BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c83054_g1_i1 len=930 path=[908:0-929]

Length=930
                                                                      Score     E

ref|XP_009597132.1|  PREDICTED: NAC transcription factor 25-like        214   3e-64   
ref|XP_009768847.1|  PREDICTED: NAC domain-containing protein 18        207   1e-61   
emb|CDP14991.1|  unnamed protein product                                199   4e-58   
ref|XP_004235471.1|  PREDICTED: NAC transcription factor 29             194   3e-56   
ref|XP_006366907.1|  PREDICTED: NAC transcription factor 25-like        193   7e-56   
gb|AGL39666.1|  NAC transcription factor 010                            191   1e-55   
ref|XP_011023926.1|  PREDICTED: NAC transcription factor 25-like        191   3e-55   
ref|XP_011020822.1|  PREDICTED: NAC transcription factor ONAC010-...    191   3e-55   
ref|XP_009336457.1|  PREDICTED: NAC transcription factor 25-like        191   5e-55   
ref|XP_002304662.1|  no apical meristem family protein                  190   6e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002297860.1|  no apical meristem family protein                  190   7e-55   Populus trichocarpa [western balsam poplar]
ref|XP_011036132.1|  PREDICTED: NAC domain-containing protein 18-...    190   9e-55   
ref|XP_003620957.1|  NAC domain protein                                 190   1e-54   
ref|XP_011043026.1|  PREDICTED: NAC transcription factor 25-like        189   2e-54   
ref|XP_002512632.1|  NAC domain-containing protein, putative            189   2e-54   Ricinus communis
ref|XP_008389924.1|  PREDICTED: NAC transcription factor 25-like        189   3e-54   
ref|XP_008222225.1|  PREDICTED: NAC transcription factor NAM-B2         189   3e-54   
gb|AGC97437.1|  NAC protein 7                                           189   3e-54   
ref|XP_007223645.1|  hypothetical protein PRUPE_ppa010222mg             188   4e-54   
gb|AFK42063.1|  unknown                                                 188   7e-54   
ref|XP_010530936.1|  PREDICTED: NAC transcription factor 25-like        188   7e-54   
ref|NP_001238078.1|  NAC domain protein                                 187   8e-54   
gb|KHN24977.1|  NAC domain-containing protein 29                        186   8e-54   
ref|NP_001238630.1|  NAC domain protein                                 186   9e-54   
ref|XP_010250592.1|  PREDICTED: NAC transcription factor 25-like        187   9e-54   
gb|AIZ03377.1|  NAC domain-containing protein                           187   1e-53   
ref|XP_002264588.1|  PREDICTED: NAC transcription factor NAM-B1         187   1e-53   Vitis vinifera
gb|ACU15279.1|  unknown                                                 186   2e-53   Glycine max [soybeans]
ref|XP_010090688.1|  NAC domain-containing protein 29                   187   2e-53   
gb|ACU14039.1|  unknown                                                 186   2e-53   Glycine max [soybeans]
ref|XP_002318155.1|  hypothetical protein POPTR_0012s10530g             186   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_004140548.1|  PREDICTED: NAC transcription factor ONAC010-...    187   2e-53   
ref|XP_004310115.1|  PREDICTED: NAC transcription factor NAM-B2-like    186   2e-53   
ref|XP_004297508.1|  PREDICTED: NAC transcription factor 29-like        184   8e-53   
ref|XP_008459893.1|  PREDICTED: NAC domain-containing protein 18        185   8e-53   
ref|NP_001281000.1|  NAC transcription factor 25-like                   185   8e-53   
ref|XP_006438824.1|  hypothetical protein CICLE_v10032547mg             184   1e-52   
gb|AIZ03376.1|  NAC domain-containing protein                           184   1e-52   
ref|XP_007043870.1|  NAC domain protein, IPR003441                      184   1e-52   
gb|AEI72272.1|  NAC domain transcription factor                         184   1e-52   
gb|KHG25755.1|  hypothetical protein F383_32963                         184   2e-52   
gb|AHF27223.1|  NAC transcription factor                                183   3e-52   
gb|AIO02871.1|  NAC domain-containing protein                           183   3e-52   
ref|XP_007038082.1|  NAC domain protein, IPR003441, putative            182   7e-52   
gb|KHG25754.1|  hypothetical protein F383_32963                         184   1e-51   
ref|XP_010682684.1|  PREDICTED: NAC transcription factor 25-like        184   1e-51   
ref|XP_007139098.1|  hypothetical protein PHAVU_008G001000g             182   1e-51   
ref|XP_008374203.1|  PREDICTED: NAC transcription factor 25-like        181   1e-51   
ref|XP_009131323.1|  PREDICTED: NAC transcription factor 29-like ...    181   2e-51   
ref|XP_002511122.1|  transcription factor, putative                     181   2e-51   Ricinus communis
ref|XP_006485134.1|  PREDICTED: NAC transcription factor NAM-B2-like    181   3e-51   
ref|XP_010044859.1|  PREDICTED: NAC transcription factor ONAC010 ...    181   3e-51   
gb|AGL39667.1|  NAC transcription factor 011                            181   4e-51   
ref|XP_007139097.1|  hypothetical protein PHAVU_008G001000g             180   4e-51   
ref|XP_002321734.1|  hypothetical protein POPTR_0015s11420g             179   7e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010663782.1|  PREDICTED: NAC transcription factor 25             178   1e-50   
gb|AFK40346.1|  unknown                                                 178   1e-50   
ref|XP_007211149.1|  hypothetical protein PRUPE_ppa027024mg             178   2e-50   
gb|AID55351.1|  NAC protein 4                                           179   2e-50   
gb|AID55355.1|  NAC protein 4                                           178   3e-50   
gb|KDO42905.1|  hypothetical protein CISIN_1g047398mg                   178   3e-50   
gb|ADG86425.1|  NAC-like protein 1                                      177   5e-50   
ref|XP_010556110.1|  PREDICTED: NAC transcription factor 29-like        177   1e-49   
ref|XP_009349483.1|  PREDICTED: NAC transcription factor 25-like        174   1e-49   
ref|XP_010533371.1|  PREDICTED: NAC domain-containing protein 18-...    176   2e-49   
gb|AIA57524.1|  NAC domain-containing protein                           172   3e-49   
ref|XP_008239527.1|  PREDICTED: NAC transcription factor 25             175   3e-49   
ref|XP_010044858.1|  PREDICTED: NAC transcription factor ONAC010 ...    176   3e-49   
ref|XP_007137875.1|  hypothetical protein PHAVU_009G163200g             175   3e-49   
gb|AGT01909.1|  NAC transcription factor                                174   4e-49   
ref|XP_009788540.1|  PREDICTED: NAC transcription factor 29-like        175   4e-49   
gb|AHJ79193.1|  NAC domain protein NAC52                                175   5e-49   
emb|CDY53625.1|  BnaC03g71470D                                          175   6e-49   
ref|XP_008392723.1|  PREDICTED: NAC transcription factor 29-like        173   6e-49   
dbj|BAJ33903.1|  unnamed protein product                                175   6e-49   
ref|XP_006399806.1|  hypothetical protein EUTSA_v10014495mg             175   6e-49   
ref|XP_009342208.1|  PREDICTED: NAC transcription factor 25-like        174   7e-49   
ref|XP_010024206.1|  PREDICTED: NAC transcription factor 25-like        174   8e-49   
ref|XP_009347838.1|  PREDICTED: NAC transcription factor 25-like        173   1e-48   
emb|CDY09772.1|  BnaC09g43890D                                          174   1e-48   
gb|KDO83127.1|  hypothetical protein CISIN_1g030727mg                   171   1e-48   
ref|XP_010453374.1|  PREDICTED: NAC domain-containing protein 68-...    174   2e-48   
ref|XP_006438825.1|  hypothetical protein CICLE_v10032547mg             171   2e-48   
gb|KDO83125.1|  hypothetical protein CISIN_1g030727mg                   171   2e-48   
ref|XP_011086848.1|  PREDICTED: NAC transcription factor 25             172   2e-48   
gb|KDO83126.1|  hypothetical protein CISIN_1g030727mg                   170   3e-48   
emb|CDX78512.1|  BnaA03g04240D                                          172   3e-48   
ref|XP_010093938.1|  NAC domain-containing protein 29                   173   4e-48   
emb|CDX85667.1|  BnaA02g01460D                                          172   5e-48   
ref|XP_006366089.1|  PREDICTED: NAC transcription factor 29-like        173   5e-48   
ref|XP_003602768.1|  NAC domain-containing protein                      172   6e-48   
ref|XP_010492064.1|  PREDICTED: NAC transcription factor 25-like        172   6e-48   
emb|CDX69662.1|  BnaA10g20110D                                          172   6e-48   
ref|XP_009125891.1|  PREDICTED: NAC domain-containing protein 18-...    172   7e-48   
gb|AFI56995.1|  NAC5                                                    172   7e-48   
ref|XP_009590289.1|  PREDICTED: NAC transcription factor 29-like        171   1e-47   
ref|XP_009131324.1|  PREDICTED: NAC transcription factor 29-like ...    171   1e-47   
ref|XP_010249131.1|  PREDICTED: NAC transcription factor 25-like        172   1e-47   
gb|AGC27322.1|  NAC domain protein 7                                    172   1e-47   
ref|XP_010419883.1|  PREDICTED: NAC domain-containing protein 68-...    171   1e-47   
ref|XP_002871551.1|  ANAC083                                            171   1e-47   
ref|XP_003532396.1|  PREDICTED: NAC transcription factor ONAC010-...    171   1e-47   
ref|XP_004501729.1|  PREDICTED: NAC transcription factor 29-like        170   2e-47   
ref|NP_196822.1|  NAC domain containing protein 83                      171   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525425.1|  PREDICTED: NAC transcription factor ONAC010-...    171   2e-47   
ref|XP_009121790.1|  PREDICTED: NAC transcription factor 29             171   2e-47   
ref|XP_003630552.1|  NAC domain protein                                 170   2e-47   
emb|CDX91143.1|  BnaC02g04540D                                          170   3e-47   
ref|NP_001266090.1|  NAC transcription factor 25-like                   169   7e-47   
ref|XP_002879454.1|  hypothetical protein ARALYDRAFT_482294             169   8e-47   
ref|XP_010549297.1|  PREDICTED: NAC transcription factor ONAC010-...    169   8e-47   
gb|ACU16982.1|  unknown                                                 168   8e-47   Glycine max [soybeans]
ref|XP_010549298.1|  PREDICTED: NAC domain-containing protein 18-...    169   1e-46   
ref|XP_007159989.1|  hypothetical protein PHAVU_002G283600g             168   1e-46   
ref|XP_006289127.1|  hypothetical protein CARUB_v10002548mg             169   1e-46   
ref|XP_010469465.1|  PREDICTED: NAC transcription factor 29-like        169   1e-46   
ref|NP_180906.1|  NAC domain containing protein 41                      169   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404749.1|  PREDICTED: NAC transcription factor 25-like        167   3e-46   
ref|XP_010413856.1|  PREDICTED: NAC transcription factor 29-like ...    168   4e-46   
ref|XP_009600037.1|  PREDICTED: NAC domain-containing protein 18-...    167   7e-46   
ref|XP_009421046.1|  PREDICTED: NAC domain-containing protein 18-...    166   1e-45   
ref|XP_003528094.1|  PREDICTED: NAC transcription factor ONAC010        166   2e-45   
ref|NP_001233811.1|  uncharacterized protein LOC100147720               166   2e-45   
ref|XP_009804476.1|  PREDICTED: NAC domain-containing protein 18-...    164   6e-45   
ref|XP_004152126.1|  PREDICTED: NAC transcription factor NAM-2-like     164   7e-45   
ref|NP_001118435.1|  NAC domain containing protein 41                   164   8e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CDP13390.1|  unnamed protein product                                164   1e-44   
ref|XP_010413857.1|  PREDICTED: NAC transcription factor 29-like ...    163   2e-44   
ref|XP_008454032.1|  PREDICTED: NAC transcription factor 25-like        162   3e-44   
ref|XP_010907664.1|  PREDICTED: NAC transcription factor 25-like        162   3e-44   
gb|EYU28642.1|  hypothetical protein MIMGU_mgv1a012899mg                162   3e-44   
gb|AIA57530.1|  NAC domain-containing protein                           162   4e-44   
ref|XP_006294782.1|  hypothetical protein CARUB_v10023833mg             162   5e-44   
ref|XP_006844574.1|  hypothetical protein AMTR_s00016p00196760          160   9e-44   
ref|XP_004156954.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    160   1e-43   
ref|XP_011083447.1|  PREDICTED: NAC transcription factor 29-like        160   1e-43   
ref|XP_004503781.1|  PREDICTED: NAC transcription factor 25-like        160   1e-43   
ref|XP_011073111.1|  PREDICTED: NAC transcription factor 25-like        160   2e-43   
ref|XP_008777977.1|  PREDICTED: NAC transcription factor 25-like        159   4e-43   
gb|KEH35702.1|  NAC transcription factor-like protein                   157   6e-43   
ref|XP_008791093.1|  PREDICTED: NAC domain-containing protein 18-...    159   7e-43   
emb|CDY23730.1|  BnaC04g43920D                                          159   7e-43   
gb|EPS68490.1|  hypothetical protein M569_06279                         158   2e-42   
ref|XP_006410492.1|  hypothetical protein EUTSA_v10017152mg             157   2e-42   
ref|XP_009141320.1|  PREDICTED: NAC domain-containing protein 48-...    157   4e-42   
ref|XP_010943745.1|  PREDICTED: NAC transcription factor 25-like        155   1e-41   
gb|AAW28153.1|  NAC-domain protein                                      154   2e-41   Helianthus annuus
ref|XP_009405877.1|  PREDICTED: NAC transcription factor 29-like        154   3e-41   
ref|XP_009405516.1|  PREDICTED: NAC transcription factor NAM-B2-like    154   4e-41   
ref|XP_010929607.1|  PREDICTED: NAC transcription factor 25-like        154   6e-41   
ref|XP_008813225.1|  PREDICTED: NAC transcription factor 25-like        154   6e-41   
ref|XP_009410565.1|  PREDICTED: NAC transcription factor NAM-B1-like    153   1e-40   
ref|XP_010909195.1|  PREDICTED: NAC domain-containing protein 18-...    153   1e-40   
gb|AIZ68166.1|  NAC domain-containing protein 29 isoform 1              152   2e-40   
ref|XP_010036866.1|  PREDICTED: NAC transcription factor ONAC010-...    151   2e-40   
ref|XP_008790723.1|  PREDICTED: NAC transcription factor 25-like ...    151   4e-40   
ref|XP_009393866.1|  PREDICTED: NAC domain-containing protein 18-...    150   9e-40   
ref|XP_009143857.1|  PREDICTED: NAC domain-containing protein 68-...    148   1e-38   
ref|XP_008790722.1|  PREDICTED: NAC transcription factor NAM-B2-l...    147   3e-38   
ref|XP_009388267.1|  PREDICTED: NAC transcription factor NAM-B2-like    145   3e-38   
ref|XP_009379969.1|  PREDICTED: NAC transcription factor NAM-B2-like    145   5e-38   
emb|CDY19496.1|  BnaC04g11030D                                          146   6e-38   
emb|CDY19495.1|  BnaC04g11040D                                          146   6e-38   
ref|XP_011098344.1|  PREDICTED: NAC domain-containing protein 18        147   1e-37   
ref|NP_001284435.1|  NAC domain-containing protein 18-like              146   3e-37   
gb|KHN04148.1|  NAC domain-containing protein 18                        140   5e-37   
ref|XP_003535156.1|  PREDICTED: NAC transcription factor ONAC010-...    139   1e-36   
ref|XP_004147807.1|  PREDICTED: NAC transcription factor ONAC010-...    143   3e-36   
ref|NP_001060017.1|  Os07g0566500                                       145   3e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011096265.1|  PREDICTED: NAC transcription factor 25             144   4e-36   
sp|A2YMR0.1|NAC10_ORYSI  RecName: Full=NAC transcription factor O...    144   7e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_003541060.1|  PREDICTED: NAC transcription factor ONAC010-...    139   9e-36   
gb|AID55354.1|  NAC protein 3                                           141   1e-35   
gb|EYU43023.1|  hypothetical protein MIMGU_mgv1a024673mg                139   1e-35   
ref|XP_002316635.1|  no apical meristem family protein                  141   3e-35   Populus trichocarpa [western balsam poplar]
gb|EPS69130.1|  hypothetical protein M569_05637                         137   3e-35   
ref|XP_010278293.1|  PREDICTED: NAC transcription factor NAM-B2-like    141   4e-35   
ref|XP_004172388.1|  PREDICTED: LOW QUALITY PROTEIN: NAC transcri...    140   4e-35   
gb|AFD54040.1|  NAC transcription factor NAM-1                          142   4e-35   
emb|CAN81855.1|  hypothetical protein VITISV_041250                     137   5e-35   Vitis vinifera
gb|EYU27944.1|  hypothetical protein MIMGU_mgv1a020591mg                139   5e-35   
sp|A0SPJ3.1|NAMA1_TRITD  RecName: Full=NAC transcription factor N...    141   6e-35   Triticum turgidum subsp. durum
ref|XP_008452274.1|  PREDICTED: NAC transcription factor 25-like        140   6e-35   
ref|XP_011047846.1|  PREDICTED: NAC transcription factor 25-like        140   6e-35   
ref|XP_006657850.1|  PREDICTED: NAC transcription factor ONAC010-...    141   7e-35   
ref|XP_009392346.1|  PREDICTED: NAC transcription factor NAM-B2-like    140   8e-35   
ref|XP_004149287.1|  PREDICTED: NAC transcription factor 25-like        140   1e-34   
ref|XP_003540450.1|  PREDICTED: NAC domain-containing protein 18-...    140   1e-34   
gb|EPS59407.1|  hypothetical protein M569_15400                         135   1e-34   
ref|XP_008800137.1|  PREDICTED: NAC transcription factor 25             140   1e-34   
ref|XP_002305677.1|  no apical meristem family protein                  139   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011027905.1|  PREDICTED: NAC transcription factor 25-like        139   1e-34   
gb|AEH68227.1|  NAC transcription factor                                140   2e-34   
gb|AFD54030.1|  NAC transcription factor NAM-1                          140   2e-34   
gb|AEI00650.1|  NAC2                                                    140   2e-34   
gb|AID55353.1|  NAC protein 2                                           138   2e-34   
emb|CBI38329.3|  unnamed protein product                                138   2e-34   
ref|XP_007149615.1|  hypothetical protein PHAVU_005G084600g             139   2e-34   
gb|AFD54039.1|  NAC transcription factor NAM-1                          140   2e-34   
ref|XP_006436908.1|  hypothetical protein CICLE_v10033415mg             132   2e-34   
ref|XP_003635288.1|  PREDICTED: NAC transcription factor 25             138   2e-34   
gb|AFD54038.1|  NAC transcription factor NAM-1                          139   3e-34   
gb|AID55350.1|  NAC protein 3                                           138   3e-34   
ref|XP_003624592.1|  NAC domain transcription factor                    138   3e-34   
gb|AFD54037.1|  NAC transcription factor NAM-1                          139   3e-34   
ref|XP_007025712.1|  NAC domain containing protein 25                   138   3e-34   
ref|XP_003528438.1|  PREDICTED: NAC transcription factor 25-like        138   4e-34   
gb|AGC27313.1|  NAC domain protein 10                                   138   4e-34   
gb|AFD54036.1|  NAC transcription factor NAM-1                          139   4e-34   
ref|XP_008240449.1|  PREDICTED: NAC transcription factor 25             139   5e-34   
gb|KEH31125.1|  NAC transcription factor-like protein                   137   5e-34   
ref|XP_010416688.1|  PREDICTED: NAC domain-containing protein 2-like    135   5e-34   
gb|AID55349.1|  NAC protein 2                                           137   5e-34   
ref|XP_010100577.1|  NAC domain-containing protein 29                   137   5e-34   
emb|CDP05873.1|  unnamed protein product                                137   6e-34   
ref|XP_007148205.1|  hypothetical protein PHAVU_006G188900g             137   6e-34   
ref|XP_003543257.1|  PREDICTED: NAC domain-containing protein 18        138   6e-34   
gb|KHN36793.1|  NAC domain-containing protein 18                        138   7e-34   
ref|XP_006467845.1|  PREDICTED: NAC transcription factor 25-like        137   8e-34   
ref|XP_001773542.1|  predicted protein                                  134   8e-34   
ref|XP_002463039.1|  hypothetical protein SORBIDRAFT_02g036620          138   8e-34   Sorghum bicolor [broomcorn]
ref|XP_006449287.1|  hypothetical protein CICLE_v10015688mg             137   8e-34   
ref|XP_004505006.1|  PREDICTED: NAC transcription factor 25-like        137   8e-34   
gb|KHG20342.1|  NAC domain-containing 18 -like protein                  137   9e-34   
gb|AEI98790.1|  NAC transcription factor NAM-G1                         138   9e-34   
gb|AEI98794.1|  NAC transcription factor NAM-G1                         138   9e-34   
ref|XP_008782755.1|  PREDICTED: NAC domain-containing protein 68-...    136   1e-33   
gb|AEI98789.1|  NAC transcription factor NAM-G1                         138   1e-33   
gb|AEI98791.1|  NAC transcription factor NAM-G1                         138   1e-33   
gb|AGL39678.1|  NAC transcription factor 022                            135   1e-33   
ref|XP_002887684.1|  ANAC032                                            134   1e-33   
gb|AEI98788.1|  NAC transcription factor NAM-G1                         138   1e-33   
gb|AGV29510.1|  putative NAC domain class transcription factor          132   1e-33   
ref|XP_007161811.1|  hypothetical protein PHAVU_001G100200g             137   1e-33   
gb|AEI98793.1|  NAC transcription factor NAM-G1                         137   1e-33   
gb|AHC54052.1|  transcriptional factor NAC11                            137   1e-33   
ref|XP_007159283.1|  hypothetical protein PHAVU_002G224900g             136   2e-33   
ref|XP_002519008.1|  transcription factor, putative                     136   2e-33   Ricinus communis
ref|XP_006302722.1|  hypothetical protein CARUB_v10020834mg             134   2e-33   
gb|KEH38791.1|  NAC transcription factor-like protein                   136   2e-33   
ref|XP_004487678.1|  PREDICTED: NAC domain-containing protein 18-...    136   2e-33   
ref|NP_177869.1|  NAC domain containing protein 32                      134   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AID55352.1|  NAC protein 1                                           135   2e-33   
dbj|BAK04712.1|  predicted protein                                      137   2e-33   
gb|ABI94356.1|  NAC transcription factor NAM-D2                         137   2e-33   Aegilops tauschii
gb|AEH68228.1|  NAC transcription factor                                137   2e-33   
gb|AFD54031.1|  NAC transcription factor NAM-1                          137   2e-33   
ref|XP_011042501.1|  PREDICTED: NAC domain-containing protein 18-...    136   2e-33   
ref|XP_007202090.1|  hypothetical protein PRUPE_ppa007445mg             136   2e-33   
ref|XP_010675608.1|  PREDICTED: NAC transcription factor 25             137   2e-33   
ref|XP_011095244.1|  PREDICTED: NAC transcription factor 25-like        136   2e-33   
emb|CDM83185.1|  unnamed protein product                                137   2e-33   
ref|XP_006390089.1|  hypothetical protein EUTSA_v10018998mg             134   3e-33   
ref|XP_010428823.1|  PREDICTED: NAC domain-containing protein 2-like    134   3e-33   
gb|AID55348.1|  NAC protein 1                                           135   3e-33   
gb|AGC27321.1|  NAC domain protein 10                                   135   3e-33   
ref|XP_010471939.1|  PREDICTED: NAC domain-containing protein 2-like    133   3e-33   
emb|CDX82430.1|  BnaA03g33910D                                          132   3e-33   
sp|A0SPJ6.1|NAMB2_TRITD  RecName: Full=NAC transcription factor N...    136   3e-33   Triticum turgidum subsp. durum
ref|XP_004493136.1|  PREDICTED: NAC transcription factor 25-like        135   3e-33   
ref|XP_002512886.1|  transcription factor, putative                     133   3e-33   Ricinus communis
ref|XP_010089502.1|  NAC domain-containing protein 18                   136   3e-33   
ref|XP_010060527.1|  PREDICTED: NAC domain-containing protein 18-...    136   3e-33   
gb|AIZ97668.1|  NAC transcription factor NAM-D2                         136   3e-33   
ref|XP_009769986.1|  PREDICTED: NAC transcription factor 25             135   3e-33   
gb|EYU33415.1|  hypothetical protein MIMGU_mgv1a009589mg                135   3e-33   
gb|AEI00651.1|  NAC3                                                    136   3e-33   
ref|XP_002532683.1|  NAC domain-containing protein, putative            135   3e-33   Ricinus communis
gb|ACD39374.1|  NAC domain protein                                      130   4e-33   Glycine max [soybeans]
ref|XP_002273649.1|  PREDICTED: NAC domain-containing protein 68        133   4e-33   Vitis vinifera
ref|XP_004293567.1|  PREDICTED: NAC transcription factor 25-like        135   4e-33   
ref|XP_008799210.1|  PREDICTED: NAC transcription factor 25-like ...    136   4e-33   
ref|XP_001769642.1|  predicted protein                                  132   4e-33   
ref|XP_009780447.1|  PREDICTED: NAC transcription factor 25-like        133   4e-33   
gb|AHJ79194.1|  NAC domain protein NAC53                                135   4e-33   
ref|XP_010686575.1|  PREDICTED: NAC transcription factor 25-like        135   4e-33   
gb|AFD54034.1|  NAC transcription factor NAM-1                          136   5e-33   
ref|XP_006829769.1|  hypothetical protein AMTR_s00119p00026870          134   5e-33   
gb|AAM65083.1|  GRAB1-like protein                                      133   5e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AIW49540.1|  NAC transcription factor NAM-A2                         136   5e-33   
gb|AGZ20119.1|  NAC transcription factor NAM-B1                         136   5e-33   
ref|XP_010521273.1|  PREDICTED: NAC domain-containing protein 2         134   5e-33   
emb|CBZ39281.1|  NAC transcription factor                               135   5e-33   
gb|AGT56012.1|  sinor-like protein 1                                    134   5e-33   
gb|AGZ20129.1|  NAC transcription factor NAM-B1                         136   5e-33   
ref|XP_009379434.1|  PREDICTED: NAC transcription factor 25             135   5e-33   
ref|XP_009378497.1|  PREDICTED: NAC domain-containing protein 18-...    135   6e-33   
gb|AGL39685.1|  NAC transcription factor 029                            135   6e-33   
ref|XP_003562891.1|  PREDICTED: NAC transcription factor NAM-B2-like    136   6e-33   
gb|AGZ20135.1|  NAC transcription factor NAM-B1                         135   6e-33   
gb|KFK42139.1|  hypothetical protein AALP_AA2G216200                    133   6e-33   
ref|XP_010268761.1|  PREDICTED: NAC transcription factor 25-like        135   6e-33   
gb|AEI98787.1|  NAC transcription factor NAM-G1                         135   7e-33   
ref|NP_001236142.1|  transcriptional factor NAC11                       135   7e-33   
ref|NP_001281058.1|  NAC transcription factor 25-like                   135   7e-33   
gb|KFK42926.1|  hypothetical protein AALP_AA1G056200                    134   7e-33   
ref|NP_001266277.1|  uncharacterized protein LOC101247735               134   7e-33   
ref|XP_004984512.1|  PREDICTED: NAC transcription factor NAM-B1-like    135   8e-33   
ref|XP_004978885.1|  PREDICTED: NAC domain-containing protein 71-...    134   9e-33   
gb|AAU43923.2|  NAC domain protein                                      134   9e-33   
gb|AEI98795.1|  NAC transcription factor NAM-G1                         135   9e-33   
ref|XP_009366417.1|  PREDICTED: NAC transcription factor 29-like        135   9e-33   
ref|XP_007133059.1|  hypothetical protein PHAVU_011G148000g             134   1e-32   
sp|A0SPJ9.1|NAM2_HORVD  RecName: Full=NAC transcription factor NA...    135   1e-32   
ref|XP_009390395.1|  PREDICTED: NAC transcription factor NAM-B1-like    131   1e-32   
ref|XP_009594217.1|  PREDICTED: NAC transcription factor 25-like        134   1e-32   
ref|XP_009345059.1|  PREDICTED: NAC transcription factor 29-like        134   1e-32   
emb|CBI21309.3|  unnamed protein product                                129   1e-32   
gb|AGH32785.1|  NAC transcription factor NAM-B1                         135   1e-32   
ref|XP_007021327.1|  NAC domain protein, IPR003441                      134   1e-32   
tpg|DAA63172.1|  TPA: putative NAC domain transcription factor su...    135   1e-32   
ref|XP_003518189.1|  PREDICTED: NAC transcription factor NAM-2-like     134   1e-32   
gb|AGZ20137.1|  NAC transcription factor NAM-B1                         135   1e-32   
gb|AAB71483.1|  similar to NAM (gp|X92205|1321924) and CUC2 (gp|A...    133   1e-32   
gb|AGZ20132.1|  NAC transcription factor NAM-B1                         135   1e-32   
ref|XP_009404860.1|  PREDICTED: NAC domain-containing protein 48-...    132   1e-32   
ref|XP_002316919.2|  no apical meristem family protein                  134   1e-32   
ref|NP_001170390.1|  uncharacterized protein LOC100384376               131   1e-32   
gb|AGZ20118.1|  NAC transcription factor NAM-B1                         135   1e-32   
sp|A0SPJ4.1|NAMB1_TRIDC  RecName: Full=NAC transcription factor N...    134   1e-32   
gb|AEI00649.1|  NAC1                                                    134   2e-32   
gb|ABI94354.1|  NAC transcription factor NAM-D1                         134   2e-32   
gb|AGZ20123.1|  NAC transcription factor NAM-B1                         134   2e-32   
gb|AHN60139.1|  NAC transcription factor 32                             132   2e-32   
ref|XP_011029435.1|  PREDICTED: NAC domain-containing protein 18-...    134   2e-32   
emb|CDP06728.1|  unnamed protein product                                134   2e-32   
gb|AAM65392.1|  NAM protein, putative                                   133   2e-32   
emb|CDY40894.1|  BnaCnng09850D                                          131   2e-32   
ref|XP_007211453.1|  hypothetical protein PRUPE_ppa007314mg             134   2e-32   
gb|AHJ79180.1|  NAC domain protein NAC39                                133   2e-32   
ref|XP_010088481.1|  NAC domain-containing protein 29                   134   2e-32   
ref|XP_009113148.1|  PREDICTED: NAC transcription factor 25             133   2e-32   
ref|XP_010036180.1|  PREDICTED: NAC transcription factor 29-like        133   2e-32   
gb|ADP69101.1|  NAC transcription factor 1                              133   2e-32   
emb|CDY40970.1|  BnaCnng10130D                                          133   2e-32   
emb|CDY12886.1|  BnaA09g13880D                                          133   2e-32   
gb|AGH32788.1|  NAC transcription factor NAM-B1                         134   2e-32   
ref|XP_006300981.1|  hypothetical protein CARUB_v10021371mg             133   2e-32   
gb|KFK35761.1|  hypothetical protein AALP_AA4G032900                    132   2e-32   
emb|CAG28971.1|  NAM-like protein                                       134   2e-32   
gb|EPS72690.1|  hypothetical protein M569_02069                         131   2e-32   
gb|AGL39684.1|  NAC transcription factor 028                            133   2e-32   
gb|AGH32787.1|  NAC transcription factor NAM-B1                         134   2e-32   
ref|XP_004958056.1|  PREDICTED: NAC transcription factor NAM-2-like     134   2e-32   
ref|XP_008799211.1|  PREDICTED: NAC transcription factor ONAC010-...    129   2e-32   
ref|XP_006827706.1|  hypothetical protein AMTR_s00009p00259320          132   2e-32   
ref|XP_002465328.1|  hypothetical protein SORBIDRAFT_01g036560          134   3e-32   
ref|XP_010418059.1|  PREDICTED: NAC transcription factor 25-like        133   3e-32   
emb|CBZ39284.1|  NAC transcription factor                               130   3e-32   
ref|XP_007211475.1|  hypothetical protein PRUPE_ppa007577mg             133   3e-32   
ref|NP_171677.1|  putative transcriptional activator with NAC domain    132   3e-32   
emb|CDY42902.1|  BnaC05g47490D                                          131   3e-32   
gb|ACJ14498.1|  mutant NAC domain protein                               133   3e-32   
ref|XP_006392059.1|  hypothetical protein EUTSA_v10023591mg             132   3e-32   
ref|NP_001066034.2|  Os12g0123700                                       128   3e-32   
ref|XP_008383789.1|  PREDICTED: NAC transcription factor 25-like ...    133   3e-32   
ref|XP_003541120.1|  PREDICTED: NAC domain-containing protein 18-...    133   3e-32   
gb|ADP69102.1|  NAC transcription factor 1                              133   3e-32   
gb|AEI00653.1|  NAC5                                                    134   3e-32   
dbj|BAE98531.1|  hypothetical protein with NAC domain protein           127   3e-32   
ref|NP_564771.1|  NAC domain containing protein 25                      132   3e-32   
gb|EYU23056.1|  hypothetical protein MIMGU_mgv1a011503mg                131   4e-32   
ref|XP_006370307.1|  no apical meristem family protein                  133   4e-32   
ref|NP_001280970.1|  NAC transcription factor 25-like                   133   4e-32   
ref|XP_009394856.1|  PREDICTED: NAC transcription factor 25-like        132   4e-32   
ref|XP_008780790.1|  PREDICTED: NAC transcription factor 29-like        127   4e-32   
ref|XP_010054307.1|  PREDICTED: NAC transcription factor 25-like        133   4e-32   
ref|XP_009410477.1|  PREDICTED: NAC transcription factor 29-like        131   4e-32   
gb|AFD54032.1|  NAC transcription factor NAM-1                          133   4e-32   
gb|KHN46799.1|  NAC domain-containing protein 29                        132   4e-32   
ref|NP_001274379.1|  NAC domain-containing protein 18-like              133   4e-32   
ref|XP_009420184.1|  PREDICTED: NAC domain-containing protein 48-...    131   4e-32   
gb|KHN36348.1|  NAC domain-containing protein 18                        133   4e-32   
gb|EAZ19492.1|  hypothetical protein OsJ_35058                          130   4e-32   
ref|XP_011098931.1|  PREDICTED: NAC domain-containing protein 18        130   4e-32   
ref|NP_001065627.1|  Os11g0126900                                       128   4e-32   
ref|XP_009387374.1|  PREDICTED: NAC transcription factor 29-like        132   5e-32   
gb|KHG07368.1|  NAC domain-containing 18 -like protein                  132   5e-32   
ref|XP_006362947.1|  PREDICTED: NAC transcription factor 25-like        132   5e-32   
gb|KHN08560.1|  NAC domain-containing protein 18                        132   5e-32   
ref|XP_001754918.1|  predicted protein                                  127   5e-32   
emb|CBI20351.3|  unnamed protein product                                132   5e-32   
ref|XP_002319143.2|  hypothetical protein POPTR_0013s05080g             132   5e-32   
gb|AHJ79165.1|  NAC domain protein NAC24                                132   5e-32   
ref|XP_008226677.1|  PREDICTED: NAC transcription factor 25             132   5e-32   
ref|XP_009393819.1|  PREDICTED: NAC domain-containing protein 2-l...    131   5e-32   
ref|XP_007027296.1|  NAC domain protein, IPR003441, putative            132   6e-32   
ref|XP_006451941.1|  hypothetical protein CICLE_v10008628mg             132   6e-32   
ref|NP_001234652.1|  NAC domain protein                                 132   6e-32   
ref|XP_001752718.1|  predicted protein                                  129   6e-32   
ref|XP_003541742.1|  PREDICTED: NAC transcription factor 25-like        132   6e-32   
ref|XP_009135446.1|  PREDICTED: NAC domain-containing protein 18-...    132   7e-32   
ref|XP_004505411.1|  PREDICTED: NAC transcription factor 29-like        130   7e-32   
gb|AGS08767.1|  NAC domain protein                                      132   7e-32   
ref|XP_010533896.1|  PREDICTED: NAC transcription factor 25 isofo...    130   7e-32   
ref|XP_009128229.1|  PREDICTED: NAC domain-containing protein 2         130   7e-32   
ref|XP_002443168.1|  hypothetical protein SORBIDRAFT_08g014060          130   7e-32   
ref|XP_010473311.1|  PREDICTED: NAC transcription factor 25-like        131   7e-32   
ref|XP_009420951.1|  PREDICTED: NAC transcription factor 29-like        131   7e-32   
ref|XP_006841705.1|  hypothetical protein AMTR_s00003p00252470          132   7e-32   
gb|AFD54033.1|  NAC transcription factor NAM-1                          132   8e-32   
dbj|BAK06957.1|  predicted protein                                      132   8e-32   
ref|XP_002284654.2|  PREDICTED: NAC transcription factor 25 isofo...    132   8e-32   
gb|EMT02241.1|  NAC domain-containing protein 29                        129   8e-32   
ref|XP_003557998.1|  PREDICTED: NAC transcription factor NAM-B1-like    132   9e-32   
ref|XP_009353167.1|  PREDICTED: NAC transcription factor 29-like        132   9e-32   
gb|KHG14643.1|  NAC domain-containing 29 -like protein                  132   9e-32   
ref|XP_006447003.1|  hypothetical protein CICLE_v10016434mg             129   9e-32   
ref|XP_010052353.1|  PREDICTED: NAC transcription factor 25-like        131   9e-32   
ref|XP_003547137.1|  PREDICTED: NAC transcription factor 25-like        132   9e-32   
gb|AGZ20124.1|  NAC transcription factor NAM-B1                         132   1e-31   
ref|XP_006418449.1|  hypothetical protein EUTSA_v10008371mg             130   1e-31   
gb|AGS08758.1|  NAC domain protein                                      132   1e-31   
ref|XP_008224995.1|  PREDICTED: NAC transcription factor 25             132   1e-31   
gb|AAU08785.1|  NAC domain transcription factor                         131   1e-31   
ref|XP_010430102.1|  PREDICTED: NAC transcription factor 25             131   1e-31   
ref|NP_001280963.1|  NAC transcription factor 29                        132   1e-31   
emb|CDM81297.1|  unnamed protein product                                128   1e-31   
gb|ABU40774.1|  NAP-like protein                                        129   1e-31   
gb|KGN64646.1|  hypothetical protein Csa_1G073060                       131   1e-31   
ref|XP_001771652.1|  predicted protein                                  128   1e-31   
gb|ABA95705.1|  NAC domain transcription factor, putative, expressed    132   1e-31   
ref|XP_010644222.1|  PREDICTED: NAC transcription factor 25 isofo...    131   1e-31   
ref|XP_004146638.1|  PREDICTED: NAC transcription factor 25-like        131   1e-31   
ref|XP_004962652.1|  PREDICTED: NAC transcription factor NAM-1-like     130   1e-31   
ref|XP_011034424.1|  PREDICTED: NAC transcription factor 29-like        131   1e-31   
ref|NP_001238061.1|  NAC domain protein                                 131   1e-31   
ref|XP_002991033.1|  hypothetical protein SELMODRAFT_47266              128   1e-31   
ref|XP_010651145.1|  PREDICTED: NAC transcription factor 25-like        127   2e-31   
ref|XP_003575526.1|  PREDICTED: NAC domain-containing protein 68        129   2e-31   
gb|AGZ20133.1|  NAC transcription factor NAM-B1                         131   2e-31   
ref|XP_002892047.1|  hypothetical protein ARALYDRAFT_887272             129   2e-31   
ref|NP_001065919.1|  Os11g0184900                                       130   2e-31   
gb|AFW65457.1|  putative NAC domain transcription factor superfam...    126   2e-31   
ref|XP_010939827.1|  PREDICTED: NAC transcription factor 29-like ...    129   2e-31   
ref|XP_010533895.1|  PREDICTED: NAC transcription factor 25 isofo...    130   2e-31   
gb|EAY80191.1|  hypothetical protein OsI_35369                          130   2e-31   
gb|AHB63580.1|  NAC transcription factor                                130   2e-31   
ref|XP_009410678.1|  PREDICTED: NAC domain-containing protein 48-...    130   2e-31   
gb|EAZ17676.1|  hypothetical protein OsJ_33216                          125   2e-31   
ref|XP_006663768.1|  PREDICTED: NAC transcription factor 25-like        131   2e-31   
ref|XP_009406849.1|  PREDICTED: NAC domain-containing protein 68-...    129   2e-31   
gb|EMT14095.1|  NAC domain-containing protein 29                        130   2e-31   
gb|AAY44098.1|  NAC domain transcription factor                         130   2e-31   
ref|XP_002282566.1|  PREDICTED: NAC domain-containing protein 67        130   2e-31   
gb|EAY80202.1|  hypothetical protein OsI_35380                          130   3e-31   
ref|XP_003548053.1|  PREDICTED: NAC transcription factor NAM-2          130   3e-31   
ref|XP_010530211.1|  PREDICTED: NAC domain-containing protein 2-like    129   3e-31   
gb|KDO63853.1|  hypothetical protein CISIN_1g025990mg                   128   3e-31   
gb|AAY44097.1|  NAC domain transcription factor                         130   3e-31   
ref|XP_002888109.1|  ANAC025                                            130   3e-31   
ref|XP_009119728.1|  PREDICTED: NAC domain-containing protein 2         129   3e-31   
ref|XP_002520341.1|  NAC domain-containing protein, putative            130   3e-31   
gb|ABA91266.1|  NAC domain transcription factor, putative, expressed    130   3e-31   
gb|KCW71245.1|  hypothetical protein EUGRSUZ_F043412                    125   3e-31   
ref|XP_008677690.1|  PREDICTED: uncharacterized protein LOC100384...    130   3e-31   
ref|NP_001151613.1|  NAC domain transcription factor                    130   3e-31   
ref|XP_009795737.1|  PREDICTED: NAC domain-containing protein 2-l...    128   3e-31   
gb|KFK33194.1|  hypothetical protein AALP_AA6G342200                    129   4e-31   
emb|CDY50880.1|  BnaA05g37410D                                          129   4e-31   
gb|AGC97438.1|  NAC protein 8                                           130   4e-31   
emb|CBZ39285.1|  NAC transcription factor                               130   4e-31   
ref|XP_009125011.1|  PREDICTED: NAC domain-containing protein 67-...    130   4e-31   
ref|XP_009416337.1|  PREDICTED: NAC transcription factor 29-like        128   4e-31   
ref|XP_004290890.1|  PREDICTED: NAC domain-containing protein 2-like    129   4e-31   
ref|XP_001779494.1|  predicted protein                                  125   4e-31   
gb|EAZ17264.1|  hypothetical protein OsJ_32784                          130   4e-31   
ref|XP_004291668.1|  PREDICTED: NAC transcription factor ONAC010-...    129   4e-31   
ref|XP_009593586.1|  PREDICTED: NAC transcription factor ONAC010 ...    125   4e-31   
gb|EAY82108.1|  hypothetical protein OsI_37306                          130   4e-31   
dbj|BAJ99416.1|  predicted protein                                      130   4e-31   
ref|XP_006443351.1|  hypothetical protein CICLE_v10020717mg             130   5e-31   
ref|XP_008782759.1|  PREDICTED: NAC transcription factor 25-like        129   5e-31   
tpg|DAA64160.1|  TPA: putative NAC domain transcription factor su...    130   5e-31   
ref|XP_002450434.1|  hypothetical protein SORBIDRAFT_05g005450          130   5e-31   
gb|AFD54035.1|  NAC transcription factor NAM-1                          130   5e-31   
ref|XP_010910754.1|  PREDICTED: NAC domain-containing protein 48-...    128   5e-31   
ref|XP_010921289.1|  PREDICTED: NAC transcription factor 25-like        129   5e-31   
gb|EMS45984.1|  NAC domain-containing protein 71                        125   5e-31   
ref|XP_008793369.1|  PREDICTED: NAC domain-containing protein 68-...    128   6e-31   
gb|ADK25055.1|  NAC1 transcription factor                               128   6e-31   
ref|XP_009394855.1|  PREDICTED: NAC domain-containing protein 68-...    128   6e-31   
emb|CDY22671.1|  BnaC08g43050D                                          125   6e-31   
ref|XP_009130419.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...    129   6e-31   
gb|ACD39367.1|  NAC domain protein                                      125   6e-31   
ref|XP_010539001.1|  PREDICTED: NAC domain-containing protein 2-like    128   6e-31   
ref|XP_006662692.1|  PREDICTED: NAC transcription factor 25-like        130   6e-31   
gb|KCW85722.1|  hypothetical protein EUGRSUZ_B02485                     128   7e-31   
ref|XP_006488646.1|  PREDICTED: NAC domain-containing protein 18-...    129   7e-31   
ref|XP_003553546.1|  PREDICTED: NAC transcription factor 25-like        129   7e-31   
gb|KDO73209.1|  hypothetical protein CISIN_1g045934mg                   129   7e-31   
ref|XP_009795736.1|  PREDICTED: NAC domain-containing protein 2-l...    128   7e-31   
ref|XP_009406848.1|  PREDICTED: NAC transcription factor 29-like        129   7e-31   
ref|XP_006305484.1|  hypothetical protein CARUB_v10009926mg             128   7e-31   
ref|XP_002525467.1|  transcription factor, putative                     129   7e-31   
gb|AAN31929.1|  unknown protein                                         128   7e-31   
gb|ACI15346.1|  NAC domain protein NAC5                                 129   7e-31   
gb|KHN02351.1|  NAC domain-containing protein 29                        129   7e-31   
ref|XP_009418167.1|  PREDICTED: NAC transcription factor NAM-B2-like    130   7e-31   
gb|AGL39682.1|  NAC transcription factor 026                            129   7e-31   



