGLDRDKASVFFKKSGEEDSAKEMTKLSGISDVMPTHVICDFEFDPCGYSMNGVE  255

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA-  980
             G A STVHVTPEEGFSYASYEAMG +   VG++ L+KRVL CF P++FSVAVT    PA 
Sbjct  256   GGALSTVHVTPEEGFSYASYEAMGFDPGSVGMKTLMKRVLACFGPSQFSVAVT---CPAG  312

Query  981   RDKIW-RGGNADVDRYACRFRVTQEL-PGDGRIDYRCFTTNK----VASRPSALQCWKE  1139
              D+ W   G  +V+ YAC+  V QEL  G+G + Y  +   +    V S  S LQCWK+
Sbjct  313   DDERWAMEGCGEVEGYACQNVVKQELSSGEGCVVYVTYEAEEKGCAVNSPKSVLQCWKD  371



>emb|CAN76946.1| hypothetical protein VITISV_017165 [Vitis vinifera]
Length=476

 Score =   395 bits (1014),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 214/363 (59%), Positives = 263/363 (72%), Gaps = 21/363 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEGFEKRL+ +F+  P+F DP+G+GLR LTR QLDSIL+ A CTIV+ L  +E DS
Sbjct  16    SPIGFEGFEKRLQJTFSEAPIFIDPQGLGLRALTRSQLDSILDAACCTIVNHLSNSELDS  75

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI+LKTCGTT+LLL++P IL+LA+ L L V SVKYSRG+F+F N+QP
Sbjct  76    YVLSESSLFVYPNKIILKTCGTTKLLLAIPPILRLAESLQLTVVSVKYSRGSFIFPNAQP  135

Query  477   APHRSFSEEVAFLNSQFKN--GVAFVLGDPESPGRNWHVYVA--EVGSGAPAPE----TT  632
             APHRSFSEEVA LN  F +    A+V+GDP  P RNWH+Y A  EV       E     T
Sbjct  136   APHRSFSEEVAALNVFFGDLSPKAYVIGDPAIPNRNWHIYSASKEVRRSPLVREEVAVIT  195

Query  633   VEICMTGLSREKAAMFFKRPGGDG---EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
             VE+CMTGL R+KA++FFK+ G +    EMTK+S I DV+P+HVICDFEFDPCGYSMNG++
Sbjct  196   VEMCMTGLDRDKASVFFKKSGEEDSAKEMTKLSGISDVMPTHVICDFEFDPCGYSMNGVE  255

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA-  980
             G A STVHVTPEEGFSYASYEAMG     VG++ L+KRVL CF P++FSVAVT    PA 
Sbjct  256   GGALSTVHVTPEEGFSYASYEAMGFXPGSVGMKTLMKRVLACFGPSQFSVAVT---CPAG  312

Query  981   RDKIW-RGGNADVDRYACRFRVTQEL-PGDGRIDYRCFTTNK----VASRPSALQCWKET  1142
              D+ W   G  +V+ YAC+  V QEL  G+G + Y  +   +    V S  S LQCWK+ 
Sbjct  313   DDEXWAMEGCGEVEGYACQNVVKQELSSGEGCVVYVTYEAEEKRCAVNSPKSVLQCWKDV  372

Query  1143  EEE  1151
             E E
Sbjct  373   EVE  375



>ref|XP_008793521.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Phoenix dactylifera]
Length=381

 Score =   391 bits (1004),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 205/357 (57%), Positives = 252/357 (71%), Gaps = 16/357 (4%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             M   L+S IGFEG+EKRLEI+F+  PLF DP G GLR LTR Q+DSILEPA CTIV++L 
Sbjct  9     MGSPLASPIGFEGYEKRLEITFSEAPLFVDPLGQGLRALTRAQIDSILEPAQCTIVAQLS  68

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
               +FDSYVLSESS+F+YP KI+LKTCGTT+LLLS+P IL+LA+ LSL V S KYSRGTF+
Sbjct  69    NKDFDSYVLSESSLFVYPYKIILKTCGTTKLLLSIPRILELAEELSLTVLSAKYSRGTFI  128

Query  459   FQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-P  623
               ++QPAPHRSFSEEVA LN  F      G A+V+GDP S   NWH+Y A   +G P  P
Sbjct  129   SPSAQPAPHRSFSEEVAILNQFFGGLASGGNAYVIGDPASSNGNWHIYYA---AGKPELP  185

Query  624   ETTVEICMTGLSREKAAMFFK-----RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYS  788
               T+E+CMTGL+ +KA++F+K           EMTK+S I ++IP   ICDFEFDPCGYS
Sbjct  186   MVTLEMCMTGLNSKKASIFYKNLVDGHSSTANEMTKLSGISEIIPEMEICDFEFDPCGYS  245

Query  789   MNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRF  968
             MNG++G A ST+HVTPE GFSYASYEAMG     V    L+KRVL+CF+P+EFSVAVT F
Sbjct  246   MNGINGLALSTIHVTPENGFSYASYEAMGFNPDRVVYGDLIKRVLHCFDPSEFSVAVTIF  305

Query  969   GVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKV--ASRPSALQCW  1133
             G   +   W G   DV+ Y C+  V QEL G G + Y+ F+ +K+   S    L CW
Sbjct  306   GGRGQAGTW-GKMVDVNGYTCKDLVEQELAGGGLLMYQTFSASKLKAVSPRCVLHCW  361



>ref|XP_010687659.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Beta vulgaris subsp. vulgaris]
Length=434

 Score =   393 bits (1009),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 207/357 (58%), Positives = 249/357 (70%), Gaps = 15/357 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEI+F+  P+F DP G+GLR LTR QLDS L+ A CTIV+EL  +EFDS
Sbjct  17    SAIGFEGFEKRLEITFSNVPMFSDPTGLGLRSLTRAQLDSFLDEAACTIVAELSNSEFDS  76

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI+LKTCGTT+LLL++  +LKLAD + L V SV YSRGTF+F N+Q 
Sbjct  77    YVLSESSLFVYPHKIILKTCGTTKLLLAIEPVLKLADSVGLSVLSVLYSRGTFIFPNAQV  136

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPE--TTVE  638
             APHRSFSEEV++LN  F N      A+VLGDP     NWH+Y A   +         TVE
Sbjct  137   APHRSFSEEVSYLNRYFGNLGSGPHAYVLGDPTVQNCNWHIYSASCVADVEDRRGVVTVE  196

Query  639   ICMTGLSREKAAMFFKRPGG-DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL+REKAA+F+K+ G    EMTKMS+I D+I SH ICD +FDPCGYSMNG+DG AY
Sbjct  197   MCMTGLNREKAAVFYKKEGHLAKEMTKMSKINDIISSHEICDVDFDPCGYSMNGVDGGAY  256

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRF-GVPARDKI  992
             STVHVTPE+GFSYASYE MG +   +  E LV+R L CFEP EF++AVT F GV ARD +
Sbjct  257   STVHVTPEDGFSYASYEVMGFDSGSIRFEPLVQRALRCFEPKEFTIAVTCFGGVVARDWV  316

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTN------KVASRPSALQCWKETE  1145
                   DV  + CR  V QELP  G + Y+ +          V     AL CWK  E
Sbjct  317   -NQKRVDVKGFTCRSAVKQELPNGGFVIYKTYVAQLPTYEVHVPKSIIALPCWKAVE  372



>gb|KDP38736.1| hypothetical protein JCGZ_04089 [Jatropha curcas]
Length=363

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 202/330 (61%), Positives = 242/330 (73%), Gaps = 12/330 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEGFEKRLEI+F  PP+F+DP G GLR LTR QLDSILEPA CTIV++L  +EFD
Sbjct  10    ASPIGFEGFEKRLEITFNEPPIFKDPTGRGLRALTRSQLDSILEPACCTIVTQLSNSEFD  69

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F++P KIVLKTCGTT+LLLS+  ILKLA+ LSL +  V YSRG+F+F N Q
Sbjct  70    SYVLSESSLFVFPFKIVLKTCGTTKLLLSIESILKLAESLSLSLFDVNYSRGSFIFPNYQ  129

Query  474   PAPHRSFSEEVAFLNSQFKN--GVAFVLGDPESPGRNWHVYVAEVGSGAP-----APETT  632
             PAPHRSFSEEV  LN  F +    A+VLG   +P  NWH+Y A  GS  P          
Sbjct  130   PAPHRSFSEEVTALNEFFGHLKTEAYVLGGSSAPNWNWHIYSASSGSSQPLMKDHTDTLN  189

Query  633   VEICMTGLSREKAAMFFKRPG--GDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             VEICMTGL ++KAA+FFKR       +MT+ S I +++PSH+ICDF+FDPCGYSMNG++G
Sbjct  190   VEICMTGLEKKKAAVFFKRSADYSASDMTRSSGIFEILPSHLICDFDFDPCGYSMNGIEG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+STVHVTPE+GFSYASYE MG+E S V L  LVKRV+NCF P+EFS+AVT  G    D
Sbjct  250   TAFSTVHVTPEDGFSYASYEVMGLEPSQVKLTTLVKRVVNCFGPSEFSIAVTCHG--GAD  307

Query  987   KIWRGGNADVDRYACRFRVTQEL-PGDGRI  1073
             K W     DVD Y+ R  V QEL  G GR+
Sbjct  308   KWWPNECDDVDGYSRRSMVEQELVSGGGRV  337



>ref|XP_010105415.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
 gb|EXC04638.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
Length=367

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 203/334 (61%), Positives = 246/334 (74%), Gaps = 9/334 (3%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             A +S IGFEGFEKRLEI F+   +F DP+G+GLR LTR Q+DSILEPA CTIVS+L  +E
Sbjct  3     ANTSPIGFEGFEKRLEIKFSETSIFSDPKGLGLRALTRSQIDSILEPACCTIVSQLSNSE  62

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
              DSYVLSESS+F++P KI++KTCGTT+LL S+  ILKLAD +SL V SVKYSRG+F+F +
Sbjct  63    LDSYVLSESSLFVFPFKIIIKTCGTTKLLSSIRPILKLADSISLSVASVKYSRGSFIFPD  122

Query  468   SQPAPHRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVAEVGSG-APAPETTVE  638
             +QP+PHRSF+EEVA LN  F+  +  A+V+GDP  P RNWHVY A    G     E  +E
Sbjct  123   AQPSPHRSFAEEVAALNEFFREFSPRAYVIGDPAVPNRNWHVYFASAERGFDRTAEINLE  182

Query  639   ICMTGLSREKAAMFFKRPGG--DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             +CMTGLS+EKAA+FFK        EMTKMS + D+IP HVICDF+FDPCGYSMNG++GAA
Sbjct  183   MCMTGLSKEKAAVFFKERNNYTAKEMTKMSGVSDIIPGHVICDFDFDPCGYSMNGIEGAA  242

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKI  992
             YSTVHVTPE+GFSYASYEA G     V L  ++++VL CF P  FSVAVT FG   RD  
Sbjct  243   YSTVHVTPEDGFSYASYEAGGFYPEAVPLRRMIEKVLTCFRPTVFSVAVTCFG---RDAW  299

Query  993   -WRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
              W    ADV+ YAC   V QELP  G I YR ++
Sbjct  300   RWAHRRADVEGYACVDVVRQELPRGGCIVYRSYS  333



>ref|XP_002324514.2| hypothetical protein POPTR_0018s11040g [Populus trichocarpa]
 gb|EEF03079.2| hypothetical protein POPTR_0018s11040g [Populus trichocarpa]
Length=396

 Score =   391 bits (1005),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 210/363 (58%), Positives = 249/363 (69%), Gaps = 16/363 (4%)
 Frame = +3

Query  123   IGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDSYV  302
             IGFEGFEKRLEI+F+ P  F DP G+GLR LTR Q+DSILEPA CTIVS+L   EFDSYV
Sbjct  13    IGFEGFEKRLEITFSEPSFFNDPNGLGLRALTRSQIDSILEPACCTIVSQLSNTEFDSYV  72

Query  303   LSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQPAP  482
             LSESS+FIYPLKI+LKTCGTT+LLLSV  ILKLA+ LSL V  V YSRG+F+F + QPAP
Sbjct  73    LSESSLFIYPLKIILKTCGTTKLLLSVHPILKLAESLSLDVCHVTYSRGSFIFPDYQPAP  132

Query  483   HRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVAEVGSGA------PAPETTVE  638
             HRSF+EEV  LN  F   N  A+V+G P S  RNWH+YVA   S +           T+E
Sbjct  133   HRSFAEEVTALNGYFGNLNSNAYVIGHPTSANRNWHIYVASKDSKSLPLSKDHTSAVTLE  192

Query  639   ICMTGLSREKAAMFFKRPG--GDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             +CMTGL R KAA+F+K+       EMTKMS I +++PSH+ICDF+FDPCGYSMNG+DG A
Sbjct  193   MCMTGLDRMKAAVFYKKSADYSAAEMTKMSGINEIMPSHMICDFDFDPCGYSMNGIDGTA  252

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD-K  989
              STVHVTPE+GFSYASYEA G +   V L  LV+RVL CF P +FSVAVT  G      +
Sbjct  253   LSTVHVTPEDGFSYASYEATGFDCGEVRLRGLVQRVLKCFGPRDFSVAVTCHGGGGIGVQ  312

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK-----VASRPSALQCWKETEEEV  1154
              W    ADV+ Y C   V QELPG G + Y  +   K       +R   + CWK+  EE 
Sbjct  313   WWAIECADVEGYLCDSVVRQELPGGGCLVYMTYHEVKESKGCAPARMMNMPCWKDVAEEE  372

Query  1155  AVV  1163
              VV
Sbjct  373   EVV  375



>gb|KCW78797.1| hypothetical protein EUGRSUZ_C00232 [Eucalyptus grandis]
Length=415

 Score =   392 bits (1006),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 211/367 (57%), Positives = 255/367 (69%), Gaps = 27/367 (7%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEGFEKRLEI+F+PPPLF DP G+GLR LTR QLDSILEPA CTIVS+L  A+ DS
Sbjct  16    SPIGFEGFEKRLEITFSPPPLFADPSGLGLRRLTRAQLDSILEPARCTIVSQLSSADLDS  75

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YPLKI+LKTCGTTRLL S+  IL+LA+ L+L VDSVKYSRGTF+F ++QP
Sbjct  76    YVLSESSLFVYPLKIILKTCGTTRLLSSIKPILQLAEPLALTVDSVKYSRGTFIFPDAQP  135

Query  477   APHRSFSEEVAFLNSQFKN--GVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-------  629
             AP+R+F++EV  LN  F      A+V+GDP  P R+WHVY A     AP   T       
Sbjct  136   APYRNFADEVEVLNGFFGGLLAEAYVIGDPRVPNRSWHVYSAARRRSAPPAATEDDGAGG  195

Query  630   -TVEICMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSM  791
              T+E+CMTGL   KA++FFK+PG D      +MTK+S I ++IP H ICDF+FDPCGYSM
Sbjct  196   ITLEMCMTGLDESKASVFFKKPGVDPDHSARQMTKLSGISEIIPGHTICDFDFDPCGYSM  255

Query  792   NGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFG  971
             NG++GAA+STVHVTPE GFSYASYEAMG++   V  +ALVKRVL CF P EFSVAVT  G
Sbjct  256   NGIEGAAFSTVHVTPENGFSYASYEAMGIDPESVKFDALVKRVLRCFGPTEFSVAVTCGG  315

Query  972   VPARDKI-WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT------NKVASR-----P  1115
               AR  I W    A V+ Y     V Q LPG   + Y  +         + A+R     P
Sbjct  316   GGARAHILWAAAAAGVEGYTLERAVQQALPGGACLVYLTYAREEGGAGRRCAARAPMKSP  375

Query  1116  SALQCWK  1136
             +   CWK
Sbjct  376   AKQCCWK  382



>ref|XP_010047048.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Eucalyptus grandis]
Length=470

 Score =   391 bits (1005),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 211/367 (57%), Positives = 255/367 (69%), Gaps = 27/367 (7%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEGFEKRLEI+F+PPPLF DP G+GLR LTR QLDSILEPA CTIVS+L  A+ DS
Sbjct  71    SPIGFEGFEKRLEITFSPPPLFADPSGLGLRRLTRAQLDSILEPARCTIVSQLSSADLDS  130

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YPLKI+LKTCGTTRLL S+  IL+LA+ L+L VDSVKYSRGTF+F ++QP
Sbjct  131   YVLSESSLFVYPLKIILKTCGTTRLLSSIKPILQLAEPLALTVDSVKYSRGTFIFPDAQP  190

Query  477   APHRSFSEEVAFLNSQFKN--GVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-------  629
             AP+R+F++EV  LN  F      A+V+GDP  P R+WHVY A     AP   T       
Sbjct  191   APYRNFADEVEVLNGFFGGLLAEAYVIGDPRVPNRSWHVYSAARRRSAPPAATEDDGAGG  250

Query  630   -TVEICMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSM  791
              T+E+CMTGL   KA++FFK+PG D      +MTK+S I ++IP H ICDF+FDPCGYSM
Sbjct  251   ITLEMCMTGLDESKASVFFKKPGVDPDHSARQMTKLSGISEIIPGHTICDFDFDPCGYSM  310

Query  792   NGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFG  971
             NG++GAA+STVHVTPE GFSYASYEAMG++   V  +ALVKRVL CF P EFSVAVT  G
Sbjct  311   NGIEGAAFSTVHVTPENGFSYASYEAMGIDPESVKFDALVKRVLRCFGPTEFSVAVTCGG  370

Query  972   VPARDKI-WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT------NKVASR-----P  1115
               AR  I W    A V+ Y     V Q LPG   + Y  +         + A+R     P
Sbjct  371   GGARAHILWAAAAAGVEGYTLERAVQQALPGGACLVYLTYAREEGGAGRRCAARAPMKSP  430

Query  1116  SALQCWK  1136
             +   CWK
Sbjct  431   AKQCCWK  437



>gb|AAL16065.1|AF420239_1 S-adenosyl-L-methionine decarboxylase [Dendrobium crumenatum]
Length=369

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 204/350 (58%), Positives = 244/350 (70%), Gaps = 14/350 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEG+EKRLEI+F+  PLF DP G GLR LTR Q+DSILEPA CTIVS+L    FDS
Sbjct  4     SPIGFEGYEKRLEITFSEAPLFVDPHGHGLRALTRPQIDSILEPAKCTIVSQLSNKHFDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K++LKTCGTTRLLLS+PVIL LA  LSL V +VKYSRG+F+F  +QP
Sbjct  64    YVLSESSLFVYPCKMILKTCGTTRLLLSIPVILDLAAELSLSVTAVKYSRGSFIFPGAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F      G A+V+G+P  P  NWHVY A        P  T+E+C
Sbjct  124   APHRSFSEEVAVLNQFFGGLGSGGNAYVIGNPAHPNLNWHVYYAS--EKPEQPMVTIEMC  181

Query  645   MTGLSREKAAMFFK-----RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             MTGL+ EKA++FFK           EMTK S ICD+IP   ICDFEFDPCGYSMNG++  
Sbjct  182   MTGLNTEKASIFFKNSVPRHESSAKEMTKRSGICDIIPEMKICDFEFDPCGYSMNGINKQ  241

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A ST+HVTPE+GFSYASYEAMG + S +    L++RVL CFEPA FSVAVT FG      
Sbjct  242   ALSTIHVTPEDGFSYASYEAMGFKPSAISYRNLIERVLRCFEPANFSVAVTIFGGRPFAC  301

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCW  1133
              + G    V+ Y C+  V Q+L G G + Y+ F  +++  AS  S L CW
Sbjct  302   SY-GQKVSVNGYNCKNLVQQDLSGGGLLLYQSFKASSDGSASPRSILYCW  350



>ref|XP_011018087.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
Length=396

 Score =   384 bits (987),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 207/363 (57%), Positives = 248/363 (68%), Gaps = 16/363 (4%)
 Frame = +3

Query  123   IGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDSYV  302
             IGFEGFEKRLEI+F+ P LF DP G+GLR LTR Q+ SILEPA CTIVS+L  +EFDSYV
Sbjct  13    IGFEGFEKRLEITFSEPSLFSDPNGLGLRTLTRSQIGSILEPACCTIVSQLSNSEFDSYV  72

Query  303   LSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQPAP  482
             LSESS+FIYPLKI+LKTCGTT+LLLSV  ILKLA+ LSL V  V YSRG+F+F + QPAP
Sbjct  73    LSESSLFIYPLKIILKTCGTTKLLLSVDPILKLAESLSLDVCHVTYSRGSFIFPDYQPAP  132

Query  483   HRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVAEVGSGA------PAPETTVE  638
             HR F+EEV  LN  F   N  A+V+G P S  RNWH+YVA   S +           T+E
Sbjct  133   HRCFAEEVTALNGYFGNLNANAYVIGHPTSANRNWHIYVASKDSKSLPLSKDHTSAVTLE  192

Query  639   ICMTGLSREKAAMFFKRPG--GDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             +CMTGL R KAA+F+K+       EMTKMS I +++P HVICDF+FDPCGYSMNG++G A
Sbjct  193   MCMTGLDRMKAAVFYKKSADYSASEMTKMSGINEIMPGHVICDFDFDPCGYSMNGIEGTA  252

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD-K  989
              STVHVTPE+GFSYASYEA G +   V L  LV+RVL CF P +FSVAVT  G      +
Sbjct  253   LSTVHVTPEDGFSYASYEATGFDCGEVKLRGLVQRVLKCFGPRDFSVAVTCHGGGGVGIQ  312

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK-----VASRPSALQCWKETEEEV  1154
              W    ADV+ Y C   V QELPG G + Y  +   K       ++   + CWK+  EE 
Sbjct  313   WWAIECADVEGYLCDSVVRQELPGGGCLVYMTYHELKESKGCTPAKMMNMPCWKDVAEEE  372

Query  1155  AVV  1163
              VV
Sbjct  373   EVV  375



>ref|XP_010929198.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Elaeis guineensis]
Length=402

 Score =   384 bits (985),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 203/358 (57%), Positives = 245/358 (68%), Gaps = 14/358 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEG+EKRLEI+F+  P+F DP+G GLR L+R Q+DSILE A CT+VS+L   +FDS
Sbjct  21    SPIGFEGYEKRLEITFSEAPVFVDPQGRGLRALSRAQIDSILELARCTVVSQLSNKDFDS  80

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI+LKTCGTTRLLLS+P IL+LA  LSL   S KYSRGTF+F  +QP
Sbjct  81    YVLSESSLFVYPCKIILKTCGTTRLLLSIPRILELAKELSLSPLSAKYSRGTFIFPGAQP  140

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PHRSFSEEV+ LN  F      G A+V+GDP +P RNWH+Y A        P  T+E+C
Sbjct  141   SPHRSFSEEVSVLNQFFGGLKSGGNAYVIGDPVAPNRNWHIYYAT--QKPEPPMVTLEMC  198

Query  645   MTGLSREKAAMFFK-----RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             MTGLS E+A++FFK           EMTK+S I D+IP   ICDFEFDPCGYSMN + G 
Sbjct  199   MTGLSTEQASIFFKNSVVGHSSSSKEMTKLSGISDIIPEMEICDFEFDPCGYSMNAIHGP  258

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A+ST+HVTPEEGFSYASYEAMG+    +    L+KRVL CF P EFSVAVT FG      
Sbjct  259   AFSTIHVTPEEGFSYASYEAMGLNPGSLVFGDLIKRVLRCFGPLEFSVAVTIFGGCRLAG  318

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVA--SRPSALQCWKETEEEVA  1157
              W     ++D YAC   V QELPG G + Y+ F  + V   S  S L CW+    E A
Sbjct  319   TW-SKKVEIDGYACNDLVEQELPGGGLLMYQNFAASAVTAVSPRSILHCWEGDSMEKA  375



>ref|XP_010904594.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Elaeis guineensis]
Length=381

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 206/358 (58%), Positives = 253/358 (71%), Gaps = 18/358 (5%)
 Frame = +3

Query  96    AMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSEL  275
             AM   LSS IGFEG+EKRLEI+F+  PLF DP G+GLR LT  Q+DSILEPA CTIV++L
Sbjct  8     AMDSPLSSPIGFEGYEKRLEITFSEAPLFVDPHGLGLRALTCTQIDSILEPAQCTIVAQL  67

Query  276   FGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTF  455
                +FDSYVLSESS+F+YP KI+LKTCGTT+LLLS+P IL LA  LSL V S KYSRGTF
Sbjct  68    SNKDFDSYVLSESSLFVYPYKIILKTCGTTKLLLSIPKILDLAKELSLTVLSAKYSRGTF  127

Query  456   VFQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-  620
             +F ++QP+PHRSF EEVA LN  F      G A+V+GDP S   NWH+Y A   +G P  
Sbjct  128   IFPSAQPSPHRSFLEEVAILNQFFGGLASGGNAYVIGDPASSNGNWHIYYA---TGKPEL  184

Query  621   PETTVEICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCG  782
             P  T+E+CMT L+ +KA++F+K    DG      EMTK+S I ++IP   ICDFEFDPCG
Sbjct  185   PMVTLEMCMTRLNCKKASIFYKN-SVDGHSSTAKEMTKLSGISEIIPEMEICDFEFDPCG  243

Query  783   YSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVT  962
             YSMNG++G A+ST+HVTPE+GFSYASYEAMG     V    L+KRVL CF+P+EFSVAVT
Sbjct  244   YSMNGINGLAFSTIHVTPEDGFSYASYEAMGFNPDSVVYGDLIKRVLRCFDPSEFSVAVT  303

Query  963   RFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTN--KVASRPSALQC  1130
              FG   +   W G   DV  Y+C+  V  EL G G + Y+ F+T+  K  S  S L+C
Sbjct  304   IFGGRRQAGTW-GKKVDVHGYSCKDLVELELAGGGLLMYQSFSTSRLKAVSPRSVLRC  360



>gb|KCW78796.1| hypothetical protein EUGRSUZ_C00232 [Eucalyptus grandis]
Length=376

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 238/318 (75%), Gaps = 20/318 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEGFEKRLEI+F+PPPLF DP G+GLR LTR QLDSILEPA CTIVS+L  A+ DS
Sbjct  16    SPIGFEGFEKRLEITFSPPPLFADPSGLGLRRLTRAQLDSILEPARCTIVSQLSSADLDS  75

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YPLKI+LKTCGTTRLL S+  IL+LA+ L+L VDSVKYSRGTF+F ++QP
Sbjct  76    YVLSESSLFVYPLKIILKTCGTTRLLSSIKPILQLAEPLALTVDSVKYSRGTFIFPDAQP  135

Query  477   APHRSFSEEVAFLNSQFKNGV--AFVLGDPESPGRNWHVYVAEVGSGAPAPET-------  629
             AP+R+F++EV  LN  F   +  A+V+GDP  P R+WHVY A     AP   T       
Sbjct  136   APYRNFADEVEVLNGFFGGLLAEAYVIGDPRVPNRSWHVYSAARRRSAPPAATEDDGAGG  195

Query  630   -TVEICMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSM  791
              T+E+CMTGL   KA++FFK+PG D      +MTK+S I ++IP H ICDF+FDPCGYSM
Sbjct  196   ITLEMCMTGLDESKASVFFKKPGVDPDHSARQMTKLSGISEIIPGHTICDFDFDPCGYSM  255

Query  792   NGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFG  971
             NG++GAA+STVHVTPE GFSYASYEAMG++   V  +ALVKRVL CF P EFSVAVT  G
Sbjct  256   NGIEGAAFSTVHVTPENGFSYASYEAMGIDPESVKFDALVKRVLRCFGPTEFSVAVTCGG  315

Query  972   VPARDKI-----WRGGNA  1010
               AR  I     WR G A
Sbjct  316   GGARAHILWAAAWRRGPA  333



>gb|AGR89928.1| S-adenosyl-L-methionine decarboxylase [Dendrobium catenatum]
Length=368

 Score =   381 bits (978),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 206/356 (58%), Positives = 244/356 (69%), Gaps = 14/356 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEG+EKRLEI+F+   LF DP G GLR LTR Q+DSILEPA CTIVS+L   +FDS
Sbjct  5     SPIGFEGYEKRLEITFSEASLFVDPHGYGLRALTRPQIDSILEPAKCTIVSQLSNKDFDS  64

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K++LKTCGTTRLLLS+PVIL LA  LSL V +VKYSRG+F+F  +QP
Sbjct  65    YVLSESSLFVYPCKMILKTCGTTRLLLSIPVILDLAAELSLSVTAVKYSRGSFIFPGAQP  124

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F        A+V+G+P  P  NWHVY A        P  TVE+C
Sbjct  125   APHRSFSEEVAVLNQYFGCLASGANAYVIGNPALPNLNWHVYYAT--EKPEQPMVTVEMC  182

Query  645   MTGLSREKAAMFFK-----RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             MTGLS E+A++FFK           EMTK S I D+IP   ICDFEFDPCGYSMNG++  
Sbjct  183   MTGLSSERASIFFKNSVLGHESSAKEMTKRSGIRDIIPEMKICDFEFDPCGYSMNGINNQ  242

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A ST+HVTPE+GFSYASYEAMG E S +    L++RVL CFEP  FSVAVT FG      
Sbjct  243   ALSTIHVTPEDGFSYASYEAMGFEPSAISYRHLIERVLRCFEPVNFSVAVTIFGGRPFAC  302

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCWKETEEE  1151
              + G    VD Y C+  V QEL G G + Y+ F  +T+  AS  S L C +  +EE
Sbjct  303   SY-GQKVCVDGYNCKDLVQQELSGGGLLLYQSFKASTDGSASPRSILYCREAEDEE  357



>ref|XP_006647495.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006647496.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Oryza brachyantha]
Length=403

 Score =   379 bits (973),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 252/361 (70%), Gaps = 17/361 (5%)
 Frame = +3

Query  120   AIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDSY  299
             AIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL    FDSY
Sbjct  14    AIGFEGYEKRLEITFSEAPVFADPNGRGLRALSRAQIDSVLDLARCTIVSELSNEVFDSY  73

Query  300   VLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQPA  479
             VLSESS+F+YP KIV+KTCGTT+LLL++P IL+LA+ LSL +++VKYSRGTF+F  +QP+
Sbjct  74    VLSESSLFVYPYKIVIKTCGTTKLLLAIPRILELAEELSLPLEAVKYSRGTFIFPEAQPS  133

Query  480   PHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEICM  647
             PH++FS+EVAFLN  F      G A+V+GDP  PG+ WHVY A        P  T+E+CM
Sbjct  134   PHKNFSDEVAFLNCYFGGLKSGGHAYVIGDPAKPGQKWHVYYAT--QHPEQPVVTLEMCM  191

Query  648   TGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             TGL +E+A++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G 
Sbjct  192   TGLDKERASVFFKT-SADGHTTCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGP  250

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A+ST+HVTPE+GFSYASYE MG   + +    LVKRVL CF P+EFSVAVT FG     +
Sbjct  251   AFSTIHVTPEDGFSYASYEVMGFNPASIAYGDLVKRVLRCFGPSEFSVAVTIFGDRNHAE  310

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRP--SALQCWKETEEEVAV  1160
              W G   ++  YAC   V QELP  G + Y+ FT T +VAS    S L C+ +   E A 
Sbjct  311   TW-GNGLNIGAYACSNMVEQELPSGGLLIYQSFTATAEVASGSPRSVLHCFADENTENAT  369

Query  1161  V  1163
              
Sbjct  370   T  370



>ref|XP_004953064.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Setaria italica]
Length=400

 Score =   378 bits (970),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 197/349 (56%), Positives = 248/349 (71%), Gaps = 15/349 (4%)
 Frame = +3

Query  93    AAMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSE  272
             AA A    SAIGFEG+EKRLEISF+   +F DP G GLR L+R Q+DS+L+ A CTIVSE
Sbjct  7     AAAAPLPVSAIGFEGYEKRLEISFSEASVFADPNGRGLRALSRAQIDSVLDLARCTIVSE  66

Query  273   LFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGT  452
             L   +FDSYVLSESS+F+YP K+V+KTCGTT+LLL++P IL+LA+ LSL + +VKYSRGT
Sbjct  67    LSNEDFDSYVLSESSLFVYPYKVVIKTCGTTKLLLAIPRILELAEELSLPLAAVKYSRGT  126

Query  453   FVFQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA  620
             F+F ++QP+PH++F++EVAFLN  F      G A+V+GDP  PG+ WH+Y A        
Sbjct  127   FIFPDAQPSPHKNFADEVAFLNRYFGGLKSGGNAYVIGDPAKPGQKWHIYYAT--EHPEE  184

Query  621   PETTVEICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCG  782
             P  T+E+CMTGL ++KA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCG
Sbjct  185   PVVTLEMCMTGLDKKKASVFFKT-SADGHISCAKEMTKLSGISDIIPEMEICDFDFEPCG  243

Query  783   YSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVT  962
             YSMN + G A+ST+HVTPE+GFSYASYE MG   +    + LVKRVL CF P+EFSVAVT
Sbjct  244   YSMNAIHGPAFSTIHVTPEDGFSYASYEVMGFNPASFDYDDLVKRVLRCFGPSEFSVAVT  303

Query  963   RFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVA  1106
              FG     K W G   DV+ YAC   V QELP  G + Y+ FT T K A
Sbjct  304   IFGERDNAKTW-GKKLDVEAYACSNMVEQELPAGGLLIYQSFTATGKAA  351



>ref|XP_002446740.1| hypothetical protein SORBIDRAFT_06g021540 [Sorghum bicolor]
 gb|EES11068.1| hypothetical protein SORBIDRAFT_06g021540 [Sorghum bicolor]
Length=396

 Score =   377 bits (968),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 251/360 (70%), Gaps = 17/360 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGYEKRLEITFSEAPVFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRGTF+F  +QP
Sbjct  73    YVLSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKYSRGTFIFPGAQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F      G A+V+GDP  PG+ WH+Y A        P   +E+C
Sbjct  133   APHRSFSEEVAALNRYFGGLKSGGNAYVIGDPARPGQKWHIYYAT--EYPEQPVVNLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  191   MTGLDKKKASVFFKT-NADGNTTCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG + + +    LVKRVL CF P EFSVAVT FG   + 
Sbjct  250   SAFSTIHVTPEDGFSYASYEVMGFDATALSYGDLVKRVLRCFGPLEFSVAVTIFGGRGQA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYR--CFTTNKVASRP-SALQCWKETEEEVA  1157
               W G     + Y C   V QELPG G + Y+  C   + VA+ P S L C++    E A
Sbjct  310   GTW-GKQLGAEVYDCNNMVEQELPGGGLLIYQSFCAAEDAVATSPKSVLHCFEGVNMENA  368



>gb|ACV52081.1| S-adenosylmethionine decarboxylase 3 [Sorghum bicolor]
 gb|ACV52083.1| S-adenosylmethionine decarboxylase 3 [Sorghum bicolor]
Length=397

 Score =   377 bits (967),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 251/360 (70%), Gaps = 17/360 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGYEKRLEITFSEAPVFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRGTF+F  +QP
Sbjct  73    YVLSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKYSRGTFIFPGAQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F      G A+V+GDP  PG+ WH+Y A        P   +E+C
Sbjct  133   APHRSFSEEVAALNRYFGGLKSGGNAYVIGDPARPGQKWHIYYAT--EYPEQPVVNLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  191   MTGLDKKKASVFFKT-NADGNTTCAEEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG + + +    LVKRVL CF P EFSVAVT FG   + 
Sbjct  250   SAFSTIHVTPEDGFSYASYEVMGFDATALSYGDLVKRVLRCFGPLEFSVAVTIFGGRGQA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYR--CFTTNKVASRP-SALQCWKETEEEVA  1157
               W G     + Y C   V QELPG G + Y+  C   + VA+ P S L C++    E A
Sbjct  310   GTW-GKQLGAEVYDCNNMVEQELPGGGLLIYQSFCAAEDAVATSPKSVLHCFEGVNMENA  368



>gb|ADC45379.1| S-adenosylmethionine decarboxylase [Cleistogenes songorica]
Length=397

 Score =   376 bits (965),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 244/340 (72%), Gaps = 13/340 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL    FDS
Sbjct  13    SAIGFEGYEKRLEISFSEAPIFADPNGRGLRALSRAQIDSVLDLARCTIVSELSNEAFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP ++V+KTCGTT+LLL++P IL+LA+ LSL + +VKYSRGTF+F ++QP
Sbjct  73    YVLSESSLFVYPYRVVIKTCGTTKLLLAIPRILELAEELSLPLAAVKYSRGTFIFPDAQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++F++EVAFLN  F      G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  133   SPHKNFADEVAFLNRYFGGLKSGGNAYVIGDPAKPGQKWHIYYAT--EYPEKPVVTLEMC  190

Query  645   MTGLSREKAAMFFKRPGGD-----GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             MTGL ++KA++FFK           EMTK+S I D+IP   ICDF+F+PCGYSMN + G 
Sbjct  191   MTGLDKKKASVFFKTSANGHISCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHGP  250

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A+ST+HVTPE+GFSYASYE MG   + +    LVKRVL CF P+EFSVAVT FG     K
Sbjct  251   AFSTIHVTPEDGFSYASYEVMGFNPASLAYGDLVKRVLKCFSPSEFSVAVTIFGERDNAK  310

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVA  1106
              W G   DV+ YAC   V +ELP  G + Y+ FT T +VA
Sbjct  311   TW-GKKLDVESYACGNMVEEELPSGGLLVYQSFTATGEVA  349



>ref|XP_010235689.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Brachypodium distachyon]
Length=399

 Score =   375 bits (964),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 195/358 (54%), Positives = 249/358 (70%), Gaps = 17/358 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGFEKRLEITFSEAPVFSDPNGRGLRALSRAQIDSVLDLAKCTIVSELSNEDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+V+KTCGTT+LLL++P IL+LA+ LSL + +VKYSRGTF+F  +QP
Sbjct  73    YVLSESSLFVYPYKVVIKTCGTTKLLLAIPRILELAEELSLPLSAVKYSRGTFIFPEAQP  132

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APH++F++EVAFLN  F N    G A+V+GDP  PG+NWHVY A        P   +E+C
Sbjct  133   APHKNFADEVAFLNGYFGNLKSGGNAYVIGDPAKPGQNWHVYYAT--QQPEHPVVNLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S ICD+IP   ICDF+F+PCGYSMN   G
Sbjct  191   MTGLDKKKASVFFKT-SADGHTSCAKEMTKLSGICDIIPEMEICDFDFEPCGYSMNATHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE MG++ + +    LVKRVL+CF P+EFSVAVT FG     
Sbjct  250   PAFSTIHVTPEDGFSYASYEVMGLDPASISYGNLVKRVLSCFGPSEFSVAVTVFGGRGHA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---NKVASRPSALQCWKETEEE  1151
             + W      +  Y     V QELP  G + Y+ FT+       S  S L C+ +   E
Sbjct  310   ETW-AEKLVIGAYDSTNMVEQELPAGGLLIYQSFTSIGEVPTGSPRSVLSCFADEHVE  366



>ref|NP_001047404.1| Os02g0611200 [Oryza sativa Japonica Group]
 emb|CAB64600.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa Japonica Group]
 dbj|BAD19232.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa Japonica Group]
 dbj|BAD19677.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa Japonica Group]
 dbj|BAF09318.1| Os02g0611200 [Oryza sativa Japonica Group]
 gb|AFI71861.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa]
 gb|AGH17542.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa]
Length=395

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 250/360 (69%), Gaps = 17/360 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL    FDS
Sbjct  13    SAIGFEGYEKRLEITFSEAPVFADPNGRGLRALSRAQIDSVLDLARCTIVSELSNEVFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KIV+KTCGTT+LLL++P IL+LA+ LSL +++VKYSRGTF+F  +QP
Sbjct  73    YVLSESSLFVYPYKIVIKTCGTTKLLLAIPRILELAEELSLPLEAVKYSRGTFIFPEAQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++FSEEVA LN  F      G A+V+GDP  PG+ WHVY A        P  T+E+C
Sbjct  133   SPHKNFSEEVAVLNRYFGGLKSGGNAYVIGDPAKPGQKWHVYYAT--QHPEQPVVTLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   +CDF+F+PCGYSMN + G
Sbjct  191   MTGLDKKKASVFFKT-SADGHTTYAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE MG   + +    LVKRVL CF P EFSVAVT FG     
Sbjct  250   PAFSTIHVTPEDGFSYASYEVMGFNPASLAYGDLVKRVLRCFGPLEFSVAVTIFGGRNHA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVA--SRPSALQCWKETEEEVA  1157
               W  G  DV  Y+C   V QELP  G + Y+ FT T ++A  S  S L C+ +   E A
Sbjct  310   GTWAKG-LDVGAYSCSNMVEQELPSGGLLIYQSFTATAEIATGSPRSVLHCFADENTEKA  368



>gb|AGT16271.1| S-adenosylmethionine decarboxylase [Saccharum hybrid cultivar 
R570]
Length=395

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 252/360 (70%), Gaps = 17/360 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGYEKRLEITFSEASVFIDPHGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRGTF+F  +QP
Sbjct  73    YVLSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKYSRGTFIFPGAQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F      G A+V+GDP  PG+ WH+Y A        P   +E+C
Sbjct  133   APHRSFSEEVAVLNRYFGGLKSGGNAYVIGDPAIPGQKWHIYYAT--EYPEQPMVNLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  191   MTGLDKKKASVFFKT-NADGNTTCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAVHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG + + +  + LVKRV+ CF P+EFSVAVT FG   + 
Sbjct  250   SAFSTIHVTPEDGFSYASYEVMGFDATALSYDDLVKRVIGCFGPSEFSVAVTIFGGRGQA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYR--CFTTNKVASRP-SALQCWKETEEEVA  1157
               W G     + Y C   V QELPG G + Y+  C   + VAS P S L C++    E A
Sbjct  310   GSW-GKQLGAEVYDCSNMVEQELPGGGLLIYQSFCAAEDAVASSPKSVLHCFEGENMENA  368



>ref|XP_009401295.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   374 bits (959),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 198/358 (55%), Positives = 241/358 (67%), Gaps = 14/358 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEG+EKRLEI+F+  P+F DP+G GLR ++R Q+DSIL+ A CTIVS+L   +FDS
Sbjct  15    SPIGFEGYEKRLEITFSEAPIFVDPQGRGLRAISRAQIDSILDLARCTIVSQLSNKDFDS  74

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI+LKTCGTT+LLLS+P IL LA  LSL V S KYSRGTF+F  +QP
Sbjct  75    YVLSESSLFVYPYKIILKTCGTTKLLLSIPRILDLAADLSLSVLSAKYSRGTFIFPGAQP  134

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PHRSFSEEV+ LN  F      G A+V+GDP  P R WH+Y A        P  T+E+C
Sbjct  135   SPHRSFSEEVSVLNGFFGSLKSGGNAYVIGDPSMPNRKWHIYYAT--QKPELPLVTLEMC  192

Query  645   MTGLSREKAAMFFKRP-----GGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             MTGL  E+A++FFK           EMTK+S I D+IP   ICDF+F+PCGYSMNG+ G 
Sbjct  193   MTGLDAERASIFFKNSVDGHNSSANEMTKLSGISDIIPEMEICDFDFEPCGYSMNGIHGP  252

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A ST+HVTPE+GFSYASYEAMG     +    LV+RVL CF P+EFSVAVT FG      
Sbjct  253   ALSTIHVTPEDGFSYASYEAMGFNPHSLKYHDLVERVLRCFGPSEFSVAVTIFGGRGLAA  312

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCWKETEEEVA  1157
              W     D+  YAC   V QELPGDG + Y+ F  +T    S  S L  W+    E A
Sbjct  313   TW-AKKVDLHGYACNDMVEQELPGDGLLVYQTFAASTATAESPRSILHHWEGVTLENA  369



>ref|XP_009403328.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Musa acuminata subsp. malaccensis]
Length=376

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 202/369 (55%), Positives = 247/369 (67%), Gaps = 19/369 (5%)
 Frame = +3

Query  81    FTICAAMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCT  260
             F +  + A  L S IGFEG+EKRLEI+F+   +F DPRG GLR L+R QLDSIL+ A CT
Sbjct  3     FLMDDSAAPPLVSPIGFEGYEKRLEITFSDASVFLDPRGRGLRALSRAQLDSILDLALCT  62

Query  261   IVSELFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKY  440
             IVS+L   +FDSYVLSESS+F+YP KI+LKTCGTT+LLLS+P IL+LA  LSL V S KY
Sbjct  63    IVSQLSNKDFDSYVLSESSLFVYPYKIILKTCGTTKLLLSIPRILELAAELSLSVHSAKY  122

Query  441   SRGTFVFQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS  608
             SRGTF+F  +QP+PHRSFSEEV+ LN  F      G AFV+GD   P R WHVY A    
Sbjct  123   SRGTFIFPGAQPSPHRSFSEEVSVLNGFFGSLKSGGNAFVIGDAAMPSRKWHVYHAT--E  180

Query  609   GAPAPETTVEICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEF  770
                AP  T+E+CMTGL  E+A++FFK    DG      EMTK+S I D+IP   ICDF+F
Sbjct  181   KPEAPMITLEMCMTGLDPERASIFFKN-SVDGHVSSAKEMTKLSGISDIIPEMEICDFDF  239

Query  771   DPCGYSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFS  950
             +PCGYSMNGM G A+STVHVTPE+GFSYASYEAMG     +    L++RVL+CF P+EFS
Sbjct  240   EPCGYSMNGMHGPAFSTVHVTPEDGFSYASYEAMGFNPDSLSYHDLIERVLSCFGPSEFS  299

Query  951   VAVTRFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVA--SRPSAL  1124
             VA T  G       W     D+  Y+C   V QELPG G + Y+ F  + V   S  S L
Sbjct  300   VATTVLG---GGSTW-ANKVDIYGYSCDNMVEQELPGGGLLVYQTFAASSVTPMSPRSIL  355