>ref|XP_009597132.1| PREDICTED: NAC transcription factor 25-like [Nicotiana tomentosiformis]
Length=245

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 145/198 (73%), Gaps = 18/198 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FV+D    +KLPPGFRFQPTE+EIVFQYL RKTFS  LPAS+I E+ NIC++DPW+L
Sbjct  3    KFNFVKDGA--IKLPPGFRFQPTEEEIVFQYLIRKTFSCPLPASIIPEI-NICKHDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQ DRYFFS+KEA KY NG++++R +S+GYWKP+   +K ITC  +      I+GM
Sbjct  60   PGDIEQ-DRYFFSNKEA-KYRNGNRSNRATSSGYWKPTGL-DKQITCSKRKP----ILGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK  H S+T+WIMHEYRLV       P   P+  H  K  SQ S++ QIGN 
Sbjct  113  KKTLVFYKGKSSHASRTDWIMHEYRLVL------PKTQPFNFHHFKKSSQSSMV-QIGNW  165

Query  351  VICHVFQKKRVNGKAGEE  298
            V+CH+F KKR NGK  +E
Sbjct  166  VLCHIFMKKR-NGKCDQE  182



>ref|XP_009768847.1| PREDICTED: NAC domain-containing protein 18 [Nicotiana sylvestris]
Length=245

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 144/202 (71%), Gaps = 18/202 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FV+D    +KLPPGFRFQPTE+EIVFQYL RKTFS  LPAS+I E+ NIC++DPW+L
Sbjct  3    KFNFVKDGA--IKLPPGFRFQPTEEEIVFQYLIRKTFSCPLPASIIPEI-NICKHDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQ DRYFFS+KEA KY NG++++R +S+G WKP+   +K ITC  +      I+GM
Sbjct  60   PGDIEQ-DRYFFSNKEA-KYRNGNRSNRATSSGCWKPTGL-DKQITCSKRKP----ILGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK  H S+T WIMHEYRLV       P   P+  H  K  SQ S++ QIGN 
Sbjct  113  KKTLVFYKGKSSHASRTEWIMHEYRLVL------PKNQPFNFHHFKKSSQSSMV-QIGNW  165

Query  351  VICHVFQKKRVNGKAGEESAEV  286
            V+CH+F K+R NGK  ++  E 
Sbjct  166  VLCHIFMKRR-NGKCDQDILEA  186



>emb|CDP14991.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 141/202 (70%), Gaps = 18/202 (9%)
 Frame = -1

Query  888  LHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP  709
            L FV+D   V++LPPGFRFQPT++EIVFQYL RKTFS  LPAS+I E+ N+C++DPW+LP
Sbjct  4    LKFVKDG--VIRLPPGFRFQPTDEEIVFQYLLRKTFSCPLPASIIPEI-NVCKHDPWDLP  60

Query  708  GDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMK  529
            GD+EQ DRYFFS+KEA KYPNG++T+R +  GYWK +  +++ +     SS    ++G++
Sbjct  61   GDLEQ-DRYFFSNKEA-KYPNGNRTNRATDTGYWKATGVDKQIV-----SSRRKPLLGLR  113

Query  528  KTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLV  349
            KTLVF+ GK PHGS+T+WIMHEYRL+                 +   S  S   Q+GN V
Sbjct  114  KTLVFHKGKSPHGSRTDWIMHEYRLILTGKTA-------CCSQQTAKSSQSSSVQLGNWV  166

Query  348  ICHVFQKKRVNGKAGEESAEVC  283
            +CH+F KK  + KA +E+ +VC
Sbjct  167  LCHIFLKKG-STKAVDETVQVC  187



>ref|XP_004235471.1| PREDICTED: NAC transcription factor 29 [Solanum lycopersicum]
Length=256

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 140/207 (68%), Gaps = 16/207 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FV+D    +KLPPGFRFQPT++EIVFQYL RKTFS  LPAS+I E+ NIC+ DPWNL
Sbjct  3    KFNFVKDGA--IKLPPGFRFQPTDEEIVFQYLIRKTFSCPLPASIIPEI-NICKNDPWNL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQ DRYFFS+KEA KY NG++ +R +  GYWKPS   +K I C  +      I+GM
Sbjct  60   PGDVEQ-DRYFFSNKEA-KYRNGNRANRATIGGYWKPSGL-DKQIICSKRKP----IVGM  112

Query  531  KKTLVFYYGK-PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            KKTLVFY GK      +T+WIMHEYRLV +    +  L  +F   K    Q + + QIGN
Sbjct  113  KKTLVFYKGKSASQAYRTDWIMHEYRLV-LPKNSSSNLHVHF--NKSSSQQNNSLVQIGN  169

Query  354  LVICHVFQKKRVNGKAGEESAEV-CGD  277
             V+CH+F KKR NGK  EE  E  C D
Sbjct  170  WVLCHIFLKKR-NGKCDEEIIEANCHD  195



>ref|XP_006366907.1| PREDICTED: NAC transcription factor 25-like [Solanum tuberosum]
Length=260

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 138/204 (68%), Gaps = 20/204 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FV+D    +KLPPGFRFQPT++EIVFQYL RKTFS  LPAS+I E+ NIC  DPW+L
Sbjct  3    KFNFVKDGA--IKLPPGFRFQPTDEEIVFQYLIRKTFSCPLPASIIPEI-NICSNDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQ DRYFFS+KEA KY NG++ +R +  GYWKP+   +K I C  +      I+GM
Sbjct  60   PGDIEQ-DRYFFSNKEA-KYRNGNRANRATIGGYWKPTGL-DKQIICSKRKP----IIGM  112

Query  531  KKTLVFYYGKPP-HGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAK-KDYSQGSLMQQIG  358
            KKTLVFY GK      +T+WIMHEYRLV       P      LHA  K  SQ SL+ QIG
Sbjct  113  KKTLVFYKGKTASQAYRTDWIMHEYRLVL------PKNSSSNLHAHFKKSSQNSLV-QIG  165

Query  357  NLVICHVFQKKRVNGKAGEESAEV  286
            N V+CH+F KKR NGK  EE  E 
Sbjct  166  NWVLCHIFLKKR-NGKCDEEIVEA  188



>gb|AGL39666.1| NAC transcription factor 010 [Jatropha curcas]
 gb|KDP22568.1| hypothetical protein JCGZ_26399 [Jatropha curcas]
Length=241

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 153/236 (65%), Gaps = 36/236 (15%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+F+R+   ++KLPPGFRFQPT++E+VF+YL+RK  S  LPAS+I E+ N+C++DPW+L
Sbjct  3    KLNFMREG--MIKLPPGFRFQPTDEELVFEYLKRKVLSWPLPASIIPEI-NVCKFDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGDMEQE RYFFS+KEA KYPNG++ +R +++GYWK +  + +     G SSS   I+GM
Sbjct  60   PGDMEQE-RYFFSNKEA-KYPNGNRINRATASGYWKATGVDRQ----IGSSSSRNNIIGM  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAI-SPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            KKTLVFY GK P+ S+T+WIMHEYRLV++ + A N PL         + S  +   Q+  
Sbjct  114  KKTLVFYRGKTPNASRTDWIMHEYRLVSLGTTASNFPL--------TNNSVQNSFNQLEK  165

Query  354  LVICHVFQKKRVNGKAGEESAEVCGDninisinegenIVDNAEQQLFERYNLMMRD  187
             V+C +F KKR       E  E C +            ++NAE +    Y+ M RD
Sbjct  166  WVLCRIFLKKR-----NSEIIEDCRN----------GRINNAEPRF---YDFMTRD  203



>ref|XP_011023926.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=248

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 141/205 (69%), Gaps = 15/205 (7%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FVRD GK+ +LPPGFRFQPT++E+VFQYL+RK  S  LPASVI E+ N+C+YDPW L
Sbjct  3    KLNFVRD-GKI-RLPPGFRFQPTDEELVFQYLKRKILSWPLPASVIHEV-NVCKYDPWEL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGDMEQE RYFFS+KE TKYPNG++ +R S++GYWK +  +++ ++   K++    I+GM
Sbjct  60   PGDMEQE-RYFFSNKE-TKYPNGNRVNRSSASGYWKATGLDKQIVSSSWKNNH---IVGM  114

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK  HGS+T+W+MHEYRLV +         P   ++ ++ S      Q+   
Sbjct  115  KKTLVFYRGKATHGSRTDWVMHEYRLVNVGEETTDCNFPQTENSAQNSS-----YQLDKC  169

Query  351  VICHVFQKKRVNGKAGEESAEVCGD  277
            V+C VF K +  G    E  E C +
Sbjct  170  VVCRVFLKNK--GGTRNEIIETCTN  192



>ref|XP_011020822.1| PREDICTED: NAC transcription factor ONAC010-like [Populus euphratica]
Length=255

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 143/205 (70%), Gaps = 17/205 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++    V+LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNGA--VRLPPGFRFHPTDEELVVQYLKRKVFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ +T  G  +     +GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGIDKQIVTSKGNQA-----VGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHG++T+WIMHEYRL +   A    L        K+  QGS++  + N 
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLASTETAACNAL------LNKNSIQGSVVVPMENW  166

Query  351  VICHVFQKKRVNGKAGEESAEVCGD  277
            V+C +F KKR + K  EE+ +   D
Sbjct  167  VLCRIFLKKR-STKNEEENMQFGND  190



>ref|XP_009336457.1| PREDICTED: NAC transcription factor 25-like [Pyrus x bretschneideri]
Length=255

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 140/201 (70%), Gaps = 18/201 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            R+ FV++   V++LPPGFRF PT++E+V QYL+RK +S  LPAS+I E+ ++C+ DPW+L
Sbjct  3    RISFVKNG--VLRLPPGFRFHPTDEELVLQYLRRKAYSCPLPASIIPEV-DVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ +TC G       ++GM
Sbjct  60   PGDCEQE-RYFFSTREA-KYPNGNRSNRATCSGYWKATGLDKQIVTCRGG-----QVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHG++T+WIMHEYRLV        P  P  + A +  S  S +  + N 
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLVL-------PENPASIAAPEKNSTHSPVVPMDNW  165

Query  351  VICHVFQKKRVNGKAGEESAE  289
            V+C +F KKR  GK  EE  +
Sbjct  166  VLCRIFLKKR-GGKNEEEQVQ  185



>ref|XP_002304662.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE79641.1| no apical meristem family protein [Populus trichocarpa]
Length=255

 Score =   190 bits (483),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 142/205 (69%), Gaps = 17/205 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++    V+LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNGA--VRLPPGFRFHPTDEELVVQYLKRKVFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ +T  G  +     +GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGIDKQIVTSKGNQA-----VGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHG++T+WIMHEYRL +   A    L        K+  QGS+   + N 
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLASTETAACNAL------LNKNSIQGSVAVPMENW  166

Query  351  VICHVFQKKRVNGKAGEESAEVCGD  277
            V+C +F KKR + K  EE+ +   D
Sbjct  167  VLCRIFLKKR-STKNEEENMQFDND  190



>ref|XP_002297860.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE82665.1| no apical meristem family protein [Populus trichocarpa]
Length=257

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 142/205 (69%), Gaps = 17/205 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L FV++   V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLSFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ +T  G       ++GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGIDKQIVTSKGH-----QVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHG++T+WIMHEYRL +        L        K+ +QG ++  + N 
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLASTETTACNTL------KNKNSTQGPVVVPMENW  166

Query  351  VICHVFQKKRVNGKAGEESAEVCGD  277
            V+C +F KKR   K  EE+ +V  D
Sbjct  167  VLCRIFLKKR-GTKNEEENIQVGND  190



>ref|XP_011036132.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica]
Length=257

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 142/205 (69%), Gaps = 17/205 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L FV++   V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLSFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ +T  G  +     +GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGIDKQIVTSKGNQA-----VGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHG++T+WIMHEYRL +        L        K+ +QG ++  + N 
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLASTETTACNAL------KNKNSTQGPVVVPMENW  166

Query  351  VICHVFQKKRVNGKAGEESAEVCGD  277
            V+C +F KKR   K  EE+ +V  D
Sbjct  167  VLCRIFLKKR-GTKNEEENIQVGND  190



>ref|XP_003620957.1| NAC domain protein [Medicago truncatula]
 gb|AES77175.1| NAC transcription factor-like protein [Medicago truncatula]
Length=256

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 136/198 (69%), Gaps = 30/198 (15%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++FV+ +G+V +LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KMNFVKKNGEV-RLPPGFRFHPTDEELVVQYLKRKVFSFPLPASIIPEV-DLCKSDPWDL  60

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGDMEQE RYFFS+KEA KYPNG++++R +++GYWK +  +++ +     +S    + GM
Sbjct  61   PGDMEQE-RYFFSTKEA-KYPNGNRSNRATNSGYWKATGLDKQIM-----NSKTHEVAGM  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRL   S   NPPL                     N 
Sbjct  114  KKTLVFYRGKPPHGSRTDWIMHEYRLT--SSHSNPPLNE-------------------NW  152

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C +F K+R   K GEE
Sbjct  153  VLCRIFLKRRSGAKNGEE  170



>ref|XP_011043026.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=245

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 135/201 (67%), Gaps = 15/201 (7%)
 Frame = -1

Query  888  LHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP  709
             +FVRD   +  LPPGFRFQPTE+E+VFQYL+RK  S  LPASVI E+ N+C+YDPW LP
Sbjct  4    FNFVRDG--MSGLPPGFRFQPTEEELVFQYLKRKILSWPLPASVIPEV-NVCKYDPWELP  60

Query  708  GDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMK  529
            GDMEQE RYFFS+KEA KYPNG++ +R SS+GYWK +  +++ ++   K++ +   +GMK
Sbjct  61   GDMEQE-RYFFSNKEA-KYPNGNRVNRASSSGYWKATGLDKQIVSSSWKNNHV---VGMK  115

Query  528  KTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLV  349
            KTLVFY GK PHGS+T+W+MHEYRLV +   G       F   +      S   Q+   V
Sbjct  116  KTLVFYRGKAPHGSRTDWVMHEYRLVNL---GVETTDSNFPQTENSAQNSSF--QMDKWV  170

Query  348  ICHVFQKKRVNGKAGEESAEV  286
            +C +F K +  G A  E+ E 
Sbjct  171  VCRIFLKNK--GTATTETIET  189



>ref|XP_002512632.1| NAC domain-containing protein, putative [Ricinus communis]
 gb|EEF50084.1| NAC domain-containing protein, putative [Ricinus communis]
Length=254

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 141/193 (73%), Gaps = 19/193 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            RL+FV++   V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++C+ DPW+L
Sbjct  3    RLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVFSCPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R +S+GYWK +  +++ +T  G       ++GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATSSGYWKATGIDKEIVTSKGN-----QLVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVA-ISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            KKTLVFY GKPPHG++T+WIMHEYRLV+  + A N P        KK+  Q S +  + N
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLVSPQTAACNSP-------QKKNPIQ-SPLGAMDN  164

Query  354  LVICHVFQKKRVN  316
             V+C +F KKR N
Sbjct  165  WVLCRIFLKKRSN  177



>ref|XP_008389924.1| PREDICTED: NAC transcription factor 25-like [Malus domestica]
Length=255

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 141/201 (70%), Gaps = 18/201 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            R+ FV++   V++LPPGFRF PT++E+V QYL+RK +S  LPAS+I E+ ++C+ DPW+L
Sbjct  3    RISFVKNG--VLRLPPGFRFHPTDEELVLQYLRRKAYSCPLPASIIPEV-DVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ +TC G       ++GM
Sbjct  60   PGDCEQE-RYFFSTREA-KYPNGNRSNRATCSGYWKATGLDKQIVTCRGGQ-----VVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHG++T+WIMHEYRLV       P  P      +K+ +Q  ++  + N 
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLVL------PENPASIAPPEKNSTQSPVV-PMDNW  165

Query  351  VICHVFQKKRVNGKAGEESAE  289
            V+C +F KKR  GK  EE  +
Sbjct  166  VLCRIFLKKR-GGKNEEEQVQ  185



>ref|XP_008222225.1| PREDICTED: NAC transcription factor NAM-B2 [Prunus mume]
Length=258

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 138/206 (67%), Gaps = 17/206 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            RL+FV++   V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+  +C+ DPW+L
Sbjct  3    RLNFVKNG--VLRLPPGFRFHPTDEELVLQYLKRKVFSCPLPASIIPEV-EVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS++EA KYPNG +++R + +GYWK +  +++ +T  G       ++GM
Sbjct  60   PGDCEQE-RYFFSTREA-KYPNGSRSNRATGSGYWKATGLDKQIVTSRGNQ-----VVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            KKTLVFY GKPPHG++T+WIMHEYRLV A + A N P        K      S +  + N
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLVLAENTAPNAP------QEKNSTQLQSPVVPMDN  166

Query  354  LVICHVFQKKRVNGKAGEESAEVCGD  277
             V+C +F KKR      E+  + C D
Sbjct  167  WVLCRIFLKKRGGKNEEEQVQQPCND  192



>gb|AGC97437.1| NAC protein 7 [Gossypium hirsutum]
Length=255

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 138/203 (68%), Gaps = 19/203 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E+ ++C+ DPW+L
Sbjct  4    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLRRKVLSWPLPASIIPEV-DVCKADPWDL  60

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ ++C G       ++GM
Sbjct  61   PGDLEQE-RYFFSTREA-KYPNGNRSNRATLSGYWKATGIDKQVVSCSGN-----QVVGM  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP G++T+WIMHEYRLV       P         KK+ +Q  L+  + N 
Sbjct  114  KKTLVFYRGKPPQGTRTDWIMHEYRLVTADTCNAP--------HKKNQTQNHLV-AVENW  164

Query  351  VICHVFQKKRVNGKAGEESAEVC  283
            V+C +F KKR      E+    C
Sbjct  165  VLCRIFLKKRSGATNREDDGLQC  187



>ref|XP_007223645.1| hypothetical protein PRUPE_ppa010222mg [Prunus persica]
 gb|EMJ24844.1| hypothetical protein PRUPE_ppa010222mg [Prunus persica]
Length=258

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 138/206 (67%), Gaps = 17/206 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            RL+FV++   V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+  +C+ DPW+L
Sbjct  3    RLNFVKNG--VLRLPPGFRFHPTDEELVLQYLKRKVFSCPLPASIIPEV-EVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS++EA KYPNG +++R + +GYWK +  +++ +T  G       ++GM
Sbjct  60   PGDCEQE-RYFFSTREA-KYPNGSRSNRATGSGYWKATGLDKQIVTSRGNQ-----VVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            KKTLVFY GKPPHG++T+WIMHEYRLV A + A N P        K      S +  + N
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLVLAENTAPNAP------REKNSTQLQSPVVPMDN  166

Query  354  LVICHVFQKKRVNGKAGEESAEVCGD  277
             V+C +F KKR      E+  + C D
Sbjct  167  WVLCRIFLKKRGGKNEEEQVQQPCND  192



>gb|AFK42063.1| unknown [Medicago truncatula]
Length=266

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 136/198 (69%), Gaps = 30/198 (15%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++FV+ +G+V +LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KMNFVKKNGEV-RLPPGFRFHPTDEELVVQYLKRKVFSFPLPASIIPEV-DLCKSDPWDL  60

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGDMEQE RYFFS+KEA KYPNG++++R +++GYWK +  +++ +     +S    + GM
Sbjct  61   PGDMEQE-RYFFSTKEA-KYPNGNRSNRATNSGYWKATGLDKQIM-----NSKTHEVAGM  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRL   S   NPPL                     N 
Sbjct  114  KKTLVFYRGKPPHGSRTDWIMHEYRLT--SSHSNPPLNE-------------------NW  152

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C +F K+R   K GEE
Sbjct  153  VLCRIFLKRRSGAKNGEE  170



>ref|XP_010530936.1| PREDICTED: NAC transcription factor 25-like [Tarenaya hassleriana]
Length=264

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 133/202 (66%), Gaps = 30/202 (15%)
 Frame = -1

Query  885  HFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPG  706
            +FV++   V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E  ++CR DPW+LPG
Sbjct  8    NFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVLSCPLPASIIPEF-DVCRADPWDLPG  64

Query  705  DMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKK  526
            D+E+E RYFFS++EA KYPNG++++R + +GYWK +  +++ +T  G       ++GMKK
Sbjct  65   DLEKE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTTRGN-----QVVGMKK  117

Query  525  TLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVI  346
            TLVFY GKPPHGS+T+WIMHEYRL     A  PP               S M +  N V+
Sbjct  118  TLVFYRGKPPHGSRTDWIMHEYRL-----ASPPP---------------SSMDRAENWVL  157

Query  345  CHVFQKKRVNGKAGEESAEVCG  280
            C VF KKR N    E+    CG
Sbjct  158  CRVFLKKRGNSSKNEDDVVSCG  179



>ref|NP_001238078.1| NAC domain protein [Glycine max]
 gb|ACD39372.1| NAC domain protein [Glycine max]
 gb|KHN03193.1| NAC domain-containing protein 29 [Glycine soja]
Length=229

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 138/202 (68%), Gaps = 29/202 (14%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            ++ FV++    ++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KVSFVKNGE--LRLPPGFRFHPTDEELVLQYLKRKVFSCPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS+KEA KYPNG++++R +++GYWK +  +++ +T  G       ++GM
Sbjct  60   PGDLEQE-RYFFSTKEA-KYPNGNRSNRATNSGYWKATGLDKQIVTSKGN-----QVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRL  ++ A    +P                  + N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLNILN-ASQSHVP------------------MENW  153

Query  351  VICHVFQKKRVNGKAGEESAEV  286
            V+C +F KKR   K GEES +V
Sbjct  154  VLCRIFLKKRSGAKNGEESNKV  175



>gb|KHN24977.1| NAC domain-containing protein 29 [Glycine soja]
Length=224

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 140/199 (70%), Gaps = 26/199 (13%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++FV++    ++LPPGFRF PT++E+V QYL+RK FS  LPAS+I EL ++C+ DPW+L
Sbjct  3    KVNFVKNGE--LRLPPGFRFHPTDEELVLQYLKRKVFSCPLPASIIPEL-HVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS+K A KYPNG++++R +++GYWK +  +++ +T  G +     ++GM
Sbjct  60   PGDLEQE-RYFFSTKVA-KYPNGNRSNRATNSGYWKATGLDKQIVTSKGNN----QVVGM  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP+GS+T+WIMHEYRL+              L+A +  S    M+   N 
Sbjct  114  KKTLVFYRGKPPNGSRTDWIMHEYRLI--------------LNASQSQSHVVPME---NW  156

Query  351  VICHVFQKKRVNGKAGEES  295
            V+C +F K+R+  K GEES
Sbjct  157  VLCRIFLKRRIGAKNGEES  175



>ref|NP_001238630.1| NAC domain protein [Glycine max]
 gb|ACD39373.1| NAC domain protein [Glycine max]
Length=224

 Score =   186 bits (473),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 140/199 (70%), Gaps = 26/199 (13%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++FV++    ++LPPGFRF PT++E+V QYL+RK FS  LPAS+I EL ++C+ DPW+L
Sbjct  3    KVNFVKNGE--LRLPPGFRFHPTDEELVLQYLKRKVFSCPLPASIIPEL-HVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS+K A KYPNG++++R +++GYWK +  +++ +T  G +     ++GM
Sbjct  60   PGDLEQE-RYFFSTKVA-KYPNGNRSNRATNSGYWKATGLDKQIVTSKGNN----QVVGM  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP+GS+T+WIMHEYRL+              L+A +  S    M+   N 
Sbjct  114  KKTLVFYRGKPPNGSRTDWIMHEYRLI--------------LNASQSQSHVVPME---NW  156

Query  351  VICHVFQKKRVNGKAGEES  295
            V+C +F K+R+  K GEES
Sbjct  157  VLCRIFLKRRIGAKNGEES  175



>ref|XP_010250592.1| PREDICTED: NAC transcription factor 25-like [Nelumbo nucifera]
Length=263

 Score =   187 bits (476),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 145/205 (71%), Gaps = 16/205 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FVR+   V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ +IC+YDPW+L
Sbjct  3    KFNFVRNG--VIRLPPGFRFHPTDEELVLQYLKRKVFSCPLPASIIPEV-DICKYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+E E RYFFS++EA KYPNG++++R + +GYWK +  +++ +     +S    ++GM
Sbjct  60   PGDLENE-RYFFSAREA-KYPNGNRSNRATGSGYWKATGLDKQIV-----ASRSNQVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP G++T+W+MHEYRLV   P     + P   H ++  S  + M Q+ + 
Sbjct  113  KKTLVFYQGKPPRGTRTDWVMHEYRLVV--PGTTVCISP---HPQRKNSIQNSMIQMEDW  167

Query  351  VICHVFQKKRVNGKAGEESAEVCGD  277
            V+C +F KKR + K+ EE ++ C +
Sbjct  168  VLCRIFLKKR-STKSEEEISQPCKE  191



>gb|AIZ03377.1| NAC domain-containing protein [Citrus limon]
Length=249

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 140/203 (69%), Gaps = 24/203 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++F+++   V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KINFMKNG--VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+ QE RYFFS++EA KYPNG++++R + +GYWK +  +++  T  G       I+GM
Sbjct  60   PGDVAQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIATSRGN-----QIVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRLV    A N P        KK+++Q +L     N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLVT---AANAP-------QKKNFAQ-TLAVATDNW  161

Query  351  VICHVFQKKRVNGKAGEESAEVC  283
            V+C +F KKR    A  E  E C
Sbjct  162  VLCRIFLKKR---GAKSEDEETC  181



>ref|XP_002264588.1| PREDICTED: NAC transcription factor NAM-B1 [Vitis vinifera]
 emb|CBI38169.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 134/190 (71%), Gaps = 20/190 (11%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK +S  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKAYSCPLPASIIPEV-DVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ +   G       ++GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATVSGYWKATGIDKQIVASKGNQ-----VVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRLV    A   P        +K  +  S M Q  N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLVG---AETTP-------QRKSSTTQSSMAQAENW  162

Query  351  VICHVFQKKR  322
            V+C +F KKR
Sbjct  163  VLCRIFLKKR  172



>gb|ACU15279.1| unknown [Glycine max]
Length=229

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 137/202 (68%), Gaps = 29/202 (14%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            ++ FV++    ++LPPGFRF PT++E+V QYL+RK FS  LP S+I E+ ++C+ DPW+L
Sbjct  3    KVSFVKNGE--LRLPPGFRFHPTDEELVLQYLKRKVFSCPLPTSIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS+KEA KYPNG++++R +++GYWK S  +++ +T  G       ++GM
Sbjct  60   PGDLEQE-RYFFSTKEA-KYPNGNRSNRATNSGYWKASGLDKQIVTSKGN-----QVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRL  ++ A    +P                  + N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLNILN-ASQSHVP------------------MENW  153

Query  351  VICHVFQKKRVNGKAGEESAEV  286
            V+C +F KKR   K GEES +V
Sbjct  154  VLCRIFLKKRSGAKNGEESNKV  175



>ref|XP_010090688.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXB40352.1| NAC domain-containing protein 29 [Morus notabilis]
Length=277

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 136/204 (67%), Gaps = 32/204 (16%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKAFSHPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS+KEA KYPNG++++R +  GYWK +  +++ ++  G       ++GM
Sbjct  60   PGDLEQE-RYFFSTKEA-KYPNGNRSNRATGTGYWKATGIDKQIVSSKGN-----QVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRLV  S                  SQ  +   + N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLVNTS------------------SQSPVEIPMENW  154

Query  351  VICHVFQKKRVNGKAGEESAEVCG  280
            V+C +F KKR    A +   E CG
Sbjct  155  VLCRIFLKKR----ASKNEEENCG  174



>gb|ACU14039.1| unknown [Glycine max]
Length=224

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 140/199 (70%), Gaps = 26/199 (13%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++FV++    ++LPPGFRF PT++E+V QYL+R+ FS  LPAS+I EL ++C+ DPW+L
Sbjct  3    KVNFVKNGE--LRLPPGFRFHPTDEELVLQYLKRRVFSCPLPASIIPEL-HVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS+K A KYPNG++++R +++GYWK +  +++ +T  G +     ++GM
Sbjct  60   PGDLEQE-RYFFSTKVA-KYPNGNRSNRATNSGYWKATGLDKQIVTSKGNN----QVVGM  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP+GS+T+WIMHEYRL+              L+A +  S    M+   N 
Sbjct  114  KKTLVFYRGKPPNGSRTDWIMHEYRLI--------------LNASQSQSHVVPME---NW  156

Query  351  VICHVFQKKRVNGKAGEES  295
            V+C +F K+R+  K GEES
Sbjct  157  VLCRIFLKRRIGAKNGEES  175



>ref|XP_002318155.1| hypothetical protein POPTR_0012s10530g [Populus trichocarpa]
 gb|EEE96375.1| hypothetical protein POPTR_0012s10530g [Populus trichocarpa]
Length=252

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 137/208 (66%), Gaps = 18/208 (9%)
 Frame = -1

Query  888  LHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP  709
             +FVRD   +  LPPGFRFQPTE+E+VFQYL+RK  S  LPASVI E+ N+C+YDPW LP
Sbjct  4    FNFVRDG--MSGLPPGFRFQPTEEELVFQYLKRKILSWPLPASVIPEV-NVCKYDPWELP  60

Query  708  GDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMK  529
            GDMEQE RYFFS+KEA KYPNG++ +R SS+GYWK +  + + ++   K++ +   +GMK
Sbjct  61   GDMEQE-RYFFSNKEA-KYPNGNRVNRASSSGYWKATGLDRQIVSSSWKNNHV---VGMK  115

Query  528  KTLVFYYGKPPHGSKTNWIMHEYRLVAIS-PAGNPPLPPYFLHAKKDY------SQGSLM  370
            KTLVFY GK PHGS+T+W+MHEYRLV +     +   P     A+  Y      +Q S  
Sbjct  116  KTLVFYRGKAPHGSRTDWVMHEYRLVNLGVETTDSNFPQTENSAQASYYYIFYATQNSSF  175

Query  369  QQIGNLVICHVFQKKRVNGKAGEESAEV  286
             Q+   V+C +F K +  G A  E  E 
Sbjct  176  -QMDKWVVCRIFLKNK--GAATTEITET  200



>ref|XP_004140548.1| PREDICTED: NAC transcription factor ONAC010-like [Cucumis sativus]
 ref|XP_004173907.1| PREDICTED: NAC transcription factor ONAC010-like [Cucumis sativus]
 gb|KGN46428.1| hypothetical protein Csa_6G092010 [Cucumis sativus]
Length=257

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 142/199 (71%), Gaps = 20/199 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+  +C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVFSCPLPASIIPEV-EVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+MEQE RYFFS++EA KYPNG++++R +++GYWK +  +++ +T  G       ++G+
Sbjct  60   PGNMEQE-RYFFSTREA-KYPNGNRSNRATTSGYWKATGIDKQIVTSKGN-----QVVGL  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQ-GSLMQQIGN  355
            KKTLVFY GKPPHGS+T+WIMHEYRL   SP      P   L+A ++ S   S +  + N
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLA--SP------PTVCLNASQEKSSFQSCVGPMEN  164

Query  354  LVICHVFQKKRVNGKAGEE  298
             V+C +F KKR NG   EE
Sbjct  165  WVLCRIFLKKR-NGHQNEE  182



>ref|XP_004310115.1| PREDICTED: NAC transcription factor NAM-B2-like [Fragaria vesca 
subsp. vesca]
Length=251

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 135/202 (67%), Gaps = 24/202 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L FVR+    ++LPPGFRF PT++E+V QYL+RK +S  LPAS+I E+  +C+ DPW+L
Sbjct  3    KLSFVRNGE--LRLPPGFRFHPTDEELVLQYLKRKVYSCPLPASIIPEV-EVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ +   G       ++GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIVASRGNQ-----VVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHG++T+WIMHEYRLV              L   K+ S       + N 
Sbjct  113  KKTLVFYRGKPPHGARTDWIMHEYRLV--------------LAEDKNNSTTQSHVPVNNW  158

Query  351  VICHVFQKKRVNGKAGEESAEV  286
            V+C +F KKR +GK  EE  +V
Sbjct  159  VLCRIFLKKRGSGKNEEEQVQV  180



>ref|XP_004297508.1| PREDICTED: NAC transcription factor 29-like [Fragaria vesca subsp. 
vesca]
Length=233

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 137/194 (71%), Gaps = 23/194 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FVR+   + +LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C YDPW+L
Sbjct  3    KFNFVRNG--MTRLPPGFRFQPTDEELVFQYLRCKVFSCPLPASIIPEI-NVCVYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS+KE+ KYPNG++T+RV+S+GYWK + S++K +     S+    I+G 
Sbjct  60   PGDLEQE-RYFFSNKES-KYPNGNRTNRVTSSGYWKATGSDKKIV-----SARRNNIVGK  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KK+LVFY GK P+GSKT+W+MHEY LV              L  +   ++ S+ QQ GN 
Sbjct  113  KKSLVFYRGKAPNGSKTDWVMHEYSLVN------------NLGTRALSTENSINQQ-GNW  159

Query  351  VICHVFQKKRVNGK  310
            V+C +F KKR + K
Sbjct  160  VLCRIFLKKRSSHK  173



>ref|XP_008459893.1| PREDICTED: NAC domain-containing protein 18 [Cucumis melo]
Length=257

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 140/198 (71%), Gaps = 18/198 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E+  +C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVLSCPLPASIIPEV-EVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+MEQE RYFFS++EA KYPNG++++R +++GYWK +  +++ +T  G       ++G+
Sbjct  60   PGNMEQE-RYFFSTREA-KYPNGNRSNRATTSGYWKATGIDKQIVTSKGNQ-----VVGL  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRL +      PP   +    +K   Q S +  + N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLAS------PPTVCFNASQEKSSFQ-SCVGPMENW  165

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C +F KKR NG+  EE
Sbjct  166  VLCRIFLKKR-NGQQNEE  182



>ref|NP_001281000.1| NAC transcription factor 25-like [Malus domestica]
 gb|ADL36803.1| NAC domain class transcription factor [Malus domestica]
Length=255

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 141/201 (70%), Gaps = 18/201 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            R++FV++   V++LPPGFRF PT++E+V QYL+RK +S  LPAS+I E+ ++C+ DPW+L
Sbjct  3    RINFVKNG--VLRLPPGFRFHPTDEELVLQYLRRKVYSCPLPASIIPEV-DVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD  QE RYFFS++EA KYPNG++++R +S+GYWK +  +++ +TC G       ++GM
Sbjct  60   PGDCAQE-RYFFSTREA-KYPNGNRSNRATSSGYWKATGLDKQIVTCRGG-----QVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHG++T+WIMHEYR V       P  P      +K+ +Q  ++  + + 
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRFVL------PENPASIAPPEKNATQSPVV-PMDDW  165

Query  351  VICHVFQKKRVNGKAGEESAE  289
            V+C +F KKR  GK  E+  +
Sbjct  166  VLCRIFLKKR-GGKNEEQQVQ  185



>ref|XP_006438824.1| hypothetical protein CICLE_v10032547mg [Citrus clementina]
 ref|XP_006483038.1| PREDICTED: NAC transcription factor NAM-B2-like [Citrus sinensis]
 gb|ESR52064.1| hypothetical protein CICLE_v10032547mg [Citrus clementina]
Length=249

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 140/205 (68%), Gaps = 24/205 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++F+++   V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KINFMKNG--VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+ QE RYFFS++EA KYPNG++++R + +GYWK +  +++  T  G       I+GM
Sbjct  60   PGDVAQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIATSRGN-----QIVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRLV    A N P        KK+++Q   +    N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLVT---AANAP-------QKKNFAQTPAV-ATDNW  161

Query  351  VICHVFQKKRVNGKAGEESAEVCGD  277
            V+C +F KKR    A  E  E C +
Sbjct  162  VLCRIFLKKR---GAKSEDEETCTE  183



>gb|AIZ03376.1| NAC domain-containing protein [Citrus trifoliata]
Length=249

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 139/203 (68%), Gaps = 24/203 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++F+++   V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KINFMKNG--VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+ QE RYFFS++EA KYPNG++++R + +GYWK +  +++  T  G       I+GM
Sbjct  60   PGDVAQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIATSRGN-----QIVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRLV    A N P        KK+++Q   +    N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLVT---AANAP-------QKKNFAQTPAV-ATDNW  161

Query  351  VICHVFQKKRVNGKAGEESAEVC  283
            V+C +F KKR    A  E  E C
Sbjct  162  VLCRIFLKKR---GAKSEDEETC  181



>ref|XP_007043870.1| NAC domain protein, IPR003441 [Theobroma cacao]
 gb|EOX99701.1| NAC domain protein, IPR003441 [Theobroma cacao]
Length=256

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 144/207 (70%), Gaps = 20/207 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK  +  LPAS+I E+ ++C+ DPW L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLRRKVLAWPLPASIIPEV-DVCKADPWEL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ IT     S    ++GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATVSGYWKATGIDKQIIT-----SRSNQVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            KKTLVFY GKPPHGS+T+WIMHEYRLV A + A N P        KK  +Q   +  + N
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLVSAETAACNAP-------HKKSQTQSHAV-PMEN  164

Query  354  LVICHVFQKKRVN-GKAGEESAEVCGD  277
             V+C +F KKR +  K  ++S + C +
Sbjct  165  WVLCRIFLKKRSSTTKNDDDSMQSCNE  191



>gb|AEI72272.1| NAC domain transcription factor [Citrus trifoliata]
Length=249

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 132/194 (68%), Gaps = 19/194 (10%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+LPGD+ QE RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEV-DVCKSDPWDLPGDVAQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++  T  G       I+GMKKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIATSRGN-----QIVGMKKTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRLV    A N P        KK+++Q   +    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLVT---AANAP-------QKKNFAQTPAV-ATDNWVLCRIFLKKR  171

Query  321  VNGKAGEESAEVCG  280
                  EE+    G
Sbjct  172  GAKSEDEETCTKIG  185



>gb|KHG25755.1| hypothetical protein F383_32963 [Gossypium arboreum]
Length=256

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 135/198 (68%), Gaps = 19/198 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV  +  V++LPPGFRF PT++E+V QYL+RK  +  LPAS+I E+ ++C+ DPW+L
Sbjct  4    KLNFV--NNGVLRLPPGFRFHPTDEELVVQYLRRKVLAWPLPASIIPEV-DVCKADPWDL  60

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ ++C G       ++GM
Sbjct  61   PGDLEQE-RYFFSTREA-KYPNGNRSNRATFSGYWKATGIDKQIVSCRGN-----QVVGM  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP G++T+WIMHEYRLV       P         KK+ +Q  ++  + N 
Sbjct  114  KKTLVFYRGKPPQGTRTDWIMHEYRLVTADTCNAP--------HKKNQTQNHVV-AVENW  164

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C +F  KR  G    E
Sbjct  165  VLCRIFLTKRSGGATKNE  182



>gb|AHF27223.1| NAC transcription factor [Hevea brasiliensis]
Length=254

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 138/191 (72%), Gaps = 19/191 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK ++  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVYACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R +S+GYWK +  +++  T  G       ++GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATSSGYWKATGIDKEIATSKGN-----QLVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAI-SPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            KKTLVFY GKPPHG++T+WIMHEYRLV+  + A N P        +K  S  S +  + N
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLVSTEATACNSP--------QKRNSIQSPLVPMEN  164

Query  354  LVICHVFQKKR  322
             V+C +F KKR
Sbjct  165  WVLCRIFFKKR  175



>gb|AIO02871.1| NAC domain-containing protein [Citrus maxima]
Length=249

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 133/195 (68%), Gaps = 22/195 (11%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+LPGD+ QE RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEV-DVCKSDPWDLPGDVAQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++  T  G       I+GMK+TLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIATSRGN-----QIVGMKRTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRLV    A N P        KK+++Q   +    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLVT---AANAP-------QKKNFAQTPAV-ATDNWVLCRIFLKKR  171

Query  321  VNGKAGEESAEVCGD  277
                A  E  E C +
Sbjct  172  ---GAKSEDEETCTE  183



>ref|XP_007038082.1| NAC domain protein, IPR003441, putative [Theobroma cacao]
 gb|EOY22583.1| NAC domain protein, IPR003441, putative [Theobroma cacao]
Length=249

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 133/191 (70%), Gaps = 18/191 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FVR+   + KLPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C+YDPW+L
Sbjct  3    KLNFVREG--MTKLPPGFRFQPTDEELVFQYLKCKVFSFPLPASIIPEI-NVCKYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+ EQE RYFFSSKEA KY  G++ +R +++GYWK ++  +K IT     S    I GM
Sbjct  60   PGESEQE-RYFFSSKEA-KYRIGNRINRATASGYWK-ATGLDKQIT-----SRRYQIAGM  111

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAI-SPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            +KTLVF+ GKPPHGS+T+WIMHEYRLV + S   N PL      +K    Q  L   +  
Sbjct  112  RKTLVFHMGKPPHGSRTDWIMHEYRLVTVASKDCNSPL------SKNPIIQNYLNHHMEK  165