Query  1125  QCWKETEEE  1151
               W+  ++ 
Sbjct  356   NNWQGKDDN  364



>ref|XP_002534009.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
 gb|EEF28374.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
Length=301

 Score =   370 bits (949),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 223/298 (75%), Gaps = 14/298 (5%)
 Frame = +3

Query  117  SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
            S IGFEGFEKRLEI+F  PP+F+DP G GLR L+R QLDSILEPA CTIVS+L   +FDS
Sbjct  9    SPIGFEGFEKRLEIAFQEPPIFKDPTGRGLRALSRSQLDSILEPACCTIVSQLSNNQFDS  68

Query  297  YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
            YVLSESS+F+YP KIVLKTCGTT+LLLS+  IL LAD LS+ V  V+YSRGTF+F N QP
Sbjct  69   YVLSESSLFVYPFKIVLKTCGTTKLLLSIKPILSLADSLSVAVTHVQYSRGTFIFPNYQP  128

Query  477  APHRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVAE----VGSGAPAPETTVE  638
            APHRSFSEEV  LN  F   N +A+V+GD       WH+Y A     +  G      TVE
Sbjct  129  APHRSFSEEVTTLNEFFSHLNPLAYVIGD-------WHIYSASQSEPLMRGNRTDMATVE  181

Query  639  ICMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
            ICMTGL ++KAA+FFK  G    EMTK+S I D+IPSHVICDF+FDPCGYSMNG+DG+ Y
Sbjct  182  ICMTGLEKKKAAVFFKSSGNTASEMTKISGIRDIIPSHVICDFDFDPCGYSMNGIDGSGY  241

Query  816  STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
            STVHVTPE+GFSYASYEA+G++   + L  L+KRVL CF P +FSVAVT  G   + K
Sbjct  242  STVHVTPEDGFSYASYEALGLDYGEIKLNPLIKRVLKCFGPKQFSVAVTCRGXXEKKK  299



>ref|NP_001105713.1| S-adenosylmethionine decarboxylase proenzyme [Zea mays]
 sp|O24575.1|DCAM_MAIZE RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Zea mays]
 emb|CAA69075.1| S-adenosylmethionine decarboxylase [Zea mays]
 gb|ACF87816.1| unknown [Zea mays]
 tpg|DAA37110.1| TPA: S-adenosyl methionine decarboxylase2 isoform 1 [Zea mays]
 tpg|DAA37111.1| TPA: S-adenosyl methionine decarboxylase2 isoform 2 [Zea mays]
Length=400

 Score =   373 bits (958),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 247/352 (70%), Gaps = 17/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGYEKRLEITFSEAPVFVDPHGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRGTF+F  +QP
Sbjct  73    YVLSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKYSRGTFIFPGAQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F      G A+V+GDP  PG+ WHV+ A        P   +E+C
Sbjct  133   APHRSFSEEVAALNRYFGGLKSGGNAYVIGDPARPGQKWHVFYAT--EYPEQPMVNLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA +FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  191   MTGLDKKKACVFFKT-NADGNTTCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG++ + +    LVKRVL CF P+EFSVAVT FG     
Sbjct  250   SAFSTIHVTPEDGFSYASYEVMGLDATALSYGDLVKRVLRCFGPSEFSVAVTIFGGRGHA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYR--CFTTNKVASRP-SALQCW  1133
               W G     + Y C   V QELPG G + Y+  C   + VA+ P S   C+
Sbjct  310   GTW-GKALGAEVYDCNNMVEQELPGGGLLVYQSFCAAEDAVATSPKSVFHCF  360



>ref|XP_008794388.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Phoenix dactylifera]
Length=396

 Score =   373 bits (957),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 242/354 (68%), Gaps = 14/354 (4%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             +L S IGFEG+EKRLEI+F+  P+F DP+G GLR L+R Q+DSILE A CTIVS+L   +
Sbjct  12    SLVSPIGFEGYEKRLEITFSEAPVFADPQGRGLRALSRAQIDSILELAQCTIVSQLSNKD  71

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
             FDSYVLSESS+F+YP KI+LKTCGTT+LLLS+P IL+LA  L L   S KYSRGTF+F  
Sbjct  72    FDSYVLSESSLFVYPYKIILKTCGTTKLLLSIPRILELAKELLLSSLSAKYSRGTFIFPG  131

Query  468   SQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTV  635
             +QP+PHRSFSEEV+ LN  F      G A+V+GDP +P RNWH+Y A        P  T+
Sbjct  132   AQPSPHRSFSEEVSILNQFFGGLKSGGNAYVIGDPTAPNRNWHIYYAT--QKPEPPMVTL  189

Query  636   EICMTGLSREKAAMFFKRPG-----GDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
             E+CMTGLS ++A++FFK           +MT +S I D+IP   ICDFEFDPCGYSMNG+
Sbjct  190   EMCMTGLSPKRASIFFKNSAVGHSSSFKDMTMLSGISDIIPEMEICDFEFDPCGYSMNGI  249

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
               AA ST+HVTPEEG SYASYEA G     +    L++RVL CF P EFSVAVT FG   
Sbjct  250   CDAALSTIHVTPEEGVSYASYEATGFNPGSLVCRDLIERVLRCFGPLEFSVAVTIFGGRR  309

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVA--SRPSALQCWK  1136
                 W    A++D YAC   V QELPGDG + Y+ F  + V   S  S L CW+
Sbjct  310   LAGTW-AKKAEIDGYACNDLVEQELPGDGLLMYQNFAASAVTAVSPRSILHCWE  362



>gb|EEE57355.1| hypothetical protein OsJ_07492 [Oryza sativa Japonica Group]
Length=466

 Score =   375 bits (964),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 250/360 (69%), Gaps = 17/360 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL    FDS
Sbjct  84    SAIGFEGYEKRLEITFSEAPVFADPNGRGLRALSRAQIDSVLDLARCTIVSELSNEVFDS  143

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KIV+KTCGTT+LLL++P IL+LA+ LSL +++VKYSRGTF+F  +QP
Sbjct  144   YVLSESSLFVYPYKIVIKTCGTTKLLLAIPRILELAEELSLPLEAVKYSRGTFIFPEAQP  203

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++FSEEVA LN  F      G A+V+GDP  PG+ WHVY A        P  T+E+C
Sbjct  204   SPHKNFSEEVAVLNRYFGGLKSGGNAYVIGDPAKPGQKWHVYYAT--QHPEQPVVTLEMC  261

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   +CDF+F+PCGYSMN + G
Sbjct  262   MTGLDKKKASVFFKT-SADGHTTYAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNAIHG  320

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE MG   + +    LVKRVL CF P EFSVAVT FG     
Sbjct  321   PAFSTIHVTPEDGFSYASYEVMGFNPASLAYGDLVKRVLRCFGPLEFSVAVTIFGGRNHA  380

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVA--SRPSALQCWKETEEEVA  1157
               W  G  DV  Y+C   V QELP  G + Y+ FT T ++A  S  S L C+ +   E A
Sbjct  381   GTWAKG-LDVGAYSCSNMVEQELPSGGLLIYQSFTATAEIATGSPRSVLHCFADENTEKA  439



>ref|NP_001148939.1| S-adenosylmethionine decarboxylase proenzyme [Zea mays]
 gb|ACG33546.1| S-adenosylmethionine decarboxylase proenzyme [Zea mays]
 gb|ACN34652.1| unknown [Zea mays]
 gb|AFW58740.1| S-adenosylmethionine decarboxylase proenzyme [Zea mays]
Length=393

 Score =   373 bits (957),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/350 (56%), Positives = 247/350 (71%), Gaps = 17/350 (5%)
 Frame = +3

Query  123   IGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDSYV  302
             IGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDSYV
Sbjct  15    IGFEGYEKRLEITFSEAPVFVDPHGSGLRALSRSQIDSVLDLARCTIVSELSNKDFDSYV  74

Query  303   LSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQPAP  482
             LSESS+FIYPLKIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRGTF+F  +QPAP
Sbjct  75    LSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKYSRGTFIFPGAQPAP  134

Query  483   HRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEICMT  650
             HRSFSEEVA LN  F      G A+V+GD   PG+ WH+Y A        P   +E+CMT
Sbjct  135   HRSFSEEVAVLNRYFGGLKSGGNAYVIGDAARPGQKWHIYYAT--EYPEQPMVNLEMCMT  192

Query  651   GLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             GL  +KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G+A
Sbjct  193   GLDTKKASVFFKT-NADGNTTCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHGSA  251

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKI  992
             +ST+HVTPE+GFSYASYE MG++ + +    LVKRVL CF P+EFSVAVT FG   +   
Sbjct  252   FSTIHVTPEDGFSYASYEVMGLDATALSYGDLVKRVLGCFGPSEFSVAVTIFGGRGQAGT  311

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYR--CFTTNKVASRP-SALQCW  1133
             W G     + Y C   V QELPG G + Y+  C   + VAS P S L+C+
Sbjct  312   W-GKELGAEAYDCNNMVEQELPGGGILIYQSFCAAEDAVASSPKSVLRCF  360



>ref|XP_009410197.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009410198.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Musa acuminata subsp. malaccensis]
Length=387

 Score =   372 bits (956),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/336 (58%), Positives = 235/336 (70%), Gaps = 13/336 (4%)
 Frame = +3

Query  123   IGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDSYV  302
             IGFEG+EKRLEI+F+  P F DPRG GLR L+R+Q+DSIL+ A CT+VS+L  +EFDSYV
Sbjct  17    IGFEGYEKRLEITFSEAPTFVDPRGRGLRSLSREQIDSILDLARCTVVSQLSNSEFDSYV  76

Query  303   LSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQPAP  482
             LSESS+F+YP KI+LKTCGTT+LLLS+P IL+LA  LSL V S KYSRGTF F  +QP+P
Sbjct  77    LSESSLFVYPYKIILKTCGTTKLLLSIPRILELAMELSLAVLSAKYSRGTFNFPGAQPSP  136

Query  483   HRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEICMT  650
             HRSF+EEVA LN  F      G A+V+GDP  P R WH+Y A     A  P  T+E+CMT
Sbjct  137   HRSFAEEVAVLNQFFGSLNSGGNAYVMGDPTKPNRKWHIYYAT--QKAELPMVTLEMCMT  194

Query  651   GLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             GL+ E+A++FF     DG     EMTK S I D+I    +CDF F+PCGYSMNG+ G A 
Sbjct  195   GLNTERASIFFNN-SVDGYSSAKEMTKFSGISDIISEMDVCDFAFEPCGYSMNGIHGPAL  253

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPEEGFSYASYEAMG   S +    L+KRVL CF P++FS AVT FG       W
Sbjct  254   STIHVTPEEGFSYASYEAMGFNPSSLVYSGLIKRVLKCFGPSKFSTAVTIFGRHGLSGTW  313

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKV  1103
              G   D+D YAC   V QELPG G + Y+ F  + V
Sbjct  314   -GRKLDLDGYACTDLVEQELPGGGLLIYQAFAVSAV  348



>gb|ACG40518.1| S-adenosylmethionine decarboxylase proenzyme [Zea mays]
Length=400

 Score =   372 bits (956),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 248/352 (70%), Gaps = 17/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGYEKRLEITFSEAPVFVDPHGCGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRGTF+F  +QP
Sbjct  73    YVLSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKYSRGTFIFPGAQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F      G A+V+GDP  PG+ WHV+ A        P   +E+C
Sbjct  133   APHRSFSEEVAALNRYFGGLKSGGNAYVIGDPARPGQKWHVFYAT--EYPEQPMINLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  191   MTGLDKKKASVFFKT-NADGNTTCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +++ST+HVTPE+GFSYASYE MG++ + +    LVKRVL CF P+EFSVAVT FG     
Sbjct  250   SSFSTIHVTPEDGFSYASYEVMGLDATALSYGDLVKRVLRCFGPSEFSVAVTIFGGRGHT  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYR--CFTTNKVASRP-SALQCW  1133
               W G     + Y C   V QELPG G + Y+  C   + VA+ P S   C+
Sbjct  310   GTW-GKALGAEVYDCNNMVEQELPGGGLLVYQSFCAAEDAVATSPKSVFHCF  360



>ref|XP_004976106.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Setaria italica]
Length=439

 Score =   374 bits (959),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/353 (55%), Positives = 249/353 (71%), Gaps = 18/353 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  56    SAIGFEGYEKRLEITFSEAPVFVDPHGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  115

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKIV+KTCGTT+LLL++P I++LA+ LS+ + +VKYSRG F+F  +QP
Sbjct  116   YVLSESSLFIYPLKIVIKTCGTTKLLLTIPRIIELAEELSMPLAAVKYSRGMFIFPGAQP  175

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F      G A+V+GDP  PG+ WH+Y A        P   +E+C
Sbjct  176   APHRSFSEEVAALNRYFGGLKSGGNAYVIGDPARPGQKWHIYYAT--EYPEQPMVNLEMC  233

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  234   MTGLDKKKASVFFKT-SADGHTTCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHG  292

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG + + +    LVKRVL CF P+EFSVAVT FG   + 
Sbjct  293   SAFSTIHVTPEDGFSYASYEVMGFDATALAYGDLVKRVLRCFGPSEFSVAVTIFGGRGQA  352

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK---VASRPSALQCWK  1136
               W G   D + Y C   V QELPG G + Y+ F+  +   V S  S L C++
Sbjct  353   ATW-GMKLDAEVYDCNNMVEQELPG-GVLIYQSFSVTEDAIVGSPKSVLHCFE  403



>ref|XP_009401296.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=439

 Score =   374 bits (959),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 198/358 (55%), Positives = 241/358 (67%), Gaps = 14/358 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEG+EKRLEI+F+  P+F DP+G GLR ++R Q+DSIL+ A CTIVS+L   +FDS
Sbjct  58    SPIGFEGYEKRLEITFSEAPIFVDPQGRGLRAISRAQIDSILDLARCTIVSQLSNKDFDS  117

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI+LKTCGTT+LLLS+P IL LA  LSL V S KYSRGTF+F  +QP
Sbjct  118   YVLSESSLFVYPYKIILKTCGTTKLLLSIPRILDLAADLSLSVLSAKYSRGTFIFPGAQP  177

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PHRSFSEEV+ LN  F      G A+V+GDP  P R WH+Y A        P  T+E+C
Sbjct  178   SPHRSFSEEVSVLNGFFGSLKSGGNAYVIGDPSMPNRKWHIYYAT--QKPELPLVTLEMC  235

Query  645   MTGLSREKAAMFFKRP-----GGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             MTGL  E+A++FFK           EMTK+S I D+IP   ICDF+F+PCGYSMNG+ G 
Sbjct  236   MTGLDAERASIFFKNSVDGHNSSANEMTKLSGISDIIPEMEICDFDFEPCGYSMNGIHGP  295

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A ST+HVTPE+GFSYASYEAMG     +    LV+RVL CF P+EFSVAVT FG      
Sbjct  296   ALSTIHVTPEDGFSYASYEAMGFNPHSLKYHDLVERVLRCFGPSEFSVAVTIFGGRGLAA  355

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCWKETEEEVA  1157
              W     D+  YAC   V QELPGDG + Y+ F  +T    S  S L  W+    E A
Sbjct  356   TW-AKKVDLHGYACNDMVEQELPGDGLLVYQTFAASTATAESPRSILHHWEGVTLENA  412



>ref|NP_001053213.1| Os04g0498600 [Oryza sativa Japonica Group]
 sp|Q0JC10.1|DCAM_ORYSJ RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAA69074.2| S-adenosylmethionine decarboxylase [Oryza sativa Japonica Group]
 emb|CAD41242.2| OSJNBa0067K08.23 [Oryza sativa Japonica Group]
 dbj|BAF15127.1| Os04g0498600 [Oryza sativa Japonica Group]
 dbj|BAG90296.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93811.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94668.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71273.1| S-adenosylmethionine [Oryza sativa Japonica Group]
Length=398

 Score =   371 bits (953),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 195/355 (55%), Positives = 246/355 (69%), Gaps = 19/355 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGYEKRLEITFSEAPVFADPDGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRG F+F ++QP
Sbjct  73    YVLSESSLFIYSDKIVIKTCGTTKLLLTIPRILELAEGLSMPLAAVKYSRGMFIFPSAQP  132

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  133   APHRSFSEEVAVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--QHPEQPMVTLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL +EKA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  191   MTGLDKEKASVFFKT-SADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE +G + S +    LVKRVL CF P+EFSVAVT FG     
Sbjct  250   SAFSTIHVTPEDGFSYASYEVVGFDASTLAYGDLVKRVLRCFGPSEFSVAVTIFGGHGHA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK-----VASRPSALQCWK  1136
               W     + D Y C   V QELP  G + Y+ F   +     V S  S L C++
Sbjct  310   GTW-AKELNADAYKCNNMVEQELPCGGLLIYQSFDATEDVPVAVGSPKSVLHCFE  363



>sp|A2XV58.2|DCAM_ORYSI RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Oryza sativa Indica Group]
 gb|AAC79990.1| S-adenosylmethionine decarboxylase [Oryza sativa]
Length=398

 Score =   370 bits (951),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 195/355 (55%), Positives = 245/355 (69%), Gaps = 19/355 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGYEKRLEITFSEAPVFADPDGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRG F+F ++QP
Sbjct  73    YVLSESSLFIYSDKIVIKTCGTTKLLLTIPRILELAEGLSMPLAAVKYSRGMFIFPSAQP  132

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  133   APHRSFSEEVAVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--QHPEQPMVTLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL +EKA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  191   MTGLDKEKASVFFKT-SADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE +G + S +    LVKRVL CF P+EFSVAVT FG     
Sbjct  250   LAFSTIHVTPEDGFSYASYEVVGFDASTLAYGDLVKRVLRCFGPSEFSVAVTIFGGHGHA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK-----VASRPSALQCWK  1136
               W     + D Y C   V QELP  G + Y+ F   +     V S  S L C++
Sbjct  310   GTW-AKELNADAYKCNNMVEQELPCGGLLIYQSFDATEDVPVAVGSPKSVLHCFE  363



>gb|ABO32298.1| S-adenosylmethionine decarboxylase [Saccharum hybrid cultivar 
FN-1702]
Length=399

 Score =   370 bits (951),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 239/335 (71%), Gaps = 14/335 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+  P+F DP G GLR L+R Q+DS+L+ A CTIVS+L   +FDS
Sbjct  15    SAIGFEGYEKRLEISFSEAPVFTDPNGRGLRALSRAQIDSVLDLARCTIVSKLSNEDFDS  74

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+V+KTCGTT+LLL++P IL+LA+ LSL + +VKYSRGTF+F ++QP
Sbjct  75    YVLSESSLFVYPYKMVIKTCGTTKLLLAIPRILELAEELSLPLAAVKYSRGTFIFPDAQP  134

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++F++EVAFLN  F      G A+V+GD   PG+ WHVY A        P  T+E+C
Sbjct  135   SPHKNFADEVAFLNRYFGGLRSGGNAYVIGDSAKPGQKWHVYYAT--EHPEEPVVTLEMC  192

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  193   MTGLDKKKASVFFKT-SADGYTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAVHG  251

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE MG     +    LVKRVL CF PAEFSVAVT FG     
Sbjct  252   PAFSTIHVTPEDGFSYASYEVMGFNPGSLSYGDLVKRVLRCFGPAEFSVAVTIFGERDNA  311

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
             K W G   D + YAC   V Q LP  G + Y+ FT
Sbjct  312   KTW-GKKLDAEAYACSNTVEQVLPSGGLLIYQSFT  345



>gb|AEL33693.1| S-adenosyl methionine decarboxylase [Triticum aestivum]
Length=392

 Score =   370 bits (950),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 194/366 (53%), Positives = 246/366 (67%), Gaps = 30/366 (8%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             A +SAIGFEG+EKRL+I+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +
Sbjct  3     APTSAIGFEGYEKRLDITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKD  62

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
             FDSYVLSESS+FIY  KIV+KTCGTT LLL++P IL+LA+ L + + +VKYSRG F+F  
Sbjct  63    FDSYVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILELAEELCMSLAAVKYSRGMFIFPG  122

Query  468   SQPAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTV  635
             +QPAPHRSFSEEV  LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+
Sbjct  123   AQPAPHRSFSEEVDVLNRHFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--EQPEQPMVTL  180

Query  636   EICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNG  797
             E+CMTGL ++KA++FFK    DG      EMTK+S I D+IP   +CDF+F+PCGYSMN 
Sbjct  181   EMCMTGLDKKKASVFFKT-SADGHVSCAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNA  239

Query  798   MDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVP  977
             ++G+A+ST+HVTPE+GFSYASYE MG++ S +    +VKRVL CF P+EFSVAVT FG  
Sbjct  240   INGSAFSTIHVTPEDGFSYASYEVMGMDASALAYGDIVKRVLRCFGPSEFSVAVTIFGGR  299

Query  978   ARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVA  1157
                  W G   D + Y C   V QELP  G + Y+ F  N                EEVA
Sbjct  300   GHAATW-GKKLDAEAYDCNNVVEQELPCGGVLIYQSFAAN----------------EEVA  342

Query  1158  VVGGLP  1175
             V  G P
Sbjct  343   VSAGSP  348



>gb|EMS45151.1| S-adenosylmethionine decarboxylase proenzyme [Triticum urartu]
Length=391

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 244/365 (67%), Gaps = 28/365 (8%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             AL+SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +
Sbjct  3     ALTSAIGFEGYEKRLEITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKD  62

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
             FDSYVLSESS+FIY  KIV+KTCGTT LLL++P IL+LA+ L + + +VKYSRG F+F  
Sbjct  63    FDSYVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILELAEELCMPLAAVKYSRGMFIFPG  122

Query  468   SQPAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTV  635
             +QPAPHRSFSEEV  L   F +    G A+V+GDP  PG+ WH+Y A        P  T+
Sbjct  123   AQPAPHRSFSEEVDVLTRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--EQPEQPMVTL  180

Query  636   EICMTGLSREKAAMFFKRPGGD-----GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
             E+CMTGL ++KA++FFK           EMTK+S I D+IP   +CDF+F+PCGYSMN +
Sbjct  181   EMCMTGLDKKKASVFFKTQADSHVSCAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNAI  240

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G+A ST+HVTPE+GFSYASYE MG++ S +    +VKRVL CF P+EFSVAVT FG   
Sbjct  241   NGSAVSTIHVTPEDGFSYASYEVMGMDASALAYGDIVKRVLRCFGPSEFSVAVTIFGGRG  300

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVAV  1160
                 W G   D + Y C   V QELP  G + Y+ FT N                EEVAV
Sbjct  301   HAATW-GKKLDAEAYDCNNVVEQELPCGGVLIYQSFTVN----------------EEVAV  343

Query  1161  VGGLP  1175
               G P
Sbjct  344   SAGSP  348



>emb|CAD41510.3| OSJNBa0029H02.4 [Oryza sativa Japonica Group]
 gb|EAZ14251.1| hypothetical protein OsJ_04176 [Oryza sativa Japonica Group]
Length=450

 Score =   371 bits (953),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 195/355 (55%), Positives = 246/355 (69%), Gaps = 19/355 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  65    SAIGFEGYEKRLEITFSEAPVFADPDGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  124

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRG F+F ++QP
Sbjct  125   YVLSESSLFIYSDKIVIKTCGTTKLLLTIPRILELAEGLSMPLAAVKYSRGMFIFPSAQP  184

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  185   APHRSFSEEVAVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--QHPEQPMVTLEMC  242

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL +EKA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  243   MTGLDKEKASVFFKT-SADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHG  301

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE +G + S +    LVKRVL CF P+EFSVAVT FG     
Sbjct  302   SAFSTIHVTPEDGFSYASYEVVGFDASTLAYGDLVKRVLRCFGPSEFSVAVTIFGGHGHA  361

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK-----VASRPSALQCWK  1136
               W     + D Y C   V QELP  G + Y+ F   +     V S  S L C++
Sbjct  362   GTW-AKELNADAYKCNNMVEQELPCGGLLIYQSFDATEDVPVAVGSPKSVLHCFE  415



>gb|ABJ15728.1| S-adenosylmethionine decarboxylase [Triticum monococcum]
Length=388

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 196/366 (54%), Positives = 246/366 (67%), Gaps = 30/366 (8%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             A +SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +
Sbjct  3     APTSAIGFEGYEKRLEITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKD  62

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
             FDSYVLSESS+FIY  KIV+KTCGTT LLL++P IL+LA+ L + + +VKYSRG F+F  
Sbjct  63    FDSYVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILELAEELCMPLAAVKYSRGMFIFPG  122

Query  468   SQPAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTV  635
             +QPAPHRSFSEEV  LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+
Sbjct  123   AQPAPHRSFSEEVDVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--EQPEQPMVTL  180

Query  636   EICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNG  797
             E+CMTGL ++KA++FFK    DG      EMTK+S I D+IP   +CDF+F+PCGYSMN 
Sbjct  181   EMCMTGLDKKKASVFFKTQ-ADGHVSCAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNA  239

Query  798   MDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVP  977
             ++G+A ST+HVTPE+GFSYASYE MG++ S +    +VKRVL CF P+EFSVAVT FG  
Sbjct  240   INGSAVSTIHVTPEDGFSYASYEVMGMDASALAYGDIVKRVLRCFGPSEFSVAVTIFGGR  299

Query  978   ARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVA  1157
                  W G   D + Y C   V QELP  G + Y+ FT N                EEVA
Sbjct  300   GHAATW-GKKLDAEAYDCNNVVEQELPCGGVLVYQSFTAN----------------EEVA  342

Query  1158  VVGGLP  1175
             V  G P
Sbjct  343   VSAGSP  348



>ref|XP_002462403.1| hypothetical protein SORBIDRAFT_02g025110 [Sorghum bicolor]
 gb|EER98924.1| hypothetical protein SORBIDRAFT_02g025110 [Sorghum bicolor]
Length=395

 Score =   369 bits (947),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 199/336 (59%), Positives = 237/336 (71%), Gaps = 14/336 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEG+EKRLEI+F+  P+F DP G+GLR L+R+Q+DS L+ A CTIVS+L    FD
Sbjct  14    TSPIGFEGYEKRLEITFSDAPVFEDPCGLGLRALSREQIDSFLDLARCTIVSQLSNKNFD  73

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K+VLKTCGTT+LLLS+P IL+LA  LSL V S KYSRGTF+F  +Q
Sbjct  74    SYVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAGLSLPVLSAKYSRGTFIFPGAQ  133

Query  474   PAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             PAPHRSFSEEV+ LN  F N    G A+V+GD   P + WHVY A        P  T+E+
Sbjct  134   PAPHRSFSEEVSVLNGFFGNLKSGGNAYVIGDTFKPNKKWHVYYAT--EEPEHPMVTLEM  191

Query  642   CMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
             CMTGL  +KAA+FFK    DG      EMTK+S I ++IP   ICDFEFDPCGYSMNG+ 
Sbjct  192   CMTGLDAKKAAVFFKN-SDDGSCTSAKEMTKLSGISEIIPEMEICDFEFDPCGYSMNGVF  250

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR  983
             G A ST+HVTPEEGFSYASYEAM    S +    ++KRVL  F P+EFSVAVT FG    
Sbjct  251   GPAASTIHVTPEEGFSYASYEAMNFNPSSLVYSDVIKRVLAGFSPSEFSVAVTIFGGRGF  310

Query  984   DKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
              K W  G ADVD Y C   V QELPG G + Y+ FT
Sbjct  311   AKSWAKG-ADVDSYMCDDLVEQELPGGGLLMYQSFT  345



>gb|EAY94718.1| hypothetical protein OsI_16495 [Oryza sativa Indica Group]
Length=450

 Score =   370 bits (951),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 195/355 (55%), Positives = 245/355 (69%), Gaps = 19/355 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  65    SAIGFEGYEKRLEITFSEAPVFADPDGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  124

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRG F+F ++QP
Sbjct  125   YVLSESSLFIYSDKIVIKTCGTTKLLLTIPRILELAEGLSMPLAAVKYSRGMFIFPSAQP  184

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  185   APHRSFSEEVAVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--QHPEQPMVTLEMC  242

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL +EKA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  243   MTGLDKEKASVFFKT-SADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHG  301

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE +G + S +    LVKRVL CF P+EFSVAVT FG     
Sbjct  302   LAFSTIHVTPEDGFSYASYEVVGFDASTLAYGDLVKRVLRCFGPSEFSVAVTIFGGHGHA  361

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK-----VASRPSALQCWK  1136
               W     + D Y C   V QELP  G + Y+ F   +     V S  S L C++
Sbjct  362   GTW-AKELNADAYKCNNMVEQELPCGGLLIYQSFDATEDVPVAVGSPKSVLHCFE  415



>gb|AAX76987.1| S-adenosylmethionine decarboxylase [Oryza sativa Indica Group]
Length=398

 Score =   369 bits (946),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 194/355 (55%), Positives = 243/355 (68%), Gaps = 19/355 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGYEKRLEITFSEAPVFADPDGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRG F+F ++QP
Sbjct  73    YVLSESSLFIYSDKIVIKTCGTTKLLLTIPRILELAEGLSMPLAAVKYSRGMFIFPSAQP  132

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  133   APHRSFSEEVAVLNRYFGHLKSGGYAYVIGDPAKPGQKWHIYYAT--QHPEQPMVTLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL +EKA++FFK    DG      EMTK+S I D+IP   ICD +F+PCGYSMN + G
Sbjct  191   MTGLDKEKASVFFKT-SADGHTSCAKEMTKLSGISDIIPEMEICDLDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE +G + S +    LVKRVL CF P EFSVAVT FG     
Sbjct  250   LAFSTIHVTPEDGFSYASYEVVGFDASTLAYGDLVKRVLRCFGPTEFSVAVTIFGGHGHA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK-----VASRPSALQCWK  1136
               W     + D Y C   V QELP  G + Y+ F   +     V S  S L C++
Sbjct  310   GTW-AKELNADAYKCNNMVEQELPCGGLLIYQSFDATEDVPVAVGSPKSVLHCFE  363



>ref|XP_008808772.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Phoenix dactylifera]
Length=435

 Score =   370 bits (949),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 202/357 (57%), Positives = 253/357 (71%), Gaps = 15/357 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEG+EKRLEI+F+  P+F DP+G GLR L+R Q+DSIL+ A CTIVS+L   +FDS
Sbjct  57    SPIGFEGYEKRLEITFSEAPIFVDPQGRGLRALSRAQVDSILDLARCTIVSQLSNKDFDS  116

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI+LKTCGTT+LLLS+P IL+LA+ LSL + S KYSRGTF+F  +QP
Sbjct  117   YVLSESSLFVYPYKIILKTCGTTKLLLSIPRILELAEELSLSLLSAKYSRGTFIFPGAQP  176

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PHRSFSEEVA LN  F +    G A+V+GDP  P R WH+Y A        P  T+E+C
Sbjct  177   SPHRSFSEEVAVLNQFFGDLGLGGKAYVIGDPAVPNRKWHIYYAT--QKPELPMVTLEMC  234

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL+ E+A++FFK   GDG      EMTK+S I D+IP   ICDFEFDPCGYSMNG+ G
Sbjct  235   MTGLNTERASIFFKN-SGDGHSYSAKEMTKLSGISDIIPEMEICDFEFDPCGYSMNGIHG  293

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              + ST+HVTPEEGFSYASYEAMG     +    L++RVL CF P+EFSVAVT FG     
Sbjct  294   PSLSTIHVTPEEGFSYASYEAMGFNPGSLVYGDLIERVLKCFGPSEFSVAVTIFGGRGLA  353

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVA  1157
              +W G   ++D YAC   V Q+LPG   + Y+ F+ + V+ R S L CW+  + E A
Sbjct  354   GMW-GRKVELDGYACNDLVEQDLPGGALLMYQSFSASAVSPR-SILHCWEGNDVEKA  408



>gb|AAO43186.1| S-adenosylmethionine decarboxylase [Narcissus pseudonarcissus]
Length=370

 Score =   367 bits (943),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 245/361 (68%), Gaps = 16/361 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEGFEKRLEI+F+    F DP G GLR L+R Q+DSIL+ A CTIV  L   +FD
Sbjct  6     TSPIGFEGFEKRLEITFSEASAFVDPHGRGLRALSRSQIDSILDLARCTIVDHLSNKDFD  65

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+FIYP +++LKTCGTT+LLLS+P IL LA  LSL + SVKYSRG+F+F  +Q
Sbjct  66    SYVLSESSLFIYPHRLILKTCGTTKLLLSIPKILDLASELSLPIQSVKYSRGSFIFPEAQ  125

Query  474   PAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             P PHR+FSEEV+ L+  F N    G A+V+GDP SP RNWH+Y A        P  T+E+
Sbjct  126   PTPHRNFSEEVSALDHFFGNLASGGNAYVIGDPSSPNRNWHIYYAT--QKPELPTVTLEM  183

Query  642   CMTGLSREKAAMFFKRPGG-----DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             CMTGL  EKA++FF  PG        +MTK+S I ++IP   ICDFEF+PCGYSMN + G
Sbjct  184   CMTGLDSEKASIFFNSPGNANNAQSKKMTKLSGISNIIPEMEICDFEFEPCGYSMNAICG  243

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+G SYASYEAMG   + +    LV+RVL CF PA+FSVAVT FG   + 
Sbjct  244   SAHSTIHVTPEDGSSYASYEAMGFNPAELDFGGLVERVLECFGPADFSVAVTIFGGRGQA  303

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT--NKVASRPSALQCW--KETEEEV  1154
               W G   D   + C   V QEL G G + Y+ FT    ++ S  S L CW  +E EE+ 
Sbjct  304   GSW-GREVDSYGFRCVDLVEQELAGGGLLMYQSFTAGVGRMGSPRSTLHCWDGEEIEEKK  362

Query  1155  A  1157
             A
Sbjct  363   A  363



>gb|AGZ61932.1| S-adenosylmethionine decarboxylase [Sorghum bicolor]
 gb|AGZ61933.1| S-adenosylmethionine decarboxylase [Sorghum bicolor]
Length=398

 Score =   368 bits (945),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 190/341 (56%), Positives = 238/341 (70%), Gaps = 14/341 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+  P+F DP G GLR L+RDQ+DS+L+ A CTIVSEL   +FD 
Sbjct  15    SAIGFEGYEKRLEISFSEAPVFADPNGRGLRALSRDQIDSVLDLARCTIVSELSNEDFDP  74

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+V+KTCGTT+LLL++P IL+LA  LSL + +VKYSRGTF+F ++QP
Sbjct  75    YVLSESSLFVYPYKMVIKTCGTTKLLLAIPRILELAKELSLPLSAVKYSRGTFIFPDAQP  134

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++F++EVAFLN  F      G A+V+GD   PG+ WHVY A        P  T+E+C
Sbjct  135   SPHKNFADEVAFLNRFFGGLKSGGNAYVIGDSAKPGQKWHVYYA--SEHPEEPVVTLEMC  192

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  193   MTGLDKKKASVFFKT-SADGYTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAVHG  251

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE MG          LVKRVL CF P EFSVAVT FG     
Sbjct  252   PAFSTIHVTPEDGFSYASYEVMGFNPGSSSYGDLVKRVLRCFGPVEFSVAVTIFGERDNA  311

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVAS  1109
             K W G   + + YAC   V Q LP  G + Y+ FT    A+
Sbjct  312   KTW-GKKLEAEAYACSNMVEQVLPSGGLLIYQSFTATGAAT  351



>ref|XP_004956866.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Setaria italica]
Length=394

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/336 (59%), Positives = 238/336 (71%), Gaps = 14/336 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEG+EKRLEI F+  P+F DP G GLR L+R+Q+DS L+ A CTIVS+L   +FD
Sbjct  14    ASPIGFEGYEKRLEIKFSDAPVFEDPCGRGLRALSREQIDSFLDLARCTIVSQLSNKDFD  73

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K+VLKTCGTT+LLLS+P IL+LA  LSL V SVKYSRGTF+F  +Q
Sbjct  74    SYVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAELSLPVLSVKYSRGTFIFPGAQ  133

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             PAPHRSFSEEV+ LN  F      G A+V+GD  +P + WHVY A        P  T+E+
Sbjct  134   PAPHRSFSEEVSVLNGFFGGLKSGGNAYVIGDAFNPKKKWHVYYAT--EEPEQPMVTLEM  191

Query  642   CMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
             CMTGL  +KAA+FFK    DG      EMTK+S I D+IP   ICDFEFDPCGYSMNG+ 
Sbjct  192   CMTGLDAKKAAVFFKN-SADGHCSSAKEMTKLSGISDIIPEMEICDFEFDPCGYSMNGVF  250

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR  983
             G A ST+HVTPEEGFSYASYE M  + S +    ++KRVL+ F P++FSVAVT FG    
Sbjct  251   GPAASTIHVTPEEGFSYASYEVMNFDPSSLVYSDVIKRVLSGFAPSDFSVAVTIFGGHGF  310

Query  984   DKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
              K W  G AD+D Y C   V QELPG G + Y+ FT
Sbjct  311   AKSWAKG-ADIDSYMCDDLVEQELPGGGLLMYQSFT  345



>ref|XP_002452433.1| hypothetical protein SORBIDRAFT_04g025720 [Sorghum bicolor]
 gb|EES05409.1| hypothetical protein SORBIDRAFT_04g025720 [Sorghum bicolor]
Length=398

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/341 (55%), Positives = 239/341 (70%), Gaps = 14/341 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+  P+F DP G GLR L+RDQ++++L+ A CTIVSEL   +FDS
Sbjct  15    SAIGFEGYEKRLEISFSEAPVFADPNGRGLRALSRDQIETVLDLARCTIVSELSNEDFDS  74

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+V+KTCGTT+LLL++P IL+LA  LSL + +VKYSRGTF+F ++QP
Sbjct  75    YVLSESSLFVYPYKMVIKTCGTTKLLLAIPRILELAKELSLPLSAVKYSRGTFIFPDAQP  134

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++F++EVAFLN  F      G A+V+GD   PG+ WHVY A        P  T+E+C
Sbjct  135   SPHKNFADEVAFLNRFFGGLKSGGNAYVIGDSAKPGQKWHVYYA--SEHPEEPVVTLEMC  192

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  193   MTGLDKKKASVFFKT-SADGYTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAVHG  251

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE MG          LVKRVL CF P EFSVAVT FG     
Sbjct  252   PAFSTIHVTPEDGFSYASYEVMGFNPGSSSYGDLVKRVLRCFGPVEFSVAVTIFGERDNA  311

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVAS  1109
             K W G   + + YAC   V Q LP  G + Y+ FT    A+
Sbjct  312   KTW-GKKLEAEAYACSNMVEQVLPSGGLLIYQSFTATGAAT  351



>gb|EAY86651.1| hypothetical protein OsI_08032 [Oryza sativa Indica Group]
Length=646

 Score =   375 bits (964),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 251/360 (70%), Gaps = 17/360 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL    FDS
Sbjct  84    SAIGFEGYEKRLEITFSEAPVFADPNGRGLRALSRAQIDSVLDLARCTIVSELSNEVFDS  143

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KIV+KTCGTT+LLL++P IL+LA+ LSL +++VKYSRGTF+F  +QP
Sbjct  144   YVLSESSLFVYPYKIVIKTCGTTKLLLAIPRILELAEELSLPLEAVKYSRGTFIFPEAQP  203

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++FSEEVA LN  F      G A+V+GDP  PG+ WHVY A        P  T+E+C
Sbjct  204   SPHKNFSEEVAVLNRYFSGLKSGGNAYVIGDPAKPGQKWHVYYAT--QHPEQPVVTLEMC  261

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   +CDF+F+PCGYSMN + G
Sbjct  262   MTGLDKKKASVFFKT-SADGHTTCAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNAIHG  320

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE MG   + +    LVKRVL CF P+EFSVAVT FG     
Sbjct  321   PAFSTIHVTPEDGFSYASYEVMGFNPASLAYGDLVKRVLRCFGPSEFSVAVTIFGGRNHA  380

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVA--SRPSALQCWKETEEEVA  1157
               W  G  DV  Y+C   V QELP  G + Y+ FT T ++A  S  S L C+ +   E A
Sbjct  381   GTWAKG-LDVGAYSCSNMVEQELPSGGLLIYQSFTATAEIATGSPRSVLHCFADENTEKA  439



>gb|ACT53876.1| S-adenosylmethionine decarboxylase [Saccharum officinarum]
Length=399

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/335 (56%), Positives = 238/335 (71%), Gaps = 14/335 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+  P+F DP G GLR L+R Q+DS+L+ A CTIVS+L   +FDS
Sbjct  15    SAIGFEGYEKRLEISFSEAPVFTDPNGRGLRALSRAQIDSVLDLARCTIVSKLSNEDFDS  74

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+V+KTCGTT+LLL++P IL+LA+ LSL + +VKYSRGTF+F ++QP
Sbjct  75    YVLSESSLFVYPYKMVIKTCGTTKLLLAIPRILELAEELSLPLAAVKYSRGTFIFPDAQP  134

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++F++EVAFLN  F      G A+V+GD   PG+ WHVY A        P  T+E+C
Sbjct  135   SPHKNFADEVAFLNRYFGGLRSGGNAYVIGDSAKPGQKWHVYYAT--EHPEEPVVTLEMC  192

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYS N + G
Sbjct  193   MTGLDKKKASVFFKT-SADGYTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSTNAVHG  251

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE MG     +    LVKRVL CF PAEFSVAVT FG     
Sbjct  252   PAFSTIHVTPEDGFSYASYEVMGFNPGSLSYGDLVKRVLRCFGPAEFSVAVTIFGERDNA  311

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
             K W G   D + YAC   V Q LP  G + Y+ FT
Sbjct  312   KTW-GKKLDAEAYACSNTVEQVLPFGGLLIYQSFT  345



>gb|ADD70015.1| S-adenosyl-L-methionine decarboxylase 2 [Leymus chinensis]
Length=392

 Score =   367 bits (941),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 242/363 (67%), Gaps = 30/363 (8%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  6     SAIGFEGYEKRLEITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KIV+KTCGTT LLL++P IL+LA+ L + + +VKYSRG F+F  +QP
Sbjct  66    YVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILELAEELCMPLAAVKYSRGMFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEV  LN  F      G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  126   APHRSFSEEVDVLNRYFGGLKSGGNAYVIGDPAKPGQKWHIYYAT--EQPEQPMVTLEMC  183

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   +CDF+F+PCGYSMN + G
Sbjct  184   MTGLDKKKASVFFKT-SADGHVSCAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNAIHG  242

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG++ S +    +VKRVL CF P+EFSVAVT FG     
Sbjct  243   SAFSTIHVTPEDGFSYASYEVMGMDASALAYGDIVKRVLRCFGPSEFSVAVTIFGGRGHA  302

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVAVVG  1166
               W G   D + Y C   V QELP  G + Y+ F  N                EEVAV  
Sbjct  303   ATW-GKKLDAEAYDCNNIVEQELPCGGVLIYQSFAAN----------------EEVAVSA  345

Query  1167  GLP  1175
             G P
Sbjct  346   GSP  348



>gb|AHJ14569.1| S-adenosyl methionine decarboxylase 2 [Triticum aestivum]
 gb|AHJ14570.1| S-adenosyl methionine decarboxylase 2 [Triticum aestivum]
 gb|AHJ14571.1| S-adenosyl methionine decarboxylase 2 [Triticum aestivum]
Length=392

 Score =   367 bits (941),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 193/365 (53%), Positives = 243/365 (67%), Gaps = 28/365 (8%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             A +SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +
Sbjct  3     APTSAIGFEGYEKRLEITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKD  62

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
             FDSYVLSESS+FIY  KIV+KTCGTT LLL++P IL+LA+ L + + +VKYSRG F+F  
Sbjct  63    FDSYVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILELAEELCMPLAAVKYSRGMFIFPG  122

Query  468   SQPAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTV  635
             +QPAPHRSFSEEV  LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+
Sbjct  123   AQPAPHRSFSEEVDVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--EQPEQPMVTL  180

Query  636   EICMTGLSREKAAMFFKRPGGD-----GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
             E+CMTGL ++KA++FFK           EMTK+S I D+IP   +CDF+F+PCGYSMN +
Sbjct  181   EMCMTGLDKKKASVFFKTQADSHVSCAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNAI  240

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G+A ST+HVTPE+GFSYASYE MG++ S +    +VKRVL CF P+EFS AVT FG   
Sbjct  241   NGSAVSTIHVTPEDGFSYASYEVMGMDASALAYGDIVKRVLRCFGPSEFSAAVTIFGGRG  300

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVAV  1160
                 W G   D + Y C   V QELP  G + Y+ FT N                EEVAV
Sbjct  301   HAATW-GKKLDAEAYDCNNVVEQELPCGGVLIYQSFTVN----------------EEVAV  343

Query  1161  VGGLP  1175
               G P
Sbjct  344   SAGSP  348



>emb|CAC09496.2| H0711G06.2 [Oryza sativa Indica Group]
Length=367

 Score =   365 bits (937),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 236/339 (70%), Gaps = 14/339 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  13    SAIGFEGYEKRLEITFSEAPVFADPDGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRG F+F ++QP
Sbjct  73    YVLSESSLFIYSDKIVIKTCGTTKLLLTIPRILELAEGLSMPLAAVKYSRGMFIFPSAQP  132

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  133   APHRSFSEEVAVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--QHPEQPMVTLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL +EKA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  191   MTGLDKEKASVFFKT-SADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A+ST+HVTPE+GFSYASYE +G + S +    LVKRVL CF P+EFSVAVT FG     
Sbjct  250   LAFSTIHVTPEDGFSYASYEVVGFDASTLAYGDLVKRVLRCFGPSEFSVAVTIFGGHGHA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKV  1103
               W     + D Y C   V QELP  G    R  T  K 
Sbjct  310   GTW-AKELNADAYKCNNMVEQELPCGGSSSTRASTLPKT  347