Query  354  LVICHVFQKKR  322
             V+C +F KKR
Sbjct  166  WVVCRIFLKKR  176



>gb|KHG25754.1| hypothetical protein F383_32963 [Gossypium arboreum]
Length=306

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 135/198 (68%), Gaps = 19/198 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV +   V++LPPGFRF PT++E+V QYL+RK  +  LPAS+I E+ ++C+ DPW+L
Sbjct  54   KLNFVNNG--VLRLPPGFRFHPTDEELVVQYLRRKVLAWPLPASIIPEV-DVCKADPWDL  110

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ ++C G       ++GM
Sbjct  111  PGDLEQE-RYFFSTREA-KYPNGNRSNRATFSGYWKATGIDKQIVSCRGNQ-----VVGM  163

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP G++T+WIMHEYRLV       P         KK+ +Q  ++  + N 
Sbjct  164  KKTLVFYRGKPPQGTRTDWIMHEYRLVTADTCNAP--------HKKNQTQNHVV-AVENW  214

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C +F  KR  G    E
Sbjct  215  VLCRIFLTKRSGGATKNE  232



>ref|XP_010682684.1| PREDICTED: NAC transcription factor 25-like [Beta vulgaris subsp. 
vulgaris]
Length=303

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 141/196 (72%), Gaps = 11/196 (6%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            R++FV+D   V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    RMNFVKDG--VLRLPPGFRFHPTDEELVVQYLKRKVFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQ-EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMG  535
            PG+ ++ ++RYFFS++EA KYPNG++++R + +GYWK +  ++  +T    +++   I+G
Sbjct  60   PGNGDKGQERYFFSTREA-KYPNGNRSNRATVSGYWKATGKDKAVVTGGRSNNNSSFIVG  118

Query  534  MKKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHA--KKDYSQGSLMQQI  361
            MKKTLVFY GKPPHGS+T+WIMHEYRL+  +      + P  L++  KK   Q +  +  
Sbjct  119  MKKTLVFYRGKPPHGSRTDWIMHEYRLIDTNQT---QITPQTLNSPFKKTLLQKT-GEAT  174

Query  360  GNLVICHVFQKKRVNG  313
            G+ V+C +F KKR N 
Sbjct  175  GDWVLCRIFLKKRNNA  190



>ref|XP_007139098.1| hypothetical protein PHAVU_008G001000g [Phaseolus vulgaris]
 gb|ESW11092.1| hypothetical protein PHAVU_008G001000g [Phaseolus vulgaris]
Length=241

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 138/199 (69%), Gaps = 25/199 (13%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++    ++LPPGFRF PT++E+V QYL+RK FS  LPASVI E+ ++C+ DPW+L
Sbjct  3    KLNFVKNGE--LRLPPGFRFHPTDEELVVQYLKRKVFSFPLPASVIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+E+E RYFFS+KE  KYPNG++++R +++GYWK +  +++ +T  G       ++GM
Sbjct  60   PGDLEKE-RYFFSTKEP-KYPNGNRSNRATNSGYWKATGLDKQIVTSKGNQ-----VVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQ-QIGN  355
            KKTLVFY GKPPHGS+T+WIMHEYRL+      N P            SQ  +++  + N
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLL------NAPT--------SSLSQSPVVEVPMEN  158

Query  354  LVICHVFQKKRVNGKAGEE  298
             V+C +F K+R   + GEE
Sbjct  159  WVLCRIFLKRRSGSRNGEE  177



>ref|XP_008374203.1| PREDICTED: NAC transcription factor 25-like [Malus domestica]
Length=226

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 136/198 (69%), Gaps = 23/198 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +  FVR+   +++LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C YDPW+L
Sbjct  3    KFKFVRNG--MIRLPPGFRFQPTDEELVFQYLRCKVFSCPLPASIIPEI-NVCMYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG++EQE RYFFS+KE +KY NG++ +RV+S+GYWK + +++K +     SS    I+G 
Sbjct  60   PGNLEQE-RYFFSNKE-SKYRNGNRANRVTSSGYWKATGADKKIV-----SSRRNHIVGK  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK PH SKT+W+MHEY LV      +       +HA ++      +   GN 
Sbjct  113  KKTLVFYRGKSPHVSKTDWVMHEYCLVNAETTAS-------IHATEN-----ALTPKGNW  160

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C VF KKR +GK  EE
Sbjct  161  VLCRVFSKKR-SGKMNEE  177



>ref|XP_009131323.1| PREDICTED: NAC transcription factor 29-like isoform X1 [Brassica 
rapa]
Length=254

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 132/188 (70%), Gaps = 22/188 (12%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK FS  LP+S+I ++ ++C+ DPW+LPG++E+E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVFSSPLPSSIIPDV-DVCKADPWHLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATESGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL     + +PP+P         +S  S +    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRL-----SSSPPIP---------FSLQSSIGPTQNWVLCRIFLKKR  168

Query  321  VNGKAGEE  298
               K  +E
Sbjct  169  AGDKNEDE  176



>ref|XP_002511122.1| transcription factor, putative [Ricinus communis]
 gb|EEF51724.1| transcription factor, putative [Ricinus communis]
Length=237

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 132/195 (68%), Gaps = 28/195 (14%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            ++KLPPGFRFQPT++E+VFQYL+RK  S  LPAS+I ++ N+C++DPW+LPG+ EQE RY
Sbjct  12   MIKLPPGFRFQPTDEELVFQYLKRKVLSWPLPASIIPDI-NVCKFDPWDLPGNTEQE-RY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS+KE+ KYPNG++ +R +++GYWK ++  EK I   G SSS   ++GMKKTLVFY GK
Sbjct  70   FFSNKES-KYPNGNRINRATASGYWK-ATGLEKQI---GSSSSGNHVVGMKKTLVFYRGK  124

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
             PH ++T+WIMHEYRLV+   AG   L                  Q+   V+C +F K R
Sbjct  125  SPHATRTDWIMHEYRLVS---AGTNSL-----------------NQLEKWVLCRIFFKNR  164

Query  321  VNGKAGEESAEVCGD  277
               + G E+ + C D
Sbjct  165  STERNG-ETIQTCND  178



>ref|XP_006485134.1| PREDICTED: NAC transcription factor NAM-B2-like [Citrus sinensis]
Length=246

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 134/191 (70%), Gaps = 24/191 (13%)
 Frame = -1

Query  888  LHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP  709
             HFVRD   V +LPPGFRFQPT+ E+VFQYL+ K FS  LPA +I  + NI +YDPW+LP
Sbjct  4    FHFVRD--GVTRLPPGFRFQPTDDELVFQYLKCKVFSSPLPAPIIPHI-NIYKYDPWDLP  60

Query  708  GDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSI-PMIMGM  532
            G++EQE RYFFS+ EA KYPNG++ +R +++GYWK +  +++ ++    SS I  M+MGM
Sbjct  61   GNLEQE-RYFFSNNEA-KYPNGNRINRATASGYWKATGLDKQILS----SSRINQMLMGM  114

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK PH S+T+WIMHEYRLV  + A N P       + ++YS     +++ N 
Sbjct  115  KKTLVFYRGKAPHESRTDWIMHEYRLV--TAATNQP-------SSRNYS-----KEMENW  160

Query  351  VICHVFQKKRV  319
            VIC +F KKR 
Sbjct  161  VICKIFMKKRT  171



>ref|XP_010044859.1| PREDICTED: NAC transcription factor ONAC010 isoform X2 [Eucalyptus 
grandis]
 gb|KCW86973.1| hypothetical protein EUGRSUZ_B03537 [Eucalyptus grandis]
Length=251

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 141/197 (72%), Gaps = 17/197 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK +S  LPAS+I E+  +C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVLQYLRRKVYSFPLPASIIPEV-EVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD++QE RYFFS++EA KYPNG++++R + +GYWK +  + + ++  G  S    ++GM
Sbjct  60   PGDLDQE-RYFFSTREA-KYPNGNRSNRATVSGYWKATGIDRQIVSSRGSQS---QVVGM  114

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP GSKT+WIMHEYRLV  +P  +  +PP  ++  +     + ++ + + 
Sbjct  115  KKTLVFYRGKPPSGSKTDWIMHEYRLV--NPEAS--VPPKIMNLNQ-----TPVEPMESW  165

Query  351  VICHVFQKKRVNGKAGE  301
            V+C +F K+R +   GE
Sbjct  166  VLCRIFLKRRSSKNEGE  182



>gb|AGL39667.1| NAC transcription factor 011 [Jatropha curcas]
 gb|KDP23291.1| hypothetical protein JCGZ_23124 [Jatropha curcas]
Length=251

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 143/201 (71%), Gaps = 21/201 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPNG++++R +++GYWK +  +++ +T  G       ++GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNGNRSNRATTSGYWKATGIDKEIVTSKGHQ-----LVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHG++T+WIMHEYRL  ++   N P        KK+  Q   M  + + 
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRL--MTTETNSP-------QKKNIIQSPSM-PMESW  162

Query  351  VICHVFQKKRVNGKAGEESAE  289
            V+C +F KKR + K  EE+ +
Sbjct  163  VLCRIFLKKR-STKNEEENVQ  182



>ref|XP_007139097.1| hypothetical protein PHAVU_008G001000g [Phaseolus vulgaris]
 gb|ESW11091.1| hypothetical protein PHAVU_008G001000g [Phaseolus vulgaris]
Length=240

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 140/199 (70%), Gaps = 26/199 (13%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++    ++LPPGFRF PT++E+V QYL+RK FS  LPASVI E+ ++C+ DPW+L
Sbjct  3    KLNFVKNGE--LRLPPGFRFHPTDEELVVQYLKRKVFSFPLPASVIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+E+E RYFFS+KE  KYPNG++++R +++GYWK +  +++ +T  G       ++GM
Sbjct  60   PGDLEKE-RYFFSTKEP-KYPNGNRSNRATNSGYWKATGLDKQIVTSKGNQ-----VVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQ-QIGN  355
            KKTLVFY GKPPHGS+T+WIMHEYRL+      N P            SQ  +++  + N
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLL------NAPT--------SSLSQSPVVEVPMEN  158

Query  354  LVICHVFQKKRVNGKAGEE  298
             V+C +F K+R +G+ GEE
Sbjct  159  WVLCRIFLKRR-SGRNGEE  176



>ref|XP_002321734.1| hypothetical protein POPTR_0015s11420g [Populus trichocarpa]
 gb|EEF05861.1| hypothetical protein POPTR_0015s11420g [Populus trichocarpa]
Length=226

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 129/196 (66%), Gaps = 31/196 (16%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+ VRD   +++LPPGFRFQPT++E+VFQYL+RK  S  LPASVI E+ N+C+YDPW L
Sbjct  3    KLNLVRDG--MIRLPPGFRFQPTDEELVFQYLKRKILSWPLPASVIHEV-NVCKYDPWEL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS+KE TKYPNG++ +R S++GYWK +  +++ I+   K++    ++GM
Sbjct  60   PGDTEQE-RYFFSNKE-TKYPNGNRVNRSSASGYWKATGLDKQIISSSWKNNH---VVGM  114

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK  HGS+T+W+MHEYRLV  S                         Q+   
Sbjct  115  KKTLVFYRGKATHGSRTDWVMHEYRLVNNSSY-----------------------QLDKW  151

Query  351  VICHVFQKKRVNGKAG  304
            V+C VF K +   + G
Sbjct  152  VVCRVFLKNKGGTRNG  167



>ref|XP_010663782.1| PREDICTED: NAC transcription factor 25 [Vitis vinifera]
 emb|CBI15718.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 23/203 (11%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FVRD   V++LP GFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+ +YDPW+L
Sbjct  3    KFNFVRDG--VIRLPLGFRFQPTDEELVFQYLKCKVFSRPLPASIIPEI-NVSKYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE +YFFS+KEA KY  G++++R +S+GYWK S ++ K IT    SS    ++GM
Sbjct  60   PGDLEQE-KYFFSNKEA-KYQIGNRSNRATSSGYWKASGTD-KQIT----SSRNSQLVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP+ S+T+W+MHEYRL+    AG P         K   S  S+  Q+ + 
Sbjct  113  KKTLVFYRGKPPYDSRTDWVMHEYRLLI---AGAP-------QTKNTPSSSSI--QMEDW  160

Query  351  VICHVFQKKRVNGKAGEESAEVC  283
            V+C VF K+R  G    E+ E C
Sbjct  161  VLCRVFLKRRT-GAEHHEATESC  182



>gb|AFK40346.1| unknown [Lotus japonicus]
Length=235

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 134/198 (68%), Gaps = 24/198 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++FV++    ++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KVNFVKNG--ELRLPPGFRFHPTDEELVVQYLKRKIFSCPLPASIIPEV-DLCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD E+E RYFFS KEA KYPNG++++R +S+GYWK +  +++  T  G       ++GM
Sbjct  60   PGDSERE-RYFFSMKEA-KYPNGNRSNRATSSGYWKATGLDKQISTSKGN-----QVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRL+               +     +QG +   + N 
Sbjct  113  KKTLVFYTGKPPHGSRTDWIMHEYRLLT--------------NTNTTTTQGHVQVPMENW  158

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C +F K+R   K GEE
Sbjct  159  VLCRIFLKRRGGVKNGEE  176



>ref|XP_007211149.1| hypothetical protein PRUPE_ppa027024mg [Prunus persica]
 gb|EMJ12348.1| hypothetical protein PRUPE_ppa027024mg [Prunus persica]
Length=233

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 131/202 (65%), Gaps = 22/202 (11%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FVR+   +++LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C YDPW+L
Sbjct  3    KFNFVRNG--MIRLPPGFRFQPTDEELVFQYLRCKVFSCPLPASIIPEV-NVCMYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS+KE+ KY NG + +RV+S+GYWK + +++K +     SS    I+G 
Sbjct  60   PGDLEQE-RYFFSNKES-KYRNGSRANRVTSSGYWKATGTDKKIV-----SSRRNHIVGK  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK P+G KT+W+MHEY LV      +       L+ K+            N 
Sbjct  113  KKTLVFYRGKAPNGCKTDWVMHEYCLVNAETTASINTAENALNEKE------------NW  160

Query  351  VICHVFQKKRVNGKAGEESAEV  286
            V+C +F KKR      EE   V
Sbjct  161  VLCRIFSKKRSCKTDDEEGIRV  182



>gb|AID55351.1| NAC protein 4 [Actinidia arguta]
Length=245

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 123/180 (68%), Gaps = 24/180 (13%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I    ++C+ DPW+LPGD  QE RY
Sbjct  11   VIRLPPGFRFHPTDEELVVQYLKRKAFSCPLPASIIPVF-DVCKSDPWDLPGDSAQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +TC         ++GMKKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKQIVTCRSN-----QVVGMKKTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP GS+T+WIMHEYRLV                 +K+YS  + M+   N V+C +F KKR
Sbjct  123  PPRGSRTDWIMHEYRLVGA-------------ETEKNYSTQTTME---NWVLCRIFLKKR  166



>gb|AID55355.1| NAC protein 4 [Actinidia chinensis]
Length=245

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 123/180 (68%), Gaps = 24/180 (13%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E  ++C+ DPW+LPGD  QE RY
Sbjct  11   VIRLPPGFRFHPTDEELVVQYLKRKAFSCPLPASIIPEF-DVCKSDPWDLPGDSAQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +TC         ++GMKKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKQIVTCRSN-----QVVGMKKTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP GS+T+WIMHEYRLV                 +K+ S  + M+   N V+C +F KKR
Sbjct  123  PPRGSRTDWIMHEYRLVGA-------------ETEKNNSTQTTME---NWVLCRIFLKKR  166



>gb|KDO42905.1| hypothetical protein CISIN_1g047398mg [Citrus sinensis]
Length=246

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 133/191 (70%), Gaps = 24/191 (13%)
 Frame = -1

Query  888  LHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP  709
              FVRD   V +LPPGFRFQPT+ E+VFQYL+ K FS  LPA +I  + NI +YDPW+LP
Sbjct  4    FQFVRD--GVTRLPPGFRFQPTDDELVFQYLKCKVFSSPLPAPIIPHI-NIYKYDPWDLP  60

Query  708  GDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSI-PMIMGM  532
            G++EQE RYFFS+ EA KYPNG++ +R +++GYWK +  +++ ++    SS I  M+MGM
Sbjct  61   GNLEQE-RYFFSNNEA-KYPNGNRINRATASGYWKATGLDKQILS----SSRINQMLMGM  114

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK PH S+T+WIMHEYRLV  + A N P       + ++YS     +++ N 
Sbjct  115  KKTLVFYRGKAPHESRTDWIMHEYRLV--TAATNQP-------SSRNYS-----KEMENW  160

Query  351  VICHVFQKKRV  319
            VIC +F KKR 
Sbjct  161  VICKIFMKKRT  171



>gb|ADG86425.1| NAC-like protein 1 [Passiflora morifolia]
Length=257

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 137/205 (67%), Gaps = 17/205 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+  +C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFYPTDEELVLQYLKRKVFACPLPASIIPEV-EVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS++E TKYPNG++++R + +GYWK +  +++ +     SS    ++GM
Sbjct  60   PGDWEQE-RYFFSTRE-TKYPNGNRSNRATGSGYWKATGIDKQIV-----SSHSNHVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKT VFY G PP+GS T WIMHEYRL +        L        K+ +QG ++  + N 
Sbjct  113  KKTFVFYGGHPPYGSITEWIMHEYRLASTETTACNTL------KNKNSTQGPVVVPMENW  166

Query  351  VICHVFQKKRVNGKAGEESAEVCGD  277
            V+C +F KKR   K  EE+ +V  D
Sbjct  167  VLCRIFLKKR-GTKNEEENIQVGND  190



>ref|XP_010556110.1| PREDICTED: NAC transcription factor 29-like [Tarenaya hassleriana]
Length=262

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 133/198 (67%), Gaps = 30/198 (15%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E+ ++CR DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVLSCPLPASIIPEV-DVCRADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ +   G +     ++G+
Sbjct  60   PGDSEQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVAARGNT-----VVGL  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRL +                    S  S      N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLSS--------------------SPPSSPSPEENW  152

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C +F KKR +GK+ ++
Sbjct  153  VLCRIFLKKRSSGKSEDD  170



>ref|XP_009349483.1| PREDICTED: NAC transcription factor 25-like [Pyrus x bretschneideri]
Length=167

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 117/147 (80%), Gaps = 10/147 (7%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            R++FV++   V++LPPGFRF PT++E+V QYL+RK +S  LPAS+I E+ ++C+ DPW+L
Sbjct  3    RINFVKNG--VLRLPPGFRFHPTDEELVLQYLRRKVYSCPLPASIIPEV-DVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD  QE RYFFS++EA KYPNG++++R + +GYWK +  +++ +TC G       ++G+
Sbjct  60   PGDCAQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIVTCRGGQ-----VVGI  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLV  451
            KKTLVFY GKPPHG++T+WIMHEYRLV
Sbjct  113  KKTLVFYRGKPPHGTRTDWIMHEYRLV  139



>ref|XP_010533371.1| PREDICTED: NAC domain-containing protein 18-like [Tarenaya hassleriana]
 ref|XP_010521426.1| PREDICTED: NAC domain-containing protein 18-like [Tarenaya hassleriana]
Length=260

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 134/203 (66%), Gaps = 31/203 (15%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVHSSPLPASIIPEV-DVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG +E+E RYFFS++EA KYPNG +++R + +GYWK +  +++ +T  G       ++GM
Sbjct  60   PGGLEKE-RYFFSTREA-KYPNGSRSNRATGSGYWKATGIDKRVVTSRGN-----QVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRL +  P                    S M    N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLASPPP--------------------SSMGPTKNW  152

Query  351  VICHVFQKKRVNGKAGEESAEVC  283
            V+C +F KKR + K+ E+  + C
Sbjct  153  VLCRIFLKKRGHNKS-EDDVDSC  174



>gb|AIA57524.1| NAC domain-containing protein [Boehmeria nivea]
Length=157

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 116/146 (79%), Gaps = 10/146 (7%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKALSHPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS++EA KYPNG++++R + +GYWK +  +++ ++C G       ++GM
Sbjct  60   PGDSEQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGIDKQIVSCRGNQ-----VVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRL  454
            KKTLVFY GKPPHGS+T+WIMHEYRL
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRL  138



>ref|XP_008239527.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=233

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 128/190 (67%), Gaps = 22/190 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FVR+   +++LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C YDPW+L
Sbjct  3    KFNFVRNG--MIRLPPGFRFQPTDEELVFQYLRCKVFSCPLPASIIPEV-NVCMYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS+KE+ KY NG + +RV+S+GYWK + +++K +     SS    I+G 
Sbjct  60   PGDLEQE-RYFFSNKES-KYRNGSRANRVTSSGYWKATGTDKKIV-----SSRRNHIVGK  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK P+G +T+W+MHEY LV      +       L+ K+            N 
Sbjct  113  KKTLVFYRGKAPNGCRTDWVMHEYCLVDAETTTSINTAENALNQKE------------NW  160

Query  351  VICHVFQKKR  322
            V+C +F KKR
Sbjct  161  VLCRIFSKKR  170



>ref|XP_010044858.1| PREDICTED: NAC transcription factor ONAC010 isoform X1 [Eucalyptus 
grandis]
 gb|KCW86972.1| hypothetical protein EUGRSUZ_B03537 [Eucalyptus grandis]
Length=253

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 141/199 (71%), Gaps = 19/199 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK +S  LPAS+I E+  +C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVLQYLRRKVYSFPLPASIIPEV-EVCKSDPWDL  59

Query  711  PG--DMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIM  538
            PG  D++QE RYFFS++EA KYPNG++++R + +GYWK +  + + ++  G  S    ++
Sbjct  60   PGQCDLDQE-RYFFSTREA-KYPNGNRSNRATVSGYWKATGIDRQIVSSRGSQS---QVV  114

Query  537  GMKKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIG  358
            GMKKTLVFY GKPP GSKT+WIMHEYRLV  +P  +  +PP  ++  +     + ++ + 
Sbjct  115  GMKKTLVFYRGKPPSGSKTDWIMHEYRLV--NPEAS--VPPKIMNLNQ-----TPVEPME  165

Query  357  NLVICHVFQKKRVNGKAGE  301
            + V+C +F K+R +   GE
Sbjct  166  SWVLCRIFLKRRSSKNEGE  184



>ref|XP_007137875.1| hypothetical protein PHAVU_009G163200g [Phaseolus vulgaris]
 gb|ESW09869.1| hypothetical protein PHAVU_009G163200g [Phaseolus vulgaris]
Length=237

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 133/192 (69%), Gaps = 29/192 (15%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            RL+F+++   V  LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+ +YDPW+L
Sbjct  3    RLNFIKNG--VSSLPPGFRFQPTDEELVFQYLKCKIFSCQLPASIIPEI-NVSKYDPWDL  59

Query  711  PGDMEQE-DRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPM-IM  538
            PG+ + E +RYFFSSKEA KY NG++ +R +++GYWK + S++K       SSSI   I 
Sbjct  60   PGNCDDEKERYFFSSKEA-KYRNGNRMNRTTNSGYWKATGSDKK------VSSSINNGIS  112

Query  537  GMKKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIG  358
            G++KTLVFY GK P+GS+T W+MHEYRL+++  + + P+                 Q+IG
Sbjct  113  GLRKTLVFYEGKSPNGSRTEWLMHEYRLLSVETSASKPI-----------------QEIG  155

Query  357  NLVICHVFQKKR  322
            + V+C +F KKR
Sbjct  156  DWVLCRIFIKKR  167



>gb|AGT01909.1| NAC transcription factor [Camellia sinensis]
Length=231

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 131/197 (66%), Gaps = 33/197 (17%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L FV++   V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLSFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVFSCPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD  QE RYFFS++EA KY NG++++R + +GYWK ++  +K I+    +S    ++GM
Sbjct  60   PGDSAQE-RYFFSTREA-KYSNGNRSNRATGSGYWK-ATGIDKQIS----TSKSNQVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPPHGS+T+WIMHEYRLV                   D +Q S+     N 
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLV-------------------DSTQASME----NW  149

Query  351  VICHVFQKKRVNGKAGE  301
            V+C +F KKRV     E
Sbjct  150  VLCRIFLKKRVTKNEEE  166



>ref|XP_009788540.1| PREDICTED: NAC transcription factor 29-like [Nicotiana sylvestris]
Length=250

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 136/199 (68%), Gaps = 26/199 (13%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L FV++   V++LPPGFRF+PT++E+V QYL+RK  S  LPAS+I EL  I + DPW+L
Sbjct  3    KLSFVKNG--VLRLPPGFRFRPTDEELVVQYLKRKVLSFPLPASIIPEL-EIHKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+E+E RYFFS++E  KYPNG++++R +++GYWK +  +++ ++C G+      ++G+
Sbjct  60   PGDLEEE-RYFFSTREV-KYPNGNRSNRATNSGYWKATGIDKQIVSCKGQ-----QLVGL  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK PHG +TNWIMHEYRL        P L    + A  + +Q        N 
Sbjct  113  KKTLVFYRGKSPHGCRTNWIMHEYRL--------PNLETISIQANNNLTQ-------ENW  157

Query  351  VICHVFQKKRVNGKAGEES  295
            V+C +F K+R +GK  +E+
Sbjct  158  VLCRIFLKRR-DGKNEDEN  175



>gb|AHJ79193.1| NAC domain protein NAC52 [Gossypium hirsutum]
Length=254

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 138/204 (68%), Gaps = 17/204 (8%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L FV++   V++LPPGFRF PT++E+V QYL+RK  +  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLSFVKNG--VLRLPPGFRFHPTDEELVVQYLRRKVLACPLPASIIPEV-DVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFFS++EA KYPN ++++R + +GYWK +  +++ +T     S     +GM
Sbjct  60   PGDLEQE-RYFFSTREA-KYPNTNRSNRATISGYWKATGIDKQIVT-----SRSNQAVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK P+G +T+WIMHEYR+V+   A     P      KK+ +Q +++  + N 
Sbjct  113  KKTLVFYRGKAPNGCRTDWIMHEYRVVSTETAACNAPP-----NKKNQTQNNVV-PMENW  166

Query  351  VICHVFQKKRVNGKAGEESAEVCG  280
            V+C +F KKR   K  EE  + C 
Sbjct  167  VLCRIFLKKR-GAKNDEEGLQSCN  189



>emb|CDY53625.1| BnaC03g71470D [Brassica napus]
Length=248

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 126/188 (67%), Gaps = 28/188 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I ++ ++CR DPW+LPG++E+E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVFSSPLPASIIPDV-DVCRADPWDLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRAAESGYWKATGIDKRVVTSRGNQ-----IVGLKKTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +  P+   P                      N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSSSPPSSIGP--------------------TQNWVLCRIFLKKR  162

Query  321  VNGKAGEE  298
               K  +E
Sbjct  163  AGDKNEDE  170



>ref|XP_008392723.1| PREDICTED: NAC transcription factor 29-like [Malus domestica]
Length=210

 Score =   173 bits (439),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 133/198 (67%), Gaps = 23/198 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +F+R+   + +LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C YDPW+L
Sbjct  3    KFNFLRNG--MSRLPPGFRFQPTDEELVFQYLRCKVFSCPLPASIIPEI-NVCLYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE +YFFS++E+ KY NG++ +RV+S+GYWK +  ++K +     SS    I+G 
Sbjct  60   PGDLEQE-KYFFSNRES-KYRNGNRANRVTSSGYWKATGVDKKIV-----SSRKNNIVGK  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK P+ SKT+WIMHEY LV      +             ++  + +   GN 
Sbjct  113  KKTLVFYKGKSPNVSKTDWIMHEYCLVNAETTAST------------HTTENALTXKGNW  160

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C VF KKR +GK  EE
Sbjct  161  VLCRVFLKKR-SGKTDEE  177



>dbj|BAJ33903.1| unnamed protein product [Thellungiella halophila]
Length=250

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 127/191 (66%), Gaps = 28/191 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I +  ++CR DPW+LPG++++E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVLSSPLPASIIPDF-DVCRADPWDLPGNLDKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M  I N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPIQNWVLCRIFLKKR  162

Query  321  VNGKAGEESAE  289
               K+ ++  +
Sbjct  163  AGNKSDDDDGD  173



>ref|XP_006399806.1| hypothetical protein EUTSA_v10014495mg [Eutrema salsugineum]
 gb|ESQ41259.1| hypothetical protein EUTSA_v10014495mg [Eutrema salsugineum]
Length=250

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 127/191 (66%), Gaps = 28/191 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I +  ++CR DPW+LPG++++E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVLSSPLPASIIPDF-DVCRADPWDLPGNLDKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M  I N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPIQNWVLCRIFLKKR  162

Query  321  VNGKAGEESAE  289
               K+ ++  +
Sbjct  163  AGNKSDDDDGD  173



>ref|XP_009342208.1| PREDICTED: NAC transcription factor 25-like [Pyrus x bretschneideri]
 ref|XP_009342214.1| PREDICTED: NAC transcription factor 25-like [Pyrus x bretschneideri]
Length=230

 Score =   174 bits (441),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 128/188 (68%), Gaps = 21/188 (11%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            +++LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C YDPW+LPG+ EQE RY
Sbjct  11   MIRLPPGFRFQPTDEELVFQYLRCKVFSCPLPASIIPEI-NVCMYDPWDLPGNSEQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS+KE+ KY NG++ +RV+ +GYWK + +++K +     SS    I+G KKTLVFY GK
Sbjct  69   FFSNKES-KYRNGNRANRVTGSGYWKATGADKKIV-----SSRRNHIVGKKKTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
             PH SKT+W+MHEY LV      +       +H  ++      +   GN V+C VF KKR
Sbjct  123  SPHVSKTDWVMHEYCLVNTETTAS-------IHTTEN-----ALTPKGNWVLCRVFSKKR  170

Query  321  VNGKAGEE  298
             +GK  EE
Sbjct  171  -SGKIDEE  177



>ref|XP_010024206.1| PREDICTED: NAC transcription factor 25-like [Eucalyptus grandis]
 gb|KCW60662.1| hypothetical protein EUGRSUZ_H03387 [Eucalyptus grandis]
Length=259

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 137/197 (70%), Gaps = 18/197 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            ++ FV++   V++LPPGFRF PT++E+V QYL+RK F+  LPAS I E+ ++C+ DPW+L
Sbjct  3    KVSFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKVFACPLPASFIPEV-DVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS++EA KYPNG++++R + +GYWK +  + + ++    S S  +++G+
Sbjct  60   PGDAEQE-RYFFSTREA-KYPNGNRSNRATVSGYWKATGIDRRVVS----SRSHQLVLGL  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            KKTLVFY GK PHGSKT+WIMHEYRLV  ++P     LPP     K + +Q   + +  N
Sbjct  114  KKTLVFYRGKAPHGSKTDWIMHEYRLVDGLAPGT--ALPP-----KMNLNQSPEVPR-EN  165

Query  354  LVICHVFQKKRVNGKAG  304
             V+C +F K+R     G
Sbjct  166  WVLCRIFFKRRSTKNDG  182



>ref|XP_009347838.1| PREDICTED: NAC transcription factor 25-like [Pyrus x bretschneideri]
Length=226

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 129/188 (69%), Gaps = 21/188 (11%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            +++LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C YDPW+LPG++EQE RY
Sbjct  11   MIRLPPGFRFQPTDEELVFQYLRCKVFSCPLPASIIPEI-NVCMYDPWDLPGNLEQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS+KE+ KY NG++ +RV+ +GYWK + +++K +     SS    I+G KKTLVFY GK
Sbjct  69   FFSNKES-KYRNGNRANRVTGSGYWKATGADKKIV-----SSRRNHIVGKKKTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
             PH SKT+W+MHEY LV      +       +H  ++      +   GN V+C VF KKR
Sbjct  123  SPHVSKTDWVMHEYCLVNTETTAS-------IHTTEN-----ALTPKGNWVLCRVFSKKR  170

Query  321  VNGKAGEE  298
             +GK  +E
Sbjct  171  -SGKIDDE  177



>emb|CDY09772.1| BnaC09g43890D [Brassica napus]
Length=276

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 125/191 (65%), Gaps = 28/191 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I +  ++CR DPW+LPG++E+E RY
Sbjct  38   VIRLPPGFRFHPTDEELVVQYLKRKVLSSPLPASIIPDF-DVCRADPWDLPGNIEKE-RY  95

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  96   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  149

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHG +T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  150  PPHGLRTDWIMHEYRLSS--------------------SPLSSMGPTQNWVLCRIFLKKR  189

Query  321  VNGKAGEESAE  289
               K+ E+  +
Sbjct  190  AGNKSDEDDGD  200



>gb|KDO83127.1| hypothetical protein CISIN_1g030727mg [Citrus sinensis]
Length=152

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 111/142 (78%), Gaps = 8/142 (6%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+LPGD+ QE RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEV-DVCKSDPWDLPGDVAQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++  T  G       I+GMKKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIATSRGNQ-----IVGMKKTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPA  436
            PPHGS+T+WIMHEYRLV  + A
Sbjct  123  PPHGSRTDWIMHEYRLVTAANA  144



>ref|XP_010453374.1| PREDICTED: NAC domain-containing protein 68-like [Camelina sativa]
Length=257

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 124/184 (67%), Gaps = 28/184 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E  ++CR DPW+LPG++++E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVSSSPLPASIIPEF-DVCRADPWDLPGNLDKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGNQ-----IVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL     + +PP               S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRL-----SSSPP---------------SCMGPTQNWVLCRIFLKKR  162

Query  321  VNGK  310
               K
Sbjct  163  AGNK  166



>ref|XP_006438825.1| hypothetical protein CICLE_v10032547mg [Citrus clementina]
 gb|ESR52065.1| hypothetical protein CICLE_v10032547mg [Citrus clementina]
Length=182

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 126/173 (73%), Gaps = 20/173 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++F+++   V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KINFMKNG--VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+ QE RYFFS++EA KYPNG++++R + +GYWK +  +++  T  G       I+GM
Sbjct  60   PGDVAQE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIATSRGNQ-----IVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSL  373
            KKTLVFY GKPPHGS+T+WIMHEYRLV    A N P        KK+++Q  L
Sbjct  113  KKTLVFYRGKPPHGSRTDWIMHEYRLVT---AANAP-------QKKNFAQVKL  155



>gb|KDO83125.1| hypothetical protein CISIN_1g030727mg [Citrus sinensis]
Length=172

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 111/142 (78%), Gaps = 8/142 (6%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+LPGD+ QE RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEV-DVCKSDPWDLPGDVAQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++  T  G       I+GMKKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIATSRGNQ-----IVGMKKTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPA  436
            PPHGS+T+WIMHEYRLV  + A
Sbjct  123  PPHGSRTDWIMHEYRLVTAANA  144



>ref|XP_011086848.1| PREDICTED: NAC transcription factor 25 [Sesamum indicum]
Length=236

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 131/201 (65%), Gaps = 35/201 (17%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            RL+ +R+   V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E+ ++C+ DPW+L
Sbjct  3    RLNLMRNG--VLRLPPGFRFHPTDEELVVQYLKRKVLSCPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD +QE RYFFS++E  KYPNG++++R + +GYWK +  +++ +     SS    I+GM
Sbjct  60   PGDSDQE-RYFFSTRE-VKYPNGNRSNRATGSGYWKATGLDKQIV-----SSRTHQIVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            KKTLVFY GKPP G++T+WIMHEYRL+ A  PA                          N
Sbjct  113  KKTLVFYRGKPPKGARTDWIMHEYRLITAEKPAQE------------------------N  148

Query  354  LVICHVFQKKRVNGKAGEESA  292
             V+C +F K+R + K  EE+A
Sbjct  149  WVLCRIFLKRRSSSKNEEEAA  169



>gb|KDO83126.1| hypothetical protein CISIN_1g030727mg [Citrus sinensis]
Length=167

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 111/142 (78%), Gaps = 8/142 (6%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK F+  LPAS+I E+ ++C+ DPW+LPGD+ QE RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKIFACPLPASIIPEV-DVCKSDPWDLPGDVAQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++  T  G       I+GMKKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGLDKQIATSRGNQ-----IVGMKKTLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPA  436
            PPHGS+T+WIMHEYRLV  + A
Sbjct  123  PPHGSRTDWIMHEYRLVTAANA  144



>emb|CDX78512.1| BnaA03g04240D [Brassica napus]
Length=248

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 126/188 (67%), Gaps = 28/188 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I ++ ++C+ DPW+LPG++E+E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVFSSPLPASIIPDV-DVCKADPWHLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATESGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +  P+   P                      N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSSSPPSSIGP--------------------TQNWVLCRIFLKKR  162

Query  321  VNGKAGEE  298
               K  +E
Sbjct  163  AGDKNEDE  170



>ref|XP_010093938.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXB54901.1| NAC domain-containing protein 29 [Morus notabilis]
Length=265

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 136/195 (70%), Gaps = 19/195 (10%)
 Frame = -1

Query  888  LHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPAS----VISELPNICRYDP  721
             +FVR++  V+KLPPGFRFQPT++E+VFQYL+RK FS  +P+S    +I E+ N+C+YDP
Sbjct  5    FNFVRNNNGVIKLPPGFRFQPTDEELVFQYLRRKIFSCPMPSSSDHHIIPEI-NVCKYDP  63

Query  720  WNLP-GDMEQEDRYFFSSKEATKYPNG-DQTSRVSSNGYWKPSSSEEKHITCPGKSSSIP  547
            W+LP GD+ +++RY+FS+KEA KY NG ++ +R +++GYWK + S++K +     SS++ 
Sbjct  64   WDLPSGDIVEQERYYFSNKEA-KYRNGSNKANRKTNSGYWKSTGSDKKIV-----SSTMK  117

Query  546  MIMGMKKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQ  367
             I+G +KTLVFY GKPPHGS+T+W MHEY L  +    +        ++  ++ Q S  Q
Sbjct  118  HIVGTRKTLVFYRGKPPHGSRTDWFMHEYSLNIVDVEDDQ------TNSGNNFPQISQSQ  171

Query  366  QIGNLVICHVFQKKR  322
               N V+C +F K+R
Sbjct  172  TENNWVLCRIFLKER  186



>emb|CDX85667.1| BnaA02g01460D [Brassica napus]
Length=247

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 122/181 (67%), Gaps = 28/181 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+IS+  ++CR DPW+LPG++E+E RY
Sbjct  11   VMRLPPGFRFHPTDEELVVQYLKRKVISSPLPASIISDF-DVCRADPWDLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPTQNWVLCRIFLKKR  162

Query  321  V  319
             
Sbjct  163  A  163



>ref|XP_006366089.1| PREDICTED: NAC transcription factor 29-like [Solanum tuberosum]
Length=266

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 132/199 (66%), Gaps = 32/199 (16%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++FV++   V++LPPGFRF+PT++E+V QYL+RK FS  LPAS+I E+  + + DPW+L
Sbjct  3    KVNFVKNG--VLRLPPGFRFRPTDEELVVQYLKRKVFSFPLPASIIPEV-EVYKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE +YFFS+KE  KYPNG++++R +++GYWK ++  +K I   G+       +G+
Sbjct  60   PGDTEQE-KYFFSTKEV-KYPNGNRSNRATNSGYWK-ATGIDKQIVLRGQQ------VGL  110

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK PHG +TNWIMHEYRL  +    +P                  +Q  GN 
Sbjct  111  KKTLVFYRGKSPHGCRTNWIMHEYRLANLESNHHP------------------IQ--GNW  150

Query  351  VICHVFQKKRVNGKAGEES  295
            VIC +F KKR N K  EE+
Sbjct  151  VICRIFLKKRGNTKNKEEN  169



>ref|XP_003602768.1| NAC domain-containing protein [Medicago truncatula]
 gb|AES73019.1| NAC transcription factor-like protein [Medicago truncatula]
Length=241

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 131/196 (67%), Gaps = 20/196 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V KLPPGF FQPT++E+VF YL+ K FS  LPAS+I E+ N+C++DPW+L
Sbjct  3    KLNFVKNG--VSKLPPGFCFQPTDEELVFHYLKCKIFSYQLPASIIPEI-NVCKFDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+  ++D+YFFSSKEA KY N ++ +R +S+GYWK + S++K       S+ I    G+
Sbjct  60   PGNCGEQDKYFFSSKEA-KYRNSNRMNRTTSSGYWKATGSDKKVSVSSSLSNGIA---GI  115

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            +K+LVFY GK P+GS+T+WIMHEYRLV++       L  Y               +IGN 
Sbjct  116  RKSLVFYQGKSPNGSRTHWIMHEYRLVSLGTTACNQLQNY-------------ANEIGNW  162

Query  351  VICHVFQKKRVNGKAG  304
            V+C +F KKR N + G
Sbjct  163  VLCRIFTKKRSNIENG  178



>ref|XP_010492064.1| PREDICTED: NAC transcription factor 25-like [Camelina sativa]
Length=260

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 124/184 (67%), Gaps = 28/184 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL++K  S  LPAS+I E  ++CR DPW+LPG++++E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKKKVSSSPLPASIIPEF-DVCRADPWDLPGNLDKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGNQ-----IVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL     + +PP               S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRL-----SSSPP---------------SCMGPTQNWVLCRIFLKKR  162

Query  321  VNGK  310
               K
Sbjct  163  AGNK  166



>emb|CDX69662.1| BnaA10g20110D [Brassica napus]
Length=249

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 126/189 (67%), Gaps = 29/189 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I +  ++CR DPW+LPG++E+E RY
Sbjct  11   VMRLPPGFRFHPTDEELVVQYLKRKVLSSPLPASIIPDF-DVCRADPWDLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGNQ-----IVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPTQNWVLCRIFLKKR  162

Query  321  VNGKA-GEE  298
               K+ G+E
Sbjct  163  AGSKSDGDE  171



>ref|XP_009125891.1| PREDICTED: NAC domain-containing protein 18-like [Brassica rapa]
Length=247

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 121/181 (67%), Gaps = 28/181 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+IS+  ++CR DPW+LPG +E+E RY
Sbjct  11   VMRLPPGFRFHPTDEELVVQYLKRKVLSSPLPASIISDF-DVCRADPWDLPGSLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPTQNWVLCRIFLKKR  162

Query  321  V  319
             
Sbjct  163  A  163



>gb|AFI56995.1| NAC5 [Brassica napus]
 gb|AHN60147.1| NAC transcription factor 83 [Brassica napus]
Length=249

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 126/189 (67%), Gaps = 29/189 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I +  ++CR DPW+LPG++E+E RY
Sbjct  11   VMRLPPGFRFHPTDEELVVQYLKRKVLSSPLPASIIPDF-DVCRADPWDLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGNQ-----IVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPTQNWVLCRIFLKKR  162

Query  321  VNGKA-GEE  298
               K+ G+E
Sbjct  163  AGSKSDGDE  171



>ref|XP_009590289.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
 ref|XP_009590290.1| PREDICTED: NAC transcription factor 29-like [Nicotiana tomentosiformis]
Length=251

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 128/190 (67%), Gaps = 25/190 (13%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L FV++   V++LPPGFRF+PT++E+V QYL+RK  S  LPAS+I E+  I + DPW+L
Sbjct  3    KLSFVKNG--VLRLPPGFRFRPTDEELVVQYLKRKVLSFPLPASIIPEV-EIHKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD EQE RYFFS++E  KYPNG++++R +++GYWK +  +++ ++C G+      ++G+
Sbjct  60   PGDSEQE-RYFFSTREV-KYPNGNRSNRATNSGYWKATGIDKQIVSCKGQ-----QLVGL  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK PHG +TNWIMHEYRL  +            + AK + +Q          
Sbjct  113  KKTLVFYRGKSPHGCRTNWIMHEYRLANLETTS--------IQAKNNLTQEK-------W  157

Query  351  VICHVFQKKR  322
            V+C +F K+R
Sbjct  158  VLCRIFLKRR  167



>ref|XP_009131324.1| PREDICTED: NAC transcription factor 29-like isoform X2 [Brassica 
rapa]
Length=248

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 126/188 (67%), Gaps = 28/188 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK FS  LP+S+I ++ ++C+ DPW+LPG++E+E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVFSSPLPSSIIPDV-DVCKADPWHLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATESGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +  P+   P                      N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSSSPPSSIGP--------------------TQNWVLCRIFLKKR  162

Query  321  VNGKAGEE  298
               K  +E
Sbjct  163  AGDKNEDE  170



>ref|XP_010249131.1| PREDICTED: NAC transcription factor 25-like [Nelumbo nucifera]
Length=257

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 131/190 (69%), Gaps = 17/190 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FV++   V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ +I ++DPW+L
Sbjct  3    KFNFVKNG--VIRLPPGFRFHPTDEELVLQYLKRKVFSCPLPASIIPEV-DIYKHDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+E E +YFF +++A KYPNG+++ R + +GYWK +  +++ +     +S    ++GM
Sbjct  60   PGDLENE-KYFFCTRQA-KYPNGNRSKRATGSGYWKATGLDKQIV-----ASRSNQVVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP GS+T+WIMHEYRLV                 +K+ +Q S+M  + + 
Sbjct  113  KKTLVFYTGKPPRGSRTDWIMHEYRLVGAGTTA------CIFPQRKNSTQNSMM-PMEDW  165

Query  351  VICHVFQKKR  322
            V+C +F KKR
Sbjct  166  VLCRIFLKKR  175



>gb|AGC27322.1| NAC domain protein 7 [Gossypium hirsutum]
Length=277

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 139/204 (68%), Gaps = 18/204 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK  +  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLRRKVLACPLPASIIPEV-DVCKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+EQE RYFF+++EA KYPN ++++R + +GYWK +  +++ +T     S     +GM
Sbjct  60   PGDLEQE-RYFFNTREA-KYPNTNRSNRATISGYWKATGIDKQIVT-----SRSNQAVGM  112

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK P+G +T+WIMHEYR+V+   A +   P      KK+ +Q +++  + N 
Sbjct  113  KKTLVFYRGKAPNGCRTDWIMHEYRVVSTETAASNAPP-----NKKNQTQNNVV-PMENW  166

Query  351  VICHVFQKKRVNGKAGEESAEVCG  280
            V+C +F KKR      +E  + C 
Sbjct  167  VLCRIFLKKR--SAKNDEGLQSCN  188



>ref|XP_010419883.1| PREDICTED: NAC domain-containing protein 68-like [Camelina sativa]
Length=258

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 123/184 (67%), Gaps = 28/184 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL++K  S  LPAS+I E  ++CR DPW+LPG++ +E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKKKVSSSPLPASIIPEF-DVCRADPWDLPGNLNKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGNQ-----IVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL     + +PP               S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRL-----SSSPP---------------SCMGPTQNWVLCRIFLKKR  162

Query  321  VNGK  310
               K
Sbjct  163  AGNK  166



>ref|XP_002871551.1| ANAC083 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47810.1| ANAC083 [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 122/184 (66%), Gaps = 28/184 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E  ++CR DPW+LPG++E+E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVCSSPLPASIIPEF-DVCRADPWDLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPTQNWVLCRIFLKKR  162

Query  321  VNGK  310
               K
Sbjct  163  AGNK  166



>ref|XP_003532396.1| PREDICTED: NAC transcription factor ONAC010-like [Glycine max]
 gb|KHN16868.1| NAC domain-containing protein 29 [Glycine soja]
Length=241

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 129/190 (68%), Gaps = 20/190 (11%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V KLPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C+YDPW+L
Sbjct  3    KLNFVKNG--VSKLPPGFRFQPTDEELVFQYLKCKVFSYPLPASIIPEI-NVCKYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+ + ++R+FFS KEA KY NG++ +R +  GYWK + S+++       S+    I+G+
Sbjct  60   PGNCDLQERHFFSPKEA-KYRNGNRMNRTTKCGYWKATGSDKR----ISSSTCNNGIVGV  114

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            +KTL+FY GK P GS+T+W++HEYRLV++                 + S  + + +IG+ 
Sbjct  115  RKTLIFYEGKSPKGSRTHWVLHEYRLVSVETGA------------ANSSHNNYVNEIGDW  162

Query  351  VICHVFQKKR  322
            V+C +  KKR
Sbjct  163  VLCRLSMKKR  172



>ref|XP_004501729.1| PREDICTED: NAC transcription factor 29-like [Cicer arietinum]
Length=227

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 125/183 (68%), Gaps = 18/183 (10%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            + KLPPGFRFQPT++E+VFQYL+ K  S  LPAS+I E+ N+C YDP +LPG+  ++DRY
Sbjct  11   ISKLPPGFRFQPTDEELVFQYLKCKILSYQLPASIIPEI-NVCNYDPSDLPGNYGEQDRY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPM-IMGMKKTLVFYYG  505
            +FSSKE TKY NG++ +R + +GYWK + SE+K I      S+  + + G++K+LVFY G
Sbjct  70   YFSSKE-TKYRNGNRMNRTTKSGYWKATGSEKKVIRISSSISNNNVGLAGIRKSLVFYKG  128

Query  504  KPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKK  325
            K P+GS+++WIMHEYRLV +               + + S    +++IG+ V+C +F KK
Sbjct  129  KSPNGSRSDWIMHEYRLVNV---------------ESNSSHQKYVKEIGDWVVCRIFMKK  173

Query  324  RVN  316
            R N
Sbjct  174  RRN  176



>ref|NP_196822.1| NAC domain containing protein 83 [Arabidopsis thaliana]
 gb|AAK60324.1|AF385734_1 AT5g13180/T19L5_140 [Arabidopsis thaliana]
 emb|CAC05446.1| NAM-like protein [Arabidopsis thaliana]
 gb|AAN28903.1| At5g13180/T19L5_140 [Arabidopsis thaliana]
 gb|AED91860.1| NAC domain containing protein 83 [Arabidopsis thaliana]
Length=252

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 122/184 (66%), Gaps = 28/184 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E  ++CR DPW+LPG++E+E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVCSSPLPASIIPEF-DVCRADPWDLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGNQ-----IVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPTQNWVLCRIFLKKR  162

Query  321  VNGK  310
               K
Sbjct  163  AGNK  166



>ref|XP_003525425.1| PREDICTED: NAC transcription factor ONAC010-like [Glycine max]
 gb|KHN17478.1| NAC domain-containing protein 29 [Glycine soja]
Length=241

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 132/191 (69%), Gaps = 22/191 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V KLPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C+YDPW+L
Sbjct  3    KLNFVKNG--VSKLPPGFRFQPTDEELVFQYLKCKVFSYPLPASIIPEI-NVCKYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+ + ++R+FFS KEA KY NG++ +R +  GYWK + S+++       +S+   I+G+
Sbjct  60   PGNCDPQERHFFSPKEA-KYRNGNRMNRTTKCGYWKATGSDKR---ISSSTSTCNGIVGV  115

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAI-SPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            +KTL+FY GK P GS+T+W++HEYRLV++ + A N              S  + + +IG+
Sbjct  116  RKTLIFYEGKSPKGSRTHWVLHEYRLVSVETGAAN--------------SSHNYVNEIGD  161

Query  354  LVICHVFQKKR  322
             V+C +  KKR
Sbjct  162  WVLCRLSMKKR  172



>ref|XP_009121790.1| PREDICTED: NAC transcription factor 29 [Brassica rapa]
Length=276

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 126/189 (67%), Gaps = 29/189 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I +  ++CR DPW+LPG++E+E RY
Sbjct  38   VMRLPPGFRFHPTDEELVVQYLKRKVLSSPLPASIIPDF-DVCRADPWDLPGNLEKE-RY  95

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  96   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGNQ-----IVGLKKTLVFYKGK  149

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  150  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPTQNWVLCRIFLKKR  189

Query  321  VNGKA-GEE  298
               K+ G+E
Sbjct  190  AGSKSDGDE  198



>ref|XP_003630552.1| NAC domain protein [Medicago truncatula]
 gb|AET05028.1| NAC transcription factor-like protein [Medicago truncatula]
Length=227

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 129/200 (65%), Gaps = 23/200 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+F+++   V +LPPGFRFQPT++E+VF YL+ K FS  LPAS+I E+ N+C+YDPW+L
Sbjct  3    KLNFIKNG--VSRLPPGFRFQPTDEELVFNYLKCKIFSCPLPASIIPEV-NVCKYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG  ++++R+FFSSKEA KY N ++ SR +  GYWK + S++K       SS+   I G+
Sbjct  60   PGGCDEQERHFFSSKEA-KYRNSNRMSRTTKCGYWKATGSDKKI-----SSSTCNGIAGL  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            +KTLVFY GK P+GS+T+WI+HEYRL+ +    N              S  +   +IG  
Sbjct  114  RKTLVFYEGKSPNGSRTDWILHEYRLINVETTNN--------------SAQNYGNEIGEW  159

Query  351  VICHVFQKKRVNGKAGEESA  292
            V+C +  +KR   + G  S 
Sbjct  160  VLCRLSVRKRSGLEYGSTST  179



>emb|CDX91143.1| BnaC02g04540D [Brassica napus]
Length=247

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 121/181 (67%), Gaps = 28/181 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I +  ++CR DPW+LPG++E+E RY
Sbjct  11   VMRLPPGFRFHPTDEELVVQYLKRKVLSSPLPASIIPDF-DVCRADPWDLPGNLEKE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPTQNWVLCRIFLKKR  162

Query  321  V  319
             
Sbjct  163  A  163



>ref|NP_001266090.1| NAC transcription factor 25-like [Cicer arietinum]
 gb|ACA96935.1| NAC transcription factor protein 1 [Cicer arietinum]
Length=239

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 113/146 (77%), Gaps = 7/146 (5%)
 Frame = -1

Query  888  LHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP  709
            ++ V+     VKLPPGFRF PT++E+V QYL+RK FS  LPAS+I EL ++   DPW+LP
Sbjct  1    MNLVKKKNGEVKLPPGFRFHPTDEELVVQYLKRKVFSFPLPASIIPELHHLSNSDPWDLP  60

Query  708  GDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMK  529
            GD+  E+RYFFS+KEA KYPNG++++R +++GYWK +  +++ +     +S+  +++GMK
Sbjct  61   GDL-GEERYFFSTKEA-KYPNGNRSNRATNSGYWKATGLDKQIL-----NSNSNVVVGMK  113

Query  528  KTLVFYYGKPPHGSKTNWIMHEYRLV  451
            KTLVFY GKPPHGS+T+WIMHEYRL 
Sbjct  114  KTLVFYKGKPPHGSRTDWIMHEYRLT  139



>ref|XP_002879454.1| hypothetical protein ARALYDRAFT_482294 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55713.1| hypothetical protein ARALYDRAFT_482294 [Arabidopsis lyrata subsp. 
lyrata]
Length=258

 Score =   169 bits (429),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 127/189 (67%), Gaps = 30/189 (16%)
 Frame = -1

Query  882  FVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD  703
            F+++ G V++LPPGFRF PT++E+V QYL+RK   L LPASVI E  ++C+ DPW+LPGD
Sbjct  6    FIKNRG-VLRLPPGFRFHPTDEELVVQYLRRKVTGLPLPASVIPET-DVCKSDPWDLPGD  63

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
             E E RYFFS++EA KYPNG++++R + +GYWK ++  +K I   GK     +++GMKKT
Sbjct  64   CESE-RYFFSTREA-KYPNGNRSNRSTGSGYWK-ATGIDKQI---GKKK---LVVGMKKT  114

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP+G++TNW++HEYRLV                   D  Q S   Q  N V+C
Sbjct  115  LVFYKGKPPNGTRTNWVLHEYRLV-------------------DSQQESSYGQNMNWVLC  155

Query  342  HVFQKKRVN  316
             VF KKR N
Sbjct  156  RVFLKKRSN  164



>ref|XP_010549297.1| PREDICTED: NAC transcription factor ONAC010-like isoform X1 [Tarenaya 
hassleriana]
Length=254

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 131/197 (66%), Gaps = 16/197 (8%)
 Frame = -1

Query  879  VRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDM  700
            VR   KV+KL PGFRF PT+QE++ +YL+RK   L LPASVISE  +IC+ DPW+LPGD+
Sbjct  7    VRVKNKVLKLLPGFRFHPTDQELIVEYLKRKVTGLPLPASVISE-TDICKSDPWDLPGDL  65

Query  699  EQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTL  520
              E RYFFS++EA KYPNG++++R + +GYWK +  +++ I      S    ++GMKKTL
Sbjct  66   GSE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGIDKRIIA----GSRGNKVLGMKKTL  119

Query  519  VFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICH  340
            VFY GKPP+G++T+WI+HEYRLV  +         + + A   ++      +  + V+C 
Sbjct  120  VFYRGKPPNGTRTDWILHEYRLVDDT--------SHDMDASSTHNPQERRARGESWVLCR  171

Query  339  VFQKKRVNGKAGEESAE  289
            +F KKR N +  EE +E
Sbjct  172  IFLKKR-NKETEEEKSE  187



>gb|ACU16982.1| unknown [Glycine max]
Length=209

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 134/190 (71%), Gaps = 21/190 (11%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            RL+F+++   V +LPPGFRFQPT++E+VFQYL+RK FS  LPAS+I E+ N+ + DPW+L
Sbjct  3    RLNFIKNG--VSRLPPGFRFQPTDEELVFQYLKRKIFSCQLPASIIPEI-NVSKNDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+ ++++RYFFSSKE  KY NG++ +R +++GYWK + S++K  +            G+
Sbjct  60   PGNCDEQERYFFSSKEV-KYRNGNRMNRTTNSGYWKATGSDKKISSSISNIG----FAGL  114

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            +KTLVFY GK P+GS+T+W+MHEYRLV++       +P    ++ ++Y+      +IG+ 
Sbjct  115  RKTLVFYEGKSPNGSRTDWVMHEYRLVSLE-----TIPS---NSSQNYA-----NEIGDW  161