>dbj|BAK00199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   365 bits (938),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 189/352 (54%), Positives = 245/352 (70%), Gaps = 17/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  4     SAIGFEGYEKRLEITFSEASVFTDPNGRGLRALSRPQIDSVLDLAKCTIVSELSNEKFDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+V+KTCGTT+LLL++P IL+LA+ L+L + +VKYSRG F+F  +QP
Sbjct  64    YVLSESSLFVYPYKVVIKTCGTTKLLLAIPRILELAEELALPLAAVKYSRGAFIFPEAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++FS+EVAFLN  F      G A+V+GDP  PG+ WHVY A        P   +E+C
Sbjct  124   SPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYAT--QQPEQPVVNLEMC  181

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  182   MTGLDKKKASVFFKT-SADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHG  240

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSY SYE MG++ + +    LVKRVL  F P+EFSVAVT FG P+  
Sbjct  241   SAFSTIHVTPEDGFSYGSYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGCPSLA  300

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---NKVASRPSALQCW  1133
               W G   +V  Y     V QELPG G + Y+ FT    +   S  S L C+
Sbjct  301   GTW-GERLNVGVYDSTNMVVQELPGGGSLIYQSFTAAGEDSSGSPRSVLNCY  351



>gb|AAD17232.1| S-adenosylmethionine decarboxylase precursor [Triticum aestivum]
Length=392

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 192/365 (53%), Positives = 243/365 (67%), Gaps = 28/365 (8%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             A +SAIGFEG+EKRL+I+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +
Sbjct  3     APTSAIGFEGYEKRLKITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSTKD  62

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
             FDSYVLSESS+FIY  KIV+KTCGTT LLL++P IL+LA+ L + + +VKYSRG F+F  
Sbjct  63    FDSYVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILELAEELCMPLAAVKYSRGMFIFPG  122

Query  468   SQPAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTV  635
             +QPAPHRSFSEEV  LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+
Sbjct  123   AQPAPHRSFSEEVDVLNRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--EQPEQPMVTL  180

Query  636   EICMTGLSREKAAMFFKRPGGD-----GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
             E+CMTGL ++KA++FFK           EMTK+S I D+IP   +CDF+F+PCGYSMN +
Sbjct  181   EMCMTGLDKKKASVFFKTQADSHVSCAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNAI  240

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G+A ST+HVTPE+GFSYASYE MG++ S +    +VKRVL CF P+EFS AVT FG   
Sbjct  241   NGSAVSTIHVTPEDGFSYASYEVMGMDASALAYGDIVKRVLRCFGPSEFSAAVTIFGGRG  300

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVAV  1160
                 W G   D + Y C   V QELP  G + Y+ FT N                EEVAV
Sbjct  301   HAATW-GKKLDAEAYDCNNVVEQELPCGGVLIYQSFTVN----------------EEVAV  343

Query  1161  VGGLP  1175
               G P
Sbjct  344   SAGSP  348



>sp|Q42829.1|DCAM_HORCH RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Hordeum chilense]
 emb|CAA58762.1| S-adenosylmethionine decarboxylase [Triticum turgidum subsp. 
durum x Hordeum chilense]
Length=393

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 242/358 (68%), Gaps = 19/358 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  6     SAIGFEGYEKRLEITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KIV+KTCGTT LLL++P IL+LA+ L + + +VKYSRG F+F  +QP
Sbjct  66    YVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILELAEELCMPLAAVKYSRGMFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEV  LN  F +    G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  126   APHRSFSEEVDVLNRYFGHLNSGGNAYVIGDPAKPGQKWHIYYAT--EQPEQPMVTLEMC  183

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL + KA++FFK    DG      EMTK+S I D+IP   +CDF+F+PCGYSMN ++G
Sbjct  184   MTGLDKTKASVFFKT-HADGHVSCAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNAING  242

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE  G++ S +    +VKRVL CF P+EFSVAVT FG     
Sbjct  243   SAFSTIHVTPEDGFSYASYEVQGMDASALAYGDIVKRVLRCFGPSEFSVAVTIFGGRGHA  302

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNK-----VASRPSALQCWKETE  1145
               W G   D + Y C   V QELP  G + Y+ F  N+       S  S   C++  E
Sbjct  303   ATW-GKKLDAEAYDCNNVVEQELPCGGVLIYQSFAANEELAVSAGSPRSVFHCFENVE  359



>gb|EMS62883.1| S-adenosylmethionine decarboxylase proenzyme [Triticum urartu]
Length=388

 Score =   363 bits (933),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 244/351 (70%), Gaps = 17/351 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  4     SAIGFEGYEKRLEITFSEAPVFTDPNGRGLRALSRAQIDSVLDLAKCTIVSELSNDKFDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYP K+V+KTCGTT+LLL++P IL+LA+ LSL + +VKYSRGTF+F  +QP
Sbjct  64    YVLSESSLFIYPYKVVIKTCGTTKLLLAIPRILELAEELSLPLAAVKYSRGTFIFPEAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++FS+EVAFLN  F      G A+V+GDP  PG+ WHVY A        P   +E+C
Sbjct  124   SPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYAT--QQPEQPMVNLEMC  181

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  182   MTGLDKKKASVFFKT-SADGHTSCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHG  240

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG++ + +    LVKRVL  F P+EFSVAVT FG     
Sbjct  241   SAFSTIHVTPEDGFSYASYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGGRNLA  300

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---NKVASRPSALQC  1130
               W G   +V  Y     V QELP  G + Y+ FT    +   S  S L C
Sbjct  301   GTW-GERLNVGVYDSTNMVVQELPDGGALIYQSFTAVGEDSTGSPRSVLNC  350



>gb|AGL46977.1| S-adenosylmethionine decarboxylase [Cynodon dactylon]
Length=403

 Score =   364 bits (934),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 187/336 (56%), Positives = 238/336 (71%), Gaps = 14/336 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   + DS
Sbjct  13    SAIGFEGYEKRLEITFSEAPIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNDDCDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRG F+F ++QP
Sbjct  73    YVLSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKYSRGMFIFPSAQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F      G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  133   APHRSFSEEVAVLNRYFDGLKSGGNAYVIGDPAKPGQKWHIYYAT--QYPEQPMVTLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MT L ++KA++FFK    DG      EMTK+S I +++P   ICDF+F+PCGYSMN + G
Sbjct  191   MTSLDKKKASVFFKT-SADGHISCAKEMTKLSGISEIVPEMEICDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             AA S +HVTPE+GFSYASYE MG +++ +    LVKRVL CF P+EFSVAVT FG   + 
Sbjct  250   AASSNIHVTPEDGFSYASYEVMGFDVAALAYGDLVKRVLKCFGPSEFSVAVTIFGGRGQA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT  1094
               W G     + Y C   V QELP  G + Y+ F+ 
Sbjct  310   GTW-GKKLGAEFYDCNNIVEQELPCGGLLIYQSFSA  344



>gb|ACV52078.1| S-adenosylmethionine decarboxylase 1 [Sorghum bicolor]
 gb|ACV52086.1| S-adenosylmethionine decarboxylase 1 [Sorghum bicolor]
Length=399

 Score =   363 bits (933),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 197/336 (59%), Positives = 235/336 (70%), Gaps = 14/336 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEG+EKRLEI+F+  P+F DP G+GLR L+R+Q+DS L+ A CTIVS+L    FD
Sbjct  14    TSPIGFEGYEKRLEITFSDAPVFEDPCGLGLRALSREQIDSFLDLARCTIVSQLSNKNFD  73

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+Y  K+VLKTCGTT+LLLS+P IL+LA  LSL V S KYSRGTF+F  +Q
Sbjct  74    SYVLSESSLFVYSHKVVLKTCGTTKLLLSIPRILELAAGLSLPVLSAKYSRGTFIFPGAQ  133

Query  474   PAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             PAPHRSFSEEV+ LN  F N    G A+V+GD   P + WHVY A        P  T+E+
Sbjct  134   PAPHRSFSEEVSVLNGFFGNLKSGGNAYVIGDTFKPNKKWHVYYA--AEEPEHPMVTLEM  191

Query  642   CMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
             CMTGL  +KAA+FFK    DG      EMTK+S I ++IP   ICDFEFDPCGYSMNG+ 
Sbjct  192   CMTGLDAKKAAVFFKN-SDDGSCTSAKEMTKLSGISEIIPEMEICDFEFDPCGYSMNGVF  250

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR  983
             G A ST+HVTPE GFSYASYEAM    S +    ++KRVL  F P+EFSVAVT FG    
Sbjct  251   GPAASTIHVTPEGGFSYASYEAMNFNPSSLVYSDVIKRVLAGFSPSEFSVAVTIFGGRGF  310

Query  984   DKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
              K W  G ADVD Y C   V QELPG G + Y+ FT
Sbjct  311   AKSWAKG-ADVDSYMCDDLVEQELPGGGLLMYQSFT  345



>gb|EMT10641.1| S-adenosylmethionine decarboxylase proenzyme [Aegilops tauschii]
Length=392

 Score =   363 bits (932),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 193/366 (53%), Positives = 244/366 (67%), Gaps = 30/366 (8%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             A +SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +
Sbjct  3     APTSAIGFEGYEKRLEITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKD  62

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
             FDSYVLSESS+FIY  KIV+KTCGTT LLL++P IL+LA+ L + + +VKYSRG F+F  
Sbjct  63    FDSYVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILELAEELCMPLAAVKYSRGMFIFPG  122

Query  468   SQPAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTV  635
             +QPAPHRSFSEEV  L   F +    G A+V+GDP  PG+ WH+Y A        P  T+
Sbjct  123   AQPAPHRSFSEEVDVLTRYFGHLKSGGNAYVIGDPAKPGQKWHIYYAT--EQPEQPMVTL  180

Query  636   EICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNG  797
             E+CMTGL ++KA++FFK    DG      EMTK+S I D+IP   +CDF+F+PCGYSMN 
Sbjct  181   EMCMTGLDKKKASVFFKTQ-ADGHVSCAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMNA  239

Query  798   MDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVP  977
             ++G+A ST+HVTPE+GFSYASYE MG++ S +    +VKRVL CF P+EFSVAVT FG  
Sbjct  240   INGSAVSTIHVTPEDGFSYASYEVMGMDASALAYGDIVKRVLRCFGPSEFSVAVTIFGGR  299

Query  978   ARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVA  1157
                  W G   + + Y C   V QELP  G + Y+ F  N                EEVA
Sbjct  300   GHAATW-GKKLEAEAYDCNNVVEQELPCGGVLIYQSFAAN----------------EEVA  342

Query  1158  VVGGLP  1175
             V  G P
Sbjct  343   VSAGSP  348



>ref|XP_010914049.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Elaeis guineensis]
Length=382

 Score =   362 bits (930),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 250/361 (69%), Gaps = 16/361 (4%)
 Frame = +3

Query  111   LSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEF  290
             L S IGFEG+EKRLEI+F+  P+F DP+G GLR L+R Q+DS+L+ A CTIVS+L   +F
Sbjct  17    LVSPIGFEGYEKRLEITFSEAPVFVDPQGRGLRALSRAQIDSMLDLARCTIVSQLSNKDF  76

Query  291   DSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNS  470
             DSYVLSESS+F+YP KI+LKTCGTT+LLLS+P IL+LA+ LSL + S KYSRGTF+F  +
Sbjct  77    DSYVLSESSLFVYPYKIILKTCGTTKLLLSIPRILELAEELSLSLLSAKYSRGTFIFPGA  136

Query  471   QPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVE  638
             QP+PHRSFSEEVAFLN  F      G A+V+GDP  P R WH+Y A        P  T+E
Sbjct  137   QPSPHRSFSEEVAFLNQFFGGLSSGGKAYVIGDPAVPNRKWHIYYAT--QKPELPMVTLE  194

Query  639   ICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
             +CMTGL+ E+A++FFK    DG      EMTK++ I D+IP   ICDFEFDPCGYSMNG+
Sbjct  195   MCMTGLNTERASIFFKN-SVDGHSSSAKEMTKLAGISDIIPEMEICDFEFDPCGYSMNGI  253

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
              G + ST+HVTPEEGFSYASYEAMG     +    L+++VL CF P+EFSVAVT FG   
Sbjct  254   HGPSLSTIHVTPEEGFSYASYEAMGFNPGSLAYRDLIEKVLRCFGPSEFSVAVTIFGGRG  313

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVA--SRPSALQCWKETEEEV  1154
                 W G   ++D YAC   V Q+LPG   + Y+ F+ + V   S  S L  W+  + E 
Sbjct  314   LAGTW-GKKVELDGYACNDLVEQDLPGGALLIYQSFSASAVTAVSPRSILHFWEGNDVEK  372

Query  1155  A  1157
             A
Sbjct  373   A  373



>gb|ADC45378.1| S-adenosylmethionine decarboxylase 2 [Cleistogenes songorica]
Length=403

 Score =   363 bits (932),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 193/360 (54%), Positives = 244/360 (68%), Gaps = 23/360 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F   P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   + DS
Sbjct  13    SAIGFEGYEKRLEITFLEAPVFADPHGRGLRALSRAQIDSVLDLAQCTIVSELSNEDCDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYPLKIV+KTCGTT+LLL++P IL+LA+ LS+ + +VKYSRG F+F ++QP
Sbjct  73    YVLSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKYSRGMFIFPSAQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEVA LN  F      G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  133   APHRSFSEEVAVLNRYFGGLKSGGNAYVIGDPAKPGQKWHIYYAT--QYPEQPMVTLEMC  190

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I +++P   ICDF+F+PCGYSMN + G
Sbjct  191   MTGLDKKKASVFFKT-SADGHISYAKEMTKLSGISEIVPEMEICDFDFEPCGYSMNAIHG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A S +HVTPE+GFSYASYE MG + + +    LVKRVL CF P+EFSVAVT FG   + 
Sbjct  250   TASSNIHVTPEDGFSYASYEVMGFDANALAYGDLVKRVLRCFGPSEFSVAVTIFGGRCQA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVAVVG  1166
               W G     + Y C   + QELP  G + Y+ F         SA +   +   E AVVG
Sbjct  310   GTW-GKKLGAEFYDCNNMIEQELPCGGILIYQSF---------SAAEGIHQNAAEDAVVG  359



>gb|EAZ09149.1| hypothetical protein OsI_31419 [Oryza sativa Indica Group]
Length=392

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 245/369 (66%), Gaps = 16/369 (4%)
 Frame = +3

Query  84    TICAAMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTI  263
             ++  +   A +S IGFEG+EKRLEI+ +  P+F DP G GLR L+R+Q+DS L+ A CTI
Sbjct  4     SLADSWGSAPASPIGFEGYEKRLEITLSDAPVFVDPCGRGLRALSREQIDSFLDLAKCTI  63

Query  264   VSELFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYS  443
             VS L    FDSYVLSESS+F+YP K+VLKTCGTT+LLLS+P IL+LA  LSL V SVKYS
Sbjct  64    VSHLSNKHFDSYVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAELSLPVLSVKYS  123

Query  444   RGTFVFQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSG  611
             RG F+F  +QP+PHRSFSEEV+ LNS F      G A+V+GD   P + WHVY A     
Sbjct  124   RGMFIFPGAQPSPHRSFSEEVSVLNSFFGGLKSGGNAYVIGDAFKPKKKWHVYYAT--EE  181

Query  612   APAPETTVEICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFD  773
                P  T+E+CMTGL  +KA +FFK    DG      EMT +S I ++IP   ICDFEFD
Sbjct  182   PEQPMVTLEMCMTGLDAKKAEVFFKD-STDGSCSSAKEMTMLSGISEIIPEMEICDFEFD  240

Query  774   PCGYSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSV  953
             PCGYSMNG+ G A ST+HVTPEEGFSYASYEAM    S +  + L+K+VL CF P++FSV
Sbjct  241   PCGYSMNGIYGPAVSTIHVTPEEGFSYASYEAMNFNPSSLVYDDLIKKVLACFCPSDFSV  300

Query  954   AVTRFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT--TNKVASRPSALQ  1127
             AVT FG     K W  G A+VD Y C   V QELPG G + Y+ FT  T    S  S L 
Sbjct  301   AVTIFGGHGFAKSWAKG-AEVDSYMCDDLVEQELPGGGVLMYQSFTAVTPGAVSPRSTLD  359

Query  1128  CWKETEEEV  1154
              W     E+
Sbjct  360   GWNSDGAEM  368



>ref|XP_010240071.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Brachypodium 
distachyon]
Length=439

 Score =   363 bits (931),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 193/363 (53%), Positives = 241/363 (66%), Gaps = 30/363 (8%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  55    SAIGFEGYEKRLEITFSEASVFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKDFDS  114

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KIV+KTCGTT LLL++P IL+LA+ L + + +VKYSRG F+F  +QP
Sbjct  115   YVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILELAEELCMPLAAVKYSRGMFIFPGAQP  174

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             APHRSFSEEV  LN  F      G A+V+GDP  PG+ WH+Y A        P  T+E+C
Sbjct  175   APHRSFSEEVDVLNRYFGGLKSGGNAYVIGDPAKPGQKWHIYYAT--EQPEKPMVTLEMC  232

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   +CDF+F+PCGYSMN + G
Sbjct  233   MTGLDKKKASVFFKT-SADGHISCAKEMTKVSGISEIIPEMEVCDFDFEPCGYSMNAIHG  291

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG++ S +    LVKRVL CF P+EFSVAVT FG     
Sbjct  292   SAFSTIHVTPEDGFSYASYEVMGIDASALAYGDLVKRVLRCFGPSEFSVAVTIFGGRGHA  351

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVAVVG  1166
               W G     + Y C   V QELP  G + Y+ F  N                EEVAV  
Sbjct  352   ATW-GKKLTAEAYDCNNTVEQELPCGGVLIYQSFAVN----------------EEVAVSA  394

Query  1167  GLP  1175
             G P
Sbjct  395   GSP  397



>ref|XP_006660640.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Oryza brachyantha]
Length=391

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 192/335 (57%), Positives = 235/335 (70%), Gaps = 12/335 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S+IGFEG+EKRLEI+F+  P+F DP G GLR L+R+Q+DS L+ A CTIVS+L    FD
Sbjct  14    ASSIGFEGYEKRLEITFSDAPVFVDPCGRGLRALSREQIDSFLDLAKCTIVSQLSNKHFD  73

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K+VLKTCGTT+LLLS+P IL+LA  LSL V SVKYSRG F+F  +Q
Sbjct  74    SYVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAELSLPVLSVKYSRGMFIFPGAQ  133

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
              +PHRSF EEV+ LNS F      G A+V+GD   P + WHVY A        P  T+E+
Sbjct  134   TSPHRSFLEEVSVLNSFFGGLKSGGNAYVIGDAFKPKKKWHVYYAT--EEPEQPMVTLEM  191

Query  642   CMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             CMTGL  +KAA+FFK    D      EMTK+S I ++IP   ICDFEFDPCGYSMNG+ G
Sbjct  192   CMTGLHAKKAAVFFKNSTDDSCSSAKEMTKLSGISEIIPEMEICDFEFDPCGYSMNGIYG  251

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A ST+HVTPEEGFSYASYEAM    + +    L+K+VL CF P++FSVAVT FG     
Sbjct  252   PAVSTIHVTPEEGFSYASYEAMNFNPTSLVYNDLIKKVLACFCPSDFSVAVTIFGGHGFA  311

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
             K W   +A+VD Y C   V QELPG G + Y+ FT
Sbjct  312   KSW-ANSAEVDPYMCDDLVEQELPGGGLLMYQSFT  345



>gb|EMT11715.1| S-adenosylmethionine decarboxylase proenzyme [Aegilops tauschii]
Length=388

 Score =   361 bits (926),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 244/351 (70%), Gaps = 17/351 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  4     SAIGFEGYEKRLEITFSEAPVFTDPNGRGLRALSRAQIDSVLDLAKCTIVSELSNEKFDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+V+KTCGTT+LLL++P +L+LA+ LSL + +VKYSRGTF+F  +QP
Sbjct  64    YVLSESSLFVYPYKVVIKTCGTTKLLLAIPRVLELAEELSLPLAAVKYSRGTFIFPEAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++FS EVAFLN  F      G A+V+GDP  PG+ WHVY A        P   +E+C
Sbjct  124   SPHKNFSAEVAFLNGFFGGLKSGGNAYVIGDPAKPGQKWHVYYAT--QQPEQPVVNLEMC  181

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  182   MTGLDKKKASIFFKT-SDDGHTSCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHG  240

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG++ + +    LVKRVL  F P+EFSVAVT FG  +  
Sbjct  241   SAFSTIHVTPEDGFSYASYEVMGLDPASMAYGDLVKRVLRSFSPSEFSVAVTIFGGHSLA  300

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---NKVASRPSALQC  1130
               W G   +V  Y     V QELP  G + Y+ FT    +   S  S L C
Sbjct  301   GTW-GERLNVGIYDSTNMVVQELPDGGALIYQSFTAVGEDFTGSPRSVLNC  350



>gb|AHJ14567.1| S-adenosyl methionine decarboxylase 1 [Triticum aestivum]
Length=388

 Score =   360 bits (924),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 243/351 (69%), Gaps = 17/351 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   + DS
Sbjct  4     SAIGFEGYEKRLEITFSEAPVFTDPNGRGLRALSRAQIDSVLDLAKCTIVSELSNDKIDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYP K+V+KTCG T+LLL++P IL+LA+ LSL + +VKYSRGTF+F  +QP
Sbjct  64    YVLSESSLFIYPYKVVIKTCGYTKLLLAIPRILELAEELSLPLAAVKYSRGTFIFPEAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++FS+EVAFLN  F      G A+V+GDP  PG+ WHVY A        P   +E+C
Sbjct  124   SPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYAT--QQPEQPMVNLEMC  181

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  182   MTGLDKKKASVFFKT-SADGYTSCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHG  240

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG++ + +    LVKRVL  F P+EFSVAVT FG     
Sbjct  241   SAFSTIHVTPEDGFSYASYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGGRNLA  300

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---NKVASRPSALQC  1130
               W G   +V+ Y     V QELP  G + Y+ FT    +   S  S L C
Sbjct  301   GTW-GERLNVEVYDSTNMVVQELPDGGALIYQSFTAVGEDSTGSPRSVLNC  350



>gb|ADE92938.1| S-adenosylmethionine decarboxylase [Triticum aestivum]
Length=388

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 238/335 (71%), Gaps = 14/335 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +FDS
Sbjct  4     SAIGFEGYEKRLEITFSEASVFTDPNGRGLRALSRAQIDSVLDLAKCTIVSELSNEKFDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+V+KTCGTT+LLL++P +L+LA+ LSL + +VKYSRGTF+F  +QP
Sbjct  64    YVLSESSLFVYPYKVVIKTCGTTKLLLAIPRVLELAEELSLPLAAVKYSRGTFIFPEAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++FS+EVAFLN  F      G A+V+GDP  PG+ WHVY A        P   +E+C
Sbjct  124   SPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYAT--QQPEQPVVNLEMC  181

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCGYSMN + G
Sbjct  182   MTGLDKKKASVFFKT-SADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMNAIHG  240

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG++ + +    LVKRVL  F P+EFSVAVT FG     
Sbjct  241   SAFSTIHVTPEDGFSYASYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGGRNLA  300

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
               W G   +V  Y     V QELP  G + Y+ FT
Sbjct  301   GTW-GERLNVGVYDSTNMVVQELPDGGALIYQSFT  334



>gb|AHJ14566.1| S-adenosyl methionine decarboxylase 1 [Triticum aestivum]
Length=388

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/354 (54%), Positives = 245/354 (69%), Gaps = 23/354 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   + DS
Sbjct  4     SAIGFEGYEKRLEITFSEAPVFTDPNGRGLRALSRAQIDSVLDLAKCTIVSELSNDKIDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYP K+V+KTCG T+LLL++P IL+LA+ LSL + +VKYSRGTF+F  +QP
Sbjct  64    YVLSESSLFIYPYKVVIKTCGYTKLLLAIPRILELAEELSLPLAAVKYSRGTFIFPEAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETT---V  635
             +PH++FS+EVAFLN  F      G A+V+GDP  PG+ WHVY A        PE +   +
Sbjct  124   SPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYA-----TQQPEQSMVNL  178

Query  636   EICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNG  797
             E+CMTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN 
Sbjct  179   EMCMTGLDKKKASVFFKT-SADGYTSCAKEMTKLSGISEIIPGMEICDFDFEPCGYSMNA  237

Query  798   MDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVP  977
             + G+A+ST+HVTPE+GFSYASYEAMG++ + +    LVKRVL  F P+EFSVAVT FG  
Sbjct  238   IHGSAFSTIHVTPEDGFSYASYEAMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGGR  297

Query  978   ARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---NKVASRPSALQC  1130
                  W G   +V  Y     V QELP  G + Y+ FT    +   S  S L C
Sbjct  298   NLAGTW-GERLNVGVYDSTNMVVQELPDGGALIYQSFTAVGEDSTGSPRSVLNC  350



>ref|NP_001149266.1| LOC100282888 [Zea mays]
 gb|ACG34783.1| S-adenosylmethionine decarboxylase proenzyme [Zea mays]
 tpg|DAA61549.1| TPA: S-adenosylmethionine decarboxylase proenzyme [Zea mays]
Length=392

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 237/335 (71%), Gaps = 12/335 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEG+EKRLEI+F+  P+F DP G GLR L+R+Q+DS L+ A CTIVS+L    FD
Sbjct  12    ASPIGFEGYEKRLEITFSDAPVFEDPCGRGLRALSREQIDSFLDLARCTIVSQLSNESFD  71

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K+VLKTCGTT+LLL++P IL+LA  LSL + S KYSRGTF+F  +Q
Sbjct  72    SYVLSESSLFVYPHKVVLKTCGTTKLLLAIPRILELAAGLSLPLLSAKYSRGTFIFPGAQ  131

Query  474   PAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             PAPHRSFSEEV+ LN+ F N    G A+++G+P  P + WHVY A        P  T+E+
Sbjct  132   PAPHRSFSEEVSVLNAFFGNLKSGGNAYLIGEPFKPNKKWHVYYAT--EEPERPMVTLEM  189

Query  642   CMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             CMT L  +KAA+FFK   G       EMTK+S I ++IP   ICDFEFDPCGYSMNG+ G
Sbjct  190   CMTELDVKKAAVFFKNSTGGSCTSAKEMTKLSGIHEIIPEMEICDFEFDPCGYSMNGVFG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A ST+HVTPEEGFSYASYEAM  + S +    +++RVL  F P++FSVAVT FG     
Sbjct  250   PAASTIHVTPEEGFSYASYEAMNFDPSSLVYSDVIRRVLAGFSPSDFSVAVTIFGGRGFA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
             K W  G AD+D Y C   V QELPG G + Y+ FT
Sbjct  310   KSWATG-ADIDSYMCGDPVEQELPGGGLLMYQSFT  343



>gb|AHJ14568.1| S-adenosyl methionine decarboxylase 1 [Triticum aestivum]
Length=388

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 242/351 (69%), Gaps = 17/351 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS+L+ A CTIVSEL   + DS
Sbjct  4     SAIGFEGYEKRLEITFSEAPVFTDPNGRGLRALSRAQIDSVLDLAKCTIVSELSNDKIDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYP K+V+KTCG T+LLL++P IL+LA+ LSL + +VKYSRGTF+F  +QP
Sbjct  64    YVLSESSLFIYPYKVVIKTCGYTKLLLAIPRILELAEELSLPLAAVKYSRGTFIFPEAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             +PH++FS+EVAFLN  F      G A+V+GDP  PG+ WHVY A        P   +E+C
Sbjct  124   SPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYAT--QQPEQPMVNLEMC  181

Query  645   MTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             MTGL ++KA++FFK    DG      EMTK+S I ++IP   ICDF+F+PCGYSMN + G
Sbjct  182   MTGLDKKKASVFFKT-SADGYTSCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMNAIHG  240

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A+ST+HVTPE+GFSYASYE MG++ + +    LVKRVL  F P+EFSVAVT FG     
Sbjct  241   SAFSTIHVTPEDGFSYASYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGGRNLA  300

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---NKVASRPSALQC  1130
               W G   +V  Y     V QELP  G + Y+ FT    +   S  S L C
Sbjct  301   GTW-GERLNVGVYDSTNMVVQELPDGGALIYQSFTAVGEDSTGSPRSVLNC  350



>ref|NP_001063217.1| Os09g0424300 [Oryza sativa Japonica Group]
 dbj|BAD26704.1| S-adenosylmethionine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD33432.1| S-adenosylmethionine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAF25131.1| Os09g0424300 [Oryza sativa Japonica Group]
 gb|EAZ44785.1| hypothetical protein OsJ_29417 [Oryza sativa Japonica Group]
 dbj|BAG90538.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95110.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95558.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   358 bits (918),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 200/369 (54%), Positives = 243/369 (66%), Gaps = 16/369 (4%)
 Frame = +3

Query  84    TICAAMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTI  263
             ++  +   A +S IGFEG+EKRLEI+ +  P+F DP G GLR L+R+Q+DS L+ A CTI
Sbjct  4     SLADSWGSAPASPIGFEGYEKRLEITLSDAPVFVDPCGRGLRALSREQIDSFLDLAKCTI  63

Query  264   VSELFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYS  443
             VS L    FDSYVLSESS+F+YP K+VLKTCGTT+LLLS+P IL+LA  LSL V SVKYS
Sbjct  64    VSHLSNKHFDSYVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAELSLPVLSVKYS  123

Query  444   RGTFVFQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSG  611
             RG F+F  +QP+PHRSF EEV+ LNS F      G A+V+GD   P + WHVY A     
Sbjct  124   RGMFIFPGAQPSPHRSFLEEVSVLNSFFGGLKSGGNAYVIGDAFKPKKKWHVYYAT--EE  181

Query  612   APAPETTVEICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFD  773
                P  T+E+CMTGL  +KA +FFK    DG      EMT  S I ++IP   ICDFEFD
Sbjct  182   PEQPMVTLEMCMTGLDAKKAEVFFKD-STDGSCSSAKEMTMFSGISEIIPEMEICDFEFD  240

Query  774   PCGYSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSV  953
             PCGYSMNG+ G A ST+HVTPEEGFSYASYEAM    S +  + L+K+VL CF P++FSV
Sbjct  241   PCGYSMNGIYGPAVSTIHVTPEEGFSYASYEAMNFNPSSLVYDDLIKKVLACFCPSDFSV  300

Query  954   AVTRFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT--TNKVASRPSALQ  1127
             AVT FG     K W  G A+VD Y C   V QELPG G + Y+ FT  T    S  S L 
Sbjct  301   AVTIFGGHGFAKSWAKG-AEVDSYMCDDLVEQELPGGGVLMYQSFTAVTPGAVSPRSTLD  359

Query  1128  CWKETEEEV  1154
              W     E+
Sbjct  360   GWNSDGAEM  368



>gb|ACL53872.1| unknown [Zea mays]
 tpg|DAA61547.1| TPA: hypothetical protein ZEAMMB73_523809 [Zea mays]
 tpg|DAA61548.1| TPA: hypothetical protein ZEAMMB73_523809 [Zea mays]
Length=392

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 236/335 (70%), Gaps = 12/335 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEG+EKRLEI+F+  P+F DP G GLR L+R+Q+DS L+ A CTIVS+L    FD
Sbjct  12    ASPIGFEGYEKRLEITFSDAPVFEDPCGRGLRALSREQIDSFLDLARCTIVSQLSNESFD  71

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K+VLKTCGTT+LLL++P IL+LA  LSL + S KYSRGTF+F  +Q
Sbjct  72    SYVLSESSLFVYPHKVVLKTCGTTKLLLAIPRILELAAGLSLPLLSAKYSRGTFIFPGAQ  131

Query  474   PAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             PAPHRSFSEEV+ LN+ F N    G A+++G+P  P + WHVY A        P  T+E+
Sbjct  132   PAPHRSFSEEVSVLNAFFGNLKSGGNAYLIGEPFKPNKKWHVYYAT--EEPERPMVTLEM  189

Query  642   CMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             CMT L  +KAA+FFK   G       EMTK+S I ++IP   ICDFEFDPCGYSMNG+ G
Sbjct  190   CMTELDVKKAAVFFKNSTGGSCTSAKEMTKLSGIHEIIPEMEICDFEFDPCGYSMNGVLG  249

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A ST+HVTPEEGFSYASYEAM  + S +    +++RVL  F P++FSVAVT FG     
Sbjct  250   PAASTIHVTPEEGFSYASYEAMNFDPSSLVYSDVIRRVLAGFSPSDFSVAVTIFGGRGFA  309

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
             K W  G AD+D Y C   V QELP  G + Y+ FT
Sbjct  310   KSWATG-ADIDSYMCGDPVEQELPSGGLLMYQSFT  343



>ref|XP_008652738.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Zea mays]
Length=436

 Score =   357 bits (916),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 236/335 (70%), Gaps = 12/335 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEG+EKRLEI+F+  P+F DP G GLR L+R+Q+DS L+ A CTIVS+L    FD
Sbjct  56    ASPIGFEGYEKRLEITFSDAPVFEDPCGRGLRALSREQIDSFLDLARCTIVSQLSNESFD  115

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K+VLKTCGTT+LLL++P IL+LA  LSL + S KYSRGTF+F  +Q
Sbjct  116   SYVLSESSLFVYPHKVVLKTCGTTKLLLAIPRILELAAGLSLPLLSAKYSRGTFIFPGAQ  175

Query  474   PAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             PAPHRSFSEEV+ LN+ F N    G A+++G+P  P + WHVY A        P  T+E+
Sbjct  176   PAPHRSFSEEVSVLNAFFGNLKSGGNAYLIGEPFKPNKKWHVYYAT--EEPERPMVTLEM  233

Query  642   CMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             CMT L  +KAA+FFK   G       EMTK+S I ++IP   ICDFEFDPCGYSMNG+ G
Sbjct  234   CMTELDVKKAAVFFKNSTGGSCTSAKEMTKLSGIHEIIPEMEICDFEFDPCGYSMNGVLG  293

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A ST+HVTPEEGFSYASYEAM  + S +    +++RVL  F P++FSVAVT FG     
Sbjct  294   PAASTIHVTPEEGFSYASYEAMNFDPSSLVYSDVIRRVLAGFSPSDFSVAVTIFGGRGFA  353

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT  1091
             K W  G AD+D Y C   V QELP  G + Y+ FT
Sbjct  354   KSWATG-ADIDSYMCGDPVEQELPSGGLLMYQSFT  387



>gb|ADW83722.1| S-adenosylmethionine decarboxylase 2 [Musa acuminata AAA Group]
Length=360

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/342 (54%), Positives = 235/342 (69%), Gaps = 12/342 (4%)
 Frame = +3

Query  111   LSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEF  290
             L+S IGFEG+EKRLEI+ +  P+F D  G GLR L+R Q+DSIL+ A CTIVS L    F
Sbjct  13    LASPIGFEGYEKRLEITLSEAPIFVDAHGWGLRALSRAQIDSILDLARCTIVSHLSNKNF  72

Query  291   DSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNS  470
             DSYVLSESS+F+YP KI+LKTCGTT+LLLS+P IL+LA  LSL V SVKYSRGTF+F  +
Sbjct  73    DSYVLSESSLFVYPYKIILKTCGTTKLLLSIPRILELAAELSLSVFSVKYSRGTFIFPGA  132

Query  471   QPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVE  638
             QP+PHRSFS+EVA LN  F      G A+V+GD  +  R WH+Y A   +    P  T+E
Sbjct  133   QPSPHRSFSDEVAVLNQFFGSLESGGDAYVIGDSANADRKWHIYYA--ANKPELPMVTLE  190

Query  639   ICMTGLSREKAAMFFKRPGGDGE-----MTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
             +CMT L+ E+A +FFK      E     MTK+S I ++IP   ICDF+F+PCGYSMNG+ 
Sbjct  191   MCMTKLNTERALIFFKNSVEGHECPAKAMTKLSGISNIIPEMEICDFDFEPCGYSMNGIH  250

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR  983
             G + ST+HVTPEEGFSYASYEAMG +      + L++RVL CF+P+EFS+AVT FG    
Sbjct  251   GPSLSTIHVTPEEGFSYASYEAMGFDPLTSVQQDLIERVLRCFDPSEFSLAVTIFGGRGL  310

Query  984   DKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVAS  1109
                W      +D Y C+ RV Q+LPG G + Y+ F  + V +
Sbjct  311   AGTWT-DKILLDGYTCKDRVEQDLPGGGLLIYQAFAASAVTA  351



>dbj|BAJ96795.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08140.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97534.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 237/365 (65%), Gaps = 14/365 (4%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             A +S IGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+DS L+ A CTIVS+L   +
Sbjct  12    APASPIGFEGYEKRLEITFSDAPVFADPCGRGLRALSRQQIDSFLDLARCTIVSQLSNKQ  71

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
             FDSYVLSESS+F+Y  K+V+KTCGTT+LLLS+P IL+LA  LSL + S KYSRGTF+F  
Sbjct  72    FDSYVLSESSLFVYSHKVVIKTCGTTKLLLSIPRILELAAELSLPLLSAKYSRGTFIFPG  131

Query  468   SQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTV  635
             +QPAPHRSFSEE + LN  F      G A+V+GD  +P + WHVY A        P  T+
Sbjct  132   AQPAPHRSFSEEASVLNDFFGGLKSGGNAYVMGDAFTPKKMWHVYYAT--EEPEQPMVTL  189

Query  636   EICMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
             E+CMTGL   KAA+FFK     G     EMTK+S I  +IP   ICDF+FDPCGYSMNG+
Sbjct  190   EMCMTGLDARKAAVFFKNSADGGCSSAKEMTKVSGISAIIPEMEICDFDFDPCGYSMNGV  249

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
              G A ST+HVTPEEGFSYASYEAM      +    L+KRVL+CF P++FSVAVT FG   
Sbjct  250   CGPAASTIHVTPEEGFSYASYEAMNFNPGSLVYSDLIKRVLSCFRPSDFSVAVTIFGGHG  309

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---NKVASRPSALQCWKETEEE  1151
               K W         Y C   V QELPG G + Y+ F+      V+ R +    W     E
Sbjct  310   FAKSWATSAEVGSSYLCDDVVQQELPGGGLLMYQSFSAVAPGAVSPRSTLDDGWSSDGME  369

Query  1152  VAVVG  1166
              AV G
Sbjct  370   TAVQG  374



>ref|XP_006878657.1| hypothetical protein AMTR_s00011p00266060 [Amborella trichopoda]
 gb|ERM94802.1| hypothetical protein AMTR_s00011p00266060 [Amborella trichopoda]
Length=377

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 237/358 (66%), Gaps = 18/358 (5%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             MA A  S IGFEG+EKRLEI F+ PP+F DP+G+GLR LTR  LD IL PA CTIVS L 
Sbjct  1     MALASQSPIGFEGYEKRLEIVFSEPPIFADPQGLGLRALTRPHLDEILAPAECTIVSNLS  60

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
                 DSYVLSESS+F+YP KI+LKTCGTT+LLLS+  ILK A  LSL    VKYSRG+F+
Sbjct  61    NPLLDSYVLSESSLFVYPQKIILKTCGTTKLLLSISPILKHAASLSLEPIFVKYSRGSFI  120

Query  459   FQNSQPAPHRSFSEEVAFLNSQFKNGV---AFVLGDPESPGRNWHVY--VAEVGSGAPAP  623
             F   QP PHRSF+EEV+ L S F N +   A+V+GDP++P +NWHVY  +A+   G P P
Sbjct  121   FAGVQPVPHRSFTEEVSTLESFFGNMLKSEAYVIGDPKTPNQNWHVYTAMAQHTEGQP-P  179

Query  624   ETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL RE A++F+K  G     MTK S I +++P   ICD+EFDPCGYSMNG+
Sbjct  180   VFTLEMCMTGLDRECASVFYKNNGSSASTMTKHSGISNILPEFEICDYEFDPCGYSMNGI  239

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
               +A+ST+HVTPEEGFSYAS+E  G++   V L  LV+RVL CF P +F++ V   G   
Sbjct  240   KDSAFSTIHVTPEEGFSYASFEVAGLDTEKVNLGELVERVLRCFLPKDFTIVVHYSG---  296

Query  981   RDKIWRGGNAD-------VDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCW  1133
                 WRGG          +  Y C   V Q L G+G++ Y+ F+     S  S   CW
Sbjct  297   -GACWRGGAYSWGGALDAMPGYCCERVVDQGLNGEGKLAYQSFSLMDSCSPRSVFGCW  353



>ref|XP_009390538.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Musa acuminata subsp. malaccensis]
Length=373

 Score =   352 bits (902),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 187/353 (53%), Positives = 236/353 (67%), Gaps = 14/353 (4%)
 Frame = +3

Query  111   LSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEF  290
             L+S IGFEG+EKRLEI+F+ P +F DP G GLR L+R Q+DSIL+ A CTIVS+L    F
Sbjct  10    LASPIGFEGYEKRLEITFSEPSIFLDPHGWGLRALSRPQIDSILDLARCTIVSQLSNNVF  69

Query  291   DSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNS  470
             DSYVLSESS+FIYP K++LKTCGTT+LLLS+P IL+LA  LSL + S +YSRGTF+F  +
Sbjct  70    DSYVLSESSLFIYPYKLILKTCGTTKLLLSIPRILELAAELSLSILSARYSRGTFIFPGA  129

Query  471   QPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVE  638
             Q +PHRSFSEEV  LN  F     +G A+VLG   +  R WH+Y A        P  T+E
Sbjct  130   QQSPHRSFSEEVVVLNQFFGSLKSSGNAYVLGGSTNANRKWHIYYAT--EKPELPMVTLE  187

Query  639   ICMTGLSREKAAMFFKRPG-----GDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
             +CMTGL+ ++A +F+K           +MT++S I ++IP   ICDFEF+PCGYSMNG+ 
Sbjct  188   MCMTGLNTDRALIFYKNSAECHSSSAKKMTEISGISNIIPEMEICDFEFEPCGYSMNGIH  247

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR  983
             G A ST+HVTPE+GFSYASYEAMG     +  + LV+RVL CF P+EFSVAVT  G    
Sbjct  248   GPALSTIHVTPEKGFSYASYEAMGFNSLTLVYQDLVERVLRCFGPSEFSVAVTILGDRGL  307

Query  984   DKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVA--SRPSALQCWK  1136
                W      +D Y C+ RV QELPG G   Y+ F  + V   S  S L  W+
Sbjct  308   AGTW-AEKIHLDGYTCKDRVDQELPGGGLSIYQMFAASAVTAVSPRSTLPYWE  359



>gb|ADD70012.1| S-adenosyl-L-methionine decarboxylase 1 [Leymus chinensis]
Length=395

 Score =   352 bits (903),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 192/371 (52%), Positives = 242/371 (65%), Gaps = 30/371 (8%)
 Frame = +3

Query  93    AAMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSE  272
             A +  A  SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSE
Sbjct  2     AVLDSAPVSAIGFEGYEKRLEITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSE  61

Query  273   LFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGT  452
             L   +FDSYVLSESS+FIY  KIV+KTCGTT L L++P IL+LA+ L + + +VKYS G 
Sbjct  62    LSNKDFDSYVLSESSLFIYSQKIVIKTCGTTMLPLTIPRILELAEELCMPLAAVKYSCGM  121

Query  453   FVFQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA  620
             F+F  +QPAPHRSFSEEV  LN  F      G A+V+GDP  PG+ WH+Y A        
Sbjct  122   FIFPGAQPAPHRSFSEEVDVLNRYFGGLKSGGNAYVIGDPARPGQKWHIYYAT--EQPEQ  179

Query  621   PETTVEICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCG  782
             P  T+E+CMTGL ++KA++FFK    DG      EMTK+S I D+IP+  +CDF+F+PCG
Sbjct  180   PMVTLEMCMTGLDKKKASVFFKT-CADGHVSCAKEMTKVSGISDIIPAMEVCDFDFEPCG  238

Query  783   YSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVT  962
             YSMN + G+A+ST+HVTPE+GF YASYE MG+  S +    +VKRVL CF P+EFSVAVT
Sbjct  239   YSMNAIHGSAFSTIHVTPEDGFGYASYEVMGMNASALDYGDVVKRVLRCFGPSEFSVAVT  298

Query  963   RFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKET  1142
              FG       W G   + + Y C   V Q LP  G + Y+ FT N               
Sbjct  299   IFGGRGDAATW-GRKLEAEAYDCNNTVEQALPCGGFLIYQSFTAN---------------  342

Query  1143  EEEVAVVGGLP  1175
              EEVAV  G P
Sbjct  343   -EEVAVSAGSP  352



>ref|XP_010238180.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Brachypodium distachyon]
Length=432

 Score =   353 bits (906),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 197/362 (54%), Positives = 238/362 (66%), Gaps = 14/362 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEG+EKRLEI+F+  P+F DP G GLR L+R+Q+DS L+ A CTIVS+L   +FD
Sbjct  54    ASPIGFEGYEKRLEITFSDAPVFVDPSGRGLRALSREQIDSFLDLARCTIVSQLSNRQFD  113

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+Y  K+VLKTCGTT+LLLS+P +L+LA  LSL V SVKYSRGTF+F ++Q
Sbjct  114   SYVLSESSLFVYSHKVVLKTCGTTKLLLSIPRVLELAAELSLPVLSVKYSRGTFIFPSAQ  173

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             P+PHRSFSEEV+ LN  F      G A+V GD   P + WHVY A        P  T+E+
Sbjct  174   PSPHRSFSEEVSVLNGFFGGLKSGGNAYVTGDSFRPRKMWHVYYAT--EEPEQPMVTLEM  231

Query  642   CMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             CMTGL  +KAA+FFK     G     EMTK S I  +IP   ICDF+FDPCGYSMNG+ G
Sbjct  232   CMTGLDTKKAAVFFKNSADGGCSSAKEMTKASGISGIIPEMEICDFDFDPCGYSMNGICG  291

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A ST+HVTPEEGFSYASYE + V    V    L+KRVL CF P++FSVAVT FG     
Sbjct  292   PAASTIHVTPEEGFSYASYEVIKVNPGSVVYSDLIKRVLACFCPSDFSVAVTIFGGRGFA  351