Query  351  VICHVFQKKR  322
            ++C +F KKR
Sbjct  162  ILCRIFMKKR  171



>ref|XP_010549298.1| PREDICTED: NAC domain-containing protein 18-like isoform X2 [Tarenaya 
hassleriana]
Length=251

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 128/197 (65%), Gaps = 19/197 (10%)
 Frame = -1

Query  879  VRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDM  700
            VR   KV+KL PGFRF PT+QE++ +YL+RK   L LPASVISE  +IC+ DPW+LPGD+
Sbjct  7    VRVKNKVLKLLPGFRFHPTDQELIVEYLKRKVTGLPLPASVISE-TDICKSDPWDLPGDL  65

Query  699  EQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTL  520
              E RYFFS++EA KYPNG++++R + +GYWK +  +++ I      S    ++GMKKTL
Sbjct  66   GSE-RYFFSTREA-KYPNGNRSNRATGSGYWKATGIDKRIIA----GSRGNKVLGMKKTL  119

Query  519  VFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICH  340
            VFY GKPP+G++T+WI+HEYRLV  +            H     S      +  + V+C 
Sbjct  120  VFYRGKPPNGTRTDWILHEYRLVDDTS-----------HDMDASSTHERRARGESWVLCR  168

Query  339  VFQKKRVNGKAGEESAE  289
            +F KKR N +  EE +E
Sbjct  169  IFLKKR-NKETEEEKSE  184



>ref|XP_007159989.1| hypothetical protein PHAVU_002G283600g [Phaseolus vulgaris]
 gb|ESW31983.1| hypothetical protein PHAVU_002G283600g [Phaseolus vulgaris]
Length=234

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 131/191 (69%), Gaps = 22/191 (12%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V KLPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C++DPW+L
Sbjct  3    KLNFVKNG--VSKLPPGFRFQPTDEELVFQYLKCKVFSYPLPASIIPEI-NVCKHDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+ + ++RYFFS KEA KY NG++ +R +  GYWK + S+++       S++   I+G+
Sbjct  60   PGNCDPQERYFFSPKEA-KYRNGNRMNRTTKCGYWKATGSDKR---ISSSSNACNGIVGI  115

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            +KTL+FY GK P GS+T+W++HEYRLV A + A N              S  + + +IG+
Sbjct  116  RKTLIFYEGKSPKGSRTDWVLHEYRLVNAETGACN--------------SSHNYVNEIGD  161

Query  354  LVICHVFQKKR  322
             V+C +  KKR
Sbjct  162  WVLCRLSMKKR  172



>ref|XP_006289127.1| hypothetical protein CARUB_v10002548mg [Capsella rubella]
 gb|EOA22025.1| hypothetical protein CARUB_v10002548mg [Capsella rubella]
Length=257

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 122/184 (66%), Gaps = 28/184 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E  ++CR DPW+LPG++++E +Y
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVCSSPLPASIIPEF-DVCRADPWDLPGNLDKE-KY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK +  +++ +T  G       I+G+KKTLVFY GK
Sbjct  69   FFSTREA-KYPNGNRSNRATGSGYWKATGIDKRVVTSRGN-----QIVGLKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEYRL +                    S  S M    N V+C +F KKR
Sbjct  123  PPHGSRTDWIMHEYRLSS--------------------SPPSSMGPTQNWVLCRIFLKKR  162

Query  321  VNGK  310
               K
Sbjct  163  AGNK  166



>ref|XP_010469465.1| PREDICTED: NAC transcription factor 29-like [Camelina sativa]
Length=272

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 124/188 (66%), Gaps = 29/188 (15%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK   L LPASVI E  ++C+ DPW+LPGD + E RY
Sbjct  12   VLRLPPGFRFHPTDEELVVQYLRRKVTGLPLPASVIPET-DVCKSDPWDLPGDCDSE-RY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS+KEA KYPNG++++R + +GYWK ++  +K I   GK +   + +GMKKTLVFY GK
Sbjct  70   FFSTKEA-KYPNGNRSNRSTGSGYWK-ATGIDKQI---GKKT---LAVGMKKTLVFYKGK  121

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP+G++TNW++HEYRLV                   D  Q S   Q  N V+C VF KKR
Sbjct  122  PPNGTRTNWVLHEYRLV-------------------DSQQESSHVQSMNWVLCRVFLKKR  162

Query  321  VNGKAGEE  298
             N    +E
Sbjct  163  SNSNKRKE  170



>ref|NP_180906.1| NAC domain containing protein 41 [Arabidopsis thaliana]
 gb|AAK17148.1|AF325080_1 putative NAM (no apical meristem)-like protein [Arabidopsis thaliana]
 gb|AAK95285.1|AF410299_1 At2g33480/F4P9.25 [Arabidopsis thaliana]
 gb|AAB80665.1| putative NAM (no apical meristem)-like protein [Arabidopsis thaliana]
 gb|AAM10354.1| At2g33480/F4P9.25 [Arabidopsis thaliana]
 gb|AEC08840.1| NAC domain containing protein 41 [Arabidopsis thaliana]
Length=268

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 123/185 (66%), Gaps = 29/185 (16%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK   L LPASVI E  ++C+ DPW+LPGD E E  Y
Sbjct  12   VLRLPPGFRFHPTDEELVVQYLRRKVTGLPLPASVIPET-DVCKSDPWDLPGDCESE-MY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK ++  +K I   GK     +++GMKKTLVFY GK
Sbjct  70   FFSTREA-KYPNGNRSNRSTGSGYWK-ATGLDKQI---GKKK---LVVGMKKTLVFYKGK  121

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP+G++TNW++HEYRLV                   D  Q SL  Q  N V+C VF KKR
Sbjct  122  PPNGTRTNWVLHEYRLV-------------------DSQQDSLYGQNMNWVLCRVFLKKR  162

Query  321  VNGKA  307
             N  +
Sbjct  163  SNSNS  167



>ref|XP_009404749.1| PREDICTED: NAC transcription factor 25-like [Musa acuminata subsp. 
malaccensis]
Length=247

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 129/197 (65%), Gaps = 20/197 (10%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK FS  LPA++I E+ N+ R DPW+LPG  E+E RY
Sbjct  13   VLRLPPGFRFHPTDEELVVQYLKRKAFSCPLPAAIIPEI-NLARLDPWDLPGGCEEE-RY  70

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF+ +EA KYP G +++R + +GYWK ++ ++K IT    S    +++GM+K LVFY GK
Sbjct  71   FFNLREA-KYPRGSRSNRAARSGYWK-ATGKDKQIT---SSWCSQVVVGMRKVLVFYRGK  125

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G+KT+WIMHEYRL        P   P     +K+ +  S+    G+ V+C +F+KKR
Sbjct  126  PPTGTKTDWIMHEYRLAG------PETRPCIFPQRKNSTHSSV-DPSGDWVLCRIFRKKR  178

Query  321  V------NGKAGEESAE  289
                     +AGEE  +
Sbjct  179  ATKMEVGTDEAGEEDED  195



>ref|XP_010413856.1| PREDICTED: NAC transcription factor 29-like isoform X1 [Camelina 
sativa]
Length=272

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 122/182 (67%), Gaps = 29/182 (16%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK   L LPASVI E  ++C+ DPW+LPGD + E RY
Sbjct  13   VLRLPPGFRFHPTDEELVVQYLRRKVTGLPLPASVIPET-DVCKSDPWDLPGDCDSE-RY  70

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS+KEA KYPNG++++R + +GYWK ++  +K I   GK +   + +GMKKTLVFY GK
Sbjct  71   FFSTKEA-KYPNGNRSNRSTGSGYWK-ATGIDKQI---GKKT---LAVGMKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP+G++TNW++HEYRLV                   D  Q S   Q  N V+C VF KKR
Sbjct  123  PPNGTRTNWVLHEYRLV-------------------DSQQESSHGQNMNWVLCRVFLKKR  163

Query  321  VN  316
             N
Sbjct  164  SN  165



>ref|XP_009600037.1| PREDICTED: NAC domain-containing protein 18-like [Nicotiana tomentosiformis]
Length=249

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 119/165 (72%), Gaps = 8/165 (5%)
 Frame = -1

Query  900  GRLRLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDP  721
            G  +LHFV+     ++LPPGFRF PT++E+VFQYL+RK FS  LPAS+I ++ ++ + DP
Sbjct  2    GMEKLHFVKIGA--LRLPPGFRFHPTDEELVFQYLKRKVFSFPLPASIIPDM-DVHKSDP  58

Query  720  WNLPGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMI  541
            W+LPGD+EQE RYFFS++E  K+P G++++R +++GYWK +  +++ ++  GK      +
Sbjct  59   WDLPGDLEQE-RYFFSTREV-KHPKGNRSNRATNSGYWKATGLDKQIVSSRGKQQQ---L  113

Query  540  MGMKKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFL  406
            +GMKKTLVFY GKP HG +T+WIMHEYRL  + P   P    + L
Sbjct  114  VGMKKTLVFYKGKPLHGCRTDWIMHEYRLANLEPKKIPTQENWVL  158



>ref|XP_009421046.1| PREDICTED: NAC domain-containing protein 18-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 121/187 (65%), Gaps = 14/187 (7%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+ K FS  LPAS+I ++ N+  +DPW+LPG  E+E RY
Sbjct  13   VLRLPPGFRFHPTDEELVVQYLRTKVFSCPLPASIIPDI-NLSNFDPWDLPGGCEEE-RY  70

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF+ +EA KY  G +++R + +GYWK ++ ++K IT    SS    ++GMKK LVFY GK
Sbjct  71   FFNLREA-KYTKGSRSNRAARSGYWK-ATGKDKQIT----SSRCSQVVGMKKVLVFYQGK  124

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G+KT+WIMHEYRL        P         +K+ SQ  +    G+ V+C +F+KKR
Sbjct  125  PPTGTKTDWIMHEYRLTG------PDTTACIFPQRKNSSQSCVAVPSGDWVLCRIFKKKR  178

Query  321  VNGKAGE  301
                  E
Sbjct  179  ATKMEAE  185



>ref|XP_003528094.1| PREDICTED: NAC transcription factor ONAC010 [Glycine max]
 gb|KHN23958.1| NAC domain-containing protein 29 [Glycine soja]
Length=248

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 128/190 (67%), Gaps = 21/190 (11%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            RL+F+++   V +LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+ + DPW+L
Sbjct  3    RLNFIKNG--VSRLPPGFRFQPTDEELVFQYLKCKIFSCQLPASIIPEI-NVSKNDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+ ++++RYFFSSKEA KY NG++ +R +++GYWK + S++K  +            G+
Sbjct  60   PGNCDEQERYFFSSKEA-KYRNGNRMNRTTNSGYWKATGSDKKISSSISNIG----FAGL  114

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            +KTLVFY GK P+GS+T+W+MHEYRLV+             L      S  +   +IG+ 
Sbjct  115  RKTLVFYEGKSPNGSRTDWVMHEYRLVS-------------LETIPSNSSQNYANEIGDW  161

Query  351  VICHVFQKKR  322
            ++C +F KKR
Sbjct  162  ILCRIFMKKR  171



>ref|NP_001233811.1| uncharacterized protein LOC100147720 [Solanum lycopersicum]
 emb|CAA99760.1| unknown [Solanum lycopersicum]
Length=272

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 131/199 (66%), Gaps = 27/199 (14%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +++F+++   V++LPPGFRF+PT++E+V QYL+RK FS  LPAS+I E+  + + DPW+L
Sbjct  3    KVNFLKNG--VLRLPPGFRFRPTDEELVVQYLKRKVFSFPLPASIIPEVE-VYKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGDMEQE +YFFS+KE  KYPNG++++R +++GYWK +  +++             ++G+
Sbjct  60   PGDMEQE-KYFFSTKEV-KYPNGNRSNRATNSGYWKATGIDKQ--IILRGRQQQQQLIGL  115

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GK PHG +TNWIMHEYRL  +    +P                  +Q  GN 
Sbjct  116  KKTLVFYRGKSPHGCRTNWIMHEYRLANLESNYHP------------------IQ--GNW  155

Query  351  VICHVFQKKRVNGKAGEES  295
            VIC +F KKR N K  EE+
Sbjct  156  VICRIFLKKRGNTKNKEEN  174



>ref|XP_009804476.1| PREDICTED: NAC domain-containing protein 18-like [Nicotiana sylvestris]
Length=248

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 129/202 (64%), Gaps = 27/202 (13%)
 Frame = -1

Query  900  GRLRLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDP  721
            G  +++FV+  G  V+LPPGFRF PT++E+V QYL+RK FS  LPAS+I ++ ++ + DP
Sbjct  2    GMEKVNFVKIGG--VRLPPGFRFHPTDEELVVQYLKRKVFSFPLPASIIPDI-DVHKSDP  58

Query  720  WNLPGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMI  541
            W+LPGD+EQE RYFFS++E  K+  G++++R +++GYWK +  +++ ++  GK      +
Sbjct  59   WDLPGDLEQE-RYFFSTREM-KHLKGNRSNRATNSGYWKATGLDKQIVSSRGKQQQ--QL  114

Query  540  MGMKKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQI  361
            +GMKKTLVFY GKP HG +T+WIMHEYRL  + P   P                      
Sbjct  115  VGMKKTLVFYKGKPLHGCRTDWIMHEYRLANLEPNNIPTQE-------------------  155

Query  360  GNLVICHVFQKKRVNGKAGEES  295
             N V+C +F KKR   K  +E+
Sbjct  156  -NWVLCRIFLKKRGGSKNEDEN  176



>ref|XP_004152126.1| PREDICTED: NAC transcription factor NAM-2-like [Cucumis sativus]
 gb|KGN53030.1| NAC domain-containing protein [Cucumis sativus]
Length=238

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 126/194 (65%), Gaps = 20/194 (10%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL ++  S  LPA+VI +  ++CR+DPW+LPGD+E+E RY
Sbjct  11   VLRLPPGFRFYPTDEELVLQYLIKRALSSPLPAAVIPD-ADVCRFDPWDLPGDLERE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KY NG +++R + +GYWK +  + K +     S+    ++G KKTLVFY GK
Sbjct  69   FFSTREA-KYSNGRRSNRATGSGYWKATGIDRKIV-----STKENRLIGFKKTLVFYTGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIG-NLVICHVFQKK  325
            PP+G +T+W+MHEYRLV  S A  PP           ++ G  +  +  N V+C +F KK
Sbjct  123  PPNGLRTDWVMHEYRLVGSSEA--PP---------SSFNDGLELPTLNPNWVLCRIFLKK  171

Query  324  RVNGKAGEESAEVC  283
            R   +  E+    C
Sbjct  172  RSTRERDEKKKNNC  185



>ref|NP_001118435.1| NAC domain containing protein 41 [Arabidopsis thaliana]
 gb|AEC08841.1| NAC domain containing protein 41 [Arabidopsis thaliana]
Length=266

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 122/185 (66%), Gaps = 31/185 (17%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK   L LPASVI E  ++C+ DPW+LPGD E E  Y
Sbjct  12   VLRLPPGFRFHPTDEELVVQYLRRKVTGLPLPASVIPET-DVCKSDPWDLPGDCESE-MY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KYPNG++++R + +GYWK ++  +K I   GK     +++GMKKTLVFY GK
Sbjct  70   FFSTREA-KYPNGNRSNRSTGSGYWK-ATGLDKQI---GKKK---LVVGMKKTLVFYKGK  121

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP+G++TNW++HEYRLV                   D  Q SL     N V+C VF KKR
Sbjct  122  PPNGTRTNWVLHEYRLV-------------------DSQQDSLYNM--NWVLCRVFLKKR  160

Query  321  VNGKA  307
             N  +
Sbjct  161  SNSNS  165



>emb|CDP13390.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 134/198 (68%), Gaps = 19/198 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V++LPPGFRF PT++E+V QYL+RK  S  LPAS+I E+ ++C+ DPW+L
Sbjct  3    KLNFVKNG--VLRLPPGFRFHPTDEELVVQYLKRKALSCPLPASIIPEV-DVCKSDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD+E+E RYFFS +E  KY +G++++R + +GYWK +  +++ + C  +      + G+
Sbjct  60   PGDLERE-RYFFSKRE-VKYRSGNRSNRATGSGYWKATGVDKQIVACRSRLGVG-GVGGV  116

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP+G +T+W+MHEYRLV +  A  P  P     A++ +            
Sbjct  117  KKTLVFYRGKPPNGIRTDWVMHEYRLVNVVEAAAPISPLQNKSAQESW------------  164

Query  351  VICHVFQKKRVNGKAGEE  298
            V+C +F K+R +GK+ E+
Sbjct  165  VLCRIFLKRR-SGKSSED  181



>ref|XP_010413857.1| PREDICTED: NAC transcription factor 29-like isoform X2 [Camelina 
sativa]
Length=270

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 121/183 (66%), Gaps = 31/183 (17%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK   L LPASVI E  ++C+ DPW+LPGD + E RY
Sbjct  13   VLRLPPGFRFHPTDEELVVQYLRRKVTGLPLPASVIPET-DVCKSDPWDLPGDCDSE-RY  70

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS+KEA KYPNG++++R + +GYWK ++  +K I   GK +   + +GMKKTLVFY GK
Sbjct  71   FFSTKEA-KYPNGNRSNRSTGSGYWK-ATGIDKQI---GKKT---LAVGMKKTLVFYKGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP+G++TNW++HEYRLV                   D  Q S      N V+C VF KKR
Sbjct  123  PPNGTRTNWVLHEYRLV-------------------DSQQESSHNM--NWVLCRVFLKKR  161

Query  321  VNG  313
             N 
Sbjct  162  SNS  164



>ref|XP_008454032.1| PREDICTED: NAC transcription factor 25-like [Cucumis melo]
Length=239

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 126/189 (67%), Gaps = 20/189 (11%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E++ QYL +K  S  LPA+VI +  ++CR+DPW+LPGD+E+E RY
Sbjct  11   VLRLPPGFRFYPTDEELLLQYLIKKALSSPLPAAVIPD-ADVCRFDPWDLPGDLERE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++EA KY NG +++R + +GYWK +  + K +     S+    ++G KKTLVFY GK
Sbjct  69   FFSTREA-KYSNGRRSNRATGSGYWKATGIDRKIV-----STKENRLIGFKKTLVFYTGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIG-NLVICHVFQKK  325
            PP+G +T+W+MHEYRLV  S A  PP           +++G  +  +  N V+C +F KK
Sbjct  123  PPNGLRTDWVMHEYRLVGSSEA--PP---------SSFNEGLELPNLNPNWVLCRIFLKK  171

Query  324  RVNGKAGEE  298
            R   +  E+
Sbjct  172  RSTRERDEK  180



>ref|XP_010907664.1| PREDICTED: NAC transcription factor 25-like [Elaeis guineensis]
Length=245

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 125/196 (64%), Gaps = 18/196 (9%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            VVKLPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++ +Y+PW LPG  EQE RY
Sbjct  11   VVKLPPGFRFHPTDEELVVQYLKRKVFSCPLPASIIPEI-DLGKYNPWELPGGSEQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF  +EA KYPNG++ +R +  GYWK +  ++K +           ++GMKK LVFY+G 
Sbjct  69   FFYLREA-KYPNGNRLNRATGCGYWKATGKDKKVLALRSNQ-----VVGMKKVLVFYHGN  122

Query  501  PPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKK  325
            PP GS+T+WIMHEYRL  A +  G  P        +K+ +  S M    + V+C +F+KK
Sbjct  123  PPRGSRTDWIMHEYRLAGAETRTGAFP-------QRKNSTHFS-MVPTKDWVLCRIFKKK  174

Query  324  RVNGKAGEESAEVCGD  277
            R   K G +  E C D
Sbjct  175  RAT-KMGVDVEEYCED  189



>gb|EYU28642.1| hypothetical protein MIMGU_mgv1a012899mg [Erythranthe guttata]
Length=236

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 121/191 (63%), Gaps = 24/191 (13%)
 Frame = -1

Query  870  DGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQE  691
            +G  ++LPPGFRF PT++E+V QYL+RK  S  LPAS+I  + N+C  DPW+LPGD EQE
Sbjct  9    NGGALRLPPGFRFHPTDEELVVQYLKRKVQSSPLPASIIPHV-NVCNSDPWDLPGDSEQE  67

Query  690  DRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFY  511
             RYFFS +E  KYPNG++++R + +GYWK +  ++K ++         +I+GMKKTLVFY
Sbjct  68   -RYFFSKREV-KYPNGNRSNRATGSGYWKATGLDKKIVSSKNNEE---IIVGMKKTLVFY  122

Query  510  YGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQ  331
             GKPP G +T+W+MHE+RL          + P  L  ++            N V+C +  
Sbjct  123  RGKPPKGCRTDWVMHEFRLTTQQ------IQPNNLSLQE------------NWVLCRIVL  164

Query  330  KKRVNGKAGEE  298
            K+R N K G++
Sbjct  165  KRRNNKKNGDD  175



>gb|AIA57530.1| NAC domain-containing protein [Boehmeria nivea]
Length=263

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 128/199 (64%), Gaps = 21/199 (11%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPAS--VISELPNICRYDPW  718
            + +FVR++  V+KLPPGFRFQPT++E+VFQYL+RK FS  LP+S  +I E+ N+C+YDPW
Sbjct  3    KFNFVRNNNGVIKLPPGFRFQPTDEELVFQYLRRKIFSCPLPSSSDIIPEI-NLCKYDPW  61

Query  717  NLP---GDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIP  547
            +LP    D+EQ DRYFFS KE+       + +R + +GYWK + S++K +     SS++ 
Sbjct  62   DLPHSGHDLEQ-DRYFFSHKESKYRSGSSRANRKTGSGYWKATGSDKKIM-----SSAMK  115

Query  546  MIMGMKKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQ  367
             ++G +KTLVFY GKPP GS+T+W MHEY L       N  +    +   ++ SQ     
Sbjct  116  HVVGTRKTLVFYRGKPPQGSRTDWFMHEYSLHV-----NNVVDQANISTTQEVSQ----N  166

Query  366  QIGNLVICHVFQKKRVNGK  310
            Q  N ++C +F K+R   K
Sbjct  167  QTENWILCRIFLKERSANK  185



>ref|XP_006294782.1| hypothetical protein CARUB_v10023833mg [Capsella rubella]
 gb|EOA27680.1| hypothetical protein CARUB_v10023833mg [Capsella rubella]
Length=273

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 122/182 (67%), Gaps = 31/182 (17%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK   L LPASVI E  ++C+ DPW+LPGD + E RY
Sbjct  12   VLRLPPGFRFHPTDEELVVQYLRRKVTGLPLPASVIPET-DVCKSDPWDLPGDCDSE-RY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS+KEA KYPNG++++R + +GYWK ++  +K I   GK     +++GMKKTLVFY GK
Sbjct  70   FFSTKEA-KYPNGNRSNRSTGSGYWK-ATGIDKQI---GKKK---LVVGMKKTLVFYKGK  121

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP+G++TNW++HEYRLV                ++ D S         N V+C VF KKR
Sbjct  122  PPNGTRTNWVLHEYRLV---------------DSQLDSSYNM------NWVLCRVFLKKR  160

Query  321  VN  316
             N
Sbjct  161  SN  162



>ref|XP_006844574.1| hypothetical protein AMTR_s00016p00196760 [Amborella trichopoda]
 gb|ERN06249.1| hypothetical protein AMTR_s00016p00196760 [Amborella trichopoda]
Length=234

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 123/180 (68%), Gaps = 15/180 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            +VKLPPGFRF PT++E+V QYL+RK FS  LP+S+I+++ +I ++DPW LPG+ E +++Y
Sbjct  11   MVKLPPGFRFHPTDEELVIQYLKRKVFSCPLPSSIIADI-DIYKHDPWELPGE-EGQEKY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF+ KEA KYPNG++ +R ++ GYWK +      I  P  SS    ++GMKK+LVFY GK
Sbjct  69   FFNIKEA-KYPNGNRPNRAAATGYWKATG-----IDKPVLSSRSNQVVGMKKSLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
             P G KT+WIMHEYRL   + AG  P     + A+K   Q + M  + + V+C +F KKR
Sbjct  123  APKGVKTDWIMHEYRL---AEAGAKPCN---ISARKSSIQ-NYMAPVEDWVVCRIFLKKR  175



>ref|XP_004156954.1| PREDICTED: LOW QUALITY PROTEIN: NAC transcription factor NAM-2-like 
[Cucumis sativus]
Length=238

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 125/194 (64%), Gaps = 20/194 (10%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL ++  S  LPA+VI +  ++CR+DPW+LPGD+E+E RY
Sbjct  11   VLRLPPGFRFYPTDEELVLQYLIKRALSSPLPAAVIPD-ADVCRFDPWDLPGDLERE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
             FS++EA KY NG +++R + +GYWK +  + K +     S+    ++G KKTLVFY GK
Sbjct  69   XFSTREA-KYSNGRRSNRATGSGYWKATGIDRKIV-----STKENRLIGFKKTLVFYTGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIG-NLVICHVFQKK  325
            PP+G +T+W+MHEYRLV  S A  PP           ++ G  +  +  N V+C +F KK
Sbjct  123  PPNGLRTDWVMHEYRLVGSSEA--PP---------SSFNDGLELPTLNPNWVLCRIFLKK  171

Query  324  RVNGKAGEESAEVC  283
            R   +  E+    C
Sbjct  172  RSTRERDEKKKNNC  185



>ref|XP_011083447.1| PREDICTED: NAC transcription factor 29-like [Sesamum indicum]
Length=227

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 125/185 (68%), Gaps = 15/185 (8%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRYFF  676
            KLPPGFRFQPT+QEIVFQYL RKTFS  LP  +I E+ ++  +DPW LPG+ +Q D+YFF
Sbjct  15   KLPPGFRFQPTDQEIVFQYLARKTFSHPLPPLLIPEI-DVSTFDPWELPGNSDQ-DKYFF  72

Query  675  SSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKPP  496
            S+KE     NGD+ SR + +G+WK + S  K I CP +   +P I+G++K+LVFY GK P
Sbjct  73   SNKEGNTRRNGDRISRGTCSGHWKATGS-TKRIICPKR---MP-IVGIRKSLVFYKGKNP  127

Query  495  HGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRVN  316
               +T+WIMHEY  +A+S   +  +       +K  SQGSL+ +IGN  +C VF KKR++
Sbjct  128  LACRTDWIMHEY-FIALSGHMDCDM------QQKKNSQGSLV-RIGNWSLCRVFLKKRIS  179

Query  315  GKAGE  301
              A E
Sbjct  180  STAEE  184



>ref|XP_004503781.1| PREDICTED: NAC transcription factor 25-like [Cicer arietinum]
Length=233

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 133/206 (65%), Gaps = 31/206 (15%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+F+++   V +LPPGFRFQPT++E+VFQYL+ K FS  LPAS+I E+ N+C+YDPW+L
Sbjct  3    KLNFIKNG--VSRLPPGFRFQPTDEELVFQYLKCKIFSCPLPASIIPEI-NVCKYDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQ-TSRVSSNGYWKPSSSEEK--HITCPGKSSSIPMI  541
            PG  ++++R+FFS KEA KY N  +  SR +  GYWK + S++K    TC G       I
Sbjct  60   PGGCDEQERHFFSWKEA-KYRNSKRMMSRTTKCGYWKATGSDKKISSPTCNG-------I  111

Query  540  MGMKKTLVFYYGKPPHGSKTNWIMHEYRLVAI--SPAGNPPLPPYFLHAKKDYSQGSLMQ  367
            +G++KTLVFY GK P+GS+T+WI+HEYRL+ +  SP  +              +Q     
Sbjct  112  VGLRKTLVFYEGKSPNGSRTDWILHEYRLINVDTSPCNS--------------TQNYYGN  157

Query  366  QIGNLVICHV-FQKKRVNGKAGEESA  292
            +IG+ V+C +  +KK +  + G  S 
Sbjct  158  EIGDWVLCRLSMRKKSLESEYGSTST  183



>ref|XP_011073111.1| PREDICTED: NAC transcription factor 25-like [Sesamum indicum]
Length=238

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 123/190 (65%), Gaps = 17/190 (9%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            + +FVRD     KLPPGFRFQPT++EIVFQYL RKTFS  LPASVI E+ N+  + PW L
Sbjct  3    KFNFVRDGES--KLPPGFRFQPTDEEIVFQYLARKTFSYPLPASVIPEI-NVFSFHPWEL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+ +Q DRYFFS    + Y + +++SR +  GYWK + S +K I C  +   +P I+G+
Sbjct  60   PGNSDQ-DRYFFSHLRESSYRSVNRSSRTTCGGYWKITGS-DKQIVCLKR---MP-IVGI  113

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            K+TLVFY GK P   +T+W MH Y    I+ +GN          +K  SQGS + QIG  
Sbjct  114  KRTLVFYKGKHPRAVRTDWFMHLY---CIALSGNVACNI----QQKRSSQGSSV-QIGKW  165

Query  351  VICHVFQKKR  322
            V+CHVF KKR
Sbjct  166  VLCHVFTKKR  175



>ref|XP_008777977.1| PREDICTED: NAC transcription factor 25-like [Phoenix dactylifera]
Length=242

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 123/192 (64%), Gaps = 18/192 (9%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL RK FS  LPAS+I E+ ++ +Y+PW+LPG  EQE RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLTRKVFSCPLPASIIPEV-DLGKYNPWDLPGGWEQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF  +EA KYPNG++ +R +  GYWK +  +++ +           ++GMKK LVFY+GK
Sbjct  69   FFYLREA-KYPNGNRLNRATGCGYWKATGKDKEIVALRSN-----QVVGMKKVLVFYHGK  122

Query  501  PPHGSKTNWIMHEYRLVA-ISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKK  325
            PP GS+T+WIMHEYRL    + AG  P        ++  S  S M    + V+C +F+KK
Sbjct  123  PPRGSRTDWIMHEYRLAGPETRAGAFP--------QRKNSTHSSMVPTEDWVLCRIFKKK  174

Query  324  RVNGKAGEESAE  289
            R   K G +  E
Sbjct  175  RA-AKMGVDDKE  185



>gb|KEH35702.1| NAC transcription factor-like protein [Medicago truncatula]
Length=174

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 119/167 (71%), Gaps = 12/167 (7%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+FV++   V KLPPGF FQPT++E+VF YL+ K FS  LPAS+I E+ N+C++DPW+L
Sbjct  3    KLNFVKNG--VSKLPPGFCFQPTDEELVFHYLKCKIFSYQLPASIIPEI-NVCKFDPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PG+  ++D+YFFSSKEA KY N ++ +R +S+GYWK + S++K       S+ I    G+
Sbjct  60   PGNCGEQDKYFFSSKEA-KYRNSNRMNRTTSSGYWKATGSDKKVSVSSSLSNGIA---GI  115

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAG-----NPPLPPYFL  406
            +K+LVFY GK P+GS+T+WIMHEYRLV++         N PL  Y +
Sbjct  116  RKSLVFYQGKSPNGSRTHWIMHEYRLVSLGTTACNQVINIPLIIYVV  162



>ref|XP_008791093.1| PREDICTED: NAC domain-containing protein 18-like [Phoenix dactylifera]
Length=241

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 119/182 (65%), Gaps = 15/182 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++ +Y+PW+ PG  +QE RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVFSCPLPASIIPEI-DLGKYNPWDFPGACKQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF  +EA KY NG++++R +  GYWK +  ++  +     +SS   ++GMKK LVFY+GK
Sbjct  69   FFHLREA-KYRNGNRSNRATGCGYWKATGKDKAIV-----ASSSNQVVGMKKVLVFYHGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP GS+T+WIMHEYRL     AG       F   K   S  S M    + V+C +F+KKR
Sbjct  123  PPRGSRTDWIMHEYRL-----AGAETRACVFPQRKN--STLSSMVPTKDWVLCRIFKKKR  175

Query  321  VN  316
              
Sbjct  176  AT  177



>emb|CDY23730.1| BnaC04g43920D [Brassica napus]
Length=255

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 119/193 (62%), Gaps = 33/193 (17%)
 Frame = -1

Query  858  VKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRYF  679
            ++LPPGFRF PT++E+V QYL RK   L LPASVI ++ +IC+ DPW+LPGD E E RYF
Sbjct  12   LRLPPGFRFHPTDEELVVQYLCRKVTGLPLPASVIPDI-DICKADPWDLPGDCESE-RYF  69

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS++EA KYPNG++++R + +GYWK +  +        K      ++GMKKTLVFY GKP
Sbjct  70   FSTREA-KYPNGNRSNRSTGSGYWKATGID--------KQIGGRKLVGMKKTLVFYKGKP  120

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKK--  325
            P+G++TNW++HEYRL+                     SQ     +  N V+C VF KK  
Sbjct  121  PNGTRTNWVLHEYRLLD--------------------SQQESYGENTNWVLCRVFLKKTS  160

Query  324  RVNGKAGEESAEV  286
              N K  E+  E+
Sbjct  161  NTNNKRKEDEKEI  173



>gb|EPS68490.1| hypothetical protein M569_06279 [Genlisea aurea]
Length=251

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 124/194 (64%), Gaps = 14/194 (7%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK  S  LP S+I E   +C+ DPW+LPGD E+E RY
Sbjct  27   VMRLPPGFRFHPTDEELVVQYLRRKALSYPLPVSIIPEF-EVCKSDPWDLPGDKEEE-RY  84

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS++E  KYPNG++++R + +GYWK +  +++ ++  G      + +G KKTLVFY GK
Sbjct  85   FFSTRE-VKYPNGNRSNRATLSGYWKATGLDKQIVSSGGN-----LAVGSKKTLVFYKGK  138

Query  501  PPHGSKTNWIMHEYRL----VAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            PP G +T+WIMHEYRL      +S   N  L   FL  +   ++G +   + N  + H F
Sbjct  139  PPKGCRTDWIMHEYRLQNADAYVSNNENWVLCRVFLKKRSRKNEGVV--AVHNQPVFHDF  196

Query  333  QKKRVNGKAGEESA  292
              KR   +  E+S+
Sbjct  197  MAKRDLNRVPEDSS  210



>ref|XP_006410492.1| hypothetical protein EUTSA_v10017152mg [Eutrema salsugineum]
 gb|ESQ51945.1| hypothetical protein EUTSA_v10017152mg [Eutrema salsugineum]
Length=247

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 119/181 (66%), Gaps = 35/181 (19%)
 Frame = -1

Query  858  VKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRYF  679
            ++LPPGFRF PT++E+V QYL+RK   L LPASVI E+ +IC+ DPW+LPGD + E +YF
Sbjct  12   LRLPPGFRFHPTDEELVVQYLRRKVTGLPLPASVIPEI-DICKADPWDLPGDCDSE-KYF  69

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS++EA KYPNG++++R + +GYWK ++  +K I   GK      ++GMKKTLVFY GKP
Sbjct  70   FSTREA-KYPNGNRSNRSTGSGYWK-ATGIDKQIG--GKK-----LVGMKKTLVFYKGKP  120

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P+G++TNW++HEYRLV                    Y +        N V+C VF KKR 
Sbjct  121  PNGTRTNWVLHEYRLV------------------DSYGESK------NWVLCRVFLKKRS  156

Query  318  N  316
            N
Sbjct  157  N  157



>ref|XP_009141320.1| PREDICTED: NAC domain-containing protein 48-like [Brassica rapa]
 emb|CDY37715.1| BnaA04g19530D [Brassica napus]
Length=256

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/192 (45%), Positives = 120/192 (63%), Gaps = 33/192 (17%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L  +++ G  ++LPPGFRF PT++E+V QYL RK   L LPASVI ++ +IC+ DPW+L
Sbjct  3    KLSSIKNRG--LRLPPGFRFHPTDEELVVQYLCRKVTGLPLPASVIPDI-DICKADPWDL  59

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            PGD E E RYFFS++EA KYPNG++++R + +GYWK +  +        K      ++GM
Sbjct  60   PGDCESE-RYFFSTREA-KYPNGNRSNRSTGSGYWKATGID--------KQIGGNKLVGM  109

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLVFY GKPP+G++TNW++HEYRL+                     SQ     +  N 
Sbjct  110  KKTLVFYKGKPPNGTRTNWVLHEYRLLD--------------------SQQESYGENTNW  149

Query  351  VICHVFQKKRVN  316
            V+C VF KK  N
Sbjct  150  VLCRVFLKKTSN  161



>ref|XP_010943745.1| PREDICTED: NAC transcription factor 25-like [Elaeis guineensis]
Length=239

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 114/182 (63%), Gaps = 15/182 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V KLPPGFRF PT++E+V  YL RK FS  LPA+VI E+ ++ ++DPW+LPG  E+E RY
Sbjct  11   VQKLPPGFRFHPTDEELVVHYLTRKAFSFPLPATVIPEI-DLGKFDPWDLPGGSEEE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF+ +EA KY NG +  R + +GYWK +  ++     P  +S    ++G KK LVFY GK
Sbjct  69   FFNLREA-KYLNGKRFKRATMSGYWKATGRDK-----PIIASRCNQLVGWKKDLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPH S T+WIMHEYRL A   + +         +++ +S  S M      V+C +F+K+R
Sbjct  123  PPHASPTDWIMHEYRLAATETSASG-------FSQRKFSAHSSMAHTKEWVVCRIFRKRR  175

Query  321  VN  316
              
Sbjct  176  AT  177



>gb|AAW28153.1| NAC-domain protein [Helianthus annuus]
Length=205

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 120/194 (62%), Gaps = 30/194 (15%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDM-EQEDRYF  679
            +LPPGFR  PT++E+V QYL+R+  S  LPAS+I E+ ++C+ DPW+LPGD  +QE+R+F
Sbjct  13   RLPPGFRLHPTDEELVVQYLKRRVHSSPLPASIIPEV-DVCKSDPWDLPGDSDQQEERFF  71

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS++E  KYPNG++++R + +GYWK +    + +      ++   ++G+KKTLVFY GKP
Sbjct  72   FSTRE-IKYPNGNRSNRATQSGYWKATGLSRQIM-----GANQVGLVGIKKTLVFYKGKP  125

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P GS+T+WIMHEYRL    P                       Q +   V+C +F KKR 
Sbjct  126  PTGSRTDWIMHEYRLATTQPT----------------------QGLEKWVLCKIFLKKRG  163

Query  318  NGKAGEESAEVCGD  277
            N K  +++  V  D
Sbjct  164  NYKDEKKNVPVFYD  177



>ref|XP_009405877.1| PREDICTED: NAC transcription factor 29-like [Musa acuminata subsp. 
malaccensis]
Length=235

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 116/182 (64%), Gaps = 24/182 (13%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK F   LP S+I E+ N+ + DPW+LPG  E+E RY
Sbjct  12   VLRLPPGFRFHPTDEELVVQYLRRKVFCCPLPTSIIPEI-NLAKLDPWDLPGGCEEE-RY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
             F+ +EA KY NG  ++R + +GYWK ++ ++K IT P  S     ++GMKK LVFY GK
Sbjct  70   CFNLREA-KYRNGSWSNRAARSGYWK-ATRKDKQITSPRCS----QVVGMKKVLVFYRGK  123

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G+KT+W+MHEYRL                 A++  S  S     G+ V+C +F+KKR
Sbjct  124  PPTGTKTDWVMHEYRLAGTEST-----------AQRHNSTHS-----GDWVLCRIFKKKR  167

Query  321  VN  316
              
Sbjct  168  AT  169



>ref|XP_009405516.1| PREDICTED: NAC transcription factor NAM-B2-like [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 122/196 (62%), Gaps = 15/196 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD-MEQEDR  685
             ++LPPGFRF PT++++V QYL+RK FS  LPAS+I E+ ++ +YDPWNLPG  ME ++R
Sbjct  12   ALRLPPGFRFHPTDEDLVVQYLKRKVFSCPLPASIIPEI-DLGKYDPWNLPGALMEGDER  70

Query  684  YFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYG  505
            Y F+ +EA KYPNG +++R + +GYWK +  ++K I   G +     ++GM++ LVFY G
Sbjct  71   YCFNRREA-KYPNGKRSNRAARSGYWK-ARGKDKQIVASGCNQ----VVGMRRVLVFYRG  124

Query  504  KPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKK  325
            KPP  S T+W+MHEYRL               ++ ++  S   LM    + V+C +F+++
Sbjct  125  KPPTSSPTDWMMHEYRLAGSDGRS-------LVYPQRKNSTHGLMIPSQDWVLCRIFKRR  177

Query  324  RVNGKAGEESAEVCGD  277
            R      EE   +  D
Sbjct  178  RAPIVVDEEEDIITND  193



>ref|XP_010929607.1| PREDICTED: NAC transcription factor 25-like [Elaeis guineensis]
Length=245

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 117/182 (64%), Gaps = 15/182 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK FS  LPAS+I E+ ++ +Y+PW+  G  +QE RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVFSCPLPASIIPEI-DLGKYNPWDFSGGCKQE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF  +EA KY NG +++R S  GYWK +  ++  +     +SS   ++GMKK LVFY+GK
Sbjct  69   FFYLREA-KYRNGHRSNRASGCGYWKATGKDKAIV-----ASSSNQVVGMKKVLVFYHGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP  S+T+WIMHEYRL     AG       F   K   S  S M    + V+C +F+KKR
Sbjct  123  PPGVSRTDWIMHEYRL-----AGTETRACVFPQRKN--STHSSMVPTKDWVLCRIFKKKR  175

Query  321  VN  316
             N
Sbjct  176  AN  177



>ref|XP_008813225.1| PREDICTED: NAC transcription factor 25-like [Phoenix dactylifera]
Length=281

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 116/182 (64%), Gaps = 14/182 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V +LPPGFRF PT++E+V QYL+RK FS  LPA+VI E+ ++ +YDPW+LPG  ++ ++Y
Sbjct  50   VTRLPPGFRFHPTDEELVVQYLRRKAFSWPLPAAVIPEI-DLGKYDPWDLPGGGKEGEQY  108

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS +EA KY  G + +R + +GYWK +         P  +S    ++G+KK LVFY GK
Sbjct  109  FFSLREA-KYLTGKRHNRATISGYWKATGK-----NTPVIASRCNQLVGLKKVLVFYRGK  162

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEY L A       P    F   ++  S  S M    + V+C +F+K+R
Sbjct  163  PPHGSRTDWIMHEYCLAA-------PETTTFSFPQRKISAHSSMVPSKHWVVCRIFKKRR  215

Query  321  VN  316
             +
Sbjct  216  AS  217



>ref|XP_009410565.1| PREDICTED: NAC transcription factor NAM-B1-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 116/189 (61%), Gaps = 13/189 (7%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V++LPPGFRF PT++E+V QYL+RK     LPA+VI E+ N+ +YDPW+LPG+ + E RY
Sbjct  11   VLRLPPGFRFHPTDEELVVQYLKRKVLCCPLPAAVIPEI-NLSKYDPWDLPGEGDGE-RY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS +EAT YP G +++  + +GYWK +  +      P  +S    ++GMKK LVF+ GK
Sbjct  69   FFSLREAT-YPKGSRSNGATLSGYWKATGKDR-----PVVASGSNELVGMKKVLVFHRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T WIMHEY  +A           +    +K +    + Q   + V+C + +K+ 
Sbjct  123  PPHGSRTEWIMHEYHCLAACETRG-----FSFAQRKKFVHSCMRQTKNDWVVCRILKKRA  177

Query  321  VNGKAGEES  295
               +AG  S
Sbjct  178  KMLEAGNTS  186



>ref|XP_010909195.1| PREDICTED: NAC domain-containing protein 18-like [Elaeis guineensis]
Length=241

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 117/182 (64%), Gaps = 14/182 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
             ++LPPGFRF PT++E+V QYL+RK FS  LPA+VI E+ ++ +YDPW+LPG   + ++Y
Sbjct  11   AMRLPPGFRFHPTDEELVVQYLRRKAFSWPLPAAVIPEI-DLGKYDPWDLPGGGSEGEQY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS +EA +Y NG + +R + +GYWK +  ++     P  +S    ++G+KK LVFY GK
Sbjct  70   FFSLREA-RYLNGRRHNRATVSGYWKVTGKDK-----PVIASRCSQLVGLKKVLVFYRGK  123

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPHGS+T+WIMHEY L         P    F  +++  S  S M    + V+C +F+K+R
Sbjct  124  PPHGSRTDWIMHEYCLAD-------PETRAFSFSQRKTSPHSSMVPSKDWVVCRIFKKRR  176

Query  321  VN  316
              
Sbjct  177  AT  178



>gb|AIZ68166.1| NAC domain-containing protein 29 isoform 1 [Galtonia saundersiae]
Length=230

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 118/197 (60%), Gaps = 20/197 (10%)
 Frame = -1

Query  864  KVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDR  685
            K+++LPPGFRF PT++E+V QYL+RK  S  LPA++I E+ ++ R+DPW+LPG  E E R
Sbjct  3    KLMRLPPGFRFHPTDEELVVQYLRRKALSWPLPAAIIPEI-DLGRFDPWDLPGCHESE-R  60

Query  684  YFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYG  505
            YFF+ ++A KY  G+ +SR + +GYWK +  +        + S    I+GMKK LVF+ G
Sbjct  61   YFFNLRDA-KYRKGNGSSRATRSGYWKATGKDR-----IVRGSKHNEIVGMKKVLVFHQG  114

Query  504  -KPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
             KPPHG +T WIMHEYRL                H      Q S M Q  + V+C +F+K
Sbjct  115  KKPPHGVRTRWIMHEYRLACSE-----------THRNISNDQSSSMVQGKDWVVCRIFKK  163

Query  327  KRVNGKAGEESAEVCGD  277
            KR +    E++   C +
Sbjct  164  KRASDTNEEDAPRCCNN  180



>ref|XP_010036866.1| PREDICTED: NAC transcription factor ONAC010-like [Eucalyptus 
grandis]
 gb|KCW48529.1| hypothetical protein EUGRSUZ_K02205 [Eucalyptus grandis]
Length=218

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 114/188 (61%), Gaps = 18/188 (10%)
 Frame = -1

Query  891  RLHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNL  712
            +L+ +R  G + KLPPGF F+PT++EI+F+YL+RK F+L LPAS+I EL N+   DPW+L
Sbjct  3    KLNQIRAIGSMSKLPPGFVFEPTDEEILFEYLRRKIFALPLPASIIPELINLSNLDPWDL  62

Query  711  PGDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
             GD EQ  RYFFS+         +   R +S G+WK +    K I+     +   MI+GM
Sbjct  63   LGDGEQ-GRYFFSNLAGAN----NAVIRATSCGFWK-AQGVPKQISPSSSDAHNRMIVGM  116

Query  531  KKTLVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNL  352
            KKTLV++ G+PPHGS+T+W+MHEYRLV    A   P               S + ++G  
Sbjct  117  KKTLVYHRGRPPHGSRTSWVMHEYRLVPSPSAARGP------------QLNSWVSELGRW  164

Query  351  VICHVFQK  328
            V+C VF K
Sbjct  165  VMCRVFVK  172



>ref|XP_008790723.1| PREDICTED: NAC transcription factor 25-like isoform X2 [Phoenix 
dactylifera]
Length=235

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 118/193 (61%), Gaps = 16/193 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V +LPPGFRF PT++E+V  YL RK FS  LPA+VI E+ ++ ++DPW+LPG  E+E +Y
Sbjct  12   VQRLPPGFRFHPTDEELVVHYLTRKVFSCPLPAAVIPEI-DLGKFDPWDLPGGSEEE-QY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF+ +EA KY +G +  R + +GYWK ++ ++K I     +S    ++G+KK LVFY GK
Sbjct  70   FFNLREA-KYLSGKRFKRATLSGYWK-ATGKDKSIV----ASRCNQLVGLKKVLVFYRGK  123

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PPH S T+WIMHEYRL A       P    F    + +S    M      V+C +FQK+R
Sbjct  124  PPHASPTDWIMHEYRLAA-------PETSAFSFPLRKFSAHRSMAHTKEWVVCRIFQKRR  176

Query  321  VNGKAGEESAEVC  283
               +   E A  C
Sbjct  177  AT-RIDAEIAPYC  188



>ref|XP_009393866.1| PREDICTED: NAC domain-containing protein 18-like [Musa acuminata 
subsp. malaccensis]
Length=235

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 123/195 (63%), Gaps = 20/195 (10%)
 Frame = -1

Query  864  KVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDR  685
            ++ +LPPGFRF PT++E+V QYL+RK FS  LPAS I +L ++ R+DPW+LPG  E+E R
Sbjct  6    RLTRLPPGFRFHPTDEELVVQYLKRKVFSCPLPASFIPDL-DLARFDPWDLPGGGEEE-R  63

Query  684  YFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYG  505
            Y FS +EA K P+  +++R++ +GYWK +S  +K IT P        ++GMKK LVFY G
Sbjct  64   YCFSLREA-KSPSRSRSNRMARSGYWK-ASGRDKRITSP----RCGQVVGMKKVLVFYGG  117

Query  504  KPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKK  325
            K P GSKT+W+MHEYRL         P     +  ++  S  + +    + V+C +F+KK
Sbjct  118  KHPTGSKTDWVMHEYRLAG-------PESTACIFPQRKNSTHNCIIPSRDWVLCRIFKKK  170

Query  324  R-----VNGKAGEES  295
            R     V  + GEE+
Sbjct  171  RATKMDVETEEGEEA  185



>ref|XP_009143857.1| PREDICTED: NAC domain-containing protein 68-like [Brassica rapa]
 emb|CDY17177.1| BnaA05g10110D [Brassica napus]
Length=252

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 100/136 (74%), Gaps = 12/136 (9%)
 Frame = -1

Query  858  VKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRYF  679
            ++LPPGFRF PT++E+V  YL RK   L LPA VI E+ +IC+ +PW+LPGD   E RYF
Sbjct  12   LRLPPGFRFHPTDEELVVHYLSRKVSGLLLPAYVIPEI-DICKAEPWDLPGDCNSE-RYF  69

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS +EA KYPNG++++R + +GYWK +  + +     GK      ++GMKKTLVFY GKP
Sbjct  70   FSMREA-KYPNGNRSNRSTGSGYWKATGIDRQ----VGKK-----VLGMKKTLVFYKGKP  119

Query  498  PHGSKTNWIMHEYRLV  451
            P+G++TNW++HEYRLV
Sbjct  120  PNGTRTNWVLHEYRLV  135



>ref|XP_008790722.1| PREDICTED: NAC transcription factor NAM-B2-like isoform X1 [Phoenix 
dactylifera]
Length=250

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/201 (43%), Positives = 121/201 (60%), Gaps = 17/201 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            V +LPPGFRF PT++E+V  YL RK FS  LPA+VI E+ ++ ++DPW+LPG  E+E +Y
Sbjct  12   VQRLPPGFRFHPTDEELVVHYLTRKVFSCPLPAAVIPEI-DLGKFDPWDLPGGSEEE-QY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF+ +EA KY +G +  R + +GYWK ++ ++K I     +S    ++G+KK LVFY GK
Sbjct  70   FFNLREA-KYLSGKRFKRATLSGYWK-ATGKDKSIV----ASRCNQLVGLKKVLVFYRGK  123

Query  501  PPHGSKTNWIMHEYRLVA-ISPAGNPPLPPYFLHA-------KKDYSQGSLMQQIGNLVI  346
            PPH S T+WIMHEYRL A  + A + PL  +  H            S    M      V+
Sbjct  124  PPHASPTDWIMHEYRLAAPETSAFSFPLRKFSAHVSSPISSSSSSSSSKRSMAHTKEWVV  183

Query  345  CHVFQKKRVNGKAGEESAEVC  283
            C +FQK+R   +   E A  C
Sbjct  184  CRIFQKRRAT-RIDAEIAPYC  203



>ref|XP_009388267.1| PREDICTED: NAC transcription factor NAM-B2-like [Musa acuminata 
subsp. malaccensis]
Length=219

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 121/187 (65%), Gaps = 15/187 (8%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
             ++LPPGFRF P+++E+V QYL+RK FS  LPA  I ++ ++ ++DPWNLPG  + E RY
Sbjct  12   ALRLPPGFRFHPSDEELVVQYLKRKVFSCPLPAFFIPDI-DLRKHDPWNLPGACQGE-RY  69

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FF+ ++ ++YPNG +++R +S+GYWK ++ ++K I   G +     ++G+KK L+FY GK
Sbjct  70   FFNLRK-SRYPNGKRSNRAASSGYWK-ATGKDKQIVASGCNQ----VVGIKKVLIFYRGK  123

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
             P GS+T+WIMHEY L     + NP L    +  ++  S   +M    + V+C +F+K+R
Sbjct  124  LPAGSRTDWIMHEYSLAG---SDNPAL----IFPQRKNSTHGMMVPNQDWVLCRIFKKRR  176

Query  321  VNGKAGE  301
                  E
Sbjct  177  TTNMVDE  183



>ref|XP_009379969.1| PREDICTED: NAC transcription factor NAM-B2-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 121/195 (62%), Gaps = 22/195 (11%)
 Frame = -1

Query  861  VVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRY  682
            +++LPPGFRF PT++E+V QYL+RK +S  LPAS+I E+ ++  +DPW+LPG  E E RY
Sbjct  11   MLRLPPGFRFHPTDEELVVQYLKRKVYSFPLPASIIPEI-DLRNHDPWDLPGGRE-EVRY  68

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
             FS +EAT Y N ++++  + +G WK +  E + +     +S    ++GMKK LVFY GK
Sbjct  69   LFSFREAT-YLNRNRSNPRARSGCWKVAGKERQVV-----ASGCNQVVGMKKVLVFYRGK  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP  ++T+WIMHEYRL    P  NP         + D +  S++   G+ V+C +F+KKR
Sbjct  123  PP--TRTDWIMHEYRLA--RPDANP---------RNDATHSSMVPN-GDWVLCRIFRKKR  168

Query  321  VNGKAGEESAEVCGD  277
                  EE  E  G+
Sbjct  169  AAKMEAEEDDEQAGE  183



>emb|CDY19496.1| BnaC04g11030D [Brassica napus]
Length=251

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 100/136 (74%), Gaps = 12/136 (9%)
 Frame = -1

Query  858  VKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRYF  679
            ++LPPGFRF PT++E+V  YL RK   L LPA VI E+ +IC+ +PW+LPGD   E RYF
Sbjct  12   LRLPPGFRFHPTDEELVVHYLSRKVSGLLLPAYVIPEI-DICKAEPWDLPGDCNSE-RYF  69

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS +EA KYPNG++++R + +GYWK +  + +     GK      ++GMKKTLVFY GKP
Sbjct  70   FSMREA-KYPNGNRSNRSTGSGYWKATGIDRQ----IGKK-----VLGMKKTLVFYKGKP  119

Query  498  PHGSKTNWIMHEYRLV  451
            P+G++T+W++HEYRLV
Sbjct  120  PNGTRTSWVLHEYRLV  135



>emb|CDY19495.1| BnaC04g11040D [Brassica napus]
Length=252

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 100/136 (74%), Gaps = 12/136 (9%)
 Frame = -1

Query  858  VKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRYF  679
            ++LPPGFRF PT++E+V  YL RK   L LPA VI E+ +IC+ +PW+LPGD   E RYF
Sbjct  12   LRLPPGFRFHPTDEELVVHYLSRKVSGLLLPAYVIPEI-DICKAEPWDLPGDCNSE-RYF  69

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS +EA KYPNG++++R + +GYWK +  + +     GK      ++GMKKTLVFY GKP
Sbjct  70   FSMREA-KYPNGNRSNRSTGSGYWKATGIDRQ----IGKK-----VLGMKKTLVFYKGKP  119

Query  498  PHGSKTNWIMHEYRLV  451
            P+G++T+W++HEYRLV
Sbjct  120  PNGTRTSWVLHEYRLV  135



>ref|XP_011098344.1| PREDICTED: NAC domain-containing protein 18 [Sesamum indicum]
Length=338

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 127/230 (55%), Gaps = 20/230 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD--MEQEDRY  682
            +LPPGFRF PT++E+V  YL++K  S  LP S+I+E+ ++ +YDPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKKKAASAPLPVSIIAEV-DLYKYDPWELPAKAIFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRD-RKYPNGARPNRAATSGYWKATGTDKPVLTAGGTQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KTNWIMHEYRL    PA N P          D+S      ++ + V+C +++K  
Sbjct  127  PPKGIKTNWIMHEYRLADNKPASNKP-------PGCDFSNKKASLRLDDWVLCRIYKKNN  179

Query  321  VNGKAGEESAE---VCGDninisinegenIVDNAEQQLFERYNLMMRDGL  181
                  +E  E   V G             +DN + Q +    +MM D +
Sbjct  180  AQRPVDQERDELNDVIGSIPPTISIGQHKFLDNNDHQNYYE-GMMMNDSM  228



>ref|NP_001284435.1| NAC domain-containing protein 18-like [Cucumis melo]
 gb|ABM88940.1| NAC transcription factor [Cucumis melo]
Length=318

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 121/204 (59%), Gaps = 14/204 (7%)
 Frame = -1

Query  879  VRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDM  700
            +  D +   LPPGFRF PT++E+V  YL++K  SL LP ++I+E+ ++ +YDPW LP   
Sbjct  8    LETDSERPNLPPGFRFHPTDEELVVHYLKKKATSLPLPVAIIAEV-DLYKYDPWELPAKA  66

Query  699  E--QEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKK  526
               +++ YFFS ++  KYPNG + +R +++GYWK + +++  I     SS     +G+KK
Sbjct  67   SYGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPVIA----SSEGNRKVGVKK  121

Query  525  TLVFYYGKPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLV  349
             LVFY GKPP G KTNWIMHEYRL    S  GN   PP F+   K  S      ++ + V
Sbjct  122  ALVFYGGKPPKGIKTNWIMHEYRLADNKSGGGNNNKPPGFIIGGKKNS-----LRLDDWV  176