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT--TNKVASRPSALQCWKETEEEVAV  1160
             + W  G A+V  Y C   V Q LPG G + Y+ FT  T    S  S L  W     E   
Sbjct  352   QTWATG-AEVGSYMCDDLVEQVLPGGGLLVYQSFTAVTPGAVSPRSTLDVWNNEGMETTA  410

Query  1161  VG  1166
              G
Sbjct  411   KG  412



>ref|NP_001149694.1| S-adenosylmethionine decarboxylase proenzyme [Zea mays]
 gb|ACG36410.1| S-adenosylmethionine decarboxylase proenzyme [Zea mays]
 gb|AFW62928.1| S-adenosylmethionine decarboxylase proenzyme isoform 1 [Zea mays]
 gb|AFW62929.1| S-adenosylmethionine decarboxylase proenzyme isoform 2 [Zea mays]
 gb|AFW62930.1| S-adenosylmethionine decarboxylase proenzyme isoform 3 [Zea mays]
 gb|AFW62931.1| S-adenosylmethionine decarboxylase proenzyme isoform 4 [Zea mays]
Length=395

 Score =   350 bits (899),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 192/345 (56%), Positives = 235/345 (68%), Gaps = 14/345 (4%)
 Frame = +3

Query  93    AAMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSE  272
             AA A    S IGFEGFEKRLEISF+  P+  DP G GLR L+R Q+DS+L+ A CTIVSE
Sbjct  7     AAAAPPPVSVIGFEGFEKRLEISFSEAPVLADPSGRGLRALSRAQIDSVLDLARCTIVSE  66

Query  273   LFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGT  452
             L   +FDSYVLSESS+F+YP KIV+KTCGTT+LLL++P IL+LA+ L L + +VKYSRGT
Sbjct  67    LSNEDFDSYVLSESSLFVYPYKIVIKTCGTTKLLLAIPRILELAEELLLPLAAVKYSRGT  126

Query  453   FVFQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA  620
             F+F  +QP+PH++F++EVAFLN  F      G A+V+GD   PG+ WHVY A        
Sbjct  127   FIFPEAQPSPHKNFADEVAFLNRFFGGLKSGGNAYVIGDSAKPGQKWHVYYA--AEHPEE  184

Query  621   PETTVEICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCG  782
             P  T+E+CMTGL ++KA++FFK    DG      EMTK+S I D+IP   ICDF+F+PCG
Sbjct  185   PVVTLEMCMTGLDKKKASVFFKTT-ADGYSLCAKEMTKLSGISDIIPEMEICDFDFEPCG  243

Query  783   YSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVT  962
             YSMN + G A ST+HVTPE+GFSYASYE MG          LVKRVL CF P EFSVAVT
Sbjct  244   YSMNAVHGPALSTIHVTPEDGFSYASYEVMGFNPGSFSYGDLVKRVLRCFGPTEFSVAVT  303

Query  963   RFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTN  1097
              FG     K W G   D + YAC   V Q LP  G + Y+ FT  
Sbjct  304   IFGDRDNAKTW-GTKLDAEAYACSNMVEQVLPFGGLLIYQSFTVT  347



>gb|KDP24344.1| hypothetical protein JCGZ_25640 [Jatropha curcas]
Length=359

 Score =   349 bits (896),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 241/357 (68%), Gaps = 11/357 (3%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLE+SF+ P  F DP GMGLR L++ Q+D IL+PA CTIV  L     D
Sbjct  5     TSAIGFEGYEKRLEVSFSEPGFFADPGGMGLRSLSKAQIDEILKPAECTIVDSLSNDHVD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+FIYP K+++KTCGTT+LLLS+P ILKLA  LSL V SV+YSRG+F+F  +Q
Sbjct  65    SYVLSESSLFIYPYKVIIKTCGTTKLLLSIPAILKLAGTLSLTVHSVRYSRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVE  638
               PHRSFSEEVA L+  F       VA+V+G P+   + WHVY A + +G  +    T+E
Sbjct  125   SFPHRSFSEEVAVLDGHFGKLGLESVAYVMGSPDKT-QKWHVYSASLDTGRHSSSVQTLE  183

Query  639   ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL R++A++F+K P      MT+ S I  ++P   ICDF+F+PCGYSMN ++G A 
Sbjct  184   MCMTGLDRDRASVFYKTPASSAAGMTEESGIRKILPQSEICDFDFEPCGYSMNSIEGGAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+EA+G  L  V L  L++RVL CFEPAEFS+A+    V   D++ 
Sbjct  244   STIHVTPEDGFSYASFEAVGYNLEQVKLTLLLERVLACFEPAEFSIALHSDFV--HDELG  301

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEEVAV  1160
                + DV  Y+C     + L   G I Y+ F   K  S P ++   CW E E++  V
Sbjct  302   LMSSLDVKGYSCGGSNYEVLGKGGSIIYQSFVKTKGCSSPRSILKCCWSEDEKDEEV  358



>gb|ADU02193.1| S-adenosylmethionine decarboxylase [Festuca arundinacea]
Length=395

 Score =   350 bits (898),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 190/371 (51%), Positives = 238/371 (64%), Gaps = 30/371 (8%)
 Frame = +3

Query  93    AAMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSE  272
             A +  A  SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSE
Sbjct  2     AVLDSAPVSAIGFEGYEKRLEITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSE  61

Query  273   LFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGT  452
             L   +FDSYVLSESS+FIY  KIV+KTCGTT LLL     L+LA+ L + + +VKYSRG 
Sbjct  62    LSNKDFDSYVLSESSLFIYSQKIVIKTCGTTMLLLGYSTSLELAEELCMPLAAVKYSRGM  121

Query  453   FVFQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA  620
             F+F  +QPAPHR+FSEEV  LN  F      G A+V+G P  PG+ WH+Y A        
Sbjct  122   FIFPGAQPAPHRTFSEEVDVLNRYFGGLKSGGDAYVIGHPAKPGQKWHIYYAT--EQPEE  179

Query  621   PETTVEICMTGLSREKAAMFFKRPGGDG------EMTKMSRICDVIPSHVICDFEFDPCG  782
             P  T+E+CMTGL ++KA++FFK    DG      EMTK+S I D+ P   +CDF+F+PCG
Sbjct  180   PMVTLEMCMTGLDKKKASVFFKT-SADGHVSCAKEMTKVSGISDITPEMEVCDFDFEPCG  238

Query  783   YSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVT  962
             YSMN + G+A+ST+HVTPE+GFSYASYE MG+  S +    +VKRVL CF P+EFSVAVT
Sbjct  239   YSMNAIHGSAFSTIHVTPEDGFSYASYEVMGMNASALAYGDVVKRVLRCFGPSEFSVAVT  298

Query  963   RFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKET  1142
              FG       W G   + + Y C   V Q LP  G + Y+ FT N               
Sbjct  299   IFGGRGDAATW-GRKLEAEAYDCNNTVEQALPCGGFLIYQSFTAN---------------  342

Query  1143  EEEVAVVGGLP  1175
              EEVAV  G P
Sbjct  343   -EEVAVSAGSP  352



>sp|Q43820.1|DCAM_PEA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Pisum sativum]
 gb|AAB03865.1| S-adenosylmethionine decarboxylase [Pisum sativum]
Length=353

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 236/352 (67%), Gaps = 10/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF+ P LF DP+G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGFEKRLEISFSDPGLFSDPQGRGLRSLTKSQLDEILAPAECTIVSSLANEDVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  K+++KTCGTT+LLLS+P ILKLAD +SL V SV+Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFVYAYKLIIKTCGTTKLLLSIPPILKLADSISLNVRSVRYTRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHR FSEEVA L+  F       +A++LG  +   +NWH+Y A   S +P     T+E+
Sbjct  124   FPHRHFSEEVAVLDGFFGKLGSGSMAYILGGSD-EAQNWHIYCASSDSVSPEGSVYTLEM  182

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++FFK + G   EMT  S I  ++ +  ICDF+F+PCGYSMN ++G+A S
Sbjct  183   CMTGLDREKASVFFKEQTGSAAEMTVNSGIRKILRNSEICDFDFEPCGYSMNSVEGSAVS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E  G +L  + L  +V RVL CF+P EFSVAV      A     +
Sbjct  243   TIHITPEDGFSYASFETAGYDLKAINLNEMVMRVLACFQPTEFSVAVHVDN--ASKSFEQ  300

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWKETEEE  1151
             G   DV  Y C  +  Q L   G + Y+ F        P S L+CWK+ +EE
Sbjct  301   GCLLDVKGYCCEEKSHQGLGMSGSVVYQKFLKTSYCGSPRSTLKCWKDEDEE  352



>gb|EMT07332.1| S-adenosylmethionine decarboxylase proenzyme [Aegilops tauschii]
Length=468

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 197/383 (51%), Positives = 245/383 (64%), Gaps = 19/383 (5%)
 Frame = +3

Query  54    YRNIEK*TLFTICAAMAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLD  233
             Y N+E     ++      A +S IGFEG+EKRLEI+F+  P+F DP G GLR L+R Q+D
Sbjct  74    YSNME----MSLADCWGPAPASPIGFEGYEKRLEITFSDAPVFADPCGRGLRALSRHQID  129

Query  234   SILEPAFCTIVSELFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLL  413
             S L+ A CTIVS+L   +FDSYVLSESS+F+Y  K+V+KTCGTT+LLLS+P IL+LA  L
Sbjct  130   SFLDLARCTIVSQLSNKQFDSYVLSESSLFVYSHKVVIKTCGTTKLLLSIPRILELAAEL  189

Query  414   SLGVDSVKYSRGTFVFQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNW  581
             SL + S KYSRG F+F  +QPAPHRSFSEEV+ LN  F      G A+V+GD   P + W
Sbjct  190   SLPLLSAKYSRGAFIFPGAQPAPHRSFSEEVSVLNGFFGGLKSGGNAYVMGDAFRPKKMW  249

Query  582   HVYVAEVGSGAPAPETTVEICMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPS  746
             HVY A        P  T+E+CMTGL   KAA+FFK     G     EMTK+S I  +IP 
Sbjct  250   HVYYAT--EEPEQPMVTLEMCMTGLDAGKAAVFFKNSADGGCSSAKEMTKVSGISAIIPE  307

Query  747   HVICDFEFDPCGYSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLN  926
               ICDF+FDPCGYSMNG+ G A ST+HVTPEEGFSYASYEAM      +    L+KRVL+
Sbjct  308   MEICDFDFDPCGYSMNGVCGPAASTIHVTPEEGFSYASYEAMNFNPGSLVYSDLIKRVLS  367

Query  927   CFEPAEFSVAVTRFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---N  1097
             CF P++FS+AVT FG     K W   +A+V  Y     V QELPG G + Y+ F+     
Sbjct  368   CFRPSDFSLAVTIFGGQGFAKSW-AADAEVCSYLLEDVVEQELPGGGLLMYQSFSAVAPG  426

Query  1098  KVASRPSALQCWKETEEEVAVVG  1166
              V+ R +    W     E AV G
Sbjct  427   AVSPRSTLDDGWSSDGMETAVQG  449



>sp|Q9M4D8.1|DCAM_VICFA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Vicia faba]
 emb|CAB76966.1| S-adenosylmethionine decarboxylase [Vicia faba]
Length=353

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 236/352 (67%), Gaps = 10/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF+ P LF DP+G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGFEKRLEISFSDPGLFSDPQGRGLRSLTKSQLDEILAPAECTIVSSLANEDVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P ILKLA+ +SL V +V+Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKLAESISLDVRAVRYTRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHR FSEEVA L+  F        A+++G  +   +NWHVY A   S +PA    T+E+
Sbjct  124   FPHRHFSEEVAVLDGFFGKLGSGSKAYIMGGSDE-AQNWHVYCASADSVSPADSVYTLEM  182

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++FFK+  G   EMT  S I  ++P+  ICDF+F+PCGYSMN ++G A S
Sbjct  183   CMTGLDREKASVFFKQQTGSAAEMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEGPAVS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E  G +L  + L  +V RVL CF+P EFSVAV      A     +
Sbjct  243   TIHITPEDGFSYASFETAGYDLKAMNLNEMVMRVLACFQPTEFSVAVHVDN--ASKSFEQ  300

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWKETEEE  1151
             G   DV  Y C  +  Q L   G + Y+ F        P S L+CWK+ +EE
Sbjct  301   GCLLDVKGYCCDEKSHQGLGMSGSVVYQKFVKASDCGSPRSTLKCWKDEDEE  352



>gb|AAM44307.1|AF512545_1 S-adenosylmethionine decarboxylase [Citrus x microcarpa]
Length=361

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 245/358 (68%), Gaps = 11/358 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F DP G GLR L++ QLD IL+PA CTIVS L     DS
Sbjct  6     SAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSNEYLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LLLS+P ILKLA+ LSL V SV+++RG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLLSIPAILKLAESLSLSVRSVRFTRGSFIFAGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHRSFSEEVA L+  F     +  AFV+G P++  R WHVY A   +G+      T+E+
Sbjct  126   FPHRSFSEEVAVLDGHFGKFGMDSTAFVMGSPDNTKR-WHVYSASAEAGSHVNLVYTLEM  184

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R++A++F+K        MT+ S I  ++P   ICDFEFDPCGYSMN ++G A S
Sbjct  185   CMTGLDRKRASVFYKTNESSAAMMTEDSGIRKILPKSEICDFEFDPCGYSMNSIEGDAVS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +  +V L +L++RVL CF+PAEFSVA+    V   D+   
Sbjct  245   TIHVTPEDGFSYASFEAVGYDFEVVKLTSLLERVLACFKPAEFSVALHSDIVG--DEHGD  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEEVAVVG  1166
                 D   Y+C  ++ +EL  +G + Y  F+    ++ P ++   CW E E++  V G
Sbjct  303   TFTLDFKGYSCGEKIYEELGNNGSLIYYSFSRTDCSTSPRSILKCCWSEDEKDEEVEG  360



>gb|ABY55856.1| S-adenosylmethionine decarboxylase 3 [Solanum lycopersicum]
Length=364

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 240/352 (68%), Gaps = 10/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P LF DP G GLR L++ QLD  L PA CTIV  LF    DS
Sbjct  7     SAIGFEGYEKRLEISFFEPGLFADPEGKGLRSLSKAQLDEFLGPAECTIVDSLFNECVDS  66

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYP KIV+KTCGTT+LLLS+PVILKLAD LSL V +VKY+RG+F+F  +Q 
Sbjct  67    YVLSESSLFIYPYKIVIKTCGTTKLLLSIPVILKLADTLSLKVQAVKYTRGSFIFPGAQS  126

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+S F N      A +LG  ++  + WHVY A  GS     P  T+E+
Sbjct  127   FPHRHFSEEVAVLDSYFGNLSSGSKAVILGSHDNL-QKWHVYSASAGSIQTKNPVYTLEM  185

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMT L R+KA++F+K       EMT  S I  ++P+  ICDFEFDPCGYSMN ++GAA S
Sbjct  186   CMTNLLRKKASVFYKTESSSAAEMTIRSGIRKILPNSDICDFEFDPCGYSMNSIEGAALS  245

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +L+   L +LV+RVL CF+P EFSVA+    V A + + R
Sbjct  246   TIHVTPEDGFSYASFEAVGYDLNSSSLGSLVRRVLTCFQPDEFSVALHADYV-ACELLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CWKETEE  1148
               + DV  Y+      +EL   G I YR FT + +   P S LQ CW E E+
Sbjct  305   ICSFDVKGYSHAEWSPEELGKGGLIVYRKFTRSSLCGSPKSVLQDCWNEEEK  356



>ref|XP_004490299.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Cicer arietinum]
 gb|ACL14489.1| S-adenosylmethionine decarboxylase [Cicer arietinum]
 gb|ACL14490.1| S-adenosylmethionine decarboxylase [Cicer arietinum]
Length=353

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 187/352 (53%), Positives = 237/352 (67%), Gaps = 10/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEI F+ P LF DP+G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGFEKRLEICFSDPGLFSDPQGRGLRSLTKSQLDEILAPAECTIVSSLANDDVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKLA+ +SL V SV+YSRG+F+F  +Q 
Sbjct  64    YVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLAESISLKVRSVRYSRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHR FSEEVA L+  F       +A+++G   +  +NWHVY A   S +P     T+E+
Sbjct  124   YPHRHFSEEVAVLDGYFGKLGSGSMAYIMGGS-NEAQNWHVYSASADSVSPIDSVYTLEM  182

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA +FFK + G   +MT  S I  ++P+  ICDF+F+PCGYSMN ++GAA S
Sbjct  183   CMTGLDREKALVFFKEQSGSAAKMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEGAAVS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+E +G  L  + L  LV RVL+CFEP EFSVAV      A     +
Sbjct  243   TIHVTPEDGFSYASFETVGYNLKTMNLNELVVRVLDCFEPTEFSVAVHVDN--ASKSFEQ  300

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRPSALQCWKETEEE  1151
             G   DV  Y    R  + L   G + Y+ F  T+   S  S L+CWK+ +EE
Sbjct  301   GCLLDVKGYCREERSHEGLGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEE  352



>ref|XP_003550675.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Glycine max]
 gb|KHN17524.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=358

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 194/361 (54%), Positives = 250/361 (69%), Gaps = 16/361 (4%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             M E+  +  GFEGFEKR+EISF+      +P+ +GLR L+  Q+ SILE A C+IVS+L 
Sbjct  1     MVESEKTEAGFEGFEKRVEISFSFSE-SGEPKKLGLRALSGAQIKSILEAARCSIVSQLS  59

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
              +E DSYVLSESS+F++PLKI+LKTCGTTRLLLSV  IL LA  LSL V +VKYSRG+F+
Sbjct  60    NSELDSYVLSESSLFVFPLKIILKTCGTTRLLLSVKPILDLAASLSLSVFAVKYSRGSFL  119

Query  459   FQNSQPAPHRSFSEEVAFLNSQFK--NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETT  632
             F N QPAPH +F  EVA LN  F   N  A+V+G+P    R WH+Y A  G  A     T
Sbjct  120   FPNDQPAPHDTFLNEVALLNHYFAHLNAKAYVIGNPN---RCWHLYSA-CGEAATL-SLT  174

Query  633   VEICMTGLSREKAAMFFKRPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             VEICMTGL R+KA +F K  GG G+MT+MS I +++ SHVICDFEF+PCGYSMNG++GAA
Sbjct  175   VEICMTGLDRDKARVFHKEWGG-GKMTEMSGISEIVQSHVICDFEFEPCGYSMNGIEGAA  233

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKI  992
             +STVHVTPE GFSY SYE  G++    G  ALV++VL CF P++FSVAVT   V A D  
Sbjct  234   FSTVHVTPENGFSYGSYEVQGLDPGSNGFGALVRKVLKCFCPSDFSVAVT-CEVGAED--  290

Query  993   WRGGNADVDRYACRFRVTQE-LPGDGRIDYRCFTT---NKVASRPSALQCWKETEEEVAV  1160
             W   +ADV+ Y C+  V Q+ LPG G + YR ++     + + + + ++C  E E+E  V
Sbjct  291   WAMSDADVEGYCCQNVVKQQLLPGKGCLVYRTYSARGRGRGSPKIAIVKCSNEIEKEELV  350

Query  1161  V  1163
             +
Sbjct  351   L  351



>gb|ADH95190.1| S-adenosylmethionine decarboxylase [Arachis hypogaea]
Length=358

 Score =   343 bits (881),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 235/353 (67%), Gaps = 11/353 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI F+ P LF DP G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  8     SAIGFEGYEKRLEICFSHPGLFSDPEGKGLRSLTKSQLDEILAPAECTIVSSLSSNDVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P IL+LA+ LSL V SV+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILRLAETLSLNVKSVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHRSFSEEVA L+S F       +A+++G      + WHVY A   S +P     T+E+
Sbjct  128   FPHRSFSEEVAILDSHFGKLGSGSMAYIMGGGIDKPQKWHVYSASAESVSPCDSVYTLEM  187

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA +F+K P G    MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  188   CMTGLDREKALVFYKEPSGSAARMTANSGIRKILPDSDICDFEFEPCGYSMNSVEGAAVS  247

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+E +G +L +V L  LV+ VL CF+P EFS+AV    V    K + 
Sbjct  248   TIHVTPEDGFSYASFETVGYDLKVVNLNDLVESVLACFQPTEFSMAVH---VDCSSKSFE  304

Query  999   GGN-ADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRPSALQCWKETEEE  1151
                  DV  Y    R  + +   G + Y+ F  T+   S  S L+CWK+  EE
Sbjct  305   QSCLLDVKGYCREERSHEGIGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEVEE  357



>sp|Q42679.1|DCAM_CATRO RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Catharanthus roseus]
 gb|AAC48989.1| S-adenosyl-L-methionine decarboxylase proenzyme [Catharanthus 
roseus]
 prf||2106177A Met(S-adenosyl) decarboxylase [Catharanthus roseus]
Length=357

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/354 (52%), Positives = 239/354 (68%), Gaps = 11/354 (3%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLEISF     F DP G GLR L + Q+D ILEPA CTIV  L     D
Sbjct  5     ASAIGFEGYEKRLEISFFESSFFADPDGKGLRALNKSQIDEILEPAECTIVDSLSNQYLD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLA+ LSL V +VKY+RG+F+F  +Q
Sbjct  65    SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILKLAESLSLSVRNVKYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVE  638
               PHRSFSEEV  L++ F K G+   AF++G+P+ P + WHVY A VGS   + P  T+E
Sbjct  125   SFPHRSFSEEVELLDNYFGKLGLESNAFIMGNPDQP-QKWHVYSASVGSEQSSDPTYTLE  183

Query  639   ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKA++F+K        MT  S I  ++P   ICDFEFDPCGYSMN ++ AA 
Sbjct  184   MCMTGLDREKASVFYKSESSSAALMTTRSGIRKILPDSEICDFEFDPCGYSMNSIEEAAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+EA G +L    L  +++RVL CF+P+EFSVAV    V  +  + 
Sbjct  244   STIHVTPEDGFSYASFEAAGYDLKAQNLGMMIERVLACFQPSEFSVAV-HCDVTCK-SLE  301

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEE  1151
             +  + ++  Y+   ++ +EL   G I Y+ F        P ++   CWKE E E
Sbjct  302   QICSLELKEYSLDEKINEELGLGGSIIYKKFLRIDACGSPRSILKCCWKEDESE  355



>ref|XP_004490298.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Cicer arietinum]
Length=411

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 187/352 (53%), Positives = 237/352 (67%), Gaps = 10/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEI F+ P LF DP+G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  62    SAIGFEGFEKRLEICFSDPGLFSDPQGRGLRSLTKSQLDEILAPAECTIVSSLANDDVDS  121

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKLA+ +SL V SV+YSRG+F+F  +Q 
Sbjct  122   YVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLAESISLKVRSVRYSRGSFIFPGAQS  181

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHR FSEEVA L+  F       +A+++G   +  +NWHVY A   S +P     T+E+
Sbjct  182   YPHRHFSEEVAVLDGYFGKLGSGSMAYIMGG-SNEAQNWHVYSASADSVSPIDSVYTLEM  240

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA +FFK + G   +MT  S I  ++P+  ICDF+F+PCGYSMN ++GAA S
Sbjct  241   CMTGLDREKALVFFKEQSGSAAKMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEGAAVS  300

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+E +G  L  + L  LV RVL+CFEP EFSVAV      A     +
Sbjct  301   TIHVTPEDGFSYASFETVGYNLKTMNLNELVVRVLDCFEPTEFSVAVHVDN--ASKSFEQ  358

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRPSALQCWKETEEE  1151
             G   DV  Y    R  + L   G + Y+ F  T+   S  S L+CWK+ +EE
Sbjct  359   GCLLDVKGYCREERSHEGLGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEE  410



>ref|XP_010325052.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum lycopersicum]
Length=364

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 239/352 (68%), Gaps = 10/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P LF DP G GLR L++ QLD  L PA CTIV  L     DS
Sbjct  7     SAIGFEGYEKRLEISFFEPGLFADPEGKGLRSLSKAQLDEFLGPAECTIVDSLSNECVDS  66

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYP KIV+KTCGTT+LLLS+PVILKLAD LSL V +VKY+RG+F+F  +Q 
Sbjct  67    YVLSESSLFIYPYKIVIKTCGTTKLLLSIPVILKLADTLSLKVQAVKYTRGSFIFPGAQS  126

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+S F N      A +LG  ++  + WHVY A  GS     P  T+E+
Sbjct  127   FPHRHFSEEVAVLDSYFGNLSSGSKAVILGSHDNL-QKWHVYSASAGSIQTKNPVYTLEM  185

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMT L R+KA++F+K       EMT  S I  ++P+  ICDFEFDPCGYSMN ++GAA S
Sbjct  186   CMTNLLRKKASVFYKTESSSAAEMTIRSGIRKILPNSDICDFEFDPCGYSMNSIEGAALS  245

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +L+   L +LV+RVL CF+P EFSVA+    V A + + R
Sbjct  246   TIHVTPEDGFSYASFEAVGYDLNSSSLGSLVRRVLTCFQPDEFSVALHADYV-ACELLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CWKETEE  1148
               + DV  Y+      +EL   G I YR FT + +   P S LQ CW E E+
Sbjct  305   ICSFDVKGYSHAEWSPEELGKGGLIVYRKFTRSSLCGSPKSVLQDCWNEEEK  356



>ref|XP_006573201.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Glycine max]
 gb|KHN07170.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=355

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 235/359 (65%), Gaps = 13/359 (4%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             MA A+S AIGFEGFEKRLEISF  P LF DP GMGLR L + QLD IL PA CTIVS L 
Sbjct  1     MAMAVS-AIGFEGFEKRLEISFFQPGLFADPEGMGLRALAKSQLDEILTPAACTIVSSLR  59

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
                 DSYVLSESS+F+Y  KI++KTCGTT+LLL++P ILK A++LSL V SV Y+RG+F+
Sbjct  60    NDHVDSYVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKFAEMLSLNVRSVNYTRGSFI  119

Query  459   FQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPE  626
             F  +QP PHR+FSEEVA L+  F        A++LG  +   +NWHVY A   S  P   
Sbjct  120   FPGAQPYPHRNFSEEVAILDGYFGKLSAGSNAYILGG-QDKSQNWHVYSASADSVTPCDN  178

Query  627   T-TVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL REKA +F+K        MT  S I  ++P   ICDF+F+PCGYSMN +
Sbjct  179   VYTLEMCMTGLDREKAQVFYKEQSASAAIMTVNSGIRKILPDSEICDFDFEPCGYSMNSV  238

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +GAA ST+HVTPE+GFSYAS+E +G +  +V L  +VKRVL CF P EFSVAV    V  
Sbjct  239   EGAAVSTIHVTPEDGFSYASFETVGYDFKVVNLNEMVKRVLACFLPTEFSVAVH---VDG  295

Query  981   RDKIW-RGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRPSALQCWKETEEE  1151
               K++ +    DV  Y    R  + L   G + Y+ F  T    S  S L+CWKE +EE
Sbjct  296   ASKLFDQTCFLDVKGYCREERSHEGLGMGGSLVYQKFAKTCDCGSPRSTLKCWKEEDEE  354



>gb|EMS50405.1| S-adenosylmethionine decarboxylase proenzyme [Triticum urartu]
Length=451

 Score =   343 bits (881),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 189/366 (52%), Positives = 232/366 (63%), Gaps = 14/366 (4%)
 Frame = +3

Query  105   EALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGA  284
             +   SA    G+EKRLEI+F+  P+F DP G GLR L+R Q+DS L+ A CTIVS+L   
Sbjct  33    KKFQSAAYSNGYEKRLEITFSDAPVFADPCGRGLRALSRQQIDSFLDLARCTIVSQLLNK  92

Query  285   EFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQ  464
             +FDSYVLSESS+F+Y  K+V+KTCGTT+LLLS+P IL+LA  LSL + S KYSRG F+F 
Sbjct  93    QFDSYVLSESSLFVYSHKVVIKTCGTTKLLLSIPRILELAAELSLPLLSAKYSRGAFIFP  152

Query  465   NSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETT  632
              +QPAPHRSFSEEV+ LN  F      G A+V+GD   P + WHVY A        P  T
Sbjct  153   GAQPAPHRSFSEEVSVLNGFFGGLKSGGNAYVMGDAFRPKKMWHVYYAT--EEPEQPMVT  210

Query  633   VEICMTGLSREKAAMFFKRPGGDG-----EMTKMSRICDVIPSHVICDFEFDPCGYSMNG  797
             +E+CMTGL   KAA+FFK     G     EMTK+S I  +IP   ICDF+FDPCGYSMNG
Sbjct  211   LEMCMTGLDAGKAAVFFKNSANGGCSSAKEMTKVSGISAIIPEMEICDFDFDPCGYSMNG  270

Query  798   MDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVP  977
             + G A ST+HVTPEEGFSYASYEAM      +    L++RVL+CF P++FSVAVT FG  
Sbjct  271   VCGPAASTIHVTPEEGFSYASYEAMNFNPGSLVYSDLIERVLSCFRPSDFSVAVTIFGGH  330

Query  978   ARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTT---NKVASRPSALQCWKETEE  1148
                K W GG      Y     V QELPG G + Y+ F+      V+ R +    W     
Sbjct  331   GFAKSWAGGAEAGSSYVLEDVVEQELPGGGLLMYQSFSAVAPGAVSPRSTLDDGWSSDGM  390

Query  1149  EVAVVG  1166
             E A  G
Sbjct  391   EAAAQG  396



>gb|KEH16884.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=353

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 234/352 (66%), Gaps = 10/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF+ P LF DP G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGFEKRLEISFSDPGLFSDPHGRGLRSLTKSQLDEILAPAECTIVSSLANDDVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P ILKLA+ +SL V SV+Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKLAESISLKVRSVRYTRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHR FSEEVA L+  F        A+++G  +   +NWHVY A   S +P     T+E+
Sbjct  124   FPHRHFSEEVAVLDGYFGKLGSGSTAYIMGGSDE-AQNWHVYSASADSVSPNDSVYTLEM  182

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++FFK +     +MT  S I  ++P+  ICDF+F+PCGYSMN ++GAA S
Sbjct  183   CMTGLDREKASVFFKDQSDSAAKMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEGAAVS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+E  G +L  + L  LV +VL CF+P EFSVAV      A     +
Sbjct  243   TIHVTPEDGFSYASFETAGYDLKAMNLNELVVKVLACFQPNEFSVAVHVDN--ASKSFEQ  300

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWKETEEE  1151
             G + DV  Y    R  + L   G + Y+ F        P S L+CWK+ +EE
Sbjct  301   GCSLDVKGYCREERSHEGLGMGGSVVYQKFVKTADCGSPRSTLKCWKDEDEE  352



>ref|XP_010257836.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Nelumbo 
nucifera]
Length=405

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 234/352 (66%), Gaps = 11/352 (3%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLE+SF  P +F DP G GLR L++ QLD IL+PA CTIV+    A  D
Sbjct  50    ASAIGFEGYEKRLEVSFFEPGIFADPDGKGLRSLSKTQLDEILKPAECTIVASQSNAHLD  109

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++KTCGTT+LLLS+P IL+LA+ LSL V +VKY+RGTF F  +Q
Sbjct  110   SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILRLANSLSLSVRAVKYTRGTFTFPGAQ  169

Query  474   PAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             P PHRSF+EE+A L+S F N      A+V+G+  +  + WHVY A        P  T+E+
Sbjct  170   PYPHRSFTEEIAVLDSYFGNLGSGSNAYVMGNL-TKSQKWHVYSASAEVNHSGPIYTLEM  228

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL ++ A++F+K        MT +S I  ++P   ICDFEFDPCGYSMN ++GAA S
Sbjct  229   CMTGLDKKMASVFYKAESSSASLMTDVSGIRKILPGSEICDFEFDPCGYSMNAIEGAAIS  288

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +L  V L  LV RVL CF+P EFSVA+      A  K+  
Sbjct  289   TIHVTPEDGFSYASFEAVGYDLKTVNLSKLVGRVLECFQPREFSVAIHG---EAAGKVGW  345

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEE  1148
                 DV  Y+   R  Q L  +G I Y+ F        P ++   CWKE E+
Sbjct  346   YFPLDVPGYSPGERSYQTLGMNGAIVYQSFIEAGNCGSPKSVLKCCWKEEED  397



>ref|XP_006408415.1| hypothetical protein EUTSA_v10022357mg [Eutrema salsugineum]
 dbj|BAJ33801.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49868.1| hypothetical protein EUTSA_v10022357mg [Eutrema salsugineum]
Length=366

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 241/352 (68%), Gaps = 18/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRL++SF  P +F+D +G+GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLKVSFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET--TVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A   S +       T+E
Sbjct  124   FPHRSFSEEVSVLDGHFSKLGLNSVAYLMGNDDET-KKWHVYAASAQSSSNCNNNVYTLE  182

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKA++F+K   G+ G MT  S I  ++P   ICDFEF+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKASVFYKNETGETGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEGDAI  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDK  989
             ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  GV A + +
Sbjct  243   STIHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSIGVKAYKPE  302

Query  990   IWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   I----SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCDW  350



>gb|AGZ90156.1| S-adenosylmethionine decarboxylase, partial [Litsea cubeba]
Length=358

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 234/353 (66%), Gaps = 13/353 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P +F DP G GLR L++ QLD IL PA CTIV+ L   + DS
Sbjct  6     SAIGFEGYEKRLEISFFEPSIFADPEGKGLRMLSKAQLDEILRPAECTIVTSLSNHDVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P ILK+AD+LSL V +V+Y+RG+F F   QP
Sbjct  66    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPSILKMADVLSLRVKAVRYTRGSFNFPAVQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
              PHRSF EEV+ L+S F        A+VL D     + WH+Y A     A     T+E+C
Sbjct  126   FPHRSFLEEVSILDSHFGKLGSGSKAYVL-DSHVKSQKWHIYSA-CAESASCSVYTLEMC  183

Query  645   MTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
             MTGL R+ A++F+K        MT  S I  ++P   I DFEFDPCGYSMN ++G+A ST
Sbjct  184   MTGLDRKLASVFYKTETSTAALMTDASGIRKILPGSEISDFEFDPCGYSMNSIEGSAIST  243

Query  822   VHVTPEEGFSYASYEAMGVEL-SLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             +HVTPE+GFSYAS+EA G +L ++V L  LV+RVLNCF+P EFS+AV    V A   I  
Sbjct  244   IHVTPEDGFSYASFEAAGYDLMNVVDLSQLVERVLNCFQPEEFSLAVH---VDASANIEL  300

Query  999   G--GNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEE  1151
             G  G+ D+  Y C  R  Q L   G + Y+ F   + AS  S L+CW E + E
Sbjct  301   GCVGSLDLSGYLCGERCYQTLGKGGYLVYQSFKMGRCASPKSILKCWAEEDSE  353



>gb|EYU44271.1| hypothetical protein MIMGU_mgv1a008754mg [Erythranthe guttata]
Length=363

 Score =   339 bits (869),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 242/358 (68%), Gaps = 11/358 (3%)
 Frame = +3

Query  105   EALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGA  284
             E  +SAIGFEG+EKRLEISF+ P +F DP G GLR L++ QLD IL+PA CTIVS L   
Sbjct  2     EMPASAIGFEGYEKRLEISFSEPGVFADPSGSGLRSLSKCQLDEILDPAQCTIVSSLKND  61

Query  285   EFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQ  464
             + DSYVLSESS+F+YP KI++KTCGTTRLLLS+P ILK+AD L L V SV+Y+RG+F+F 
Sbjct  62    DVDSYVLSESSLFVYPYKIIVKTCGTTRLLLSIPPILKMADTLGLTVSSVRYTRGSFIFP  121

Query  465   NSQPAPHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGA--PAPE  626
              +QP PHRSF+EEV  L+  F K G+   A+V+G  +     WHVY A   + A    P 
Sbjct  122   GAQPFPHRSFTEEVVVLDEHFTKLGLISKAYVMGGADEY-EKWHVYSACAATSATETVPV  180

Query  627   TTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
              T+E+CMT L ++KA++FFK        MT++S I  ++P   ICDF+F+PCGYSMN ++
Sbjct  181   YTLEMCMTNLDQKKASVFFKNQSSSAAVMTEVSGIRKILPESDICDFDFEPCGYSMNAIE  240

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR  983
             G A ST+H+TPE+GFSYAS+EA+G E     L  LV+RVL+CF+PA+FSV++    V   
Sbjct  241   GGAISTIHITPEDGFSYASFEAVGYEFERDDLSQLVERVLDCFKPAKFSVSLHS-SVSGD  299

Query  984   DKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CWKETEEE  1151
             +     G  D++ Y C  +  +EL   G + Y  FT+N     P S LQ CW E E+E
Sbjct  300   EVDTEFGALDIEGYRCGEKSFEELGDGGAMVYSSFTSNGGCGSPKSTLQCCWSENEDE  357



>gb|KHN13794.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=359

 Score =   339 bits (869),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 184/354 (52%), Positives = 239/354 (68%), Gaps = 13/354 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF    +F DP G+GLR L++DQLD IL+PA CTIV+ L     DS
Sbjct  4     SAIGFEGYEKRLEISFFENGVFADPGGLGLRALSKDQLDEILKPAECTIVASLSNDYVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+PVILKLAD L + V SV+Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPVILKLADALDIAVKSVRYTRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHRSFSEEV+ L+S F N      A+V+GDP S  + WH+Y A   + G+      +E+
Sbjct  124   FPHRSFSEEVSVLDSYFSNLGSGSKAYVMGDP-SKSQIWHIYSASAQTKGSSEAVYGLEM  182

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL +E A++FFK        MT+ S I  ++P   I DFEFDPCGYSMNG++G+A S
Sbjct  183   CMTGLDKESASVFFKENTSSAASMTENSGIRKILPQSDISDFEFDPCGYSMNGIEGSAIS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G + + + L  LV+RVL CF PAEFSVA+    +    +   
Sbjct  243   TIHVTPEDGFSYASFEAVGYDFNDMALGELVERVLACFCPAEFSVALH---IDMHGEKLN  299

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTT--NKVASRPSALQ-CWKETEEE  1151
                 D+  Y C  R T+EL   G + Y+ F    +  AS  S L+ CW E E E
Sbjct  300   KFPLDIKGYYCGERSTEELGVGGAVVYQTFVQGCDGSASPRSILKCCWSEDENE  353



>sp|Q9M6K1.1|DCAM_IPOBA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Ipomoea batatas]
 gb|AAF71199.1|AF188998_1 S-adenosylmethionine decarboxylase [Ipomoea batatas]
 gb|AAN03494.1|AF291761_2 S-adenosylmethionine decarboxylase [Ipomoea batatas]
Length=362

 Score =   339 bits (869),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 183/355 (52%), Positives = 236/355 (66%), Gaps = 13/355 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+E RLEISF    +F DP G GLR L+++QLD +L+PA CTIVS L   E D
Sbjct  5     TSAIGFEGYENRLEISFFEAGIFSDPEGRGLRALSKEQLDKVLKPAECTIVSSLSNNEVD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++KTCGTT+LLLS+P IL+LAD LSL V SVKY+RG+F F   Q
Sbjct  65    SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLSLKVKSVKYTRGSFNFPEVQ  124

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVE  638
             P PHR+FSEEVA L+S F        A+V+G      + WHVY A   S     P  T+E
Sbjct  125   PYPHRNFSEEVAILDSYFGKLSTGSKAYVMGGA-GKQQQWHVYSASAESAENTFPIYTLE  183

Query  639   ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL ++ A++FFK        MT  S I  ++P   ICDF+F+PCGYSMN ++G A 
Sbjct  184   MCMTGLDKKSASVFFKTQSSSAAVMTDASGIRKILPGSEICDFDFEPCGYSMNAVEGGAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR-DKI  992
             S +HVTPE+GFSYAS+EAMG +   V L+AL++RVL+CF+PAEFSVA+    +  + D +
Sbjct  244   SPIHVTPEDGFSYASFEAMGYDFKDVNLDALIQRVLSCFQPAEFSVALHCDSIGEKLDSV  303

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSA--LQCWKETEEE  1151
             ++    DV  YAC  R  + L   G I Y  FT+      P +  L CW E E+E
Sbjct  304   FK---LDVKGYACGERSYEGLNKGGSIMYCGFTSTGSCGSPRSTLLCCWSENEDE  355



>ref|XP_011099087.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Sesamum indicum]
Length=410

 Score =   340 bits (872),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 235/352 (67%), Gaps = 10/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+ P +F DP G GLR L++ QLD ILEPA CTIVS L   E DS
Sbjct  57    SAIGFEGYEKRLEISFSEPGVFADPGGCGLRSLSKGQLDEILEPAQCTIVSSLKNDEVDS  116

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI+LKTCGTT+LLLS+P ILK+AD L L V SV+Y+RG+F+F  +QP
Sbjct  117   YVLSESSLFVYSYKIILKTCGTTKLLLSIPPILKMADSLGLTVCSVRYTRGSFIFPGAQP  176

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
              PHRSFSEEVA L+S F     +  A+V+G  +     WHVY A   +   AP  T+E+C
Sbjct  177   FPHRSFSEEVAVLDSHFTVLGLSSKAYVMGG-DDEHEKWHVYSACAKTSELAPVYTLEMC  235

Query  645   MTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
             MT L ++KA++FFK        MT++S I  ++P   ICDF+FDPCGYSMN ++GAA ST
Sbjct  236   MTNLDQKKASVFFKSQSDSAAVMTEVSGIRKILPDSEICDFDFDPCGYSMNAIEGAAIST  295

Query  822   VHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWRG  1001
             +H+TPE+GFSYAS+EA+G +   + L  L++RVL CF+PA FSVA+      A  ++   
Sbjct  296   IHITPEDGFSYASFEAVGYDFKQLDLTLLLERVLACFKPATFSVAL--HASVAEKELDSE  353

Query  1002  GNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEE  1151
                DV  Y C  R  + L   G + Y  FT+      P ++   CW E E+E
Sbjct  354   FTLDVKGYTCGGRSYKVLGDGGAMMYNSFTSQGSCGSPKSILHCCWSENEDE  405



>ref|XP_007215554.1| hypothetical protein PRUPE_ppa007294mg [Prunus persica]
 gb|EMJ16753.1| hypothetical protein PRUPE_ppa007294mg [Prunus persica]
Length=374

 Score =   339 bits (869),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 232/353 (66%), Gaps = 15/353 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF DP GMGLR L++DQLD IL+PA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEVSFFEPGLFADPAGMGLRSLSKDQLDEILKPAECTIVSSLSNDDLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LL S+P ILKLA+ LSL V SV+YSRG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLAETLSLAVKSVRYSRGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEV-------GSGAPAP  623
             +PHRSFSEEVA L+  F K G+   A+V+G  +   + WH+Y A         G+    P
Sbjct  126   SPHRSFSEEVAVLDGHFGKLGLASRAYVMGSSDKT-QKWHIYSASAELASLLWGARQSGP  184

Query  624   ETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL+R+KA++F+K        MT+ S I  ++P   ICDFEFDPCGYSMN +
Sbjct  185   TYTLEMCMTGLNRKKASVFYKSKASSAAGMTEESGIRKILPQSEICDFEFDPCGYSMNSI  244

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+E MG +   V L  L+ RVL+CF+PAEFSVA+       
Sbjct  245   EGNAISTIHVTPEDGFSYASFETMGYDFKNVNLTQLIDRVLDCFKPAEFSVALHTTSTAG  304

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSAL--QCW  1133
                  +    D+  Y C     + L   G + +  F  +     P ++   CW
Sbjct  305   EQLNAKFPLDDLRGYCCGESNYERLGLGGAVIFHSFVKDAGCQSPRSILKGCW  357



>ref|XP_006602987.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Glycine max]
 ref|XP_006602988.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Glycine max]
 ref|XP_006602989.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X3 [Glycine max]
 ref|XP_006602990.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X4 [Glycine max]
Length=359

 Score =   338 bits (867),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 240/357 (67%), Gaps = 13/357 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF    +F DP G+GLR L++DQLD IL+PA CTIV+ L     DS
Sbjct  4     SAIGFEGYEKRLEISFFENGVFADPGGLGLRALSKDQLDEILKPAECTIVASLSNDYVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+PVILKLAD L + V SV+Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPVILKLADALDIAVKSVRYTRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHRSFSEEV+ L+S F N      A+V+GDP S  + WH+Y A   + G+      +E+
Sbjct  124   FPHRSFSEEVSVLDSYFSNLGSGSKAYVMGDP-SKSQIWHIYSASAQTKGSSEAVYGLEM  182

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL +E A++FFK        MT+ S I  ++P   I DFEFDPCGYSMNG++G+A S
Sbjct  183   CMTGLDKESASVFFKENTSSAASMTENSGIRKILPQSDISDFEFDPCGYSMNGIEGSAIS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G + + + L  LV+R+L CF PAEFSVA+    +    +   
Sbjct  243   TIHVTPEDGFSYASFEAVGYDFNDMALGELVERILACFCPAEFSVALH---IDMHGEKLN  299

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTT--NKVASRPSALQ-CWKETEEEVAV  1160
                 D+  Y C  R T+EL   G + Y+ F    +  AS  S L+ CW E E E  V
Sbjct  300   KFPLDIKGYYCGERSTEELGVGGAVVYQTFVQGCDGSASPRSILKCCWSEDENEDEV  356



>gb|ABO77440.1| S-adenosylmethionine decarboxylase [Medicago falcata]
Length=353

 Score =   338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 232/352 (66%), Gaps = 10/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF+ P LF DP G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGFEKRLEISFSDPGLFSDPHGRGLRSLTKSQLDEILAPAECTIVSSLANDDVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P ILKLA+ +SL V SV+Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKLAESISLKVRSVRYTRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHR FSEEVA L+  F        A+++G  +    NWHVY A   S +P     T+E+
Sbjct  124   FPHRHFSEEVAVLDGYFGKLGSGSTAYIMGGSDE-AHNWHVYSASADSVSPNDSVYTLEM  182

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA +FFK +     +MT  S I  ++P+  ICDF+F+PCGYSMN ++GAA S
Sbjct  183   CMTGLDREKALVFFKDQSDSAAKMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEGAAVS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+E  G +L  + L  LV +VL CF+P EFSVAV      A     +
Sbjct  243   TIHVTPEDGFSYASFETAGYDLKAMNLNELVVKVLACFQPNEFSVAVHVDN--ASKSFEQ  300

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWKETEEE  1151
             G + DV  Y    R  + L   G + Y+ F        P S L+CWK+ +EE
Sbjct  301   GCSLDVKGYCREERSLEGLGMGGSVVYQKFVKTADCGSPRSTLKCWKDEDEE  352



>sp|Q96471.1|DCAM_IPONI RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Ipomoea nil]
 gb|AAC04611.1| S-adenosylmethionine decarboxylase [Ipomoea nil]
Length=362

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 237/355 (67%), Gaps = 13/355 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLEISF    +F DP G GLR L+++QLD +L+PA CTIVS L   E D
Sbjct  5     TSAIGFEGYEKRLEISFFEAGIFSDPEGRGLRALSKEQLDKVLKPAECTIVSSLSNNEVD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++KTCGTT+LLLS+P IL+LAD LSL V SVKY+RG+F F   Q
Sbjct  65    SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLSLKVKSVKYTRGSFNFPEVQ  124

Query  474   PAPHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVE  638
             P PHR+FSEEVA L+  F K G    A+V+G      + WHVY A   S     P  T+E
Sbjct  125   PYPHRNFSEEVAILDGYFGKLGTGSKAYVMGGA-GKQQQWHVYSASAESAENTFPIYTLE  183

Query  639   ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL ++ A++FFK        MT  S I  ++P   ICDF+F+PCGYSMN ++G   
Sbjct  184   MCMTGLDKKSASVFFKTQSSSAAVMTDASGIRKILPGSDICDFDFEPCGYSMNAVEGGTI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR-DKI  992
             ST+HVTPE+GFSYAS+EAMG +   V L+AL++RVL+CF+PAEFSVA+    +  + D +
Sbjct  244   STIHVTPEDGFSYASFEAMGYDFKDVNLDALIQRVLSCFQPAEFSVALHCDSIGEKLDSV  303

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSA--LQCWKETEEE  1151
             +     DV  YAC  R  + L   G I Y  FT+      P +  L CW E E++
Sbjct  304   FE---LDVKGYACGERSYEALGKGGSIMYCGFTSTGSCGSPRSTLLCCWSENEDQ  355



>gb|ADD91750.1| S-adenosylmethionine decarboxylase proenzyme [Salvia miltiorrhiza]
Length=354

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 183/354 (52%), Positives = 237/354 (67%), Gaps = 13/354 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEGFEKRLEISF  P  F DP G GLR L++ QLD IL+PA CTIV+ L     D
Sbjct  5     ASAIGFEGFEKRLEISFFEPSFFADPEGKGLRSLSKSQLDEILQPAQCTIVASLSNEHVD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLA LLSL V  VKY+RG+F+F  +Q
Sbjct  65    SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLAGLLSLSVQDVKYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQF-----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTV  635
               PHRSFSEEVA L+  F         A+V+G  +   + WH+Y A  GS    +P  T+
Sbjct  125   SFPHRSFSEEVAVLDGYFGKLGSSGSKAYVMGSSDKR-QQWHIYSASAGSVECDSPVYTL  183

Query  636   EICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMTGL REKAA+FFK        MT  S + +++P   ICDFEF+PCGYSMN ++G A
Sbjct  184   EMCMTGLDREKAAVFFKNESNVSMLMTNTSGVRNILPKSHICDFEFEPCGYSMNSIEGDA  243

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARDK  989
              ST+H+TPE+GFSYAS+EA G +L  V L ALV+RVL CFEP EFSV+V  + G    ++
Sbjct  244   VSTIHITPEDGFSYASFEAAGYDLKAVNLGALVERVLGCFEPNEFSVSVHAQCGAELFEE  303

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWKETEE  1148
             I      ++  Y+   R  +EL   G I Y+ F  +     P S L+C+++ ++
Sbjct  304   ICF---PELKCYSGGERSVEELGAGGAITYQKFVRSVSCGSPRSTLKCFRDEDD  354



>ref|XP_002282704.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 ref|XP_002282708.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 ref|XP_002282716.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 ref|XP_010660528.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 emb|CAN75613.1| hypothetical protein VITISV_022291 [Vitis vinifera]
Length=360

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 239/355 (67%), Gaps = 9/355 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P +F DP GMGLR L++ QLD ILEPA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEISFFEPGIFADPVGMGLRSLSKTQLDEILEPAECTIVSSLSNDDVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLA+ L L V SVKY+RG+F+F  +Q 
Sbjct  66    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLANSLDLSVRSVKYTRGSFIFPGAQS  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVEI  641
              PHR+FSEEV  L+  F K G    A+++G  + P + WHVY A    +G   P  T+E+
Sbjct  126   FPHRNFSEEVVELDGHFGKLGAGSKAYMMGSHDKP-QKWHVYTAAAEFTGRLDPVYTLEM  184

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R+KA++F+K        MT+ S I  ++P+  ICDFEFDPCGYSMN ++  A S
Sbjct  185   CMTGLDRKKASVFYKTDTSSAAVMTENSGIRKILPNSEICDFEFDPCGYSMNAIEEDAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EAMG  L+   L  +++RVL+CF+PA FSVA+    V  + K+  
Sbjct  245   TIHVTPEDGFSYASFEAMGYNLNDDSLTQMLERVLDCFQPAHFSVAL-HADVEGK-KLEY  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVAVV  1163
                 DV  Y C  R  + L   G I Y  F  ++    P ++  W+E EEE  V+
Sbjct  303   DFPLDVMGYYCEGRSYEGLGKGGSIIYHSFMKSEECGSPRSILKWRENEEEEQVL  357



>emb|CDP00521.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 229/347 (66%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P +F DP G GLR LT+ QLD ILEPA CTIVS L     DS
Sbjct  6     SAIGFEGYEKRLEISFFEPSIFADPEGKGLRSLTKTQLDEILEPAECTIVSTLSNKYLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F++P KI++KTCGTT+LLLS+P ILKLA+ LSL V +VKY+ G+F+F  +Q 
Sbjct  66    YVLSESSLFVHPYKIIIKTCGTTKLLLSIPPILKLAESLSLTVRAVKYTHGSFIFPGAQS  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PHRSFSEEVA L+S F        AFV+GD   P + WHVY A  GS   + P  T+E+
Sbjct  126   FPHRSFSEEVALLDSYFGKLGSGSKAFVMGDSGQP-QKWHVYYASAGSEQSSDPVYTLEM  184

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL RE A++F++        MT  S I  ++P   ICDFEFDPCGYSMN ++G A S
Sbjct  185   CMTGLDREMASVFYRSQSSSAALMTVQSGIRKILPESEICDFEFDPCGYSMNSIEGDAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA G +L +V L  L+ RVL CFEP+EFS+AV     P   ++  
Sbjct  245   TIHVTPEDGFSYASFEAAGYDLKVVNLGLLIARVLACFEPSEFSIAVHADLSPKLLEL--  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
               + D+  Y    +  +EL  D  + Y+ F        P ++   CW
Sbjct  303   TCSLDLKGYHLGEKCREELGSDNSVVYQKFVKTVACGSPRSILKCCW  349



>emb|CAN66014.1| hypothetical protein VITISV_041154 [Vitis vinifera]
Length=357

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/349 (54%), Positives = 230/349 (66%), Gaps = 12/349 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+ P +F DP G GLR L+R QLD ILEPA CTIV  L     DS
Sbjct  6     SAIGFEGYEKRLEISFSEPGIFSDPEGRGLRSLSRAQLDEILEPAECTIVGSLSNDIVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLAD LSL V  V+Y+RG+F F  +QP
Sbjct  66    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLADTLSLSVSCVRYTRGSFNFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVY--VAEVGSGAPAPETTVE  638
              PHR FSEEVA L+S F        A+V+G  +   + WHVY   AEV S A  P  T+E
Sbjct  126   YPHRHFSEEVAVLDSYFGKLGSGSKAYVMGSSDK-SQKWHVYSASAEVRS-ACDPVYTLE  183

Query  639   ICMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL RE A++F+K       +MT  S I  ++P   ICDFEFDPCGYSMN ++GAA 
Sbjct  184   MCMTGLDREMASVFYKTHSSSAVKMTDTSGIRKILPDSEICDFEFDPCGYSMNAIEGAAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+E MG     V L  L++RVL+CF+P EFSVAV      +   + 
Sbjct  244   STIHVTPEDGFSYASFETMGYNPKDVNLSQLIERVLSCFQPNEFSVAV--HADISGKLLE  301

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDY-RCFTTNKVASRPSALQCWKE  1139
             R    DV  Y C  R  +EL   G I Y R   T  V S  S L+C  E
Sbjct  302   RNCLLDVKGYCCEERSNEELGMCGSIVYHRFMKTEGVVSPRSILKCCLE  350



>gb|ADD91751.1| S-adenosylmethionine decarboxylase proenzyme [Salvia miltiorrhiza]
Length=354

 Score =   336 bits (862),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 183/354 (52%), Positives = 236/354 (67%), Gaps = 13/354 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEGFEKRLEISF  P  F DP G GLR L++ QLD IL+PA CTIV+ L     D
Sbjct  5     ASAIGFEGFEKRLEISFFEPSFFADPEGKGLRSLSKSQLDEILQPAQCTIVASLSNEHVD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++K CGTT+LLLS+P ILKLA LLSL V  VKY+RG+F+F  +Q
Sbjct  65    SYVLSESSLFVYPYKIIIKACGTTKLLLSIPPILKLAGLLSLSVQDVKYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQF-----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTV  635
               PHRSFSEEVA L+  F         A+V+G  +   + WH+Y A  GS    +P  T+
Sbjct  125   SFPHRSFSEEVAVLDGYFGKLGSSGSKAYVMGSSDKR-QQWHIYSASAGSVECDSPVYTL  183

Query  636   EICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMTGL REKAA+FFK        MT  S I +++P   ICDFEF+PCGYSMN ++G A
Sbjct  184   EMCMTGLDREKAAVFFKNESNVSTLMTNTSGIRNILPKSHICDFEFEPCGYSMNSIEGDA  243

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARDK  989
              ST+H+TPE+GFSYAS+EA G +L  V L ALV+RVL CFEP EFSV+V  + G    ++
Sbjct  244   VSTIHITPEDGFSYASFEAAGYDLKAVNLGALVERVLACFEPNEFSVSVHAQCGAELFEE  303

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWKETEE  1148
             I      ++  Y+   R  +EL   G I Y+ F  +     P S L+C+++ ++
Sbjct  304   ICF---PELKCYSGGERSVEELGAGGAITYQKFVRSVSCGSPRSTLKCFRDEDD  354



>ref|XP_008353516.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=374

 Score =   337 bits (863),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 178/352 (51%), Positives = 234/352 (66%), Gaps = 16/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF DP+GMGLR L++ Q+D IL PA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEVSFFEPGLFADPKGMGLRSLSKAQIDEILTPAECTIVSSLSNDDLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LL S+P ILKLAD LSL V SV+YSRG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLADTLSLAVKSVRYSRGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEV-------GSGAPAP  623
             +PHRSFSEEVA L+  F K G+   A+V+G P+   + WH+Y A         GS    P
Sbjct  126   SPHRSFSEEVAVLDGHFSKLGLASKAYVMGSPDKT-QKWHIYSASAELASLLWGSRQSGP  184

Query  624   ETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL R++A++F+K        MT  S I +++P   ICDFEF+PCGYSMN +
Sbjct  185   TYTLEMCMTGLDRKRASVFYKSDASSAAGMTVESGIRNILPQSDICDFEFEPCGYSMNSI  244

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+E +G +   V L  L+ RVL+CF+PAEFS+A+       
Sbjct  245   EGNAVSTIHVTPEDGFSYASFETVGYDFKDVNLTQLLYRVLDCFKPAEFSIALHTTSTAG  304

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP--SALQC  1130
              D +      D+  Y C     + L   G + YR F  +   S+   S L+C
Sbjct  305   ED-LDAKCPLDLKGYCCGGSSYEGLGLGGAVTYRSFVKDDSGSQSPRSILKC  355



>ref|XP_010660529.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X2 [Vitis vinifera]
Length=405

 Score =   337 bits (865),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 239/355 (67%), Gaps = 9/355 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P +F DP GMGLR L++ QLD ILEPA CTIVS L   + DS
Sbjct  51    SAIGFEGYEKRLEISFFEPGIFADPVGMGLRSLSKTQLDEILEPAECTIVSSLSNDDVDS  110

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLA+ L L V SVKY+RG+F+F  +Q 
Sbjct  111   YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLANSLDLSVRSVKYTRGSFIFPGAQS  170

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVEI  641
              PHR+FSEEV  L+  F K G    A+++G  + P + WHVY A    +G   P  T+E+
Sbjct  171   FPHRNFSEEVVELDGHFGKLGAGSKAYMMGSHDKP-QKWHVYTAAAEFTGRLDPVYTLEM  229

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R+KA++F+K        MT+ S I  ++P+  ICDFEFDPCGYSMN ++  A S
Sbjct  230   CMTGLDRKKASVFYKTDTSSAAVMTENSGIRKILPNSEICDFEFDPCGYSMNAIEEDAIS  289

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EAMG  L+   L  +++RVL+CF+PA FSVA+    V  + K+  
Sbjct  290   TIHVTPEDGFSYASFEAMGYNLNDDSLTQMLERVLDCFQPAHFSVAL-HADVEGK-KLEY  347

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVAVV  1163
                 DV  Y C  R  + L   G I Y  F  ++    P ++  W+E EEE  V+
Sbjct  348   DFPLDVMGYYCEGRSYEGLGKGGSIIYHSFMKSEECGSPRSILKWRENEEEEQVL  402



>gb|ADF81048.1| S-adenosylmethionine decarboxylase [Salvia miltiorrhiza]
Length=360

 Score =   336 bits (861),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 234/350 (67%), Gaps = 13/350 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEGFEKRLEISF  P  F DP G GLR L++ QLD IL+PA CTIV+ L     D
Sbjct  5     ASAIGFEGFEKRLEISFFEPSFFADPEGKGLRSLSKSQLDEILQPAQCTIVASLSNEHVD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLA LLSL V  VKY+RG+F+F  +Q
Sbjct  65    SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLAGLLSLSVQDVKYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQF-----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTV  635
               PHRSFSEEVA L+  F         A+V+G  +   + WH+Y A  GS    +P  T+
Sbjct  125   SFPHRSFSEEVAVLDGYFGKLGSSGSKAYVMGSSDKR-QQWHIYSASAGSVECDSPVYTL  183

Query  636   EICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMTGL REKAA+FFK        MT  S + +++P   ICDFEF+PCGYSMN ++G A
Sbjct  184   EMCMTGLDREKAAVFFKNESNVSMLMTNTSGVRNILPKSHICDFEFEPCGYSMNSIEGDA  243

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARDK  989
              ST+H+TPE+GFSYAS+EA G +L  V L ALV+RVL CFEP EFSV+V  + G    ++
Sbjct  244   VSTIHITPEDGFSYASFEAAGYDLKAVNLGALVERVLGCFEPNEFSVSVHAQCGAELFEE  303

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWK  1136
             I      ++  Y+   R  +EL   G I Y+ F  +     P S L+C++
Sbjct  304   ICF---PELKCYSGGERSVEELGAGGAITYQKFVRSVSCGSPRSTLKCFR  350



>ref|XP_006367530.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum tuberosum]
Length=363

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 233/347 (67%), Gaps = 10/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P LF DP G GLR L++ QLD  L PA CTIV  L     DS
Sbjct  8     SAIGFEGYEKRLEISFFEPGLFADPEGKGLRSLSKAQLDEFLGPAECTIVDSLSNECVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FI+P KI++KTCGTT+LLLS+PVILKLAD L L V +VKY+RG+F+F  +Q 
Sbjct  68    YVLSESSLFIFPYKIIIKTCGTTKLLLSIPVILKLADTLLLKVQAVKYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+S F N      A +LG P+   + WHVY A  G      P  T+E+
Sbjct  128   FPHRHFSEEVAVLDSYFGNLSSGSKAVILGSPDKL-QKWHVYSASAGPIQTKNPVYTLEM  186

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMT L R+KA++F+K       +MT  S I  ++P   ICDFEFDPCGYSMN ++GAA S
Sbjct  187   CMTNLDRKKASVFYKTESSSAAQMTIRSGIRKILPDSAICDFEFDPCGYSMNSIEGAALS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +L+   L +LV+RVL CF+P EFSVA+    V A + + R
Sbjct  247   TIHVTPEDGFSYASFEAVGYDLNCSSLGSLVRRVLTCFQPDEFSVALHADDV-ACELLER  305

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CW  1133
               + DV  Y+      +EL   G I Y+ FT + V   P S LQ CW
Sbjct  306   ICSFDVKGYSHAEWSPEELGKGGSIVYQKFTRSSVCGSPKSVLQDCW  352



>ref|XP_009373729.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Pyrus x bretschneideri]
 ref|XP_009373730.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Pyrus x bretschneideri]
Length=374

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 178/352 (51%), Positives = 233/352 (66%), Gaps = 16/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF DPRGMGLR L++ Q+D IL PA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEVSFFEPGLFADPRGMGLRSLSKAQIDEILTPAECTIVSSLSNDDLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LL S+P ILKL D LSL V SV+YSRG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLVDSLSLAVKSVRYSRGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEV-------GSGAPAP  623
             +PHRSFSEEVA L+  F K G+   A+V+G P+   + WH+Y A         GS    P
Sbjct  126   SPHRSFSEEVAVLDGHFGKLGLASKAYVMGSPDKT-QKWHIYSASAELASLLWGSRHTGP  184

Query  624   ETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL R++A++F+K        MT+ S I  ++P   ICDFEF+PCGYSMN +
Sbjct  185   TYTLEMCMTGLDRKRASVFYKSDASSAAGMTEESGIRKILPQSDICDFEFEPCGYSMNSI  244

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+E +G   + V L  L+ RVL+CF+PAEFS+A+       
Sbjct  245   EGNAVSTIHVTPEDGFSYASFETVGYNFNDVNLTQLLYRVLDCFKPAEFSIALHTTSTAG  304

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP--SALQC  1130
              D +   G  D+  Y C     + L   G + Y  F  +   S+   S L+C
Sbjct  305   ED-LDAKGPLDLKGYCCGGSSYEGLGLGGAVVYHSFVKDNSGSQSPRSILKC  355



>ref|XP_006845442.1| hypothetical protein AMTR_s00019p00109640 [Amborella trichopoda]
 gb|ERN07117.1| hypothetical protein AMTR_s00019p00109640 [Amborella trichopoda]
Length=399

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 234/362 (65%), Gaps = 14/362 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEGFEKRLEI F+ PP+F DP+G+GLR L+R Q+D IL+ A CTIV  L     D
Sbjct  5     TSPIGFEGFEKRLEIIFSEPPVFADPKGLGLRALSRAQIDEILDSARCTIVDSLSNEFLD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS F+YP K++LKTCGTT+LLLS+P+I+K A  LSL    VKYSRG+F+F   Q
Sbjct  65    SYVLSESSFFVYPDKVILKTCGTTKLLLSIPLIVKHAGSLSLTPIFVKYSRGSFIFPGVQ  124

Query  474   PAPHRSFSEEVAFLNSQFK---NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             PAPHRSFSEE++ L+  F       A+V+GDP  P RNWHVYVA      P    T+E+C
Sbjct  125   PAPHRSFSEEISMLDGHFSPLLKSEAYVIGDPSKPARNWHVYVAS-APHIPPQVCTLEMC  183

Query  645   MTGLSREKAAMFFKRP-GGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
             MTGL  ++A++F+K        MT+ S I D++PS  I DF FDPCGYSMN +D    ST
Sbjct  184   MTGLDHKQASVFYKSDINSASSMTRDSGIKDILPSFKINDFMFDPCGYSMNAIDEKVVST  243

Query  822   VHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWRG  1001
             +HVTPE+GFSYAS+EA+G++ + V L  LV RV  CF P EF++AV   G       W  
Sbjct  244   IHVTPEDGFSYASFEAVGLDPNRVRLNELVSRVFACFGPTEFTIAVHCGGSSMGS--WAE  301

Query  1002  GNADVDRYACRFRVTQELPGDGRIDYRCF----TTNKVASRPSALQCW---KETEEEVAV  1160
                 VD Y C   + Q+LPG G I Y+ F    +++ + S    L  W   ++TE+E   
Sbjct  302   LTGSVDGYRCERAIEQDLPGGGFIVYQSFMKVRSSSSIFSPKLVLGSWINEEKTEKEADE  361

Query  1161  VG  1166
              G
Sbjct  362   YG  363



>gb|ADF81049.1| S-adenosylmethionine decarboxylase [Salvia miltiorrhiza]
Length=360

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 233/350 (67%), Gaps = 13/350 (4%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEGFEKRLEISF  P  F DP G GLR L++ QLD IL+PA CTIV+ L     D
Sbjct  5     ASAIGFEGFEKRLEISFFEPSFFADPEGKGLRSLSKSQLDEILQPAQCTIVASLSNEHVD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++K CGTT+LLLS+P ILKLA LLSL V  VKY+RG+F+F  +Q
Sbjct  65    SYVLSESSLFVYPYKIIIKACGTTKLLLSIPPILKLAGLLSLSVQDVKYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQF-----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTV  635
               PHRSFSEEVA L+  F         A+V+G  +   + WH+Y A  GS    +P  T+
Sbjct  125   SFPHRSFSEEVAVLDGYFGKLGSSGSKAYVMGSSDKR-QQWHIYSASAGSVECDSPVYTL  183

Query  636   EICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMTGL REKAA+FFK        MT  S I +++P   ICDFEF+PCGYSMN ++G A
Sbjct  184   EMCMTGLDREKAAVFFKNESNVSTLMTNTSGIRNILPKSHICDFEFEPCGYSMNSIEGDA  243

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARDK  989
              ST+H+TPE+GFSYAS+EA G +L  V L ALV+RVL CFEP EFSV+V  + G    ++
Sbjct  244   VSTIHITPEDGFSYASFEAAGYDLKAVNLGALVERVLACFEPNEFSVSVHAQCGAELFEE  303

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWK  1136
             I      ++  Y+   R  +EL   G I Y+ F  +     P S L+C++
Sbjct  304   ICF---PELKCYSGGERSVEELGAGGAITYQKFVRSVSCGSPRSTLKCFR  350



>gb|AAS45435.1| S-adenosylmethionine decarboxylase [Brassica juncea]
Length=366

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 185/356 (52%), Positives = 239/356 (67%), Gaps = 26/356 (7%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-----  629
              PHRSFSEEV+ L+  F     N VA+++G+ +   R WHVY A     A AP       
Sbjct  124   FPHRSFSEEVSVLDGHFSKLGLNSVAYLMGNDDET-RKWHVYAA----SAQAPSNCNNNV  178

Query  630   -TVEICMTGLSREKAAMFFKRPGG-DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
              T+E+CMTGL REKA++F+K   G +G MT  S I  ++P   ICDFEF+PCGYSMN ++
Sbjct  179   YTLEMCMTGLDREKASVFYKNETGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIE  238

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA  980
             G A ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  G  A
Sbjct  239   GDAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANA  298

Query  981   -RDKIWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
              + +I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  299   YKPEI----SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  350



>emb|CDY57536.1| BnaA05g33510D [Brassica napus]
Length=364

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 238/350 (68%), Gaps = 17/350 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFLEPSIFQDSKGLGLRALTRSQLDQILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +L+LA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLELAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A   S +      T+E+
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDET-KKWHVYAASAQSFSDNNNVYTLEM  182

Query  642   CMTGLSREKAAMFFKRPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
             CMTGL REKA++F+K  G  G MT  S I  ++P   ICDFEF+PCGYSMN ++G A ST
Sbjct  183   CMTGLDREKASVFYKN-GETGTMTDNSGIRKILPKSHICDFEFEPCGYSMNSIEGDAIST  241

Query  822   VHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDKIW  995
             +HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  GV A + +I 
Sbjct  242   IHVTPEDGFSYASFEAVGYDFNTMDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAYKPEI-  300

Query  996   RGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
                + D+D Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  301   ---SVDLDDYGCRERTFESLGEESGMVMYQTFEKLGKYCGSPRSTLKCEW  347



>ref|XP_009622584.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana tomentosiformis]
Length=384

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 239/355 (67%), Gaps = 14/355 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F    +   P G GLR L++DQLD IL PA CTIVS L   E DS
Sbjct  28    SAIGFEGYEKRLEITFFELGMSDGP-GCGLRSLSKDQLDEILTPAACTIVSSLANDEVDS  86

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKLAD L+L V SV+Y+RG+F+F  +QP
Sbjct  87    YVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLADALNLKVKSVRYTRGSFIFPGAQP  146

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSG---APAPETTV  635
              PHR FSEEVA L+S F        A+V+G+ +   +NWHVY A   S     P P  T+
Sbjct  147   YPHRHFSEEVAVLDSYFGKLGAGSSAYVMGNADKQ-QNWHVYSASAESANANNPNPVYTL  205

Query  636   EICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMT L ++KA++FFK       EMT++S I  ++P   ICDF+FDPCGYSMN ++G A
Sbjct  206   EMCMTNLDKKKASVFFKTHSSTAAEMTEVSGIRKILPESNICDFDFDPCGYSMNAIEGPA  265

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKI  992
              ST+H+TPE+GFSYAS+EA+G +   V L A+++RVL+CF PAEFSV+V     P ++ +
Sbjct  266   ISTIHITPEDGFSYASFEAVGYDFKAVNLTAMIERVLSCFGPAEFSVSV-HCDTPGKE-L  323

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQC-WKETEEE  1151
             +     D+  YA   + T+ L   G + Y  F++N     P S   C W E+E+E
Sbjct  324   YTESGLDIIGYASGEKTTEVLGEGGSLTYLTFSSNGSCGSPRSIFHCSWSESEDE  378



>ref|XP_006585825.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Glycine max]
 ref|XP_006585826.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Glycine max]
 ref|XP_006585827.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X3 [Glycine max]
 gb|KHN14467.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=359

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 236/357 (66%), Gaps = 13/357 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF    +F DP G+GLR L++DQLD IL+PA C+IV+ L     DS
Sbjct  4     SAIGFEGYEKRLEISFFEHGVFADPEGIGLRALSKDQLDEILKPAECSIVASLSNDYVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYP KI++KTCGTT+LLLS+PVILKLAD L + V SV+Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFIYPYKIIIKTCGTTKLLLSIPVILKLADALDIAVKSVRYTRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHRSFSEEV+ L+S F N      A+V+GDP S  + WH+Y A   + G+      +E+
Sbjct  124   FPHRSFSEEVSVLDSYFSNLGSGSKAYVMGDP-SKSQIWHIYSASAQTKGSSEVVYGLEM  182

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL +E A++FFK        MT+ S I  ++P   I DFEFDPCGYSMNG++G A S
Sbjct  183   CMTGLEKESASVFFKENTSSAALMTENSGIRKILPQSDISDFEFDPCGYSMNGIEGGAIS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +   + L  LV+RVL CF PAEFSVA+    +    +   
Sbjct  243   TIHVTPEDGFSYASFEAVGYDFDEMALGELVERVLACFRPAEFSVALH---IDMHGEKLN  299

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTT--NKVASRPSALQ-CWKETEEEVAV  1160
                 D+  Y C  R  +EL   G + Y+ F    +   S  S L+ CW E E E  V
Sbjct  300   KFPLDIKGYYCGERSYEELGVGGAVVYQSFVQGCDGSTSPRSILKCCWSEDENEDEV  356



>dbj|BAP47514.1| S-adenosylmethionine decarboxylase [Gentiana triflora]
Length=363

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 234/357 (66%), Gaps = 15/357 (4%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             M+E   SAIGFEGFEKRLEISF  P +F DP G GLR LT+ QLD ILEPA CTIV+ L 
Sbjct  1     MSEMPVSAIGFEGFEKRLEISFFEPNMFSDPNGFGLRSLTKAQLDEILEPAECTIVASLS  60

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
               + DSYVLSESS+F+YP KI++KTCGTT+LLLS+PVILKLA  LSL V +V Y+RG+F+
Sbjct  61    NKQLDSYVLSESSLFVYPYKIIMKTCGTTKLLLSIPVILKLAKSLSLDVKAVNYTRGSFI  120

Query  459   FQNSQPAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPE  626
             F  +Q  PHRSF EE + L+  F N      AFV+GD     + WHVY A        P 
Sbjct  121   FPGAQSFPHRSFFEEASLLDGYFGNLGMRSKAFVMGDG-GQQQKWHVYTA-TAEYVDEPN  178

Query  627   T----TVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSM  791
             +    T+E+CMTGL R+KA++F+K        MT  S I  ++P   ICDFEFDPCGYSM
Sbjct  179   SDCVYTLEMCMTGLDRDKASVFYKNESSSASLMTCSSGIRKILPDSEICDFEFDPCGYSM  238

Query  792   NGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFG  971
             N ++G+A ST+HVTPE GFSYAS+EA G +L  V L +L++RVL+CF+P++FSVAV R  
Sbjct  239   NSIEGSAISTIHVTPENGFSYASFEAAGYDLESVKLGSLIERVLDCFQPSDFSVAV-RTD  297

Query  972   VPARDKIWRGGNADVDRYACRFRVTQELPGDGR-IDYRCFTTNKVASRPSAL--QCW  1133
               A   + R  + DV+ Y    +  +E  G G  I Y+ F   +    P ++   CW
Sbjct  298   SAAGKSVERICSIDVEAYHMGEKSVEEAVGGGSCIVYQKFVKAEYCGSPRSILKGCW  354



>ref|XP_002882231.1| S-adenosylmethionine decarboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58490.1| S-adenosylmethionine decarboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 180/352 (51%), Positives = 238/352 (68%), Gaps = 18/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE++F  P +F+D +G+GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDKLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET--TVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A     +       T+E
Sbjct  124   FPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDET-KKWHVYAASAQDSSNCNNNVYTLE  182

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKA++F+K      G MT  S I  ++P   ICDFEF+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKASVFYKNEADKTGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEGDAI  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDK  989
             ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  GV A + +
Sbjct  243   STIHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAYKPE  302

Query  990   IWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   I----SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  350



>ref|XP_011077597.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Sesamum 
indicum]
Length=349

 Score =   334 bits (856),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 232/347 (67%), Gaps = 12/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P +F DP G GLR L++ QLD IL PA CTIV+ L     DS
Sbjct  6     SAIGFEGFEKRLEISFFEPSIFADPEGKGLRSLSKAQLDEILGPAECTIVASLSNEHVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKLA  LSL V SV+Y+RG+F+F  +Q 
Sbjct  66    YVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLAQCLSLSVQSVRYTRGSFIFPGAQS  125

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHRSFS+EVA L+S F        A+V+G P+   + WHVY A  G+  A +P  T+E+
Sbjct  126   YPHRSFSDEVAVLDSHFAKLGSGRKAYVMGSPDKQ-QKWHVYSACAGTVEATSPVYTLEM  184

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R+KA++F+K        MTK S I +++P   ICDFEF+PCGYSMN ++G A S
Sbjct  185   CMTGLDRKKASVFYKNESSSATLMTKSSGIRNILPESDICDFEFEPCGYSMNSIEGDAVS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARDKIW  995
             T+H+TPE+GFSYAS+EA G +L  V +  L++RVL CFEP EFSV+V  +FG    D I 
Sbjct  245   TIHITPEDGFSYASFEAAGYDLKQVNMGQLIERVLACFEPKEFSVSVHAQFGAHLCDDIH  304

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCW  1133
               G   +  Y    R  +EL   G I Y+ F        P S L+C+
Sbjct  305   VLG---MKGYTPEERCFEELGMGGSIIYQKFVRTASCGSPRSILKCF  348



>ref|XP_011008996.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Populus euphratica]
Length=406

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 186/352 (53%), Positives = 237/352 (67%), Gaps = 11/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI++  P +F DP G GLR L++ QLD IL PA CTIV  L     DS
Sbjct  57    SAIGFEGYEKRLEITYFEPGIFDDPEGKGLRSLSKPQLDEILGPAECTIVDSLSNDYVDS  116

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLAD LSL V SV+Y+RG+F+F  +Q 
Sbjct  117   YVLSESSLFVYPYKIIIKTCGTTKLLLSIPTILKLADTLSLNVRSVRYTRGSFIFPGAQS  176

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHRSFSEEVA L+  F K G+   A+++G  + P + WHVY A   S        T+E+
Sbjct  177   YPHRSFSEEVAVLDGFFGKLGLASKAYIMGGLDKP-QKWHVYSASADSALSHDLIYTIEM  235

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K        MT  S I  ++P+  ICDFEF+PCGYSMN ++GAA S
Sbjct  236   CMTGLDREKASVFYKTQSSSASAMTDDSGIRKILPASNICDFEFEPCGYSMNSIEGAAIS  295

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA G +L +V L  LV RVL CF+ +EFS+AV      A +++ R
Sbjct  296   TIHVTPEDGFSYASFEAAGYDLKVVSLNQLVDRVLACFQSSEFSIAV--HADVAGEQLER  353

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQC-WKETEE  1148
               + DV  Y    R   EL   G I Y+ F  +  A  P S L+C WKE E+
Sbjct  354   ICSLDVKGYCLGERSHGELGTGGSIIYQKFVRSGNADSPRSILKCRWKEEED  405



>ref|NP_001236931.1| S-adenosylmethionine decarboxylase [Glycine max]
 gb|AAL89723.1|AF488307_1 S-adenosylmethionine decarboxylase [Glycine max]
 gb|KHN07743.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=355

 Score =   333 bits (855),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 233/358 (65%), Gaps = 11/358 (3%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             MA A+S AIGFEGFEKRLEISF  P LF DP G GLR LT+ QL  IL PA CTIVS L 
Sbjct  1     MAMAVS-AIGFEGFEKRLEISFFQPGLFADPEGRGLRALTKSQLGEILTPAACTIVSSLK  59

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
                 DSYVLSESS+F+Y  KI++KTCGTT+LLL++P ILK A++LSL V SV Y+RG+F+
Sbjct  60    NDNVDSYVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKFAEMLSLNVKSVNYTRGSFI  119

Query  459   FQNSQPAPHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGAPAPE  626
             F ++QP PHR+FSEEVA L+  F K G    A++LG  +   +NWHVY A   S      
Sbjct  120   FPSAQPYPHRNFSEEVAILDGYFGKLGAGSNAYILGG-QDKAQNWHVYSASADSVTQCDN  178

Query  627   T-TVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL REKA +F+K        MT  S I  ++P   ICDF+F+PCGYSMN +
Sbjct  179   VYTLEMCMTGLDREKAQVFYKEQSASAAMMTVNSGIRKILPDSEICDFDFEPCGYSMNSV  238

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +GAA ST+HVTPE+GFSYAS+E +G +   V L  +V+RVL CF P EFSVAV   G  A
Sbjct  239   EGAAVSTIHVTPEDGFSYASFETVGYDFKAVNLNEMVQRVLACFLPTEFSVAVHVDG--A  296

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCF-TTNKVASRPSALQCWKETEEE  1151
                  +    DV  Y    R  + L   G + Y+ F  T+   S  S L+CW E +EE
Sbjct  297   SKSFEQTCFLDVKGYCREERSHEGLGMGGSVVYQKFGKTSDCGSPRSTLKCWNEEDEE  354



>ref|XP_008243751.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Prunus 
mume]
Length=357

 Score =   333 bits (855),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 186/360 (52%), Positives = 241/360 (67%), Gaps = 14/360 (4%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             MA A+S AIGFEGFEKRLEISF  P +F DP G GLR L + Q+D++L+ A CTIVS L 
Sbjct  1     MAMAVS-AIGFEGFEKRLEISFFEPSIFVDPEGRGLRSLAKAQIDALLDEAECTIVSSLS  59

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
                 DSYVLSESS+FIYP K+++KTCGTT+LLL +P +LKLA+ +SL V +VKY+RG+F+
Sbjct  60    NDHVDSYVLSESSLFIYPYKMIIKTCGTTKLLLVIPPLLKLAETISLAVRAVKYTRGSFI  119

Query  459   FQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-P  623
             F  +Q  PHR+FSEEV+ L+  F        A+V+G  + P + WHVY A   SG+ A P
Sbjct  120   FPGAQSYPHRNFSEEVSVLDGYFGKLGSGSRAYVMGRSDGP-QKWHVYSASAESGSLADP  178

Query  624   ETTVEICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL REKA++F+K +      MT  S I  ++P   ICDFEFDPCGYSMN +
Sbjct  179   VYTLEMCMTGLDREKASVFYKSQSSSAAAMTNDSGIRKILPDSDICDFEFDPCGYSMNSI  238

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +GAA ST+HVTPE+GFSYAS+E  G +L  V +  LV+RVL CF+P EFS+AV      A
Sbjct  239   EGAAISTIHVTPEDGFSYASFETAGYDLKDVNINQLVERVLACFQPREFSIAV--HADVA  296

Query  981   RDKIWRGGNADVDRYACRFRVTQELPG-DGRIDY-RCFTTNKVASRPSALQ-CWKETEEE  1151
                + +  + D+  Y CR   T E  G  G I Y R   T +  S  S L+ CW++ EEE
Sbjct  297   TKSLQQLSSVDLKGY-CREESTHEELGMGGSIVYNRFLKTERCGSPRSTLKGCWRDEEEE  355



>ref|XP_008362232.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=374

 Score =   334 bits (857),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 180/352 (51%), Positives = 233/352 (66%), Gaps = 16/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF DP+GMGLR L++ Q+D IL PA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEVSFFEPGLFADPKGMGLRSLSKAQIDEILTPAECTIVSSLSNDDLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LL S+P ILKLAD LSL V SV+YSRG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLADTLSLAVKSVRYSRGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEV-------GSGAPAP  623
             +PHRSFSEEVA L+  F K G+   A+V+G P+   + WH+Y A         GS    P
Sbjct  126   SPHRSFSEEVAVLDGHFSKLGLASKAYVMGSPDKT-QKWHIYSASAELASLLWGSRQTGP  184

Query  624   ETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL R++A++F+K        MT+ S I  V+P   ICDFEF+PCGYSMN +
Sbjct  185   TYTLEMCMTGLDRKRASVFYKSDASSAAGMTEESGIRKVLPQSDICDFEFEPCGYSMNSI  244

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+E +G   + V L  L+ RVL+CF+PAEFSVA+       
Sbjct  245   EGNAVSTIHVTPEDGFSYASFETVGYNFNDVNLTLLLYRVLDCFKPAEFSVALHTTSTAG  304

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP--SALQC  1130
              D +      D+  Y C     + L   G I Y  F  +   S+   S L+C
Sbjct  305   ED-LDAKCPLDLRGYCCGGSSYEGLGLGGAIIYHSFVKDDSGSQSPRSILKC  355



>ref|XP_006430871.1| hypothetical protein CICLE_v10013866mg [Citrus clementina]
 gb|ESR44111.1| hypothetical protein CICLE_v10013866mg [Citrus clementina]
Length=361

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 246/358 (69%), Gaps = 11/358 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F DP G GLR L++ QLD IL+PA CTIVS L     DS
Sbjct  6     SAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSNEYLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LLLS+P ILKL++ LSL V SV+Y+RG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLLSIPAILKLSESLSLSVRSVRYTRGSFIFAGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PHRSFSEEVA L+  F     +  AFV+G P++  R WHVY A   +G+   P  T+E+
Sbjct  126   FPHRSFSEEVAVLDGHFGKFGMDSTAFVMGSPDNTKR-WHVYSASAEAGSHVNPVYTLEM  184

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R++A++F+K        MT+ S I  ++P   ICDFEFDPCGYSMN ++G A S
Sbjct  185   CMTGLDRKRASVFYKTNESSAAMMTEDSGIRKILPKSEICDFEFDPCGYSMNSIEGDAVS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +  +V L  L++RVL CF+PAEFSVA+    V   D+   
Sbjct  245   TIHVTPEDGFSYASFEAVGYDFEVVKLTPLLERVLTCFKPAEFSVALHSDIV--GDEHGD  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEEVAVVG  1166
                 D+  Y+C  ++ +EL  +G + Y  F+    ++ P ++   CW E E++  V G
Sbjct  303   TFMLDLKGYSCGEKIYEELGNNGSLIYYSFSRTDCSTSPRSILKCCWSEDEKDEEVEG  360



>ref|XP_002314904.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 gb|EEF01075.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
Length=355

 Score =   333 bits (854),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 235/352 (67%), Gaps = 11/352 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI++  P +F DP G GLR L++ QLD IL PA CTIV  L     DS
Sbjct  6     SAIGFEGYEKRLEITYFEPGIFDDPEGKGLRSLSKPQLDEILGPAECTIVDSLSNDYVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLAD LSL V SV+Y+RG+F+F  +Q 
Sbjct  66    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILKLADTLSLNVRSVRYTRGSFIFPGAQS  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHRSFSEE+A L+  F K G+   A+++G  + P + WHVY A   S        T+E+
Sbjct  126   YPHRSFSEEIAVLDGCFGKLGLASKAYIMGGLDKP-QKWHVYSASADSARSRDLIYTIEM  184

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K +      MT  S I  ++P+  ICDFEF+PCGYSMN ++GAA S
Sbjct  185   CMTGLDREKASVFYKTQSSSAAAMTDDSGIRKILPASNICDFEFEPCGYSMNSIEGAAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA G +L    L  LV RVL CF+  EFS+AV      A +++ R
Sbjct  245   TIHVTPEDGFSYASFEAAGYDLKDASLNQLVDRVLACFQATEFSIAV--HADVAGEQLER  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEE  1148
               + DV  Y    R+  EL   G I Y+ F  +  A  P ++   CWKE E+
Sbjct  303   ICSLDVKGYCRGERIHGELGMGGSIIYQKFVRSGNADSPRSILKCCWKEEED  354



>emb|CDY71278.1| BnaAnng36830D [Brassica napus]
Length=363

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 240/350 (69%), Gaps = 17/350 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V+SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVESVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A  G  + +    T+E+
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDET-KKWHVYAASSGQSSSSNNVYTLEM  182

Query  642   CMTGLSREKAAMFFKRPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
             CMTGL REKA++F+K  G  G MT  S I  ++P   ICDFEF+PCGYSMN ++G A ST
Sbjct  183   CMTGLDREKASVFYKN-GETGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEGDAIST  241

Query  822   VHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDKIW  995
             +HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  GV A + +I 
Sbjct  242   IHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAYKPEI-  300

Query  996   RGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
                + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  301   ---SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  347



>ref|XP_007225621.1| hypothetical protein PRUPE_ppa007732mg [Prunus persica]
 gb|EMJ26820.1| hypothetical protein PRUPE_ppa007732mg [Prunus persica]
Length=357

 Score =   333 bits (854),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 239/359 (67%), Gaps = 12/359 (3%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             MA A+S AIGFEGFEKRLEISF  P +F DP G GLR L + Q+D++L+ A CTIVS L 
Sbjct  1     MAMAVS-AIGFEGFEKRLEISFFEPSIFVDPEGRGLRSLAKAQIDALLDEAECTIVSSLS  59

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
                 DSYVLSESS+FIYP K+++KTCGTT+LLL +P +LKLA+ +SL V SVKY+RG+F+
Sbjct  60    NDHVDSYVLSESSLFIYPYKMIIKTCGTTKLLLVIPPLLKLAETISLSVRSVKYTRGSFI  119

Query  459   FQNSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-P  623
             F  +Q  PHR+FSEEV+ L+  F        A+V+G  + P + WHVY A   SG+   P
Sbjct  120   FPGAQSYPHRNFSEEVSVLDGYFGKLGSGSRAYVMGRSDGP-QKWHVYSASAESGSLVDP  178

Query  624   ETTVEICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL REKA++F+K +      MT  S I  ++P   ICDFEFDPCGYSMN +
Sbjct  179   VYTLEMCMTGLDREKASVFYKSQSSSAAAMTNDSGIRKILPDSDICDFEFDPCGYSMNSI  238

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +GAA ST+HVTPE+GFSYAS+E  G +L  V +  LV+RVL CF+P EFS+AV      A
Sbjct  239   EGAAISTIHVTPEDGFSYASFETAGYDLKDVNINQLVERVLACFQPREFSIAV--HADVA  296

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDY-RCFTTNKVASRPSALQ-CWKETEEE  1151
                + +  + D+  Y  +    +EL   G I Y R   T +  S  S L+ CW++ EEE
Sbjct  297   TKSLQQLSSVDLKGYCRKESSHEELGMGGSIVYNRFLKTERCGSPRSTLKGCWRDEEEE  355



>ref|XP_004304166.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 1 [Fragaria vesca subsp. vesca]
 ref|XP_004304167.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=371

 Score =   334 bits (856),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 238/353 (67%), Gaps = 18/353 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+ F  P LF DP+GMGLR L+R Q++ IL PA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEVCFFEPGLFADPKGMGLRSLSRAQINEILNPAECTIVSSLLNDDLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LL S+P ILKLA+ LSL V SV+YSRG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLAETLSLAVRSVRYSRGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEV-------GSGAPAP  623
             +PHRSFSEEVA L+  F K G+   A+++G P++  + WHVY A         G+ +  P
Sbjct  126   SPHRSFSEEVAVLDGHFSKLGLASRAYIMGSPDN-SQKWHVYSASAELASLFWGTRSSGP  184

Query  624   ETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL R+KA++F+K        MT+ S I  ++P   ICDFEFDPCGYSMN +
Sbjct  185   TYTLEMCMTGLDRKKASVFYKTNASSAAIMTEDSGIRKILPKSEICDFEFDPCGYSMNSI  244

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+E +G     V L  L++RVL+CF+PAEFSV++    + A
Sbjct  245   EGDAVSTIHVTPEDGFSYASFETVGYNFKDVNLTRLIERVLDCFKPAEFSVSLHS-TIAA  303

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
              +++      ++  Y C     +EL   G + Y  F  +  +  P ++   CW
Sbjct  304   SEEL--EFPLELSGYCCGSTSYEELGLGGAVIYHSFNKDGGSQSPRSILKCCW  354



>gb|KGN57743.1| hypothetical protein Csa_3G271360 [Cucumis sativus]
Length=364

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 238/362 (66%), Gaps = 18/362 (5%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLE+SF  P +F DPRGMGLR L++ QLD IL  A CTIV  L     D
Sbjct  5     TSAIGFEGYEKRLEVSFFEPSVFVDPRGMGLRALSKAQLDEILTLAECTIVDSLSNDYLD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K ++KTCGTT+LLLS+P +LKLAD LSL V SV+Y+RG+F+F  +Q
Sbjct  65    SYVLSESSLFVYPYKFIIKTCGTTKLLLSIPALLKLADSLSLTVKSVRYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYV--AEVGSGAPAPETTV  635
               PHRSFSEEVA L+        NG A+V+G P+   R WHVY   A +G+ +  P  T+
Sbjct  125   SFPHRSFSEEVAVLDGYLARLGLNGSAYVMGSPDET-RKWHVYAACASMGNQSNNPVYTL  183

Query  636   EICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMTGL +EKA++FFK        MT+ S I  ++P   ICDFEFDPCGYSMN ++G A
Sbjct  184   EMCMTGLDKEKASVFFKTDASSAAAMTENSGIRKILPKSEICDFEFDPCGYSMNAIEGDA  243

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTR--FGVPARD  986
              ST+HVTPE+GFSYAS+EA G +   + L  L+ RVL CF+P++FSVA+     G    D
Sbjct  244   ESTIHVTPEDGFSYASFEAAGYDFDDMNLSKLIVRVLACFQPSDFSVALHSDVVGENLED  303

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRP--SALQCWKETEEEV  1154
              +      ++  Y    +  + L  +G + Y+ F  T    AS P  + L+CW E E++ 
Sbjct  304   LLC----LELKGYEGGEKSCEILGENGTVIYQSFMKTEGDYASSPRSTLLKCWSEDEKDE  359

Query  1155  AV  1160
              V
Sbjct  360   EV  361



>ref|XP_010654269.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
Length=360

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/348 (54%), Positives = 227/348 (65%), Gaps = 13/348 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+ P +F DP G GLR L+R QLD ILEPA C IV  L     DS
Sbjct  6     SAIGFEGYEKRLEISFSEPGIFSDPEGRGLRSLSRAQLDEILEPAECIIVGSLSNDIVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLAD LSL V  V+Y+RG+F F  +QP
Sbjct  66    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLADALSLSVSCVRYTRGSFNFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVY--VAEVGSGAPAPETTVE  638
              PHR FSEEVA L+S F        A+V+G  +   + WHVY   AEV S A  P  T+E
Sbjct  126   YPHRHFSEEVAVLDSYFGKLGSGSKAYVMGSSDK-SQKWHVYSASAEVRS-ACDPVYTLE  183

Query  639   ICMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL RE A++F+K       +MT  S I  ++P   ICDFEFDPCGYSMN ++GAA 
Sbjct  184   MCMTGLDREMASVFYKTHSSSAVKMTDTSGIRKILPDSEICDFEFDPCGYSMNAIEGAAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+E MG     V L  L++RVL+CF+P EFSVAV      +   + 
Sbjct  244   STIHVTPEDGFSYASFETMGYNPKDVNLSQLIERVLSCFQPNEFSVAV--HADISGKLLE  301

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCW  1133
             R    DV  Y C  R  +EL   G I Y  F  T   V+ R     CW
Sbjct  302   RNCLLDVKGYCCEERSNEELGMCGSIVYHRFMKTEGLVSPRSILKCCW  349



>ref|XP_008230354.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Prunus mume]
Length=426

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/353 (50%), Positives = 232/353 (66%), Gaps = 15/353 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF DP GMGLR L++DQLD IL+PA CTIVS L   + DS
Sbjct  58    SAIGFEGYEKRLEVSFFEPGLFADPAGMGLRSLSKDQLDEILKPAECTIVSSLSNDDLDS  117

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LL S+P ILKLA+ LSL V SV+YSRG+F+F  +QP
Sbjct  118   YVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLAETLSLAVKSVRYSRGSFIFPGAQP  177

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEV-------GSGAPAP  623
             +PHRSFSEEVA L+  F K G+   A+V+G  +   + WH+Y A         G+    P
Sbjct  178   SPHRSFSEEVAVLDGHFGKLGLASRAYVMGGSDKT-QKWHIYSASAELASLLWGARQSGP  236

Query  624   ETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL R+KA++F+K        MT+ S I  ++P   ICDFEF+PCGYSMN +
Sbjct  237   TYTLEMCMTGLDRKKASVFYKSNASSAAGMTEESGIRKILPQSEICDFEFEPCGYSMNSI  296

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+E MG +   V L  L+ RVL+CF+PAEFSVA+       
Sbjct  297   EGNAISTIHVTPEDGFSYASFETMGYDFKNVNLTQLIDRVLDCFKPAEFSVALHTTSTAG  356

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSAL--QCW  1133
                  +    D+  Y C     + L   G + +  F  +  +  P ++   CW
Sbjct  357   EQLNVKFPLDDLRGYCCGESNYEMLGLGGAVIFHSFVKDAGSQSPRSILKGCW  409



>gb|EPS62258.1| s-adenosylmethionine decarboxylase proenzyme, partial [Genlisea 
aurea]
Length=357

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 233/354 (66%), Gaps = 14/354 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMG-LRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             SAIGFEG+EKRLEISF     F  PRG G LR LT+ QLD IL+PA CTIVS L     D
Sbjct  6     SAIGFEGYEKRLEISFFESDAFTGPRGKGGLRSLTKSQLDEILKPAECTIVSSLSNEHLD  65

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K+++KTCGTT+LLLS+P ILKLA  L+L V  V+Y+RG+F+F  +Q
Sbjct  66    SYVLSESSLFVYPYKMIIKTCGTTKLLLSIPAILKLAQSLALSVKDVRYTRGSFIFPGAQ  125

Query  474   PAPHRSFSEEVAFLNSQF----KNGV-AFVLGDPESPGRNWHVY--VAEVGSGAPAPETT  632
               PHR FSEE   L   F     NG  A+V+G P++P + WHVY   AE  + +P P  T
Sbjct  126   TYPHRDFSEEFVVLEGYFGKLSSNGSRAYVMGSPDTP-QKWHVYSASAETATESPNPVVT  184

Query  633   VEICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             VE+CMTGL RE+A++F+K       +MTK S I  ++P   ICDFEF+PCGYSMN ++GA
Sbjct  185   VEMCMTGLDRERASVFYKEDSSSAAQMTKSSGIRHILPDSEICDFEFEPCGYSMNSIEGA  244

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVT-RFGVPARD  986
             A ST+HVTPE+GFSYAS+EA G +L  + LE L++R L CFEP EFSV+V    G    D
Sbjct  245   AISTIHVTPEDGFSYASFEAAGYDLKRLNLELLIERALTCFEPDEFSVSVHGERGTELCD  304

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWKETE  1145
                 G   D+  Y C  +  +EL   G I YR F   +    P S L+C+ E E
Sbjct  305   DEDVG--LDMCGYVCEDKWFEELGQGGWIMYRKFARARRCGSPRSILKCFGEEE  356



>ref|XP_002525956.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
 gb|EEF36380.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
Length=359

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 228/345 (66%), Gaps = 13/345 (4%)
 Frame = +3

Query  123   IGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDSYV  302
             IGFEG+EKRLE+SF+ P  F DP GMGLR L++ QLD IL+PA CTIV  L     DSYV
Sbjct  8     IGFEGYEKRLEVSFSEPGFFADPGGMGLRSLSKSQLDEILKPAECTIVDSLSNDHVDSYV  67

Query  303   LSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQPAP  482
             LSESS+F+YP K+++KTCGTT+LLLS+P ILKLAD LSL V SV+Y+RG+F+F ++Q  P
Sbjct  68    LSESSLFVYPYKLMIKTCGTTKLLLSIPAILKLADTLSLSVSSVRYTRGSFIFPSAQTFP  127

Query  483   HRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGA-PAPETTVEICM  647
             HRSFSEEVA L+  F       VA+V+G P+   R WH Y A +      +P  T+E+CM
Sbjct  128   HRSFSEEVAVLDGHFGKLGLESVAYVMGSPDET-RKWHAYSAAIDERCHSSPIYTLEMCM  186

Query  648   TGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYSTV  824
             TGL RE+A++F+K        MT+ S I  ++P   ICDF+FDPCGYSMN ++G A ST+
Sbjct  187   TGLDRERASVFYKTHTSSAAVMTEDSGIRKILPQSEICDFDFDPCGYSMNAVEGDAISTI  246

Query  825   HVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWRGG  1004
             H+TPE+GFSYAS+E+MG     V L  L++RVL CFEP EFS+A+    V    K +   
Sbjct  247   HITPEDGFSYASFESMGYNFEEVNLTQLLERVLACFEPTEFSIALHSNIVHDELKFF---  303

Query  1005  NADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
               DV  Y+C  R  + L   G I Y  F   K  + P ++   CW
Sbjct  304   -PDVKGYSCGGRNYEVLGKGGSIIYYSFERIKGCASPRSILKCCW  347



>ref|XP_011070874.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Sesamum indicum]
Length=358

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 235/359 (65%), Gaps = 14/359 (4%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             MA ++SS + FEGFEKRLEISF  P +F DP G GLR L++ +LD ILEPA CTIV  L 
Sbjct  1     MALSISSIV-FEGFEKRLEISFFQPSIFSDPEGKGLRSLSKAKLDEILEPAECTIVGSLS  59

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
                 DSYVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLA  LSL V +V+Y+RG+F+
Sbjct  60    NEHVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPSILKLAGCLSLSVGTVRYTRGSFI  119

Query  459   FQNSQPAPHRSFSEEVAFLNSQFKN-----GVAFVLGDPESPGRNWHVYVAEVGS-GAPA  620
             F  +Q  PHRSFSEEVA L+  F N       A+V+G  +   + WHVY A   S  A  
Sbjct  120   FPGAQSYPHRSFSEEVAVLDKYFGNLGPGSTKAYVMGGSDKR-QKWHVYSASAASVEAFN  178

Query  621   PETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNG  797
             P  T+E+CMTGL REKA++F+K        MT  S I +++P   ICDFEF+PCGYSMN 
Sbjct  179   PVYTLEMCMTGLDREKASVFYKNESSSASLMTNKSGIRNILPESCICDFEFEPCGYSMNS  238

Query  798   MDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGV  974
             ++GAA ST+HVTPE+GFSYAS+EA G +  +V L  L +RVL CF+P EF +AV   FG 
Sbjct  239   VEGAALSTIHVTPEDGFSYASFEAAGYDFKVVNLGLLSERVLACFQPMEFCLAVHADFGA  298

Query  975   PARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSA-LQCWKETEE  1148
                D I      D+  Y+   +  +EL   G I Y+ F        PS+ L+C +E +E
Sbjct  299   KLLDDIHA---FDMKGYSLNEKSCKELGMGGSIMYQKFVRTTTCGSPSSILRCCREEDE  354



>dbj|BAF75727.1| S-adenosylmethionine decarboxylase [Triticum turgidum]
Length=386

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 239/363 (66%), Gaps = 30/363 (8%)
 Frame = +3

Query  108   ALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAE  287
             A +SAIGFEG+EKRLEI+F+   +F DP G GLR L+R Q+DS+L+ A CTIVSEL   +
Sbjct  3     APTSAIGFEGYEKRLEITFSEASIFADPHGRGLRALSRAQIDSVLDLARCTIVSELSNKD  62

Query  288   FDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQN  467
             FDSYVLSESS+FIY  KIV+KTCGTT LLL++P IL+ A+ L + + +VKYSRG F+F  
Sbjct  63    FDSYVLSESSLFIYSQKIVIKTCGTTMLLLTIPRILE-AEELCMPLAAVKYSRGMFIFPG  121

Query  468   SQPAPHRSFSEEVAFLNSQFKNGVA--FVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
             +QPAPHRSFSEEV  LN  F +     +V+GDP  PG+ WH+Y A        P  T+E+
Sbjct  122   AQPAPHRSFSEEVDVLNRYFGHLKVWPYVIGDPAKPGQKWHIYYAT--EQPEQPMVTLEM  179

Query  642   CMTGLSREKAAMFFKRPGGD-----GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             CMTGL ++KA++FFK           EMTK+S I D+IP   +C+ +F+PCGYSMN ++G
Sbjct  180   CMTGLDKKKASVFFKTQADSHVSCAKEMTKLSGISDIIPEMEVCEVDFEPCGYSMNAING  239

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             +A ST++VTPE+GFSYASYE MG++ S +    +VKRVL C+ P+E S  VT FG   R 
Sbjct  240   SAVSTIYVTPEDGFSYASYEVMGMDASALAYGDIVKRVLRCW-PSE-SCGVTIFG--GRG  295

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQCWKETEEEVAVVG  1166
             +   G  AD + Y C   V QELP  G + Y+ FT N                EEVAV  
Sbjct  296   QPPLGQEADAEAYDCNNVVEQELPCGGVLIYQSFTVN----------------EEVAVSA  339

Query  1167  GLP  1175
             G P
Sbjct  340   GSP  342



>gb|KDO58885.1| hypothetical protein CISIN_1g039582mg [Citrus sinensis]
Length=361

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 246/358 (69%), Gaps = 11/358 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F DP G GLR L++ QLD IL+PA CTIVS L     DS
Sbjct  6     SAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSNEHLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LLLS+P ILKL++ LSL V SV+Y+RG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLLSIPAILKLSESLSLSVRSVRYTRGSFIFAGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PHRSFSEEVA L+  F     +  AFV+G P++  R WHVY A   +G+   P  T+E+
Sbjct  126   FPHRSFSEEVAVLDGHFGKFGMDSTAFVMGSPDNTKR-WHVYSASAEAGSHVNPVYTLEM  184

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R++A++F+K        MT+ S I  ++P   ICDFEFDPCGYSMN ++G A S
Sbjct  185   CMTGLDRKRASVFYKTNESSVALMTEDSGIRKILPKSEICDFEFDPCGYSMNSIEGDAVS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +  +V L  L++RVL CF+PAEFSVA+    V   D+   
Sbjct  245   TIHVTPEDGFSYASFEAVGYDFEVVKLTPLLERVLACFKPAEFSVALHSDIV--GDEHGD  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEEVAVVG  1166
                 D+  Y+C  ++ +EL  +G + Y  F+    ++ P ++   CW E E++  V G
Sbjct  303   TFMLDLKGYSCGEKIYEELGNNGSLIYYSFSRADCSTSPRSILKCCWSEDEKDEEVEG  360



>emb|CAD98785.2| S-adenosylmethionine decarboxylase proenzyme [Vitis vinifera]
Length=358

 Score =   332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 186/348 (53%), Positives = 228/348 (66%), Gaps = 13/348 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+ P +F DP G GLR L+R QLD ILEPA CTIV  L     DS
Sbjct  6     SAIGFEGYEKRLEISFSEPGIFSDPEGRGLRSLSRAQLDEILEPAECTIVGSLSNDIVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLAD LSL V  V+Y+RG+F F  +QP
Sbjct  66    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLADTLSLSVSCVRYTRGSFNFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVY--VAEVGSGAPAPETTVE  638
              PHR FSEEVA L+S F        A+V+G  +   + WHVY   AEV S A  P  T+E
Sbjct  126   YPHRHFSEEVAVLDSYFGKLGSGSKAYVMGSSDK-SQKWHVYSASAEVRS-ACDPVYTLE  183

Query  639   ICMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL RE A++F+K       +MT  S I  ++P   ICDFEFDPCGYSMN ++GAA 
Sbjct  184   MCMTGLDREMASVFYKTHSSSAVKMTDTSGIRKILPDSEICDFEFDPCGYSMNAIEGAAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+E +G     V L  L++RVL+CF+P EFSVAV      +   + 
Sbjct  244   STIHVTPEDGFSYASFETVGYNPKDVNLSHLIERVLSCFQPNEFSVAV--HADISGKLLE  301

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCW  1133
             R    DV  Y C  R  +EL   G + Y  F  T   V+ R     CW
Sbjct  302   RNCLLDVKGYCCEERSNEELGMCGSMVYHRFMKTEGLVSPRSILKCCW  349



>sp|Q9SDM8.1|DCAM3_BRAJU RecName: Full=S-adenosylmethionine decarboxylase proenzyme 3; 
Short=AdoMetDC 3; Short=SAMDC 3; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 3 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 3 beta chain; 
Flags: Precursor [Brassica juncea]
 gb|AAF20160.1|AF215665_1 S-adenosyl-L-methionine decarboxylase [Brassica juncea]
Length=367

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 237/353 (67%), Gaps = 19/353 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P  F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET--TVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A   + +       T+E
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGN-DDENKKWHVYAASAQTSSDCNNNVYTLE  182

Query  639   ICMTGLSREKAAMFFKRPGG--DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             +CMTGL +EKA++F+K   G  +G MT  S I  ++P   ICDFEF+PCGYSMN ++G A
Sbjct  183   MCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSVEGDA  242

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RD  986
              ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  G  A + 
Sbjct  243   ISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGSNAYKP  302

Query  987   KIWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             +I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   EI----SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  351



>gb|ADG57793.1| S-adenosyl-l-methionine decarboxylase 3-2 [Brassica napus]
Length=368

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 237/354 (67%), Gaps = 20/354 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P  F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYV---AEVGSGAPAPETTV  635
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY    A+  S       T+
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGN-DDENKKWHVYAASSAQTSSDCNNNVYTL  182

Query  636   EICMTGLSREKAAMFFKRPGG--DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             E+CMTGL +EKA++F+K   G  +G MT  S I  ++P   ICDFEF+PCGYSMN ++G 
Sbjct  183   EMCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEGD  242

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-R  983
             A ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  G  A +
Sbjct  243   AISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANAYK  302

Query  984   DKIWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
              +I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   PEI----SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  352



>emb|CDX74257.1| BnaA03g27900D [Brassica napus]
Length=368

 Score =   332 bits (851),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 237/354 (67%), Gaps = 20/354 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P  F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYV---AEVGSGAPAPETTV  635
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY    A+  S       T+
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGN-DDENKKWHVYAASSAQTSSDCNNNVYTL  182

Query  636   EICMTGLSREKAAMFFKRPGG--DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             E+CMTGL +EKA++F+K   G  +G MT  S I  ++P   ICDFEF+PCGYSMN ++G 
Sbjct  183   EMCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEGD  242

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-R  983
             A ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  G  A +
Sbjct  243   AISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGSNAYK  302

Query  984   DKIWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
              +I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   PEI----SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  352



>ref|XP_009118044.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 3-like 
[Brassica rapa]
Length=363

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 238/350 (68%), Gaps = 17/350 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V+SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVESVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A     +      T+E+
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDET-KKWHVYAASSAQSSSNNNVYTLEM  182

Query  642   CMTGLSREKAAMFFKRPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
             CMTGL REKA++F+K  G  G MT  S I  ++P   ICDFEF+PCGYSMN ++G A ST
Sbjct  183   CMTGLDREKASVFYKN-GETGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEGDAIST  241

Query  822   VHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDKIW  995
             +HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  GV A + +I 
Sbjct  242   IHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAYKPEI-  300

Query  996   RGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
                + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  301   ---SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  347



>ref|XP_010463654.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 1 [Camelina 
sativa]
 ref|XP_010463655.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 1 [Camelina 
sativa]
Length=366

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 235/352 (67%), Gaps = 18/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F+D +G+GLR LT+ QLD IL PA CTIVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTKSQLDDILTPAACTIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET--TVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A             T+E
Sbjct  124   FPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDET-KQWHVYAASAQDSGNCNNNVYTLE  182

Query  639   ICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKA +F+K      G MT  S I  ++P   ICDFEF+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKALVFYKDESDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEGDAI  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDK  989
             ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  GV A + +
Sbjct  243   STIHVTPEDGFSYASFEAVGYDFNTMDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAYKPE  302

Query  990   IWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   I----SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  350



>ref|XP_009147351.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 3-like 
[Brassica rapa]
Length=364

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 237/350 (68%), Gaps = 17/350 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFLEPSIFQDTKGLGLRALTRSQLDQILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KT GTT+LLLS+P +L+LA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTSGTTKLLLSIPPLLELAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A   S +      T+E+
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDET-KKWHVYAASAQSFSDNNNVYTLEM  182

Query  642   CMTGLSREKAAMFFKRPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
             CMTGL REKA++F+K  G  G MT  S I  ++P   ICDFEF+PCGYSMN ++G A ST
Sbjct  183   CMTGLDREKASVFYKN-GETGTMTDNSGIRKILPKSHICDFEFEPCGYSMNSIEGDAIST  241

Query  822   VHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDKIW  995
             +HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  GV A + +I 
Sbjct  242   IHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAYKPEI-  300

Query  996   RGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
                + D+D Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  301   ---SVDLDDYGCRERTFESLGEESGMVMYQTFEKLGKYCGSPRSTLKCEW  347



>ref|XP_009764781.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana sylvestris]
Length=362

 Score =   332 bits (850),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 239/355 (67%), Gaps = 14/355 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F    +   P G GLR L++DQLD IL PA CTIVS L   E DS
Sbjct  6     SAIGFEGYEKRLEITFFELGMSDGP-GCGLRSLSKDQLDEILTPAACTIVSSLANDEVDS  64

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKLAD L+L V SV+Y+RG+F+F  +QP
Sbjct  65    YVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLADALNLKVKSVRYTRGSFIFPGAQP  124

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSG---APAPETTV  635
              PHR FSEEVA L+S F        A+V+G+ +   ++WHVY A   S     P P  T+
Sbjct  125   YPHRHFSEEVAVLDSYFGKLGAGSSAYVMGNADKQ-QSWHVYSASAESANANNPNPVYTL  183

Query  636   EICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMT L ++KA++FFK       EMT++S I  ++P   ICDF+FDPCGYSMN ++G A
Sbjct  184   EMCMTNLDKKKASVFFKTHSSTAAEMTEVSGIRKILPESNICDFDFDPCGYSMNAIEGPA  243

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKI  992
              ST+HVTPE+GFSYAS+EA+G +   V L A+++RVL+CF PAEFSV++     P ++ +
Sbjct  244   ISTIHVTPEDGFSYASFEAVGYDFKDVNLTAMIERVLSCFGPAEFSVSL-HCDTPGKE-L  301

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQC-WKETEEE  1151
             +     D+  YA   + T+ L   G + Y  F++N     P S   C W E+E+E
Sbjct  302   YTESGLDIIGYASGEKTTEVLGEGGSLTYLTFSSNGSCGSPRSIFHCSWSESEDE  356



>emb|CDP02379.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   331 bits (849),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 235/353 (67%), Gaps = 11/353 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P +F DP G GLR L+  QLD IL+PA CTIVS L   E DS
Sbjct  6     SAIGFEGFEKRLEISFFEPGIFADPGGRGLRALSNYQLDEILKPAHCTIVSSLSNGEVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FI+P KI+LKTCGTT+LLLS+P+ILK A  L L V SV+YSRG+F+F  +QP
Sbjct  66    YVLSESSLFIFPYKIILKTCGTTKLLLSIPLILKFAGDLKLTVKSVRYSRGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PHR+FSEEVA LNS F K G    A+++G  +   + WHVY A         P  T+E+
Sbjct  126   YPHRNFSEEVAVLNSYFGKLGAGSRAYLMGGADKQ-QKWHVYSASAEHMENMDPVYTLEM  184

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL + +AA+F+K R      MT+ S I  ++P   ICDF+FDPCGYSMN ++G A S
Sbjct  185   CMTGLDKNRAAVFYKTRSRSAAVMTETSGIRKILPQSEICDFDFDPCGYSMNSIEGDAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GF+YAS+EA+G +L ++ L  L++RVL CF+P EF  A+      + +++  
Sbjct  245   TIHVTPEDGFNYASFEAVGYDLKVLDLTKLLERVLACFQPTEFCFAL--HSGSSGEELDF  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEE  1151
               N ++  Y C  R  + L   G I Y+ FT       P ++   CW E+E+E
Sbjct  303   DFNLNLKGYTCEERSCEMLGKGGSIIYQSFTGAGCCGSPRSILKCCWSESEDE  355



>gb|EYU28926.1| hypothetical protein MIMGU_mgv1a008898mg [Erythranthe guttata]
Length=359

 Score =   331 bits (849),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 228/348 (66%), Gaps = 12/348 (3%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +S IGFEGFEKRLEISF  P +F DP G GL+ L++ Q+D IL PA CTIVS L     D
Sbjct  5     ASPIGFEGFEKRLEISFFEPSIFADPEGKGLQSLSKSQIDEILGPAECTIVSSLSNEHID  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++KTCGTT+LLLS+P IL LA  LSL V +V+Y+RG+F+F  +Q
Sbjct  65    SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILNLAKSLSLSVQTVRYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVE  638
               PHR+FSEEVA L+  F        A+V+G  +   + WH+Y A   S  A  P  T+E
Sbjct  125   SYPHRNFSEEVAVLDGYFGKLGSGSKAYVMGGSDKE-QKWHIYSACAASVEAENPVYTLE  183

Query  639   ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKA++FFK+       MT++S I D++P   ICDF+F+PCGYSMN ++GAA 
Sbjct  184   MCMTGLDREKASVFFKKQSSSAALMTEVSGIRDILPESDICDFDFEPCGYSMNSIEGAAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARDKI  992
             ST+H+TPE+GFSYAS+EA G +   V L  L+ RVL CFEP+EFSV+V  + G      I
Sbjct  244   STIHITPEDGFSYASFEAAGYDFKHVNLGELIDRVLYCFEPSEFSVSVHAQLGAKMFQHI  303

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCW  1133
                   DV  Y    R  +EL  DG I Y  F        P S L+C+
Sbjct  304   QA---LDVKGYTHEERSIKELGMDGSIVYHKFARAAFCGSPRSTLKCF  348



>gb|ACZ73828.1| S-adenosylmethionine decarboxylase [Olea europaea]
Length=354

 Score =   331 bits (848),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 228/349 (65%), Gaps = 11/349 (3%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEGF+KRLEISF+ P LF DP+G GLR LT+ QLD I  PA CTIVS L   + D
Sbjct  3     TSAIGFEGFKKRLEISFSDPGLFSDPQGRGLRSLTKSQLDEIFAPAECTIVSSLANDDVD  62

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP KI++KTCGTT+LL S+P ILKLA  LSL V +V+Y+RG+F+F  +Q
Sbjct  63    SYVLSESSLFVYPYKIIIKTCGTTKLLRSIPPILKLAGSLSLSVQAVRYTRGSFIFPGAQ  122

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEI  641
               PHR+FSEEVA L+S F      G A+V+G  +   + WHVY A  GS    P  T+E+
Sbjct  123   SYPHRNFSEEVAVLDSYFGELGSGGKAYVMGSSQKQ-QKWHVYSACAGSIETNPIYTLEM  181

Query  642   CMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL RE A++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++ AA S
Sbjct  182   CMTGLDREMASVFYKSDSSSATSMTNTSGIRKILPKSDICDFEFEPCGYSMNSIEEAAIS  241

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARDKIW  995
             T+HVTPE+GFSYAS+EA G  L  V L  L++RVL CF P EFS+AV    GV   D I+
Sbjct  242   TIHVTPEDGFSYASFEAAGYNLKDVNLSMLIERVLACFRPKEFSIAVHVDNGVMLFDNIY  301

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWKE  1139
                  D+  Y+      +E    G I Y+ F        P S L+C+ +
Sbjct  302   F---QDLKGYSVNEECHEEPGYGGSIVYQKFVQTAYCGSPRSILKCFSD  347



>gb|AGV68760.1| S-adenosylmethionine decarboxylase [Cucumis melo]
Length=364

 Score =   331 bits (849),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 238/362 (66%), Gaps = 18/362 (5%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLE+SF  P +F DPRGMGLR L++ QLD IL  A CTIV  L     D
Sbjct  5     TSAIGFEGYEKRLEVSFFEPSVFVDPRGMGLRALSKAQLDEILTLAECTIVDSLSNDYLD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K V+KTCGTT+LLLS+P +LKLAD LSL V SV+Y+RG+F+F  +Q
Sbjct  65    SYVLSESSLFVYPYKFVIKTCGTTKLLLSIPALLKLADSLSLTVKSVRYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVY--VAEVGSGAPAPETTV  635
               PHRSFSEEVA L+        +G A+V+G P+   R WHVY   A +G+ +  P  T+
Sbjct  125   SFPHRSFSEEVAVLDGYLAKLGLHGSAYVMGSPDET-RKWHVYSACANMGNQSNNPVYTL  183

Query  636   EICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             EICMTGL +EKA++FF+        MT+ S I  ++P   ICDFEFDPCGYSMN ++G A
Sbjct  184   EICMTGLDKEKASVFFRTDASSAAAMTENSGIRKILPKSEICDFEFDPCGYSMNAIEGDA  243

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTR--FGVPARD  986
              ST+HVTPE+GFSYAS+EA G +   + L  L+ RVL CF+P++FSVA+     G    D
Sbjct  244   ESTIHVTPEDGFSYASFEAAGYDFDDMNLSKLIVRVLACFQPSDFSVALHSDVVGENLED  303

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRP--SALQCWKETEEEV  1154
              +      ++  Y    +  + L  +G + Y+ F  T    AS P  + L+CW E E++ 
Sbjct  304   LLC----LELKGYEGGEKSCEMLGENGTVIYQSFMKTGGDYASSPRSTLLKCWSEDEKDE  359

Query  1155  AV  1160
              V
Sbjct  360   EV  361



>dbj|BAC55114.1| S-adenosylmethionine decarboxylase [Malus domestica]
Length=374

 Score =   332 bits (850),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 232/352 (66%), Gaps = 16/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF DP+GMGLR L++ Q+D IL PA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEVSFFEPGLFADPKGMGLRSLSKAQIDEILTPAECTIVSSLSNDDLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LL S+P ILKLAD LSL V SV+YSRG+F+F  + P
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLADSLSLAVKSVRYSRGSFIFPGAHP  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEV-------GSGAPAP  623
             +PHRSFSEEVA L+  F K G+   A+V+G P+   + WH+Y A         GS    P
Sbjct  126   SPHRSFSEEVAVLDGHFGKLGLASKAYVMGSPDKT-QKWHIYSASAELASLLWGSRQSGP  184

Query  624   ETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL R++A++F+K        MT  S I +++P   ICDFEF+PCGYSMN +
Sbjct  185   TYTLEMCMTGLDRKRASVFYKSDASSAAGMTVESGIRNILPQSDICDFEFEPCGYSMNSI  244

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+E +G +   V L  L+ RVL+CF+PAEFS+A+       
Sbjct  245   EGNAVSTIHVTPEDGFSYASFETVGYDFKDVNLTQLLYRVLDCFKPAEFSIALHTTSTAG  304

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP--SALQC  1130
              D +      D+  Y C     + L   G + Y  F  +   S+   S L+C
Sbjct  305   ED-LDAKCPLDLKGYCCGGSSYEGLGLGGAVMYHSFVKDDSGSQSPRSILKC  355



>ref|NP_186896.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 ref|NP_001078093.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 ref|NP_001154585.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 sp|Q96286.2|DCAM1_ARATH RecName: Full=S-adenosylmethionine decarboxylase proenzyme 1; 
Short=AdoMetDC1; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 beta chain; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL16237.1|AF428468_1 AT3g02470/F16B3_10 [Arabidopsis thaliana]
 gb|AAF32454.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AAK68764.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AAM10008.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 dbj|BAH19598.1| AT3G02470 [Arabidopsis thaliana]
 gb|AEE73812.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AEE73813.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AEE73814.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=366

 Score =   331 bits (849),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 179/352 (51%), Positives = 236/352 (67%), Gaps = 18/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE++F  P +F+D +G+GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET--TVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A     +       T+E
Sbjct  124   FPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDET-KKWHVYAASAQDSSNCNNNVYTLE  182

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKAA+F+K      G MT  S I  ++P   ICDFEF+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKAAVFYKDEADKTGSMTDNSGIRKILPKSEICDFEFEPCGYSMNSIEGDAI  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDK  989
             ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  G  + + +
Sbjct  243   STIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANSYKPE  302

Query  990   IWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             I      D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   I----TVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  350



>ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X2 [Vitis vinifera]
Length=410

 Score =   332 bits (852),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 187/348 (54%), Positives = 227/348 (65%), Gaps = 13/348 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+ P +F DP G GLR L+R QLD ILEPA C IV  L     DS
Sbjct  56    SAIGFEGYEKRLEISFSEPGIFSDPEGRGLRSLSRAQLDEILEPAECIIVGSLSNDIVDS  115

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P ILKLAD LSL V  V+Y+RG+F F  +QP
Sbjct  116   YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLADALSLSVSCVRYTRGSFNFPGAQP  175

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVY--VAEVGSGAPAPETTVE  638
              PHR FSEEVA L+S F        A+V+G  +   + WHVY   AEV S A  P  T+E
Sbjct  176   YPHRHFSEEVAVLDSYFGKLGSGSKAYVMGSSDK-SQKWHVYSASAEVRS-ACDPVYTLE  233

Query  639   ICMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL RE A++F+K       +MT  S I  ++P   ICDFEFDPCGYSMN ++GAA 
Sbjct  234   MCMTGLDREMASVFYKTHSSSAVKMTDTSGIRKILPDSEICDFEFDPCGYSMNAIEGAAI  293

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+E MG     V L  L++RVL+CF+P EFSVAV      +   + 
Sbjct  294   STIHVTPEDGFSYASFETMGYNPKDVNLSQLIERVLSCFQPNEFSVAV--HADISGKLLE  351

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCW  1133
             R    DV  Y C  R  +EL   G I Y  F  T   V+ R     CW
Sbjct  352   RNCLLDVKGYCCEERSNEELGMCGSIVYHRFMKTEGLVSPRSILKCCW  399



>gb|AAL06846.1| AT3g02470/F16B3_10 [Arabidopsis thaliana]
Length=366

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 179/352 (51%), Positives = 235/352 (67%), Gaps = 18/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE++F  P +F+D +G+GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET--TVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A     +       T+E
Sbjct  124   FPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDET-KKWHVYAASAQDSSNCNNNVYTLE  182

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKAA+F+K      G MT  S I  ++P   ICDFEF+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKAAVFYKDEADKTGSMTDNSGIRKILPKSEICDFEFEPCGYSMNSIEGDAI  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDK  989
             ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  G  + + +
Sbjct  243   STIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANSYKPE  302

Query  990   IWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             I      D++ Y CR R  + L  + G + Y  F    K    P S L+C W
Sbjct  303   I----TVDLEDYGCRERTFESLGEESGTVMYHTFEKLGKYCGSPRSTLKCEW  350



>gb|AGI02585.1| S-adenosylmethionine decarboxylase [Pyrus x bretschneideri]
Length=374

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 231/352 (66%), Gaps = 16/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF DP+GMGLR L + Q+D IL PA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEVSFFEPGLFADPKGMGLRSLLKAQIDEILTPAECTIVSSLSNDDLDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LL S+P ILKLAD LSL V SV+YSRG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLADSLSLAVKSVRYSRGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEV-------GSGAPAP  623
             +PHR FSEEVA L+  F K G+   A+V+G P+   + WH+Y A         GS    P
Sbjct  126   SPHRIFSEEVAVLDGHFGKLGLASKAYVMGSPDKT-QKWHIYSASAELASLLWGSRQSGP  184

Query  624   ETTVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL R++A++F+K        MT  S I +++P   ICDFEF+PCGYSMN +
Sbjct  185   TYTLEMCMTGLDRKRASVFYKSDASSAAGMTVESGIRNILPQSNICDFEFEPCGYSMNSI  244

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+E +G +   V L  L+ RVL+CF+PAEFS+A+       
Sbjct  245   EGNAVSTIHVTPEDGFSYASFETVGYDFKDVNLTQLLYRVLDCFKPAEFSIALHTTSTAG  304

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP--SALQC  1130
              D   R    D+  Y C     + L   G + Y  F  +   S+   S L+C
Sbjct  305   EDLNAR-CPLDLKGYCCGGSSYEGLGLGGAVMYHSFVKDDSGSQSPRSILKC  355



>ref|XP_009134671.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 3 [Brassica 
rapa]
Length=368

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 237/354 (67%), Gaps = 20/354 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P  F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYV---AEVGSGAPAPETTV  635
              PHRSFSEEV+ L+  F     + VA+++G+ +   + WHVY    A+  S       T+
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLSSVAYLMGN-DDENKKWHVYAASSAQTSSDCNNNVYTL  182

Query  636   EICMTGLSREKAAMFFKRPGG--DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             E+CMTGL +EKA++F+K   G  +G MT  S I  ++P   ICDFEF+PCGYSMN ++G 
Sbjct  183   EMCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSVEGD  242

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-R  983
             A ST+HVTPE+GFSYAS+EA+G + S + L  LV RVL+CFEP +FSVAV +  G  A +
Sbjct  243   AISTIHVTPEDGFSYASFEAVGYDFSTLDLSQLVTRVLSCFEPKQFSVAVHSSVGSNAYK  302

Query  984   DKIWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
              +I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   PEI----SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  352



>ref|XP_007153542.1| hypothetical protein PHAVU_003G044200g [Phaseolus vulgaris]
 gb|ESW25536.1| hypothetical protein PHAVU_003G044200g [Phaseolus vulgaris]
Length=354

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 178/355 (50%), Positives = 230/355 (65%), Gaps = 15/355 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI F+ P LF DP G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEICFSQPGLFADPEGRGLRVLTKSQLDEILTPAACTIVSSLSNDDVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILK AD+LSL V SV Y+RG+F+F  +QP
Sbjct  64    YVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKFADMLSLKVKSVTYTRGSFIFPGAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS--GAPAPETTVE  638
              PHR F+EEVA LN  F       +AF++G P+   + WH+Y A       +     T+E
Sbjct  124   HPHRCFTEEVAILNDYFGKLGSGSMAFIMGSPDKK-QKWHIYSASADPLISSDTNVCTLE  182

Query  639   ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKA +F+K        MT  S I  ++P+  ICDF+F+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKAQIFYKEQSASAAIMTVNSGIRKILPNSDICDFDFEPCGYSMNSVEGDAV  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGV--PARDK  989
             ST+H+TPE+GFSYAS+E +G +  ++ L ALV RVL+CF P EFSVAV   G   P+   
Sbjct  243   STIHITPEDGFSYASFETVGYDFKVLNLNALVDRVLSCFLPNEFSVAVRVDGASKPSEQM  302

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRPSALQCWKETEEE  1151
              +     DV  Y     + + L   G + Y+ F   +   S  S L+CWK+  EE
Sbjct  303   CF----VDVKGYCREEWIHEGLGMGGFVVYQKFVKISDCVSPRSTLKCWKDEVEE  353



>ref|XP_010549939.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Tarenaya hassleriana]
 gb|ABD96871.1| hypothetical protein [Cleome spinosa]
Length=363

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 238/358 (66%), Gaps = 18/358 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P LF DP+G GLR L + QLD IL+PA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEISFFEPSLFLDPQGKGLRALAKSQLDEILQPAECTIVSSLSNDQVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SV+Y+RG+F+    QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLAVKSVRYTRGSFICPGGQP  125

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVG-----SGAPAPET  629
              PHRSFSEEV+ L+  F     +  A+V+G+ +   + WHVY A        +G      
Sbjct  126   FPHRSFSEEVSVLDGHFAKLGLSSSAYVMGNADE-SKKWHVYSASANDVSRSAGGYKNVY  184

Query  630   TVEICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             T+E+CMTGL R+KA++FFK   G    MT+ S I  ++P+  ICDFEF+PCGYSMN ++G
Sbjct  185   TLEMCMTGLDRKKASVFFKTESGSTTSMTEGSGIRKILPNSAICDFEFEPCGYSMNSVEG  244

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A ST+HVTPE+GFSYAS+E++G +L+   L+ +V+RVL CFEP +FSVA+         
Sbjct  245   DAVSTIHVTPEDGFSYASFESVGYDLNAAELKGMVRRVLECFEPKQFSVAIH----ADMA  300

Query  987   KIWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTTNKVA--SRPSALQCWKETEEE  1151
             +   G   D+D Y C  R  ++L  + G + Y+ F     A  S  S L+C   +E+E
Sbjct  301   EGVHGKAIDMDDYVCVERTMEKLGEERGAVVYQGFERVAAACGSPRSILKCGWSSEDE  358



>emb|CDX91992.1| BnaC03g32940D [Brassica napus]
Length=367

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 236/353 (67%), Gaps = 19/353 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P  F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  L L V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELYLNVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYV--AEVGSGAPAPETTVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   R WHVY   A+  S   +   T+E
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDET-RKWHVYAASAQTSSDCNSNVYTLE  182

Query  639   ICMTGLSREKAAMFFKRPGG--DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             +CMTGL +EKA++F+K   G  +G MT  S I  ++P   ICDFEF+PCGYSMN ++G A
Sbjct  183   MCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSVEGDA  242

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RD  986
              ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL CFEP +FSVAV +  G  A + 
Sbjct  243   ISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLCCFEPKQFSVAVHSSVGANAYKP  302

Query  987   KIWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             +I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   EI----SVDLEDYGCRERTFETLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  351



>ref|XP_006299023.1| hypothetical protein CARUB_v10015160mg [Capsella rubella]
 gb|EOA31921.1| hypothetical protein CARUB_v10015160mg [Capsella rubella]
Length=426

 Score =   331 bits (849),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 180/352 (51%), Positives = 237/352 (67%), Gaps = 18/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE++F  P +F+D +G+GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  64    SAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQLDS  123

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  124   YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  183

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET--TVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A     +       T+E
Sbjct  184   FPHRSFSEEVSVLDGHFSQLGLNSVAYLMGNDDET-KKWHVYAASAQDSSNCNNNVFTLE  242

Query  639   ICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKA++F+K      G MT  S I  ++P   ICDFEF+PCGYSMN ++G A 
Sbjct  243   MCMTGLDREKASVFYKDETDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEGDAI  302

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDK  989
             ST+HVTPE+GFSYAS+EA+G + S + L  LV RVL+CFEP +FSVAV +  G  A + +
Sbjct  303   STIHVTPEDGFSYASFEAVGYDFSTMDLSQLVTRVLSCFEPKQFSVAVHSSVGCNAYKPE  362

Query  990   IWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             I    + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  363   I----SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  410



>ref|XP_009588870.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana tomentosiformis]
Length=415

 Score =   331 bits (848),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 230/348 (66%), Gaps = 11/348 (3%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLEISF  P LF DP G GLR L++ QLD IL PA CTIV  L     D
Sbjct  60    ASAIGFEGYEKRLEISFVEPGLFADPEGKGLRSLSKAQLDEILGPAECTIVDSLSNEFVD  119

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+FIY  KI++KTCGTT+LLLS+P ILKLAD LSL V +VKY+RG+F+F  +Q
Sbjct  120   SYVLSESSLFIYSYKIIIKTCGTTKLLLSIPAILKLADTLSLEVQAVKYTRGSFIFPGAQ  179

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVE  638
               PHR FSEEVA L+S F        A +LG P+   + WHVY A  G + +  P  T+E
Sbjct  180   SFPHRHFSEEVAVLDSYFGKLTSGSKAVILGSPDKL-QKWHVYSASAGPTQSKNPVYTLE  238

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMT L REKA++F+K       +MT  S I  ++P+  ICDFEFDPCGYSMN ++GAA 
Sbjct  239   MCMTSLDREKASIFYKTESSSAAQMTIRSGIRKILPNSDICDFEFDPCGYSMNSIEGAAL  298

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+EA+G +     L +LVKRVL CF+P EFS+A+      A + + 
Sbjct  299   STIHVTPEDGFSYASFEAVGYDFKSSSLGSLVKRVLACFQPDEFSIAL--HADVALELLK  356

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CW  1133
                + DV  Y+      +EL   G I Y+ F  +     P S LQ CW
Sbjct  357   HTCSLDVKGYSPAEWSPEELGKSGSIVYQKFARSSFCGSPKSVLQNCW  404



>gb|ADG57791.1| S-adenosyl-l-methionine decarboxylase 3-1 [Brassica napus]
Length=367

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 180/352 (51%), Positives = 234/352 (66%), Gaps = 17/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P  F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  L L V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELYLNVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYV--AEVGSGAPAPETTVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   R WHVY   A+  S   +   T+E
Sbjct  124   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDET-RKWHVYAASAQTSSDCNSNVYTLE  182

Query  639   ICMTGLSREKAAMFFKRPGG--DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             +CMTGL +EKA++F+K   G  +G MT  S I  ++P   ICDFEF+PCGYSMN ++G A
Sbjct  183   MCMTGLDKEKASVFYKNETGGENGSMTDNSGIRRILPKSQICDFEFEPCGYSMNSVEGDA  242

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARDK  989
              ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL CFEP +FSVAV +  G  A + 
Sbjct  243   ISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLCCFEPKQFSVAVHSSVGANAYEP  302

Query  990   IWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
                  + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   EI---SVDLEDYGCRERTFETLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  351



>ref|XP_007045669.1| S-adenosylmethionine decarboxylase proenzyme [Theobroma cacao]
 gb|EOY01501.1| S-adenosylmethionine decarboxylase proenzyme [Theobroma cacao]
Length=359

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 236/348 (68%), Gaps = 12/348 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P +F DP G GLR L++ QLD IL PA CTIVS L   + DS
Sbjct  9     SAIGFEGYEKRLEISFFEPGIFVDPEGKGLRSLSKAQLDEILGPAECTIVSSLSNKQVDS  68

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLL++P ILKLA  LSL + SV+Y+RG+F+F  +QP
Sbjct  69    YVLSESSLFVYPYKIIIKTCGTTKLLLAIPPILKLAGGLSLAIKSVRYTRGSFIFPGAQP  128

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSG-APAPETTVEI  641
              PHR+FSEEVA L+S F        A+V+G  +   + WHVY A   +  +  P  TVE+
Sbjct  129   YPHRNFSEEVAILDSYFGKLGGGSKAYVMGGLDK--QKWHVYSASAEAVISSGPIYTVEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             C+TGL RE A++F+K + G    MT  S I  ++P   ICDFEFDPCGYSMN ++GAA S
Sbjct  187   CLTGLDREMASVFYKDQSGSAAVMTINSGIRKILPDSEICDFEFDPCGYSMNAIEGAAIS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +   + L+ LV+RVL CF+P++FSVAV    V A   + +
Sbjct  247   TIHVTPEDGFSYASFEAVGYDPKDLNLKQLVERVLVCFKPSDFSVAV-HVDV-AGQSLEQ  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CWK  1136
                 DV  Y C  R  +EL   G + Y+ F +      P S L+ CWK
Sbjct  305   NCLLDVKGYCCGERGIEELGIGGSVIYQKFNSTGGCGSPRSTLKCCWK  352



>emb|CDY71710.1| BnaAnng38530D [Brassica napus]
Length=429

 Score =   330 bits (847),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 238/350 (68%), Gaps = 17/350 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  70    SAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDHLDS  129

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V+SVKY+RG+F+    QP
Sbjct  130   YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVESVKYTRGSFLCPGGQP  189

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A     +      T+E+
Sbjct  190   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDET-KKWHVYAASSAQSSSNNNVYTLEM  248

Query  642   CMTGLSREKAAMFFKRPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
             CMTGL REKA++F+K  G  G MT  S I  ++P   ICDFEF+PCGYSMN ++G A ST
Sbjct  249   CMTGLDREKASVFYKN-GETGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEGDAIST  307

Query  822   VHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDKIW  995
             +HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  GV A + +I 
Sbjct  308   IHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAYKPEI-  366

Query  996   RGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
                + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  367   ---SVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCGW  413



>ref|XP_010525150.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Tarenaya hassleriana]
 gb|ABD96954.1| hypothetical protein [Cleome spinosa]
Length=365

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 236/358 (66%), Gaps = 14/358 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P LF DP+GMG R L + QLD IL+PA CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEISFFEPSLFLDPKGMGFRALAKSQLDEILQPAECTIVSSLSNDQVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LL S+P +L+LA  LSL V SV+Y+RG+F+   +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLFSIPPLLELAGELSLVVKSVRYTRGSFICPGAQP  125

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLG-DPESPGRNWHVYVAEVGSGAPAPET---T  632
              PHRSFSEEVA L++ F     +  A+V+G D     R WHVY A     + +      T
Sbjct  126   FPHRSFSEEVAVLDAHFAKLGLSSSAYVMGNDGADETRKWHVYAASAKGTSRSDYNNVYT  185

Query  633   VEICMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             +E+CMTGL R+KAA+F+K        MT+ S I  ++P+  ICDFEF+PCGYSMN ++G 
Sbjct  186   LEMCMTGLDRKKAAVFYKTESSSALSMTEESGIRKILPNSAICDFEFEPCGYSMNSIEGE  245

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A ST+HVTPE+GFSYAS+EA+G +   + +  +V+RV++CFEP +FSVA+    V   D 
Sbjct  246   AISTIHVTPEDGFSYASFEAVGYDFKAMDVSGMVRRVIDCFEPKQFSVAIHADTVEEEDM  305

Query  990   IWR---GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQCWKETEEE  1151
             +     G   D D Y CR R  Q+L  + R     +  ++    P S L+C   +E+E
Sbjct  306   MMMMITGIEEDGD-YGCRERTVQKLGEEERGAVLYYGFDRTNGSPRSILKCGWSSEDE  362



>gb|ADQ37302.1| putative S-adenosyl methionine decarboxylase [Pinus sylvestris]
Length=386

 Score =   329 bits (843),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 179/360 (50%), Positives = 224/360 (62%), Gaps = 22/360 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             +AIGFEGFEKRLE+ F  P +F DP G GLR LTR  LD +L+ A CTIVSEL     DS
Sbjct  13    TAIGFEGFEKRLEVEFFAPSIFNDPEGRGLRALTRADLDEMLDAAQCTIVSELSNEHLDS  72

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+VLKTCGTT+LLLS+P+ILK A  LSL V +VKY+RGTF+F   QP
Sbjct  73    YVLSESSLFVYPYKLVLKTCGTTKLLLSIPLILKNASKLSLSVKNVKYTRGTFIFAGVQP  132

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS----GAPAPETT  632
              PHRSF EE+++L+  F      G A+V+GD    G NWHVY A        G   P  T
Sbjct  133   FPHRSFGEEISYLDKYFGKLGSGGKAYVMGD-SGKGYNWHVYSASAVDTSFEGNAPPVYT  191

Query  633   VEICMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             +E+CMT L R++A++F+K       E+T  S I D++P   ICDF+FDPCGYSMN ++GA
Sbjct  192   LEMCMTQLDRKQASVFYKDTSNSAMEITLNSGISDILPESKICDFQFDPCGYSMNALEGA  251

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A ST+HVTPE+G SYAS+EAMG       LEALV+RVL+CF P  FS++V          
Sbjct  252   AISTIHVTPEDGSSYASFEAMGYNPKDCDLEALVERVLSCFRPMVFSISVHASVGNGHSS  311

Query  990   ----IWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCWKETEEE  1151
                 +W  G      Y C     Q L G   + Y  +   TN+       L  W+E  EE
Sbjct  312   WTRPVWPQG------YICDMTSDQGLTGKSSVVYHTYRMATNESPRSTLPLLAWEEESEE  365



>emb|CAA69073.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=366

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/352 (51%), Positives = 235/352 (67%), Gaps = 18/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE++F  P +F+D +G+GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    Q 
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQL  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET--TVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A     +       T+E
Sbjct  124   FPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDET-KKWHVYAASAQDSSNCNNNVYTLE  182

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKAA+F+K      G MT  S I  ++P   ICDFEF+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKAAVFYKDEADKTGSMTDNSGIRKILPKSEICDFEFEPCGYSMNSIEGDAI  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDK  989
             ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  G  + + +
Sbjct  243   STIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANSYKPE  302

Query  990   IWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             I      D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   I----TVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  350



>gb|KEH21805.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=360

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 232/348 (67%), Gaps = 12/348 (3%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLEI+F     F DP G+GLR L++DQ+D IL+PA CTIV  L     D
Sbjct  5     NSAIGFEGYEKRLEITFFENGFFSDPAGLGLRALSKDQIDEILKPAECTIVDSLSNDCVD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+FIY  K+++KTCGTT+LLLS+P ILKLAD L++ V SV+Y+RG+F+F  +Q
Sbjct  65    SYVLSESSLFIYAYKLIIKTCGTTKLLLSIPAILKLADGLNIAVKSVRYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVE  638
               PHRSFSEEVA L+S F        A+++G+ +   + WH+Y A      +P     +E
Sbjct  125   SFPHRSFSEEVAVLDSYFGKLGSGSQAYMMGNADKS-QIWHIYSASAKLEASPEAVYGLE  183

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL +EKA++FFK  G   G MTK S I  ++P   ICDFEF+PCGYSMNG++G+A 
Sbjct  184   MCMTGLDKEKASVFFKTEGSSAGLMTKNSGIRKILPKSDICDFEFEPCGYSMNGIEGSAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+EA+G + S   L  LV RVL CF PAEFS+A+    +    +  
Sbjct  244   STIHVTPEDGFSYASFEAVGYDYSEKSLNELVGRVLACFYPAEFSIALH---IDTNGEKI  300

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CW  1133
                  +V  Y C  R+ + L  DG + YR F      S P S L+ CW
Sbjct  301   DKFPLEVKGYNCGERINEVLGEDGAVVYRTFVRIDGCSSPRSTLKCCW  348



>emb|CDY43235.1| BnaC05g48280D [Brassica napus]
Length=463

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 238/351 (68%), Gaps = 18/351 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P +F+D +G+GLR LTR QLD IL PA C IVS L     DS
Sbjct  102   SAIGFEGYEKRLEVSFLEPSIFQDSKGLGLRALTRSQLDQILTPAACEIVSSLSNDHLDS  161

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +L+LA  LSL V SVKY+RG+F+    QP
Sbjct  162   YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLELAGELSLSVKSVKYTRGSFLCPGGQP  221

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEV--GSGAPAPETTVE  638
              PHRSFSEEV+ L+  F     N VA+++G+ +   + WHVY A     SG      T+E
Sbjct  222   FPHRSFSEEVSVLDGHFTKLGLNSVAYLMGN-DDETKKWHVYAASSPQSSGDNNNVYTLE  280

Query  639   ICMTGLSREKAAMFFKRPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             +CMTGL REKA++F+K  G  G MT  S I  ++P   ICDFEF+PCGYSMN ++G A S
Sbjct  281   MCMTGLDREKASVFYKN-GETGTMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEGDAIS  339

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDKI  992
             T+HVTPE+GFSYAS+EA+G +L+ + L  LV RVL+CFEP + SVAV +  GV A + +I
Sbjct  340   TIHVTPEDGFSYASFEAVGYDLNTMDLSQLVTRVLSCFEPKQLSVAVHSSVGVNAYKPEI  399

Query  993   WRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
                 + D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  400   ----SVDLEDYGCRERTFESLGEESGMVMYQTFEKLGKYCGSPRSTLKCEW  446



>gb|ABK95104.1| unknown [Populus trichocarpa]
Length=361

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 229/347 (66%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEI F  P  F DP G GLR L++ QLD IL+PA CTIV  L   E DS
Sbjct  6     SAIGFEGFEKRLEICFLEPGFFSDPEGKGLRSLSKAQLDEILKPAECTIVDSLSNDEVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LLLS+PVIL+LAD LSL V SV+Y+RG+F+   +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILELADALSLTVCSVRYTRGSFICPGAQP  125

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PHR+F EEV  L+  F       VA+V+G P S  + WHVY A  G  + + P  T+E+
Sbjct  126   FPHRNFCEEVTVLDGHFSKFGLESVAYVMGSPNST-QKWHVYSAAAGMKSHSGPVYTLEM  184

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R++A++F+K        MT+ S I  ++P   ICDF+FDPCGYSMN ++G+A S
Sbjct  185   CMTGLDRKRASVFYKTHASSATVMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEGSAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +   + L  L+ RVL CFEP EFS+A+    V   D++  
Sbjct  245   TIHVTPEDGFSYASFEAVGYDFQDLNLRQLLYRVLVCFEPTEFSIALHS-NVEC-DELGA  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
               + DV  Y+C     + L   G I Y  F      S P ++   CW
Sbjct  303   MFSLDVKGYSCGGGNYEMLGKGGSIVYHSFAATGGCSSPRSILKCCW  349



>gb|KEH17677.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=406

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/348 (50%), Positives = 232/348 (67%), Gaps = 12/348 (3%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLEI+F    +F DP G+G R L++DQ+D IL+PA CTIV  L     D
Sbjct  51    NSAIGFEGYEKRLEITFFENGVFSDPAGLGFRALSKDQIDEILKPAECTIVDSLSNDYVD  110

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+FIY  K+++KTCGTT+LLLS+P ILKLAD L++ V SV+Y+RG+F+F  +Q
Sbjct  111   SYVLSESSLFIYAYKLIIKTCGTTKLLLSIPAILKLADGLNIAVKSVRYTRGSFIFPGAQ  170

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVE  638
               PHRSFSEEV  L+S F        A+++GD +   + WH+Y A      +P     +E
Sbjct  171   SFPHRSFSEEVVVLDSYFGKLGSGSQAYMMGDADK-SQIWHIYSASAKLEASPEAVYGLE  229

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL +EKA++FFK      G MTK S I  ++P   ICDFEF+PCGYSMNG++G+A 
Sbjct  230   MCMTGLDKEKASVFFKSDASSAGLMTKNSGIRKILPKSDICDFEFEPCGYSMNGIEGSAI  289

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+EA+G +     L  LV+RVL CF PAEFSVA+    +    +  
Sbjct  290   STIHVTPEDGFSYASFEAVGYDYEEKSLNELVRRVLACFYPAEFSVALH---IDTNGEKL  346

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CW  1133
                  +V  Y C  R+++ L  DG + YR F  N   + P S L+ CW
Sbjct  347   DKFPLEVKGYNCGERISEVLGEDGAVVYRTFVRNDGCTSPRSTLKCCW  394



>gb|AEI98604.1| S-adenosylmethionine decarboxylase [Gossypium hirsutum]
Length=355

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 229/348 (66%), Gaps = 11/348 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P +F DP G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEISFFEPGIFADPEGKGLRALTKAQLDEILGPAECTIVSSLSNKQVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLL++P ILKLA  LSL V SV+Y+RG+F+F  +QP
Sbjct  64    YVLSESSLFVYPYKIIIKTCGTTKLLLAIPPILKLAGSLSLAVKSVRYTRGSFIFPGAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR+FSEEVA L++ F      G A V+G  +   + WHVY A      A  P  T+E+
Sbjct  124   FPHRNFSEEVAVLDNYFGKLGAGGKACVMGGLDK--QKWHVYSASAEPVTATGPVYTLEM  181

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             C+TGL R+KA++F+K   G    MT  S I  ++P   ICDFEF PCGYSMN ++GAA S
Sbjct  182   CLTGLDRDKASVFYKDQSGSAAVMTINSGIRKILPESEICDFEFGPCGYSMNAIEGAAIS  241

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G  L    L+ LV RVL CF+P +FSVAV    V     + +
Sbjct  242   TIHVTPEDGFSYASFEAVGYNLKDKNLKQLVGRVLKCFKPGDFSVAV-HVDVGGDQSLEQ  300

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CWK  1136
                 DV  Y C     + L   G + Y+ F++      P S L+ CWK
Sbjct  301   SCLLDVKGYRCGEMGIEGLGNGGSMMYQKFSSTGGCGSPRSTLKCCWK  348



>ref|XP_006338297.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum tuberosum]
Length=362

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/355 (50%), Positives = 237/355 (67%), Gaps = 14/355 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI F        P G GLR L++DQLD IL PA CTIVS L   E DS
Sbjct  6     SAIGFEGYEKRLEICFFELGNSYGP-GCGLRSLSKDQLDEILTPAACTIVSSLANDEVDS  64

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKLAD L+L V SV+Y+RG F+F  +QP
Sbjct  65    YVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLADALNLKVKSVRYTRGCFIFPGAQP  124

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGAP---APETTV  635
              PHR FSEEVA L++ F K G    A+V+G+ +   +NWHVY A   S       P  T+
Sbjct  125   YPHRHFSEEVAVLDTYFGKLGAGSNAYVMGNADKQ-QNWHVYSASAESADANNMNPVYTL  183

Query  636   EICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMT L ++KA++FFK +     EMT++S I  ++P   ICDF+FDPCGYSMN ++G A
Sbjct  184   EMCMTNLDKKKASVFFKTQSSTAAEMTEVSGIRKILPESNICDFDFDPCGYSMNAVEGPA  243

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKI  992
              ST+H+TPE+GFSYAS+EA+G +   V L A+++RVL+CF PAEFSVA+    +P ++ +
Sbjct  244   ISTIHITPEDGFSYASFEAVGYDFRAVDLSAMIERVLSCFRPAEFSVAL-HCDIPGKE-L  301

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSAL--QCWKETEEE  1151
             +     DV  Y    + T+ L   G + Y  F++      P ++   CW E E+E
Sbjct  302   YTESGLDVIGYVSGEKTTEVLGKGGSLTYLTFSSGGSCGSPRSILSNCWSENEDE  356



>ref|XP_004491770.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Cicer arietinum]
 ref|XP_004491771.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Cicer arietinum]
Length=360

 Score =   327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 175/348 (50%), Positives = 229/348 (66%), Gaps = 12/348 (3%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             SS IGFEG+EKRLE+SF    +F DP G+GLR L++DQLD IL+PA CTIV  L     D
Sbjct  5     SSPIGFEGYEKRLEVSFFENGVFSDPAGLGLRALSKDQLDEILKPAECTIVDSLSNGYVD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+Y  K+++KTCGTT+LLLS+P ILKLAD L++ V SV+Y+RG+F+F  +Q
Sbjct  65    SYVLSESSLFVYAYKVIIKTCGTTKLLLSIPAILKLADGLNIAVKSVRYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPETT-VE  638
               PHRSFSEEVA L+  F        A+++GD ++  + WH+Y A     A +     +E
Sbjct  125   SFPHRSFSEEVAVLDGYFGKLGSGSQAYMMGDAKNS-QIWHIYSASAKPEASSEAVYGLE  183

Query  639   ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL +EKA++FFK        MTK S I  ++P   ICDFEFDPCGYSMNG++G A 
Sbjct  184   MCMTGLDKEKASVFFKTDTSSASLMTKNSGIRKILPKSNICDFEFDPCGYSMNGIEGNAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+EA+G +   + L  +V RVL CF PAEFSVA+    +    +  
Sbjct  244   STIHVTPEDGFSYASFEAVGYDFEKMSLNEIVGRVLACFYPAEFSVALH---IDMNGEKL  300

Query  996   RGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CW  1133
                  D+  Y C  R+ + L   G + YR F  N   S P S L+ CW
Sbjct  301   DKFPLDIKGYCCGERINEVLGIGGAVVYRTFVRNDGCSSPRSTLKCCW  348



>ref|XP_002305295.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 gb|EEE85806.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
Length=361

 Score =   327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 228/347 (66%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI F  P  F DP G GLR L++ QLD IL+PA CTIV  L   E DS
Sbjct  6     SAIGFEGYEKRLEICFLEPGFFSDPEGKGLRSLSKAQLDEILKPAECTIVDSLSNDEVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LLLS+PVIL+LAD LSL V SV+Y+RG+F+   +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILELADALSLTVCSVRYTRGSFICPGAQP  125

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PHR+F EEV  L+  F       VA+V+G P S  + WHVY A  G  + + P  T+E+
Sbjct  126   FPHRNFCEEVTVLDGHFSKFGLESVAYVMGSPNST-QKWHVYSAAAGMKSHSGPVYTLEM  184

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R++A++F+K        MT+ S I  ++P   ICDF+FDPCGYSMN ++G+A S
Sbjct  185   CMTGLDRKRASVFYKTHASSATVMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEGSAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +   + L  L+ RVL CFEP EFS+A+        D++  
Sbjct  245   TIHVTPEDGFSYASFEAVGYDFQDLNLRQLLYRVLVCFEPTEFSIAL--HSNVECDELGA  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
               + DV  Y+C     + L   G I Y  F      S P ++   CW
Sbjct  303   MFSLDVKGYSCGGGNYEMLGKGGSIVYHSFAATGGCSSPRSILKCCW  349



>ref|XP_009625495.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Nicotiana 
tomentosiformis]
Length=402

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 178/349 (51%), Positives = 229/349 (66%), Gaps = 11/349 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR L++ QLD IL PA CTIV  L   + DS
Sbjct  56    SAIGFEGFEKRLEISFFEPGLFADPNGNGLRSLSKAQLDEILGPAECTIVDSLSNDDVDS  115

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P ILKLA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  116   YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAESLSLKVQDVRYTRGSFIFPGAQS  175

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G P+   + WHVY A  G   +  P  T+E+
Sbjct  176   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDK-AQKWHVYSASAGPIQSNDPVYTLEM  234

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K  G     MT  S I  ++P+  ICDFEF+PCGYSMN ++GAA S
Sbjct  235   CMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEGAALS  294

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+EA+G ++  + L  LV+RVL CFEP EFS+A+      A   + R
Sbjct  295   TIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFEPDEFSIAL--HADVATKLLQR  352

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSAL--QCWKE  1139
               + DV  Y+      +E    G I Y+ FT       P ++   CWKE
Sbjct  353   VCSVDVKGYSLAECSPEEFGKGGSIVYQKFTRTPFCGSPKSVLKGCWKE  401



>gb|KHG07410.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
Length=355

 Score =   326 bits (836),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 185/352 (53%), Positives = 235/352 (67%), Gaps = 19/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P +F DP G GLR LTR QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEISFFEPGIFADPEGKGLRALTRAQLDQILGPAECTIVSSLSNKQVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLL++P ILKLA  LSL V SV+Y+RG+F+F  +QP
Sbjct  64    YVLSESSLFVYPYKIIIKTCGTTKLLLAIPPILKLAGSLSLAVKSVRYTRGSFIFPGAQP  123

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGAP----APETT  632
              PHR+FSEEVA L++ F K G    A V+G  +   + WHVY A   S  P     P  T
Sbjct  124   FPHRNFSEEVAVLDNYFGKLGAGSKACVMGGLDK--QKWHVYSA---SAEPVTTTGPVYT  178

Query  633   VEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             +E+C+TGL R+KA++F+K   G    MT  S I  ++P   ICDFEF+PCGYSMN ++GA
Sbjct  179   LEMCLTGLDRDKASVFYKDQSGSAAVMTINSGIRKILPESGICDFEFEPCGYSMNAIEGA  238

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARD  986
             A ST+HVTPE+GFSYAS+EA+G +L    L+ LV RVL CF+P++FSVAV   FG     
Sbjct  239   AISTIHVTPEDGFSYASFEAVGYDLKEKNLKQLVGRVLQCFKPSDFSVAVHVDFG--GDQ  296

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CWK  1136
              + +    DV  Y C     + L   G + Y+ F++      P S L+ CWK
Sbjct  297   SLEQSCLLDVKGYCCGEMGIEGLGSGGSMMYQKFSSTGGCGSPRSTLKCCWK  348



>gb|AGT80621.1| S-adenosylmethionine decarboxylase [Camellia sinensis]
Length=359

 Score =   325 bits (834),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 233/355 (66%), Gaps = 14/355 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             S IGFEG+EKRLEISF    +F DPR  GLR L++ QLD IL PA CTIVS L   + DS
Sbjct  6     SPIGFEGYEKRLEISFFESSIFADPRSNGLRSLSKSQLDEILNPAECTIVSSLANDDVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILK A++LSL V SV+Y+RG+F+F  +QP
Sbjct  66    YVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKFAEMLSLSVRSVRYTRGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLG-DPESPGRNWHVYVAEVGS-GAPAPETTVE  638
              PHR FSEEVA L+  F        A+V+G D ES  R WH+Y A   S     P  T+E
Sbjct  126   FPHRDFSEEVAVLDGYFGKLGSGSKAYVMGSDDES--RKWHIYSASAESTNHLRPVYTLE  183

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL R+K ++F+K        MT +S I  ++P   ICDFEFDPCGYSMN ++G+A 
Sbjct  184   MCMTGLDRKKVSVFYKTSASSAAAMTDLSGIRMILPDSDICDFEFDPCGYSMNAIEGSAI  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIW  995
             ST+HVTPE+GFSYAS+EA+G +   + L  L++RVL CF+P+EFS+A+    V   +K+ 
Sbjct  244   STIHVTPEDGFSYASFEAVGYDFKSMNLTHLLERVLACFQPSEFSIALHSDAVA--NKLS  301

Query  996   RGGNADVDRYACRFRVTQELPGD-GRIDYRCFTTNKVASRPSALQ--CWKETEEE  1151
                + DV  Y C  R  + L  + G + Y  F        P ++   CW E++E+
Sbjct  302   SDMSLDVQGYYCGERSFEVLGKEGGSVVYHNFMKAGGCGSPRSILHCCWSESDED  356



>dbj|BAB83763.1| S-adenosylmethionine decarboxylase [Phaseolus lunatus]
Length=354

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 229/355 (65%), Gaps = 15/355 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI F+ P +F DP G GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEICFSQPGIFADPEGRGLRVLTKSQLDEILTPAACTIVSSLSNEDVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILK AD+LSL V SV Y+RG+F+F  +QP
Sbjct  64    YVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKFADMLSLTVRSVTYTRGSFIFPGAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS--GAPAPETTVE  638
              PH SF+EEVA LN  F       +A+++G P+   + WH+Y A       +     T+E
Sbjct  124   HPHCSFTEEVAILNDYFGKLGSGSMAYIMGSPDKK-QKWHIYSASADPLISSDTNVCTLE  182

Query  639   ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKA +F+K        MT  S I  ++P   ICDF+F+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKAQIFYKEQSASAAIMTVNSGIRKILPKSDICDFDFEPCGYSMNSVEGDAV  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGV--PARDK  989
             ST+H+TPE+GFSYAS+E +G +  ++ L A+V RVL+CF P EFSVAV   G   P+   
Sbjct  243   STIHITPEDGFSYASFETVGYDFKVLNLNAMVDRVLSCFLPNEFSVAVRVDGASKPSEHM  302

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRPSALQCWKETEEE  1151
              +     DV  Y       +EL   G + Y+ F   +   S  S L+CWK+  EE
Sbjct  303   CF----VDVKGYCREEWCHEELGMGGFVVYQKFVKISDCVSPRSTLKCWKDEVEE  353



>gb|AAB17665.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=366

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/352 (51%), Positives = 233/352 (66%), Gaps = 18/352 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE++F  P +F+D +G+GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS F+YP K+++KTCGTT+LLLS+P +LKLA  LSL V SVKY+RG+F+    QP
Sbjct  64    YVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET--TVE  638
              PHRSFSEEV+ L+  F     N VA ++G+ +   + WHVY A     +       T+E
Sbjct  124   FPHRSFSEEVSVLDGHFTQLGLNSVATLMGNDDET-KKWHVYAASAQDSSNCNNNVYTLE  182

Query  639   ICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKAA+F+K      G MT  S I   +P   ICDFEF+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKAAVFYKDEADKTGSMTDNSGIRKNLPKSEICDFEFEPCGYSMNSIEGDAI  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPA-RDK  989
             ST HVTPE+GFSYAS+EA+G + + + L  LV RVL+CFEP +FSVAV +  G  + + +
Sbjct  243   STNHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANSYKPE  302

Query  990   IWRGGNADVDRYACRFRVTQELPGD-GRIDYRCFTT-NKVASRP-SALQC-W  1133
             I      D++ Y CR R  + L  + G + Y+ F    K    P S L+C W
Sbjct  303   I----TVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEW  350



>ref|XP_008461582.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Cucumis melo]
Length=418

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 238/362 (66%), Gaps = 18/362 (5%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLE+SF  P +F DPRG+GLR L++ QLD IL  A CTIV  L     D
Sbjct  59    TSAIGFEGYEKRLEVSFFEPSVFVDPRGLGLRALSKAQLDEILTLAECTIVDSLSNDYLD  118

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             SYVLSESS+F+YP K V+KTCGTT+LLLS+P +LKLAD LSL V SV+Y+RG+F+F  +Q
Sbjct  119   SYVLSESSLFVYPYKFVIKTCGTTKLLLSIPALLKLADSLSLTVKSVRYTRGSFIFPGAQ  178

Query  474   PAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVY--VAEVGSGAPAPETTV  635
               PHRSFSEEVA L+        +G A+V+G P+   R WHVY   A +G+ +  P  T+
Sbjct  179   SFPHRSFSEEVAVLDGYLVKLGLHGSAYVMGSPDET-RKWHVYSACANMGNQSNNPVYTL  237

Query  636   EICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMTGL +EKA++FF+        MT+ S I  ++P   ICDFEFDPCGYSMN ++G A
Sbjct  238   EMCMTGLDKEKASVFFRTDASSAAAMTENSGIRKILPKSEICDFEFDPCGYSMNAIEGDA  297

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTR--FGVPARD  986
              ST+HVTPE+GFSYAS+EA G +   + L  L+ RVL CF+P++FSVA+     G    D
Sbjct  298   ESTIHVTPEDGFSYASFEAAGYDFDDMNLSKLIVRVLACFQPSDFSVALHSDVVGENLED  357

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRP--SALQCWKETEEEV  1154
              +      ++  Y    +  + L  +G + Y+ F  T    AS P  + L+CW E E++ 
Sbjct  358   LLC----LELKGYEGGEKSCEMLGENGTVIYQSFMKTGGDYASSPRSTLLKCWSEDEKDE  413

Query  1155  AV  1160
              V
Sbjct  414   EV  415



>gb|KEH20218.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=370

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 184/354 (52%), Positives = 233/354 (66%), Gaps = 11/354 (3%)
 Frame = +3

Query  99    MAEALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELF  278
             MA A+SS IGFEGFEKRLEISF  P +F DP G  LR LT+ QLD IL PA C IVS L 
Sbjct  1     MALAVSS-IGFEGFEKRLEISFFEPGVFLDPEGKDLRSLTKSQLDEILAPAECIIVSSLS  59

Query  279   GAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFV  458
               + DSYVLSESS+F+YP KI++KTCGTT+LLLS+P ILKL++ L L V SV+Y+RG+F 
Sbjct  60    NDKVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLSEALGLTVRSVRYTRGSFT  119

Query  459   FQNSQPAPHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPE  626
             F ++Q  PHRSFSEEVA L+S F       VA+VLG  +S  + WHVY A   S +    
Sbjct  120   FPSAQSFPHRSFSEEVAVLDSYFAKLGTGSVAYVLGGSDST-QKWHVYSAAAKSVSLFDS  178

Query  627   T-TVEICMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL +EKA++F+K        MT  S I +++P   I DF+FDPCGYSMN +
Sbjct  179   VYTLEMCMTGLDKEKASVFYKEQSSSAFLMTANSGIRNILPDSEISDFDFDPCGYSMNSV  238

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +GAA ST+HVTPE+GFSYAS+E     L L+ L  LV+RVL CF+P EF +AV    V A
Sbjct  239   EGAAVSTIHVTPEDGFSYASFETCEYNLELMNLNQLVERVLTCFQPNEFMIAV-HVDV-A  296

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRPSALQCWKE  1139
              +   +    +V  Y    +  QEL   G + ++ F  T+   S  S LQCWKE
Sbjct  297   SNSFEQNCLLNVKGYCREEKCYQELGRGGCVAFQKFIKTSDCGSSFSTLQCWKE  350



>sp|Q96555.1|DCAM_DATST RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Datura stramonium]
 emb|CAA69076.1| S-adenosylmethionine decarboxylase [Datura stramonium]
Length=362

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 228/347 (66%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR L++ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFSDPNGKGLRSLSKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G   +  P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-QKWHVYSASAGPVQSNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K  G     MT  S I  ++P+  ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +L  + L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDLKTMELGPLVERVLACFEPAEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
                 DV  Y+      +E    G I Y+ FT     + P ++   CW
Sbjct  305   VCCVDVKGYSLAEWSPEEFGKGGSIVYQKFTKTPYCASPKSVLKGCW  351



>ref|XP_010528023.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Tarenaya 
hassleriana]
Length=367

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 224/353 (63%), Gaps = 13/353 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P +F DP G GLR L++ QLD  L PA CTIVS L  A  DS
Sbjct  4     SAIGFEGFEKRLEISFHEPSVFLDPEGKGLRALSKSQLDEFLGPAECTIVSSLSNAYVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P IL+LAD LSL V S +Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILRLADSLSLAVRSARYTRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA--PETTVE  638
              PHRSFSEEV+ L+  F        AFV+G  ES  + WHVY A     +    P  T+E
Sbjct  124   YPHRSFSEEVSVLDGYFGKLGSGSKAFVMGGTESNPQRWHVYSATSADASVCCEPVYTLE  183

Query  639   ICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             ICMTGL REKA++F+K   G   EMT  S I   +P   ICDFEFDPCGYSMN ++G A 
Sbjct  184   ICMTGLDREKASVFYKCHSGSAAEMTIGSGIRKFLPGSEICDFEFDPCGYSMNSVEGDAV  243

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV-TRFGVPARDK-  989
             ST+HVTPE+G SYAS+E +G +L  + L  LV +VL CF+P  FS+AV    G     + 
Sbjct  244   STIHVTPEDGLSYASFETVGYDLKNLNLNELVNKVLICFKPGGFSIAVHADLGAELLKQD  303

Query  990   --IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWK  1136
                    + DV  Y  + R  +EL   G + Y+ F  +     P +    CWK
Sbjct  304   CDFEFDPSVDVKGYCSKERCLEELELGGSVVYQKFVKSGECDTPKSTLACCWK  356



>sp|O04009.1|DCAM_TOBAC RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Nicotiana tabacum]
 gb|AAB51301.1| S-adenosylmethionine decarboxylase [Nicotiana tabacum]
Length=361

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 227/347 (65%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR L++ QLD IL PA CTIV  L   + DS
Sbjct  8     SAIGFEGFEKRLEISFFEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDSLSNDDVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P ILKLA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G P+   + WHVY A  G   +  P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDK-AQKWHVYSASAGPIQSNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K  G     MT  S I  ++P+  ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEGAALS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+EA+G ++  + L  LV+RVL CFEP EFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFEPDEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
               + DV  Y+      +E    G I Y+ FT       P ++   CW
Sbjct  305   VCSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPFCGSPKSVLKGCW  351



>ref|XP_011008131.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
 ref|XP_011008132.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
Length=361

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 228/347 (66%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI F  P  F DP G GLR L++ QLD IL+PA CTIV  L   E DS
Sbjct  6     SAIGFEGYEKRLEICFFEPGFFSDPEGKGLRSLSKAQLDEILKPAECTIVDSLSNDEVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LLLS+PVILKLAD LSL V SV+Y+RG+F+   +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILKLADALSLTVCSVRYTRGSFICPGAQP  125

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PHR+F EEV  L+  F       VA+V+G P S  + WHVY A  G  + + P  T+E+
Sbjct  126   FPHRNFCEEVTVLDGHFSKFGLESVAYVMGSPNST-QKWHVYSAAAGMKSHSGPVYTLEM  184

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R++A++F+K        MT+ S I  ++P   ICDF+FDPCGYSMN ++G+A S
Sbjct  185   CMTGLDRKRASVFYKTHASSATVMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEGSAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPEEGFSYAS+EA+G +   + L  L+ RVL CFEP EFS+A+    V   D++  
Sbjct  245   TIHVTPEEGFSYASFEAVGYDFQDLNLRQLLYRVLVCFEPTEFSIALHS-NVEC-DELGA  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
               + DV  Y+      + L   G I Y  F      S P ++   CW
Sbjct  303   MFSLDVKGYSSGGGNYEMLGKGGSIVYHSFAATGGCSSPRSILKCCW  349



>sp|O80402.1|DCAM_NICSY RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Nicotiana sylvestris]
 dbj|BAA29040.1| S-adenosylmethionine decarboxylase [Nicotiana sylvestris]
Length=361

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 227/347 (65%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR L++ QLD IL PA CTIV  L   + DS
Sbjct  8     SAIGFEGFEKRLEISFFEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDSLSNDDVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P ILKLA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G P+   + WHVY A  G   +  P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDK-AQKWHVYSASAGPIQSNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K  G     MT  S I  ++P+  ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEGAALS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+EA+G ++  + L  LV+RVL CFEP EFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFEPDEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
               + DV  Y+      +E    G I Y+ FT       P ++   CW
Sbjct  305   VCSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPFCGSPKSVLKGCW  351



>ref|NP_001275865.1| S-adenosylmethionine decarboxylase [Citrus sinensis]
 gb|ACQ91107.1| S-adenosylmethionine decarboxylase [Citrus sinensis]
Length=364

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 185/351 (53%), Positives = 234/351 (67%), Gaps = 17/351 (5%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P +F DP G GLR LT+ QLD IL PA CTIVS L   E DS
Sbjct  11    SAIGFEGYEKRLEISFFEPSIFVDPEGKGLRRLTKAQLDEILGPAECTIVSSLSNDEVDS  70

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKLA+ LSL V SV+Y+RG+F+F  +Q 
Sbjct  71    YVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLAETLSLNVRSVRYTRGSFIFPGNQL  130

Query  477   APHRSFSEEVAFLNSQFKNGV----AFVLGDPESPGRNWHVYVAEVGSGAPA----PETT  632
              PHR+FSEEVA L+S F   V    A+++G    P + WHVY A   S  P     P  T
Sbjct  131   YPHRNFSEEVAVLDSYFGKLVSGSNAYIIGGSGKP-QKWHVYSA---SAEPLISSDPVFT  186

Query  633   VEICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             +E+C+TGL RE A++F+K + G  G MT  S I  ++P   ICDFEFDPCGYSMN ++GA
Sbjct  187   IEMCLTGLDREMASVFYKTQSGSAGAMTVNSGIRKILPGSKICDFEFDPCGYSMNSVEGA  246

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A ST+HVTPE+GFSYAS+E +G + + V L  LV+RVL CF+P +FS+AV      A   
Sbjct  247   AISTIHVTPEDGFSYASFETVGYDPNDVNLNQLVERVLACFQPRDFSIAV--HAEVAGKM  304

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CWK  1136
             I +    +V  Y+   R  +EL   G I Y+ F   +    P S L+ CWK
Sbjct  305   IEQECLLNVKGYSREERGLEELGMGGSIWYQKFVKTEGNGSPRSTLKCCWK  355



>gb|KDP31452.1| hypothetical protein JCGZ_11828 [Jatropha curcas]
Length=358

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 236/356 (66%), Gaps = 15/356 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F  P +F DP G GLR L++ QLD  L PA CTIV  L     DS
Sbjct  4     SAIGFEGYEKRLEITFFEPGIFVDPEGKGLRALSKAQLDEFLGPAECTIVDSLKNDHVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIYP K+++KTCGTT+LLL++P ILKL++ LSL V SV+Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFIYPYKLIIKTCGTTKLLLAIPPILKLSNALSLKVKSVRYTRGSFIFPGAQS  123

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLG--DPESPGRNWHVYVAEVGSGAPAPET-TV  635
              PHRSF+EEVA L+  F       +A+V+G  D +SP + WHVY A   S        TV
Sbjct  124   YPHRSFTEEVAVLDDYFGKLGGGSMAYVMGGSDSDSP-QKWHVYSAYADSAISRDLVYTV  182

Query  636   EICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMTGL R+KAA+FFK R      MT  S I  ++P   ICDF+FDPCGYSMN ++G+A
Sbjct  183   EMCMTGLDRQKAAVFFKTRSASAAVMTVDSGIRKILPDSKICDFDFDPCGYSMNSIEGSA  242

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKI  992
              ST+H+TPE+GFSYAS+E +G     V L  LV RVL+CF+P++FS+AV      A  ++
Sbjct  243   ISTIHITPEDGFSYASFETVGYHPEEVNLNQLVDRVLSCFQPSQFSIAV--HADVAGKQL  300

Query  993   WRGGNADVDRYACRFRVT-QELPGDGRIDYRCF--TTNKVASRPSALQCWKETEEE  1151
              R  + DV  Y CR   + +E    G + Y+ F  T +  + R +   CWKE E+E
Sbjct  301   MRTCSLDVKGY-CRGESSFEEFGKGGSLVYQKFIRTGDSGSPRSTLKCCWKEEEDE  355



>gb|AIS20829.1| SAMDC3 [Pyrus x bretschneideri]
Length=358

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 231/354 (65%), Gaps = 12/354 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F  P +F DP G GLR L++ Q+D  L+ A CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEIAFFEPSVFLDPEGRGLRSLSKAQIDEFLDQAECTIVSSLSNDDVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FI+P K+++KTCGTT+LL  +P +L+LA+ +SL V SVKY+RG+F+F  +Q 
Sbjct  66    YVLSESSLFIHPYKMIIKTCGTTKLLRVIPTVLQLAETISLAVRSVKYTRGSFIFPGAQT  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGA-PAPETTVEI  641
              PHRSFSEEV+ L+S F        A+V+G  + P + WHVY A   S +   P  T+E+
Sbjct  126   YPHRSFSEEVSVLDSYFGKLGSGSRAYVMGRSDGP-QKWHVYSATAESASFVEPVYTLEM  184

Query  642   CMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R KA++F+K        MT  S I  ++P   ICDFEFDPCGYSMN ++GAA S
Sbjct  185   CMTGLDRGKASVFYKSESSSATTMTNESGIRKILPDSDICDFEFDPCGYSMNSIEGAAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+E  G +L  V L  LV+RVL CF+P EFS+AV      A   + +
Sbjct  245   TIHVTPEDGFSYASFETAGYDLKSVNLNELVERVLVCFQPKEFSIAV--HANVASKSLQQ  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQ-CWKETEEE  1151
                 D+  Y       +EL   G I Y+ F  T  +  S  S L+ CW+E EEE
Sbjct  303   HSLVDLKGYCREESSHEELGLGGAIVYQRFLKTAERCGSPRSTLKGCWREEEEE  356



>ref|XP_009356498.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Pyrus 
x bretschneideri]
Length=357

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 231/353 (65%), Gaps = 11/353 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI+F  P +F DP G GLR L++ Q+D  L+ A CTIVS L   + DS
Sbjct  6     SAIGFEGYEKRLEIAFFEPSVFLDPEGRGLRSLSKAQIDEFLDQAECTIVSSLSNDDVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FI+P K+++KTCGTT+LL  +P +L+LA+ +SL V SVKY+RG+F+F  +Q 
Sbjct  66    YVLSESSLFIHPYKMIIKTCGTTKLLRVIPTVLQLAETISLAVRSVKYTRGSFIFPGAQT  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGA-PAPETTVEI  641
              PHRSFSEEV+ L+S F        A+V+G  + P + WHVY A   S +   P  T+E+
Sbjct  126   YPHRSFSEEVSVLDSYFGKLGSGSRAYVMGRSDGP-QKWHVYSATAESASFVEPVYTLEM  184

Query  642   CMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R KA++F+K        MT  S I  ++P   ICDFEFDPCGYSMN ++GAA S
Sbjct  185   CMTGLDRGKASVFYKSESSSATTMTNESGIRKILPDSDICDFEFDPCGYSMNSIEGAAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+E  G +L  V L  LV+RVL CF+P EFS+AV      A   + +
Sbjct  245   TIHVTPEDGFSYASFETAGYDLKGVNLNELVERVLVCFQPKEFSIAV--HANVASKSLQQ  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCF-TTNKVASRPSALQ-CWKETEEE  1151
                 D+  Y       +EL   G I Y+ F  T +  S  S L+ CW+E EEE
Sbjct  303   HSLVDLKGYCREESSHEELGLGGAIVYQRFLKTERCGSPRSTLKGCWREEEEE  355



>ref|XP_009801145.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana sylvestris]
Length=416

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 228/347 (66%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P LF DP G GLR L++ QLD IL PA CTIV  L     DS
Sbjct  62    SAIGFEGYEKRLEISFFEPGLFADPEGKGLRSLSKAQLDEILGPAECTIVDSLSNECVDS  121

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FIY  KI++KTCGTT+LLLS+P ILKLAD LSL V +VKY+RG+F+F  +Q 
Sbjct  122   YVLSESSLFIYSYKIIIKTCGTTKLLLSIPAILKLADTLSLEVQAVKYTRGSFIFPGAQS  181

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVEI  641
              PHR FSEEVA L+S F        A +LG P+   + WHVY A  G + +  P  T+E+
Sbjct  182   FPHRHFSEEVAVLDSYFGKLTSGSKAVILGSPDKL-QKWHVYSASAGPTQSMNPVYTLEM  240

Query  642   CMTGLSREKAAMFFKRPGG-DGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMT L REKA++F+K       +MT  S I  ++P+  ICDFEFDPCGYSMN ++GAA S
Sbjct  241   CMTSLDREKASIFYKTESSLAAQMTIRSGIRKILPNSDICDFEFDPCGYSMNSIEGAALS  300

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G +   + L ALVKRVL CF+P EFS+A+        + +  
Sbjct  301   TIHVTPEDGFSYASFEAVGYDFKFLSLGALVKRVLACFQPDEFSIAL--HADVDLELLEN  358

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SALQ-CW  1133
               + DV  Y+      +EL     I Y+ F  +     P S LQ CW
Sbjct  359   TCSLDVKGYSLAEWSPEELGKGDSIVYQKFARSSFCGSPKSVLQDCW  405



>ref|XP_006395646.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
 ref|XP_006395647.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
 gb|ESQ32932.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
 gb|ESQ32933.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
Length=362

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/354 (52%), Positives = 229/354 (65%), Gaps = 20/354 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P +F DP G GLR LT+ QLD IL PA C+IVS L  +  DS
Sbjct  4     SAIGFEGFEKRLEISFFKPSVFLDPEGKGLRALTKAQLDEILTPAACSIVSSLSNSFVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P IL LAD LSL V SV+Y+RG+F+F  +Q 
Sbjct  64    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPHILNLADSLSLTVKSVRYTRGSFIFSVAQS  123

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVY-----VAEVGSGAPAPET  629
              PHR FSEEVA L+  F N      A V+G   +  + WHVY       E  +    P  
Sbjct  124   YPHRCFSEEVALLDGYFGNLKSGSKALVMGGSANNPQRWHVYSASSSSDEAAAACDKPVY  183

Query  630   TVEICMTGLSREKAAMFFKRP-GGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             T+E+CMTGL + KA++FFK P     EMT  S I +++PS  ICDFEFDPCGYSMN ++ 
Sbjct  184   TLEMCMTGLDKRKASVFFKTPLVSASEMTLSSGIRNILPSSEICDFEFDPCGYSMNSIEE  243

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTR---FGVP  977
              A ST+HV PE+GFSYAS+E +G +L  +  + LV RVL CF P EFSVAV      G+ 
Sbjct  244   DAVSTIHVIPEDGFSYASFETVGYDLKALNFKELVNRVLVCFGPGEFSVAVHADHGTGLL  303

Query  978   ARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRPSALQ-CW  1133
             ARD +      DV  Y  + R  +EL   G + Y+ F  T +  S  S L+ CW
Sbjct  304   ARDCV-----VDVKGYLIKERGLEELELGGSVLYQKFVKTVECGSPKSTLRFCW  352



>ref|XP_010091687.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
 gb|EXB44953.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
Length=360

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 235/360 (65%), Gaps = 12/360 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE++F  P +F DP+G GLR L++ QLD IL+PA CTIV+ L     DS
Sbjct  4     SAIGFEGYEKRLELTFYEPSIFLDPQGKGLRSLSKAQLDEILQPAECTIVATLSNEHVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LL S+P ILKL + LSL V SV+YSRG+F+F  +QP
Sbjct  64    YVLSESSLFVYPYKIIIKTCGTTKLLRSIPPILKLTETLSLAVKSVRYSRGSFIFPGAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PH SF EEVA L+S F        A+V+G+ + P + WHVY A   + +   P  T+E+
Sbjct  124   FPHHSFVEEVAVLDSYFGKLGSGSRAYVMGNSQEP-QKWHVYSASADTASSVDPVYTLEM  182

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL +EKA++F+K        MT  S I  ++P   ICDF+FDPCGYSMN ++GAA S
Sbjct  183   CMTGLDKEKASVFYKAQSSSAALMTINSGIRKILPDSEICDFDFDPCGYSMNAIEGAAVS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E +G +L  V  E L+ RVL CF+P EFS+AV      A   +  
Sbjct  243   TIHITPEDGFSYASFETVGYDLKDVKFEQLIVRVLACFQPREFSIAV--HADVACGSLEE  300

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQ-CWKETEEEVAVVGG  1169
               + +V  Y+C     +EL   G I    F  T +   S  S L  CWKE +EE    GG
Sbjct  301   NCSPNVKGYSCGESSYKELGMSGSIVCHKFVRTNDSYGSPRSTLSCCWKEEKEEEDYYGG  360



>ref|XP_006437789.1| hypothetical protein CICLE_v10033607mg, partial [Citrus clementina]
 gb|ESR51029.1| hypothetical protein CICLE_v10033607mg, partial [Citrus clementina]
Length=476

 Score =   328 bits (840),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 189/366 (52%), Positives = 240/366 (66%), Gaps = 21/366 (6%)
 Frame = +3

Query  84    TICAAMAEALS----SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPA  251
              I AAM  A +    SAIGFEG+EKRLEISF  P +F DP G GLR LT+ QLD IL PA
Sbjct  108   NISAAMVSADTTMAVSAIGFEGYEKRLEISFFEPSIFVDPEGKGLRRLTKAQLDEILGPA  167

Query  252   FCTIVSELFGAEFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDS  431
              CTIVS L   E DSYVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKL + LSL V S
Sbjct  168   ECTIVSSLSNDEVDSYVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLVETLSLNVRS  227

Query  432   VKYSRGTFVFQNSQPAPHRSFSEEVAFLNSQFKNGV----AFVLGDPESPGRNWHVYVAE  599
             V+Y+RG+F+F  +Q  PHR+FSEEVA L+S F   V    A+++G    P + WHVY A 
Sbjct  228   VRYTRGSFIFPGNQLYPHRNFSEEVAVLDSYFGKLVSGSNAYIIGGSGKP-QKWHVYSA-  285

Query  600   VGSGAPA----PETTVEICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDF  764
               S  P     P  T+E+C+TGL RE A++F+K + G  G MT  S I  ++P   ICDF
Sbjct  286   --SAEPLISSDPVFTIEMCLTGLDREMASVFYKTQSGSAGAMTVSSGIRKILPDSKICDF  343

Query  765   EFDPCGYSMNGMDGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAE  944
             EFDPCGYSMN ++GAA ST+HVTPE+GFSYAS+E +G + + V L+ LV+RVL CF+P +
Sbjct  344   EFDPCGYSMNSVEGAAISTIHVTPEDGFSYASFETVGYDPNDVNLKQLVERVLACFQPRD  403

Query  945   FSVAVTRFGVPARDKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP-SA  1121
             FS+AV      A   I +    +V  Y+   R  +EL   G I Y+ F   +    P S 
Sbjct  404   FSIAV--HAEVAGKMIEQKCLLNVKGYSREERGLEELGMGGSILYQKFVKTEGNGSPRST  461

Query  1122  LQ-CWK  1136
             L+ CWK
Sbjct  462   LKCCWK  467



>ref|XP_011021158.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
Length=361

 Score =   323 bits (829),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 177/349 (51%), Positives = 229/349 (66%), Gaps = 15/349 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P  F DP G GLR L++ QLD IL PA CTIV  L   + DS
Sbjct  6     SAIGFEGYEKRLEISFLEPGFFSDPEGKGLRSLSKAQLDEILRPAECTIVDLLSNDQVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LLLS+PVILKLAD LSL V SV+Y+RG+F+   +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILKLADALSLTVCSVRYTRGSFLCPGAQP  125

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVEI  641
              PHRSF EEVA L+  F     N VA+V+G  +   + WHVY A         P  T+E+
Sbjct  126   FPHRSFCEEVAVLDDHFSKLGLNSVAYVMGGLDKT-QKWHVYSASADIESHSGPVYTLEM  184

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGLSR++A++F+K        MT+ S I  ++P   ICDF+FDPCGYSMN ++G+A S
Sbjct  185   CMTGLSRKQASVFYKTHSSSAAAMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEGSAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRF--GVPARDKI  992
             T+HVTPE+GFSYAS+EA+G +L  + L  L++RVL CFEP EFSVA+     G   + K 
Sbjct  245   TIHVTPEDGFSYASFEAVGYDLQDLNLSQLLERVLACFEPTEFSVALHSNIKGAELQAKF  304

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
                   DV+ Y+      + L   G I Y  F     ++ P ++   CW
Sbjct  305   ----PLDVEGYSGGGGNYEMLGKGGSIIYHSFARTGGSASPRSILKCCW  349



>gb|AAB88854.1| S-adenosylmethionine decarboxylase [Nicotiana tabacum]
Length=361

 Score =   323 bits (829),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 227/347 (65%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR L++ QLD IL PA CTIV  L   + DS
Sbjct  8     SAIGFEGFEKRLEISFFEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDSLSNDDVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P ILKLA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G P+   + WHVY A  G   +  P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDK-AQKWHVYSASAGPIQSNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K  G     MT  S I  ++P+  ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEGAALS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+EA+G ++  + L  LV+RVL CF+P EFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFQPDEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
               + DV  Y+      +E    G I Y+ FT       P ++   CW
Sbjct  305   VCSLDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPFCGSPKSVLKGCW  351



>gb|AAR84406.1| S-adenosylmethionine decarboxylase [Daucus carota]
 gb|AAR84408.1| S-adenosylmethionine decarboxylase [Daucus carota]
Length=361

 Score =   323 bits (828),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 229/348 (66%), Gaps = 12/348 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P  F DP G GLR L+++QLD  L PA CTIV+ L     DS
Sbjct  6     SAIGFEGFEKRLEISFFEPSFFADPEGKGLRVLSKNQLDEFLGPAECTIVASLSNEHVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LL S+P ILKLAD LSL V SV+Y+RG F+F  +Q 
Sbjct  66    YVLSESSLFVYAYKIIIKTCGTTKLLKSIPPILKLADSLSLTVRSVRYTRGCFIFPGAQS  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PHRSFSEEV+ L++ F        A+++G  +   + WHVY A   S     P  T+E+
Sbjct  126   YPHRSFSEEVSVLDNYFGKLGSGSKAYIMGGSDKQ-QKWHVYSACAASTRTLDPVYTMEM  184

Query  642   CMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMT L+R+KA++F+K        MT  S I D++P+  ICDFEFDPCGYSMN ++G A S
Sbjct  185   CMTSLNRDKASVFYKTNSSSATSMTDNSGIRDILPNSRICDFEFDPCGYSMNAVEGPAVS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSY+S+EA+G +   V L  LV RVLNCF+P EFS+A+      A + + +
Sbjct  245   TIHITPEDGFSYSSFEAVGYDPKSVNLSDLVARVLNCFQPGEFSIALQ--ADIASELLEK  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQ-CW  1133
               +  V  Y    +  +EL  DG I Y+ F  TT +  S  S L+ CW
Sbjct  303   TSSVHVKGYRVEEKTCEELGMDGSIVYQKFVKTTERCESPRSVLKCCW  350



>ref|XP_007033429.1| S-adenosylmethionine decarboxylase proenzyme isoform 2 [Theobroma 
cacao]
 gb|EOY04355.1| S-adenosylmethionine decarboxylase proenzyme isoform 2 [Theobroma 
cacao]
Length=370

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 229/356 (64%), Gaps = 11/356 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P  F DPRGMGLR L++ QLD IL+PA CTIVS L     DS
Sbjct  6     SAIGFEGYEKRLEVSFFDPGSFVDPRGMGLRSLSKIQLDEILKPAECTIVSSLSNDHVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P IL+ A+ LSL V SV+Y+ G+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILRFANNLSLSVRSVRYTHGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVEI  641
              PHR+FSEEVA L+  F        A+++G  +   + WHVY A    SG   P  T+E+
Sbjct  126   FPHRNFSEEVAILDRFFLKLGSRRKAYIMGSSDKT-KKWHVYSAYAERSGHSDPVYTLEM  184

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL ++KA++F+K        MT+ S I +++P   ICDFEFDPCGYSMN ++  A S
Sbjct  185   CMTGLDKKKASVFYKTHVSSAVLMTEHSGIREILPQSQICDFEFDPCGYSMNSIEKDAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA G +   V L  L++RVL CF P EFSV++        D +  
Sbjct  245   TIHVTPEDGFSYASFEAAGYDFETVNLNQLMERVLACFRPTEFSVSL--HADVNGDVLDH  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEEVAV  1160
               + DV+ Y C  R    L     + Y  F    V   P ++   CW E E++  V
Sbjct  303   RIHLDVNGYCCEERRFDVLGNGSSVIYYSFIGADVCVSPRSILKCCWSEDEKDEEV  358



>ref|XP_007139351.1| hypothetical protein PHAVU_008G022100g [Phaseolus vulgaris]
 gb|ESW11345.1| hypothetical protein PHAVU_008G022100g [Phaseolus vulgaris]
Length=356

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 232/357 (65%), Gaps = 22/357 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF+   +     G+GLR L+RDQLD IL PA CTIVS L     DS
Sbjct  4     SAIGFEGYEKRLEISFSEDGVL--AGGLGLRALSRDQLDEILNPAECTIVSSLSNDYVDS  61

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+PVILKLAD + + V SV+Y+RG+F+F  +Q 
Sbjct  62    YVLSESSLFVYPYKIIIKTCGTTKLLLSIPVILKLADAIDISVKSVRYTRGSFIFPGAQT  121

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETT----  632
              PHRSFSEEV+ L+S F N      A+ +GDP S  + WH+Y A     A A E+     
Sbjct  122   FPHRSFSEEVSVLDSYFGNLGNGSKAYAMGDP-SKSQLWHIYSA----SAQAKESLDSVY  176

Query  633   -VEICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
              +E+CMTGL ++ A++FFK        MT+ S I  ++P   ICDFEFDPCGYSMNG++G
Sbjct  177   GLEMCMTGLDKDCASVFFKENTSSAASMTENSGIRYILPQSDICDFEFDPCGYSMNGIEG  236

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
              A ST+HVTPE+GFSYAS+EA+G +     L  LV RVL CF PAEFSVA+    +    
Sbjct  237   NAISTIHVTPEDGFSYASFEAVGYDYDDKTLCELVDRVLACFRPAEFSVALH---IDMHG  293

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEE  1151
             ++      D+  Y C  R  +EL   G + Y+ F     ++ P ++   CW E E E
Sbjct  294   EMLDKFPLDIKGYCCGERSFEELGVGGAVVYQTFVQGDGSASPRSILRCCWSEDENE  350



>gb|KHG30390.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
 gb|KHG30391.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
Length=369

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 229/357 (64%), Gaps = 12/357 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG EKRLEISF  P    DPRGMGLR L++ QLD IL+PA CTIVS L     DS
Sbjct  6     SAIGFEGCEKRLEISFFDPGFSVDPRGMGLRSLSKAQLDEILKPAECTIVSSLSNNHVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LL S+P ILKLA+ LSL V SV+YSRG+F+F  +QP
Sbjct  66    YVLSESSLFVYPYKIIIKTCGTTKLLFSIPAILKLANSLSLSVQSVRYSRGSFIFPGAQP  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEV-GSGAPAPETTVEI  641
              PHR+F EEVA L+  F     +  A+++G  +   + WHVY A    S    P  T+E+
Sbjct  126   FPHRNFCEEVAILDRFFLKLGSHRKAYIMGGSDKT-KKWHVYSASARTSNHSNPVYTLEM  184

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R+KA++F+K        MT+ S I  ++P   ICDFEFDPCGYSMN ++  A S
Sbjct  185   CMTGLDRKKASIFYKTHASSAASMTEHSGIRKILPYSQICDFEFDPCGYSMNSIEKGAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA G +   +    L++RVL CF+P EFSV++       RD +  
Sbjct  245   TIHVTPEDGFSYASFEASGYDFETLNSNQLIERVLACFKPTEFSVSLHV--NMTRDDLRC  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSAL--QC-WKETEEEVAV  1160
                + V+ Y C  R  ++L   G + Y  F    +   P ++   C W E ++ V V
Sbjct  303   RMPSYVNGYCCEKRSFEQLGNGGSVMYYSFGGGDMCVSPRSILKSCSWNEDDQSVGV  359



>gb|ABK25576.1| unknown [Picea sitchensis]
Length=373

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 177/356 (50%), Positives = 221/356 (62%), Gaps = 14/356 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             +AIGFEGFEKRLE+ F  P +F DP   GLR LTR +LD +L+ A CTIVSEL     DS
Sbjct  2     TAIGFEGFEKRLEVEFFAPSIFNDPERRGLRALTRAELDEMLDAAQCTIVSELSNEHLDS  61

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K VLKTCGTT+LLLS+P+ILK A  LSL V +VKY+RGTF+F   QP
Sbjct  62    YVLSESSLFVYPYKFVLKTCGTTKLLLSIPLILKNASKLSLSVKNVKYTRGTFIFAGVQP  121

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS----GAPAPETT  632
              PHRSF EEV++L+  F      G A+V+GD      NWHVY A        G   P  T
Sbjct  122   FPHRSFGEEVSYLDKYFGKLGSGGKAYVMGD-SGKAYNWHVYTASAEDASFEGNAPPVYT  180

Query  633   VEICMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
             +E+CMT L  ++A++F+K       EMT  S I D++P   ICDF+FDPCGYSMN ++GA
Sbjct  181   LEMCMTELDHKQASVFYKDTSKSAVEMTLNSGISDILPESKICDFQFDPCGYSMNALEGA  240

Query  810   AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDK  989
             A ST+HVTPE+GFSYAS+EAMG       LEALV+RVL+CF P  FS++V    V     
Sbjct  241   AISTIHVTPEDGFSYASFEAMGYNPKDCDLEALVERVLSCFRPMVFSISV-HVSVDNGRS  299

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCWKETEEE  1151
              W         Y C     + L G   + Y  +   T++       L  W+E  EE
Sbjct  300   SWTKP-VFPQGYICDMTSHEALTGKSSVVYHTYRMATDESPRSTLPLLAWEEEGEE  354



>gb|AGL95795.1| S-adenosylmenthionine decarboxylase [Momordica charantia]
Length=358

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 175/359 (49%), Positives = 234/359 (65%), Gaps = 18/359 (5%)
 Frame = +3

Query  114   SSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFD  293
             +SAIGFEG+EKRLE+SF  P +F DPRGMGLR L++ QLD IL  A CTIV  L     D
Sbjct  5     TSAIGFEGYEKRLEVSFFEPGVFSDPRGMGLRALSKAQLDEILTLAECTIVDSLSNDYLD  64

Query  294   SYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQ  473
             S VLSESS+F+YP K ++KTCGTT+LLLS+P +LKLAD LSL V SV+Y+RG+F+F  +Q
Sbjct  65    SCVLSESSLFVYPYKFIIKTCGTTKLLLSIPALLKLADSLSLTVRSVRYTRGSFIFPGAQ  124

Query  474   PAPHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVY--VAEVGSGAPAPETTV  635
               PHRSFSEEVA L+        +  A+V+G P+   + WHVY   A +GS +  P  T+
Sbjct  125   SFPHRSFSEEVAVLDGYLGKLGLDSTAYVMGSPDET-KKWHVYSACANMGSKSNNPVYTL  183

Query  636   EICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAA  812
             E+CMTGL +EK ++FFK        MTK S I  ++P   ICDFEFDPCGYSMN ++G A
Sbjct  184   EMCMTGLDKEKTSVFFKTDASSAAAMTKNSGIRKILPKSEICDFEFDPCGYSMNAIEGDA  243

Query  813   YSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTR--FGVPARD  986
              ST+H+TPE+GFSYAS+EA G + + V L  L+ RVL CF+P++FSVA+     G    D
Sbjct  244   ESTIHITPEDGFSYASFEASGYDFNEVNLSQLIGRVLACFQPSDFSVALHSDDCGENLED  303

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCF-TTNKVASRPSALQ---CWKETEEE  1151
              +      ++  Y    +  + L  +G + Y+ F  T   AS P ++    CW + E++
Sbjct  304   LLC----VELKGYEGGEKSCEMLGENGTVIYQSFMKTGDYASSPRSILLKCCWSDDEKD  358



>gb|AGV54395.1| S-adenosylmethionine decarboxylase [Phaseolus vulgaris]
Length=354

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 228/355 (64%), Gaps = 15/355 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SA+ FEG+EKRLEI F+ P LF DP   GLR LT+ QLD IL PA CTIVS L   + DS
Sbjct  4     SALRFEGYEKRLEICFSQPGLFADPERRGLRVLTKSQLDEILTPAACTIVSSLSNDDVDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILK AD+LSL V SV Y+RG+F+F  +QP
Sbjct  64    YVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKFADMLSLKVKSVTYTRGSFIFPGAQP  123

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS--GAPAPETTVE  638
              PHR F+EEVA LN  F       +AF++G P+   + WH+Y A       +     T+E
Sbjct  124   HPHRCFTEEVAILNDYFGKLGSGSMAFIMGSPDKK-QKWHIYSASADPLISSDTNVCTLE  182

Query  639   ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
             +CMTGL REKA +F+K        MT  S I  ++P+  ICDF+F+PCGYSMN ++G A 
Sbjct  183   MCMTGLDREKAQIFYKEQSASAAIMTVNSGIRKILPNSDICDFDFEPCGYSMNSVEGDAV  242

Query  816   STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGV--PARDK  989
             ST+H+TPE+GFSYAS+E +G +  ++ L ALV RVL+CF P EFSVAV   G   P+   
Sbjct  243   STIHITPEDGFSYASFETVGYDFKVLNLNALVDRVLSCFLPNEFSVAVRVDGASKPSEQM  302

Query  990   IWRGGNADVDRYACRFRVTQELPGDGRIDYRCFT-TNKVASRPSALQCWKETEEE  1151
              +     DV  Y     + + L   G + Y+ F   +   S  S L+CWK+  EE
Sbjct  303   CF----VDVKGYCREEWIHEGLGMGGFVVYQKFVKISDCVSPRSTLKCWKDEVEE  353



>ref|XP_002514534.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
 gb|EEF47640.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
Length=361

 Score =   322 bits (825),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 179/352 (51%), Positives = 228/352 (65%), Gaps = 11/352 (3%)
 Frame = +3

Query  105   EALSSAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGA  284
             E   SAIGFEG+EKRLEISF    +F DP G GLR L++ QLD IL PA CTIV  L   
Sbjct  5     EMAVSAIGFEGYEKRLEISFFELGMFVDPEGKGLRSLSKAQLDMILGPAECTIVDSLSNE  64

Query  285   EFDSYVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQ  464
               DSYVLSESS+F+YP KI++KTCGTT+LLL++P ILKLAD LSL V SV+Y+RG+F+F 
Sbjct  65    NVDSYVLSESSLFVYPYKIIIKTCGTTKLLLAIPPILKLADALSLNVKSVRYTRGSFIFP  124

Query  465   NSQPAPHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-  629
              +Q  PHRSFSEEVA L+  F        A+V+G   SP + WHVY A   S        
Sbjct  125   GAQSYPHRSFSEEVAVLDDYFGKLGAGSTAYVMGGLHSP-QKWHVYSASAHSTYCCDCVY  183

Query  630   TVEICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDG  806
             T+E+CMTGL REKA++FFK        MT  S I  ++P+  ICDF+FDPCGYSMN ++G
Sbjct  184   TIEMCMTGLEREKASVFFKSQSASAAVMTVDSGIRRILPNSKICDFDFDPCGYSMNAIEG  243

Query  807   AAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARD  986
             AA ST+H+TPE+GFSYAS+E +G     V L  LV+RVL CF+P++FS+AV      A  
Sbjct  244   AAISTIHITPEDGFSYASFETVGYNPEEVNLNQLVERVLACFQPSQFSIAV--HANVADK  301

Query  987   KIWRGGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQCWK  1136
             ++ +    DV  Y    R  +EL   G I Y+ F  T +  + R +   CW+
Sbjct  302   QLVQTCALDVKGYCRGERSFEELGMGGSIVYQKFVRTGDSGSPRSTLKCCWR  353



>gb|KDO70175.1| hypothetical protein CISIN_1g0194112mg, partial [Citrus sinensis]
Length=312

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 169/290 (58%), Positives = 210/290 (72%), Gaps = 13/290 (4%)
 Frame = +3

Query  117  SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
            SAIGFEG+EKRLEISF  P +F DP G GLR LT+ QLD IL PA CTIVS L   E DS
Sbjct  11   SAIGFEGYEKRLEISFFEPSMFVDPEGKGLRRLTKAQLDEILGPAECTIVSSLSNDEVDS  70

Query  297  YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
            YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKLA+ LSL V SV+Y+RG+F+F  +Q 
Sbjct  71   YVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLAETLSLNVRSVRYTRGSFIFPGNQL  130

Query  477  APHRSFSEEVAFLNSQFKNGV----AFVLGDPESPGRNWHVYVAEVGSGAPA----PETT  632
             PHR+FSEEVA L+S F   V    A+++G    P + WHVY A   S  P     P  T
Sbjct  131  YPHRNFSEEVAVLDSYFGKLVSGSNAYIIGGSGKP-QKWHVYSA---SAEPLISSDPVFT  186

Query  633  VEICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGA  809
            +E+C+TGL RE A++F+K + G  G MT  S I  ++P   ICDFEFDPCGYSMN ++GA
Sbjct  187  IEMCLTGLDREMASVFYKTQSGSAGAMTVNSGIRKILPDSKICDFEFDPCGYSMNSVEGA  246

Query  810  AYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAV  959
            A STVHVTPE+GFSYAS+E +G + + V L  LV+RVL CF+P +FS+AV
Sbjct  247  AISTVHVTPEDGFSYASFETVGYDPNDVNLNQLVERVLACFQPRDFSIAV  296



>ref|XP_010681340.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Beta vulgaris subsp. vulgaris]
Length=372

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/289 (55%), Positives = 209/289 (72%), Gaps = 8/289 (3%)
 Frame = +3

Query  117  SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
            SAIGFEG+EKRLEI+F  P +F D  G GLR L++DQLD IL PA CTIV  L     DS
Sbjct  17   SAIGFEGYEKRLEITFFEPGIFVDSDGKGLRALSKDQLDEILGPAECTIVDSLANESVDS  76

Query  297  YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
            YVLSESS+F+Y  KI++KTCGTT+LLL++P ILKLA  LSL + +V+Y+RG+F+F  +Q 
Sbjct  77   YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAASLSLDIKAVRYTRGSFIFPGAQS  136

Query  477  APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYV--AEVGSGAPAPETTVE  638
             PHRSFSEEVA L+  F        AFV+G+P  P + WHVY   AE  +    P  T+E
Sbjct  137  FPHRSFSEEVAVLDGYFGKLAAGSNAFVMGNPSKP-QKWHVYCASAETTASYDDPVYTLE  195

Query  639  ICMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAY  815
            +CMTGL++EKA++FFK        MT+ S I  ++P   ICDF+F+PCGYSMN ++G A 
Sbjct  196  MCMTGLNKEKASVFFKAQSDSAAVMTESSGIRKILPDSAICDFDFEPCGYSMNAIEGPAV  255

Query  816  STVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVT  962
            ST+H+TPE+GFSYAS+EA+G +L ++ L  LV+RVL CFEP+EFS+A+ 
Sbjct  256  STIHITPEDGFSYASFEAVGYDLKMIDLNQLVERVLACFEPSEFSIAIN  304



>ref|XP_007033428.1| S-adenosylmethionine decarboxylase proenzyme isoform 1 [Theobroma 
cacao]
 gb|EOY04354.1| S-adenosylmethionine decarboxylase proenzyme isoform 1 [Theobroma 
cacao]
Length=417

 Score =   323 bits (828),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 229/356 (64%), Gaps = 11/356 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P  F DPRGMGLR L++ QLD IL+PA CTIVS L     DS
Sbjct  53    SAIGFEGYEKRLEVSFFDPGSFVDPRGMGLRSLSKIQLDEILKPAECTIVSSLSNDHVDS  112

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP KI++KTCGTT+LLLS+P IL+ A+ LSL V SV+Y+ G+F+F  +QP
Sbjct  113   YVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILRFANNLSLSVRSVRYTHGSFIFPGAQP  172

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVEI  641
              PHR+FSEEVA L+  F        A+++G  +   + WHVY A    SG   P  T+E+
Sbjct  173   FPHRNFSEEVAILDRFFLKLGSRRKAYIMGSSDKT-KKWHVYSAYAERSGHSDPVYTLEM  231

Query  642   CMTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL ++KA++F+K        MT+ S I +++P   ICDFEFDPCGYSMN ++  A S
Sbjct  232   CMTGLDKKKASVFYKTHVSSAVLMTEHSGIREILPQSQICDFEFDPCGYSMNSIEKDAIS  291

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA G +   V L  L++RVL CF P EFSV++        D +  
Sbjct  292   TIHVTPEDGFSYASFEAAGYDFETVNLNQLMERVLACFRPTEFSVSL--HADVNGDVLDH  349

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CWKETEEEVAV  1160
               + DV+ Y C  R    L     + Y  F    V   P ++   CW E E++  V
Sbjct  350   RIHLDVNGYCCEERRFDVLGNGSSVIYYSFIGADVCVSPRSILKCCWSEDEKDEEV  405



>gb|ABW21886.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   320 bits (821),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 174/339 (51%), Positives = 221/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   R WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-RKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL+REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSKICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   VCSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>gb|AAZ85237.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85241.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
Length=343

 Score =   320 bits (820),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 221/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-QKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL+REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   ACSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>ref|XP_004233654.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Solanum 
lycopersicum]
Length=417

 Score =   322 bits (826),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 240/358 (67%), Gaps = 20/358 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEI F        P G GLR L++DQLD IL PA CTIVS L   E DS
Sbjct  61    SAIGFEGYEKRLEICFFELGNSYGP-GCGLRSLSKDQLDEILTPAACTIVSSLANDEVDS  119

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLLS+P ILKLAD L+L V SV+Y+RG+F+F  +QP
Sbjct  120   YVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLADSLNLKVKSVRYTRGSFIFPGAQP  179

Query  477   APHRSFSEEVAFLNSQF-KNGV---AFVLGDPESPGRNWHVYVAEVGSGAPA------PE  626
              PHR FSEEVA L++ F K G    ++V+G+ +   +NWHVY A   S  PA      P 
Sbjct  180   FPHRHFSEEVAVLDTYFGKLGAGSNSYVMGNADKQ-QNWHVYSA---SAEPADANNVNPV  235

Query  627   TTVEICMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMD  803
              T+E+CMT L ++KA++FFK +     EMT++S I  ++P   ICDF+FDPCGYSMN ++
Sbjct  236   YTLEMCMTNLDKKKASVFFKTQSSTAAEMTEVSGIRKILPESNICDFDFDPCGYSMNAVE  295

Query  804   GAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPAR  983
             G+A ST+H+TPE+GFSYAS+EA+G +   V L A+++RVL+CF PAEFSVA+    +  +
Sbjct  296   GSAISTIHITPEDGFSYASFEAVGYDFRAVDLSAMIERVLSCFGPAEFSVAL-HCDILGK  354

Query  984   DKIWRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSAL--QCWKETEEE  1151
             + ++     D+  Y    + T+ L   G + Y  F++      P ++   CW E E+E
Sbjct  355   E-LYTESGLDIIGYVSGEKTTEMLGKGGSLTYLTFSSGGSCGSPRSILNNCWSENEDE  411



>gb|ADV29193.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   320 bits (819),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 222/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F       +A ++G+P+   + WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSMAVIMGNPDKT-QKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL+REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIAL--HADVATKILER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   VCSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>sp|Q9AXE3.1|DCAM_DAUCA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Daucus carota]
 gb|AAG61146.1|AF334029_1 S-adenosyl-methionine decarboxylase [Daucus carota]
Length=361

 Score =   320 bits (821),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 174/348 (50%), Positives = 229/348 (66%), Gaps = 12/348 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P  F DP G GLR L+++QLD  L PA CTIV+ L     DS
Sbjct  6     SAIGFEGFEKRLEISFFEPSFFADPEGKGLRVLSKNQLDEFLGPAECTIVASLSNEHVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LL S+P ILKLAD LSL V SV+Y+RG F+F  +Q 
Sbjct  66    YVLSESSLFVYAYKIIIKTCGTTKLLKSIPPILKLADSLSLTVRSVRYTRGCFIFPGAQS  125

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGSGAPA-PETTVEI  641
              PHRSFSEEV+ L++ F        A+++G  +   + WHVY A   S     P  T+E+
Sbjct  126   YPHRSFSEEVSVLDNYFGKLGSGSKAYIMGGSDKQ-QKWHVYSACAASTRTLDPVYTMEM  184

Query  642   CMTGLSREKAAMFFKRPGGDG-EMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMT L+R+KA++F+K        +T  S + D++P+  ICDFEFDPCGYSMN ++G A S
Sbjct  185   CMTSLNRDKASVFYKTNSSSATSVTDNSGLRDILPNSRICDFEFDPCGYSMNAVEGPAVS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSY+S+EA+G +   V L  LV RVLNCF+P EFS+A+      A + + +
Sbjct  245   TIHITPEDGFSYSSFEAVGYDPKSVNLSDLVARVLNCFQPGEFSIALQ--ADIASELLEK  302

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCF--TTNKVASRPSALQ-CW  1133
               +  V  Y    +  +EL  DG I Y+ F  TT +  S  S L+ CW
Sbjct  303   TSSVHVKGYRVEEKTCEELGMDGSIVYQKFVKTTERCESPRSVLKCCW  350



>gb|AAZ85232.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85233.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85234.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85235.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85236.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85238.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85239.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85240.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
Length=343

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 222/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-QKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL+REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L +LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGSLVERVLACFEPAEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   VCSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>sp|Q39677.1|DCAM2_DIACA RecName: Full=S-adenosylmethionine decarboxylase proenzyme 2; 
Short=AdoMetDC 2; Short=SAMDC 2; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 2 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 2 beta chain; 
Flags: Precursor [Dianthus caryophyllus]
 gb|AAD09840.1| S-adenosylmethionine decarboxylase 2 [Dianthus caryophyllus]
Length=377

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 226/350 (65%), Gaps = 11/350 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P +F DP G GLR L++  LD IL PA CTIV  L     DS
Sbjct  19    SAIGFEGFEKRLEISFFEPGIFVDPEGKGLRALSKAHLDEILGPAECTIVDSLANESVDS  78

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LL S+P IL+LA+ L L V SV+Y+RG+F+F  +Q 
Sbjct  79    YVLSESSLFVYSYKIIIKTCGTTKLLNSIPPILRLAETLFLDVKSVRYTRGSFIFPGAQS  138

Query  477   APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
              PHRSFSEEVA L++ F        A V+G P  P + WHVY A   +    P  T+E+C
Sbjct  139   FPHRSFSEEVAVLDNYFAKLGAGSKAIVMGSPGKP-QKWHVYSATAETNYDDPVYTLEMC  197

Query  645   MTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
             MTGL +EKA++FFK        MT+ S I  ++P  VICDF+F+PCGYSMN ++G A ST
Sbjct  198   MTGLDKEKASVFFKSQSASAAVMTESSGIRKILPDSVICDFDFEPCGYSMNAIEGPAVST  257

Query  822   VHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWRG  1001
             +H+TPE+GFSYAS+EA+G +L +V L  LV+RVL CFEP EFS+AV      A   + R 
Sbjct  258   IHITPEDGFSYASFEAVGYDLQVVDLNLLVERVLACFEPKEFSIAVHADTDTADKVLARN  317

Query  1002  GNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ-----CWK  1136
              + +V  Y+      +EL   G + Y+ F        P A +     CWK
Sbjct  318   CSVNVIGYSREEGGIEELGLGGSVFYQKFCKGTAPVCPPAPKKTLKCCWK  367



>ref|XP_006288009.1| hypothetical protein CARUB_v10001243mg [Capsella rubella]
 gb|EOA20907.1| hypothetical protein CARUB_v10001243mg [Capsella rubella]
Length=362

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 224/325 (69%), Gaps = 12/325 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF DP+G GLR L + Q+D IL+PA CTIVS L   + DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPGLFLDPQGKGLRALAKSQIDEILQPAECTIVSSLSNDQLDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FI+P KIV+KTCGTT+LLLS+  +L+LA  LSL V +V+Y+RG+F+    QP
Sbjct  64    YVLSESSLFIFPYKIVIKTCGTTKLLLSIEPLLRLAAELSLEVKAVRYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-TVEI  641
              PHR+FSEEV+ L++ F     + VA+++G+ +   + WHVY A   +        T+E+
Sbjct  124   FPHRNFSEEVSVLDAHFAKLGLSSVAYLMGNDDET-KKWHVYSASAKNDNNNKNVYTLEM  182

Query  642   CMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL ++KA++F+K+     G MT  S I  ++P   ICDFEF+PCGYSMN ++G A S
Sbjct  183   CMTGLDKDKASVFYKKESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEGDAIS  242

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+HVTPE+GFSYAS+EA+G + + + L  LV +VL CFEP +FSVAV         K + 
Sbjct  243   TIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAVHS---SVEQKGYG  299

Query  999   GGNA-DVDRYACRFRVTQELPGDGR  1070
              G A D+D Y CR  +T E  G+ R
Sbjct  300   SGLAVDLDDYGCR-ELTMESLGEER  323



>gb|ABW21889.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=344

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 174/340 (51%), Positives = 222/340 (65%), Gaps = 10/340 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-QKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYA-CRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+   +R  +E    G I Y+ FT       P
Sbjct  305   VCSVDVKGYSLAEWRCPEEFGKGGSIVYQKFTRTPYCESP  344



>sp|Q39676.1|DCAM1_DIACA RecName: Full=S-adenosylmethionine decarboxylase proenzyme 1; 
Short=AdoMetDC 1; Short=SAMDC 1; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 1 beta chain; 
Flags: Precursor [Dianthus caryophyllus]
 gb|AAD09839.1| S-adenosylmethionine decarboxylase 1 [Dianthus caryophyllus]
 gb|AAB70461.1| S-adenosylmethionine decarboxylase [Dianthus caryophyllus]
Length=381

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/297 (56%), Positives = 207/297 (70%), Gaps = 9/297 (3%)
 Frame = +3

Query  117  SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
            SAIGFEGFEKRLEISF  P +F DP G GLR L++ QLD IL PA CTIV  L     DS
Sbjct  28   SAIGFEGFEKRLEISFFEPGIFVDPEGKGLRALSKAQLDEILGPAECTIVDSLANESVDS  87

Query  297  YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
            YVLSESS+F+Y  KI++KTCGTT+LL S+  IL LAD L L V SV+Y+RG+F+F  +Q 
Sbjct  88   YVLSESSLFVYSYKIIIKTCGTTKLLHSILPILTLADGLCLDVKSVRYTRGSFIFPGAQS  147

Query  477  APHRSFSEEVAFLNSQFKN----GVAFVLGDPESPGRNWHVYVAEVGSGAPAPETTVEIC  644
             PHRSFSEEVA L+  F N      AFV+G P  P + WHVY A        P  T+E+C
Sbjct  148  YPHRSFSEEVAVLDKYFGNLGTGSKAFVMGSPAKP-QKWHVYSATAEPSYDDPVYTLEMC  206

Query  645  MTGLSREKAAMFFKRPGGDGE-MTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYST  821
            MTGL + KA++FFK        MT+ S I  ++P   ICDF+F+PCGYSMN ++G A ST
Sbjct  207  MTGLDKGKASVFFKSESASAAVMTETSGIRKILPDSAICDFDFEPCGYSMNAIEGPAVST  266

Query  822  VHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKI  992
            +H+TPE+GFSYAS+EA+G +L +V +  LV+RVLNCF+P EFS+AV+   V   DK+
Sbjct  267  IHITPEDGFSYASFEAVGYDLKIVDVNQLVERVLNCFQPREFSIAVS---VDTADKV  320



>gb|ADV29203.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 221/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-QKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL+REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLNREKASVFYKTEESSAAHMTVKSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIAL--HADVATKILER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   VCSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>ref|XP_006373494.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 ref|XP_006373495.1| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 ref|XP_006373496.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 ref|XP_006373497.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 gb|ABK95786.1| unknown [Populus trichocarpa]
 gb|ERP51291.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 gb|ERP51292.1| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 gb|ERP51293.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 gb|ERP51294.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
Length=361

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 227/349 (65%), Gaps = 15/349 (4%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLEISF  P  F DP G GLR L++ QLD IL PA CTIV  L   + DS
Sbjct  6     SAIGFEGYEKRLEISFLEPGFFSDPEGKGLRSLSKAQLDEILRPAECTIVDSLSNDQVDS  65

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+YP K+++KTCGTT+LLLS+PVILKLAD LSL V SV+Y+RG+F+   +QP
Sbjct  66    YVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILKLADALSLTVCSVRYTRGSFLCPGAQP  125

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVG-SGAPAPETTVEI  641
              PHR+F EEVA L+  F     N VA+V+G  +   + WHVY A         P  T+E+
Sbjct  126   FPHRNFCEEVAVLDDHFSKLGLNSVAYVMGGLDKT-QKWHVYSASADIESHSGPVYTLEM  184

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL R++A++F+K        MT+ S I  ++P   ICDF+FDPCGYSMN ++G+A S
Sbjct  185   CMTGLGRKQASVFYKTHSSSAAAMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEGSAIS  244

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRF--GVPARDKI  992
             T+HVTPE+GFSYAS+EA+G +L  + L  L++RVL CFEP  FSVA+     G   R K 
Sbjct  245   TIHVTPEDGFSYASFEAVGYDLQDLNLSRLLERVLACFEPTMFSVALHSNIKGAELRAKF  304

Query  993   WRGGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
                   DV+ Y+      + L   G I Y  F     ++ P ++   CW
Sbjct  305   ----PLDVEGYSGGGGNYEMLGKGGSIIYHSFARTGGSASPRSILKCCW  349



>gb|AAZ85231.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
lycopersicoides]
Length=343

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 172/339 (51%), Positives = 222/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKSQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G+  +  P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-QKWHVYSASAGTVQSNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL+REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEP+EFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPSEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   VCSVDVKGYSVAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>gb|ADV29165.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29166.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29167.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29168.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29172.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29173.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29179.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29180.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29182.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29183.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29187.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29188.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29189.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29190.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29191.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29192.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29195.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29196.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29197.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29201.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29204.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 221/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-QKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL+REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIAL--HADVATKILER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   VCSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>ref|XP_006348617.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum tuberosum]
Length=360

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 223/347 (64%), Gaps = 11/347 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR L++ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G P    + WHVY A  GS  +  P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPNKT-QKWHVYSASAGSVQSNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G     + L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYNPKTMELGPLVERVLACFEPAEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRPSALQ--CW  1133
               + DV  Y+      +E    G I Y+ FT       P ++   CW
Sbjct  305   VCSVDVKGYSLAEWSPEEFGEGGSIVYQKFTRTPYCESPKSVLKGCW  351



>gb|AAX56884.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56888.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56889.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56893.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56895.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56901.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21894.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ADV29169.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29175.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|AEO52833.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 221/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-QKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL+REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   VCSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>gb|ABW21925.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 221/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKT-QKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K        MT  S I +++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLDREKASVFYKTEESSAAHMTVRSGIRNILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   VCSVDVKGYSLAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>gb|ABW21912.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/339 (51%), Positives = 220/339 (65%), Gaps = 9/339 (3%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEGFEKRLEISF  P LF DP G GLR LT+ QLD IL PA CTIV  L     DS
Sbjct  8     SAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSNDYVDS  67

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+F+Y  KI++KTCGTT+LLL++P IL+LA+ LSL V  V+Y+RG+F+F  +Q 
Sbjct  68    YVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIFPGAQS  127

Query  477   APHRSFSEEVAFLNSQF----KNGVAFVLGDPESPGRNWHVYVAEVGS-GAPAPETTVEI  641
              PHR FSEEVA L+  F        A ++G+P+   + WHVY A  G+     P  T+E+
Sbjct  128   FPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDK-TQKWHVYSASAGTVQCNDPVYTLEM  186

Query  642   CMTGLSREKAAMFFK-RPGGDGEMTKMSRICDVIPSHVICDFEFDPCGYSMNGMDGAAYS  818
             CMTGL REKA++F+K        MT  S I  ++P   ICDFEF+PCGYSMN ++GAA S
Sbjct  187   CMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEGAAVS  246

Query  819   TVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPARDKIWR  998
             T+H+TPE+GFSYAS+E++G +     L  LV+RVL CFEPAEFS+A+      A   + R
Sbjct  247   TIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIAL--HADVATKLLER  304

Query  999   GGNADVDRYACRFRVTQELPGDGRIDYRCFTTNKVASRP  1115
               + DV  Y+      +E    G I Y+ FT       P
Sbjct  305   VCSVDVKDYSLAEWSPEEFGKGGSIVYQKFTRTPYCESP  343



>emb|CDX69487.1| BnaA10g18360D [Brassica napus]
Length=368

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 225/337 (67%), Gaps = 19/337 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF D  G GLR L++ Q+D IL PA CTIVS L   E DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSLFLDTHGKGLRALSKSQIDEILAPAECTIVSSLSNDELDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FI+P KI++KTCGTT+LLLS+  +L+L+  +SL V SV+Y+RG+F+    QP
Sbjct  64    YVLSESSLFIFPYKIIIKTCGTTKLLLSIEPLLRLSGGVSLEVKSVRYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-----  629
              PHR+FSEEV+ L+  F     + VA+++GD +   + WHVY A     APA  +     
Sbjct  124   FPHRNFSEEVSVLDGHFAKMGLSSVAYLMGDDDET-KKWHVYSA----SAPAKNSNSDNN  178

Query  630   --TVEICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL ++KA++FFK      G MT  S I  ++P   ICDFEF+PCGYSMN +
Sbjct  179   VYTLEMCMTGLDKDKASVFFKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSV  238

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL CFEP +FSVAV    V  
Sbjct  239   EGDAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSRVLTCFEPKQFSVAVNS-SVAQ  297

Query  981   RDKIWRGGNADVDRYACRFRVTQELPGD-GRIDYRCF  1088
             +     G + D++ Y CR    + L  + G + Y+ F
Sbjct  298   KSYDHSGLSVDLEDYGCRETTVESLGEERGTVMYQRF  334



>ref|XP_009121534.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme 1 [Brassica rapa]
Length=368

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 217/318 (68%), Gaps = 18/318 (6%)
 Frame = +3

Query  117   SAIGFEGFEKRLEISFTPPPLFRDPRGMGLRGLTRDQLDSILEPAFCTIVSELFGAEFDS  296
             SAIGFEG+EKRLE+SF  P LF D  G GLR L++ Q+D IL PA CTIVS L   E DS
Sbjct  4     SAIGFEGYEKRLEVSFFEPSLFLDTHGKGLRALSKSQIDEILAPAECTIVSSLSNDELDS  63

Query  297   YVLSESSMFIYPLKIVLKTCGTTRLLLSVPVILKLADLLSLGVDSVKYSRGTFVFQNSQP  476
             YVLSESS+FI+P KI++KTCGTT+LLLS+  +L+LA  +SL V SV+Y+RG+F+    QP
Sbjct  64    YVLSESSLFIFPYKIIIKTCGTTKLLLSIEPLLRLAGGVSLEVKSVRYTRGSFLCPGGQP  123

Query  477   APHRSFSEEVAFLNSQFK----NGVAFVLGDPESPGRNWHVYVAEVGSGAPAPET-----  629
              PHR+FSEEV+ L+  F     + VA+++GD +   + WHVY A     APA  +     
Sbjct  124   FPHRNFSEEVSVLDGHFAKMGLSSVAYLMGDDDET-KKWHVYSA----SAPAKNSNGDNN  178

Query  630   --TVEICMTGLSREKAAMFFKRPGGD-GEMTKMSRICDVIPSHVICDFEFDPCGYSMNGM  800
               T+E+CMTGL ++KA++FFK      G MT  S I  ++P   ICDFEF+PCGYSMN +
Sbjct  179   VYTLEMCMTGLDKDKASVFFKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSV  238

Query  801   DGAAYSTVHVTPEEGFSYASYEAMGVELSLVGLEALVKRVLNCFEPAEFSVAVTRFGVPA  980
             +G A ST+HVTPE+GFSYAS+EA+G + + + L  LV RVL CFEP +FSVAV    V  
Sbjct  239   EGDAISTIHVTPEDGFSYASFEAVGYDFTTMDLSQLVSRVLTCFEPKQFSVAV-HSSVAQ  297

Query  981   RDKIWRGGNADVDRYACR  1034
             +     G + D++ Y CR
Sbjct  298   KSYDHSGLSVDLEDYGCR  315



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3733082205876