Query  348  ICHVFQKKRVNGKAGEESAEVCGD  277
            +C +++K   N    +   E C D
Sbjct  177  LCRIYKKNNSNKPGTDHEREDCFD  200



>gb|KHN04148.1| NAC domain-containing protein 18, partial [Glycine soja]
Length=142

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 97/133 (73%), Gaps = 7/133 (5%)
 Frame = -1

Query  849  PPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRYFFSS  670
            PP +       E+V QYL+RK FS  LPAS+I EL ++C+ DPW+LPGD+EQE RYFFS+
Sbjct  6    PPLYTKNIISMELVLQYLKRKVFSCPLPASIIPEL-HVCKSDPWDLPGDLEQE-RYFFST  63

Query  669  KEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKPPHG  490
            K A KYPNG++++R +++GYWK +  +++ +T  G +     +  M KTLVF  GKPP+G
Sbjct  64   KVA-KYPNGNRSNRATNSGYWKATGLDKQIVTSKGNNQ----VFEMNKTLVFCRGKPPYG  118

Query  489  SKTNWIMHEYRLV  451
            S+T+WIMHEYRL+
Sbjct  119  SRTDWIMHEYRLI  131



>ref|XP_003535156.1| PREDICTED: NAC transcription factor ONAC010-like [Glycine max]
Length=133

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 94/122 (77%), Gaps = 7/122 (6%)
 Frame = -1

Query  816  EIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRYFFSSKEATKYPNGDQ  637
            E+V QYL+RK FS  LPAS+I EL ++C+ DPW+LPGD+EQE RYFFS+K A KYPNG++
Sbjct  2    ELVLQYLKRKVFSCPLPASIIPEL-HVCKSDPWDLPGDLEQE-RYFFSTKVA-KYPNGNR  58

Query  636  TSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKPPHGSKTNWIMHEYR  457
            ++R +++GYWK +  +++ +T  G +     +  M KTLVF  GKPP+GS+T+WIMHEYR
Sbjct  59   SNRATNSGYWKATGLDKQIVTSKGNNQ----VFEMNKTLVFCRGKPPYGSRTDWIMHEYR  114

Query  456  LV  451
            L+
Sbjct  115  LI  116



>ref|XP_004147807.1| PREDICTED: NAC transcription factor ONAC010-like [Cucumis sativus]
 gb|KGN59897.1| hypothetical protein Csa_3G852460 [Cucumis sativus]
Length=318

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/201 (41%), Positives = 119/201 (59%), Gaps = 14/201 (7%)
 Frame = -1

Query  870  DGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--  697
            D +   LPPGFRF PT++E+V  YL++K  SL LP ++I+E+ ++ +YDPW LP      
Sbjct  11   DSERPNLPPGFRFHPTDEELVVHYLKKKATSLPLPVAIIAEV-DLYKYDPWELPAKASYG  69

Query  696  QEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLV  517
            +++ YFFS ++  KYPNG + +R +++GYWK + +++  I     SS     +G+KK LV
Sbjct  70   EQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPVIA----SSEGNRKVGVKKALV  124

Query  516  FYYGKPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICH  340
            FY GKPP G KTNWIMHEYRL    S  GN   PP F    K  S      ++ + V+C 
Sbjct  125  FYGGKPPKGIKTNWIMHEYRLADNKSGGGNNNKPPGFNIGGKKNS-----LRLDDWVLCR  179

Query  339  VFQKKRVNGKAGEESAEVCGD  277
            +++K   N    +   E C D
Sbjct  180  IYKKTNSNKPGMDHEREDCFD  200



>ref|NP_001060017.1| Os07g0566500 [Oryza sativa Japonica Group]
 sp|Q8H4S4.1|NAC10_ORYSJ RecName: Full=NAC transcription factor ONAC010 [Oryza sativa 
Japonica Group]
 dbj|BAC22555.1| putative OsNAC5 protein [Oryza sativa Japonica Group]
 dbj|BAC55651.1| putative OsNAC5 protein [Oryza sativa Japonica Group]
 dbj|BAF21931.1| Os07g0566500 [Oryza sativa Japonica Group]
 gb|EAZ40329.1| hypothetical protein OsJ_24777 [Oryza sativa Japonica Group]
Length=425

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 129/206 (63%), Gaps = 23/206 (11%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K  S+ LP ++I+E+ ++ ++DPW+LP   +  +
Sbjct  24   GSAPELPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEV-DLYKFDPWDLPEKANFGE  82

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK + +++  ++    S S    +G+KK LVF
Sbjct  83   QEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPIMS----SGSTREKVGVKKALVF  137

Query  513  YYGKPPHGSKTNWIMHEYRL-------VAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            Y GKPP G KTNWIMHEYRL        A++    PP PP         S+G++  ++ +
Sbjct  138  YRGKPPKGVKTNWIMHEYRLTDTSSSAAAVATTRRPP-PPI-----TGGSKGAVSLRLDD  191

Query  354  LVICHVFQKKRVNGKAGEESAEVCGD  277
             V+C +++K    G AG+ S E C D
Sbjct  192  WVLCRIYKKTNKAG-AGQRSME-CED  215



>ref|XP_011096265.1| PREDICTED: NAC transcription factor 25 [Sesamum indicum]
Length=360

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 116/178 (65%), Gaps = 17/178 (10%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ +YDPW LP      +++ Y
Sbjct  15   RLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEV-DLYKYDPWELPSKASFGEQEWY  73

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS +E  KYPNG++ +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  74   FFSPRE-RKYPNGERPNRAATSGYWKATGTDKPILTANGTQK-----IGVKKALVFYGGK  127

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            PP G K+NWIMHEYRLV  + + N   PP     KK    GSL  Q+ + V+C +F+K
Sbjct  128  PPKGIKSNWIMHEYRLVDKNSSAN--KPPGISLTKK----GSL--QLDDWVLCRIFKK  177



>sp|A2YMR0.1|NAC10_ORYSI RecName: Full=NAC transcription factor ONAC010 [Oryza sativa 
Indica Group]
 gb|EAZ04371.1| hypothetical protein OsI_26514 [Oryza sativa Indica Group]
Length=425

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 127/206 (62%), Gaps = 23/206 (11%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K  S+ LP ++I+E+ ++ ++DPW LP   +  +
Sbjct  24   GSAPELPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEV-DLYKFDPWELPEKANFGE  82

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK + +++  +     S S    +G+KK LVF
Sbjct  83   QEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPIMA----SGSTREKVGVKKALVF  137

Query  513  YYGKPPHGSKTNWIMHEYRL-------VAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGN  355
            Y GKPP G KTNWIMHEYRL        A++    PP PP         S+G++  ++ +
Sbjct  138  YRGKPPKGVKTNWIMHEYRLTDTSSSAAAVATTRQPP-PPI-----TGGSRGAVSLRLDD  191

Query  354  LVICHVFQKKRVNGKAGEESAEVCGD  277
             V+C +++K    G AG+ S E C D
Sbjct  192  WVLCRIYKKTNKAG-AGQRSME-CED  215



>ref|XP_003541060.1| PREDICTED: NAC transcription factor ONAC010-like [Glycine max]
Length=235

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 94/122 (77%), Gaps = 7/122 (6%)
 Frame = -1

Query  816  EIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDRYFFSSKEATKYPNGDQ  637
            E+V QYL+RK FS  LPAS+I EL ++C+ DPW+LPGD+EQE RYFFS+K A KYPNG++
Sbjct  2    ELVLQYLKRKVFSCPLPASIIPEL-HVCKSDPWDLPGDLEQE-RYFFSTKVA-KYPNGNR  58

Query  636  TSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKPPHGSKTNWIMHEYR  457
            ++R +++GYWK +  +++ +T  G +     +  M KTLVF  GKPP+GS+T+WIMHEYR
Sbjct  59   SNRATNSGYWKATGLDKQIVTSKGNN----QVFEMNKTLVFCRGKPPYGSRTDWIMHEYR  114

Query  456  LV  451
            L+
Sbjct  115  LI  116



>gb|AID55354.1| NAC protein 3 [Actinidia chinensis]
Length=319

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 117/194 (60%), Gaps = 17/194 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD--MEQEDRYF  679
            LPPGFRF PT++E+V  YL++K  S +LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKVASATLPVAIITEI-DLYKFDPWELPAKAMFGEQELYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK +  ++  +T  G        +G+KK LVFY GKP
Sbjct  74   FSPRDR-KYPNGARPNRTATSGYWKATGIDKPVLTSSGTQK-----VGVKKALVFYRGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL+       PP           +S+GSL  ++ + V+C +++K   
Sbjct  128  PKGVKTNWIMHEYRLIDNRAKSKPP------GYDAGHSKGSL--RLDDWVLCRIYKKNYP  179

Query  318  NGKAGEESAEVCGD  277
            +   G E  +   D
Sbjct  180  SRLIGHEKEDSMTD  193



>gb|EYU43023.1| hypothetical protein MIMGU_mgv1a024673mg [Erythranthe guttata]
Length=224

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 116/192 (60%), Gaps = 18/192 (9%)
 Frame = -1

Query  888  LHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP  709
            + FV + G+  KLPPGFRFQPT++EIVFQYL RKTFS  LPA ++    NI   +P+  P
Sbjct  4    MKFVGEGGR--KLPPGFRFQPTDEEIVFQYLARKTFSHPLPAHILIPEINIFTLNPFEFP  61

Query  708  GDMEQEDRYFFSSKEA-TKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGM  532
            G+ ++E RYFFS+KE   +  N  Q+S+ +  GYWK + S  K I C  K  ++P I+G+
Sbjct  62   GNSDEE-RYFFSNKEGNNRKGNTVQSSKATCTGYWKATGS-AKRINCSKK--AMP-IIGI  116

Query  531  KKTLVFYYGK--PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIG  358
            +K+LVFY  K       +TNW MHEY  +A+S         Y +  K +  Q   + +IG
Sbjct  117  RKSLVFYKTKKNSNRAFRTNWTMHEY-FIAVSEN-------YSIQHKNNSLQAGTLARIG  168

Query  357  NLVICHVFQKKR  322
            N  +C +F KKR
Sbjct  169  NWTLCRIFLKKR  180



>ref|XP_002316635.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE97247.1| no apical meristem family protein [Populus trichocarpa]
Length=335

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 115/178 (65%), Gaps = 17/178 (10%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL++K  S+ LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKKKVASVPLPVTIIAEI-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRDR-KYPNGARPNRAATSGYWKATGTDKPILTSNGAQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            PP G KTNWIMHEYRL+  +P+  PP          +   GSL  ++ + V+C +++K
Sbjct  127  PPKGIKTNWIMHEYRLINNNPSSKPP------GDSANKKGGSL--RLDDWVLCRIYKK  176



>gb|EPS69130.1| hypothetical protein M569_05637, partial [Genlisea aurea]
Length=188

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 114/188 (61%), Gaps = 18/188 (10%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD--MEQEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LPAS+I+E+ ++ ++DPW LP       ++ YF
Sbjct  14   LPPGFRFHPTDEELVVHYLKKKIASAPLPASIIAEV-DLYKFDPWELPSKAIFGGQEWYF  72

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  73   FSPRD-RKYPNGARPNRAATSGYWKATGTDKPVMTSGGTER-----VGVKKALVFYNGKP  126

Query  498  PHGSKTNWIMHEYRLVAIS-PAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            P G K+NWIMHEYRLV  + P+  PP          D +      ++ + V+C ++QK  
Sbjct  127  PRGIKSNWIMHEYRLVDNNKPSSKPP--------GCDIANKKTSLRLDDWVLCRIYQKNN  178

Query  321  VNGKAGEE  298
            +     +E
Sbjct  179  LQRAMDQE  186



>ref|XP_010278293.1| PREDICTED: NAC transcription factor NAM-B2-like [Nelumbo nucifera]
Length=359

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 112/182 (62%), Gaps = 17/182 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRY  682
            +LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LPG     +++ Y
Sbjct  19   RLPPGFRFHPTDEELVVHYLKKKASSAPLPVTIIAEV-DLYKFDPWELPGKATFGEQEWY  77

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY G+
Sbjct  78   FFSPRDR-KYPNGARPNRAATSGYWKATGTDKPILTSGGTQK-----VGVKKALVFYGGR  131

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KTNWIMHEYRL   S +  PP          D S      ++ + V+C +++K  
Sbjct  132  PPKGVKTNWIMHEYRLADNSTSSKPP--------GVDVSNKKSSLRLDDWVLCRIYKKNN  183

Query  321  VN  316
             N
Sbjct  184  SN  185



>ref|XP_004172388.1| PREDICTED: LOW QUALITY PROTEIN: NAC transcription factor ONAC010-like 
[Cucumis sativus]
Length=318

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 118/201 (59%), Gaps = 14/201 (7%)
 Frame = -1

Query  870  DGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--  697
            D +   LPPGFRF PT++E+V  YL++K  SL LP ++I+E+ ++ +YDPW LP      
Sbjct  11   DSERPNLPPGFRFHPTDEELVVHYLKKKATSLPLPVAIIAEV-DLYKYDPWELPAKASYG  69

Query  696  QEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLV  517
            +++ Y FS ++  KYPNG + +R +++GYWK + +++  I     SS     +G+KK LV
Sbjct  70   EQEWYXFSPRD-RKYPNGARPNRAATSGYWKATGTDKPVIA----SSEGNRKVGVKKALV  124

Query  516  FYYGKPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICH  340
            FY GKPP G KTNWIMHEYRL    S  GN   PP F    K  S      ++ + V+C 
Sbjct  125  FYGGKPPKGIKTNWIMHEYRLADNKSGGGNNNKPPGFNIGGKKNS-----LRLDDWVLCR  179

Query  339  VFQKKRVNGKAGEESAEVCGD  277
            +++K   N    +   E C D
Sbjct  180  IYKKTNSNKPGMDHEREDCFD  200



>gb|AFD54040.1| NAC transcription factor NAM-1 [Aegilops longissima]
Length=405

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 119/202 (59%), Gaps = 7/202 (3%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GD  703
            R  G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP    
Sbjct  25   RQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKAT  83

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              +++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK 
Sbjct  84   FGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKA  142

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP G KTNWIMHEYRL   S + N   PP  +      S+ +   ++ + V+C
Sbjct  143  LVFYRGKPPKGLKTNWIMHEYRLTDASGSTNTSRPPPPVTGG---SRAAASLRLDDWVLC  199

Query  342  HVFQKKRVNGKAGEESAEVCGD  277
             +++K        ++ +  C D
Sbjct  200  RIYKKINKAAAGDQQRSTECED  221



>emb|CAN81855.1| hypothetical protein VITISV_041250 [Vitis vinifera]
Length=226

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 116/178 (65%), Gaps = 16/178 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL+RK  S+ LP ++I+++ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKRKAASVPLPVTIIADV-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILTSNGSQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            PP G KTNWIMHEYRL+  + +   P P   +  KK    GSL  ++ + V+C +++K
Sbjct  127  PPKGIKTNWIMHEYRLIDSTSSNTKP-PGADMGNKK----GSL--RLDDWVLCRIYKK  177



>gb|EYU27944.1| hypothetical protein MIMGU_mgv1a020591mg, partial [Erythranthe 
guttata]
Length=304

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 112/178 (63%), Gaps = 16/178 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL+++  S  LP ++I+EL ++ +YDPW LP      +++ Y
Sbjct  12   RLPPGFRFHPTDEELVVHYLKKRAASAPLPVAIIAEL-DLYKYDPWELPSKASFGEQEWY  70

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS +E  KYPNG++ +R +++GYWK + +++  +T  G  +     +G+KK LVFY GK
Sbjct  71   FFSRRE-RKYPNGERPNRAATSGYWKATGTDKPILTANGAQT-----VGVKKALVFYGGK  124

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            PP G K+NWIMHEYRLV  + A        F+  K          ++ + V+C +F+K
Sbjct  125  PPKGIKSNWIMHEYRLVDGNSAAKKTPGIAFIGNKTS-------SRLDDWVLCRIFKK  175



>sp|A0SPJ3.1|NAMA1_TRITD RecName: Full=NAC transcription factor NAM-A1; Short=TtNAM-A1 
[Triticum turgidum subsp. durum]
 gb|ABI94352.1| NAC transcription factor NAM-A1 [Triticum turgidum subsp. durum]
Length=405

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 119/202 (59%), Gaps = 7/202 (3%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GD  703
            R  G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP    
Sbjct  25   RQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKAT  83

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              +++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK 
Sbjct  84   FGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKA  142

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP G KTNWIMHEYRL  +S +     PP  +      S+ +   ++ + V+C
Sbjct  143  LVFYRGKPPKGLKTNWIMHEYRLTDVSGSTTTSRPPPPVTGG---SRAAASLRLDDWVLC  199

Query  342  HVFQKKRVNGKAGEESAEVCGD  277
             +++K        ++ +  C D
Sbjct  200  RIYKKINKAAAGDQQRSTECED  221



>ref|XP_008452274.1| PREDICTED: NAC transcription factor 25-like [Cucumis melo]
Length=353

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 114/177 (64%), Gaps = 15/177 (8%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKANSSPLPVAIIAEV-DLYKFDPWELPAKATFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS +E  KYPNG + +R +++GYWK + +++  +   G +  +    G+KK LVFY GKP
Sbjct  74   FSPRE-RKYPNGARPNRAATSGYWKATGTDKPVLAADGSNQKV----GVKKALVFYGGKP  128

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            P G KTNWIMHEYRL    P  N P P Y L  KK+    SL  ++ + V+C +++K
Sbjct  129  PKGIKTNWIMHEYRLADNKPCINKP-PGYDLANKKN----SL--KLDDWVLCRIYKK  178



>ref|XP_011047846.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=355

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 114/178 (64%), Gaps = 17/178 (10%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL++K  S+ LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  14   RLPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEI-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R + +GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRDR-KYPNGARPNRAAPSGYWKATGTDKPILTSNGAQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            PP G KTNWIMHEYRL+  +P+  PP          +   GSL  ++ + V+C +++K
Sbjct  127  PPKGIKTNWIMHEYRLINNNPSSKPP------GDSANKKGGSL--RLDDWVLCRIYKK  176



>ref|XP_006657850.1| PREDICTED: NAC transcription factor ONAC010-like [Oryza brachyantha]
Length=437

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 126/207 (61%), Gaps = 22/207 (11%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K  S+ LP ++I+E+ ++ ++DPW LP      +
Sbjct  24   GSAPELPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEV-DLYKFDPWELPEKASFGE  82

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK ++  +K I   G S      +G+KK LVF
Sbjct  83   QEWYFFSPRD-RKYPNGARPNRAATSGYWK-ATGTDKPIMASGSSREK---VGVKKALVF  137

Query  513  YYGKPPHGSKTNWIMHEYRLV-----AISPAGNPPL---PPYFLHAKKDYSQGSLMQQIG  358
            Y GKPP G KTNWIMHEYRL      +++ AG       PP         S+G++  ++ 
Sbjct  138  YRGKPPKGIKTNWIMHEYRLTDTTSSSLTAAGVATTRRPPPTITGG----SRGAVSLRLD  193

Query  357  NLVICHVFQKKRVNGKAGEESAEVCGD  277
            + V+C +++K    G AG+ S E C D
Sbjct  194  DWVLCRIYKKTNKAG-AGQRSME-CED  218



>ref|XP_009392346.1| PREDICTED: NAC transcription factor NAM-B2-like [Musa acuminata 
subsp. malaccensis]
Length=389

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 117/182 (64%), Gaps = 14/182 (8%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPG--DMEQEDRY  682
            +LPPGFRF PT++E+V  YL++K  +  LP ++I+E+ ++ ++DPW LPG  +  +++ Y
Sbjct  20   QLPPGFRFHPTDEELVVHYLKKKAAAAPLPVAIITEV-DLYKFDPWELPGKANFGEQEWY  78

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G    +    G+KK LVFY G+
Sbjct  79   FFSPRD-RKYPNGARPNRAATSGYWKATGTDKPVLTSGGSQVKV----GVKKALVFYRGR  133

Query  501  PPHGSKTNWIMHEYRLV----AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            PP G+KTNWIMHEYRL       + + +   PPY  H       GSL  ++ + V+C ++
Sbjct  134  PPRGTKTNWIMHEYRLADGSSPENSSSSSCRPPYGGHMANKKKGGSL--RLDDWVLCRIY  191

Query  333  QK  328
            +K
Sbjct  192  KK  193



>ref|XP_004149287.1| PREDICTED: NAC transcription factor 25-like [Cucumis sativus]
 gb|KGN56220.1| hypothetical protein Csa_3G100800 [Cucumis sativus]
Length=353

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 114/177 (64%), Gaps = 15/177 (8%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKANSSPLPVAIIAEV-DLYKFDPWELPAKATFGEQEWYF  74

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS +E  KYPNG + +R +++GYWK + +++  +   G +  +    G+KK LVFY GKP
Sbjct  75   FSPRE-RKYPNGARPNRAATSGYWKATGTDKPVLASDGSNQKV----GVKKALVFYGGKP  129

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            P G KTNWIMHEYRL    P  N P P Y L  KK+    SL  ++ + V+C +++K
Sbjct  130  PKGIKTNWIMHEYRLADNKPCINKP-PGYDLANKKN----SL--KLDDWVLCRIYKK  179



>ref|XP_003540450.1| PREDICTED: NAC domain-containing protein 18-like [Glycine max]
 gb|KHN28035.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 112/180 (62%), Gaps = 16/180 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++KT S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKTASAPLPVAIIAEV-DLYKFDPWELPAKAAFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            F+ ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FTPRD-RKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL    P   PP P   L  KK+        ++ + V+C +++K   
Sbjct  128  PRGIKTNWIMHEYRLADNKPNNRPP-PGCDLGNKKN------TLRLDDWVLCRIYKKSNT  180



>gb|EPS59407.1| hypothetical protein M569_15400, partial [Genlisea aurea]
Length=171

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 112/178 (63%), Gaps = 20/178 (11%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD--MEQEDRYF  679
            LP GFRF PT++E+V  YL+RK     LPAS+I+++ ++ ++DPW LP      +   YF
Sbjct  1    LPSGFRFHPTDEELVIDYLKRKVAGAPLPASIIADI-DLYKFDPWELPDKALFGEHVWYF  59

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            F+ +E  KYPNG + +R + +GYWK ++  +K I   G +S +    G+KK LVFY GKP
Sbjct  60   FTPRE-RKYPNGARPNRAAISGYWK-ATGTDKSIMAEGGASRV----GVKKALVFYTGKP  113

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKK  325
            P G KTNWIMHEYRLV  +P    P+P +   +++D S      ++   V+C +++K+
Sbjct  114  PKGLKTNWIMHEYRLVDNNPG---PIPEFL--SRRDSS------RLDEWVLCRIYEKR  160



>ref|XP_008800137.1| PREDICTED: NAC transcription factor 25 [Phoenix dactylifera]
Length=394

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 114/182 (63%), Gaps = 15/182 (8%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRY  682
            +LPPGFRF PT++E+V  YL++K  S  LPA++I+E+ ++ ++DPW LPG     +++ Y
Sbjct  16   QLPPGFRFHPTDEELVVHYLKKKAASAPLPATIIAEV-DLYKFDPWELPGKANYGEQEWY  74

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R + +GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  75   FFSPRD-RKYPNGARPNRAAPSGYWKATGTDKPILTSGGAHK-----VGVKKALVFYGGK  128

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KT+WIMHEYRL   SP G+   PP      K  S      ++ + V+C +++K  
Sbjct  129  PPKGIKTDWIMHEYRLADSSP-GSTFRPPGSAAGSKKSS-----LRLDDWVLCRIYKKNS  182

Query  321  VN  316
             N
Sbjct  183  TN  184



>ref|XP_002305677.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE86188.1| no apical meristem family protein [Populus trichocarpa]
Length=351

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 116/178 (65%), Gaps = 16/178 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL++K  S+ LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEI-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILTSNGAQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            PP G KTNWIMHEYRL+  + +   P PP    A K    GSL  ++ + V+C +++K
Sbjct  127  PPKGIKTNWIMHEYRLIENNSS---PKPPAADSANK--KGGSL--RLDDWVLCRIYKK  177



>ref|XP_011027905.1| PREDICTED: NAC transcription factor 25-like [Populus euphratica]
Length=351

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 116/178 (65%), Gaps = 16/178 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL++K  S+ LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEI-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILTSNGAQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            PP G KTNWIMHEYRL+  + +   P PP    A K    GSL  ++ + V+C +++K
Sbjct  127  PPKGIKTNWIMHEYRLIENNSS---PKPPAADSANK--KGGSL--RLDDWVLCRIYKK  177



>gb|AEH68227.1| NAC transcription factor [Triticum aestivum]
 gb|AIZ97664.1| NAC transcription factor NAM-A1 [Triticum aestivum]
Length=405

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 118/202 (58%), Gaps = 7/202 (3%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GD  703
            R  G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP    
Sbjct  25   RQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKAT  83

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              +++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK 
Sbjct  84   FGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKA  142

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C
Sbjct  143  LVFYRGKPPKGLKTNWIMHEYRLTDASGSTTTSRPPPPVTGG---SRAAASLRLDDWVLC  199

Query  342  HVFQKKRVNGKAGEESAEVCGD  277
             +++K        ++ +  C D
Sbjct  200  RIYKKINKAAAGDQQRSTECED  221



>gb|AFD54030.1| NAC transcription factor NAM-1 [Aegilops sharonensis]
Length=408

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 118/202 (58%), Gaps = 4/202 (2%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GD  703
            R  G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP    
Sbjct  25   RQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLFKFDPWELPEKAT  83

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              +++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK 
Sbjct  84   FGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKA  142

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP G KTNWIMHEYRL   S + N   PP         S+ +   ++ + V+C
Sbjct  143  LVFYRGKPPKGLKTNWIMHEYRLTDASGSTNTSRPPPPPPPVTGGSRAAASLRLDDWVLC  202

Query  342  HVFQKKRVNGKAGEESAEVCGD  277
             +++K        ++ +  C D
Sbjct  203  RIYKKINKAAAGDQQRSTECED  224



>gb|AEI00650.1| NAC2 [Triticum aestivum]
Length=405

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 118/202 (58%), Gaps = 7/202 (3%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GD  703
            R  G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP    
Sbjct  25   RQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKAT  83

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              +++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK 
Sbjct  84   FGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKA  142

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C
Sbjct  143  LVFYRGKPPKGLKTNWIMHEYRLTDASGSTTTSRPPPPVTGG---SRAAASLRLDDWVLC  199

Query  342  HVFQKKRVNGKAGEESAEVCGD  277
             +++K        ++ +  C D
Sbjct  200  RIYKKINKAAAGDQQRSTECED  221



>gb|AID55353.1| NAC protein 2 [Actinidia chinensis]
Length=315

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 113/177 (64%), Gaps = 16/177 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKVASAPLPVAIIAEI-DLYKFDPWELPAKATFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS +   KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FSPRN-RKYPNGARPNRAATSGYWKATGTDKPVLTSSGNQK-----VGVKKALVFYRGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            P G KTNWIMHEYR++       PP P Y       +++GSL  ++ + V+C +++K
Sbjct  128  PKGVKTNWIMHEYRIIDNEAKSKPP-PGY----DAGHNKGSL--RLDDWVLCRIYKK  177



>emb|CBI38329.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 123/196 (63%), Gaps = 19/196 (10%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL+RK  S+ LP ++I+++ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKRKAASVPLPVTIIADV-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRDR-KYPNGARPNRAATSGYWKATGTDKPILTSNGSQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK--  328
            PP G KTNWIMHEYRL+  + +   P P   +  KK    GSL  ++ + V+C +++K  
Sbjct  127  PPKGIKTNWIMHEYRLIDSTSSNTKP-PGADMGNKK----GSL--RLDDWVLCRIYKKNI  179

Query  327  -KRVNGKAGEESAEVC  283
             +R   +  EES E  
Sbjct  180  SQRPMERDKEESMEAL  195



>ref|XP_007149615.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
 gb|ESW21609.1| hypothetical protein PHAVU_005G084600g [Phaseolus vulgaris]
Length=369

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 110/181 (61%), Gaps = 17/181 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRY  682
            +LPPGFRF PT++E+V  YL++KT S+ LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  15   QLPPGFRFHPTDEELVVHYLKKKTASVPLPVAIIAEV-DLYKFDPWELPAKATFGEQEWY  73

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  74   FFSPRDR-KYPNGARPNRAATSGYWKATGTDKPVLTSGGTQK-----VGVKKALVFYGGK  127

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KTNWIMHEYRL    P   PP          D        ++ + V+C +++K  
Sbjct  128  PPRGIKTNWIMHEYRLADNKPNNRPP--------GCDLGNKKNSLRLDDWVLCRIYKKSN  179

Query  321  V  319
             
Sbjct  180  T  180



>gb|AFD54039.1| NAC transcription factor NAM-1 [Aegilops longissima]
Length=408

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 118/202 (58%), Gaps = 4/202 (2%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GD  703
            R  G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP    
Sbjct  25   RQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKAT  83

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              +++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK 
Sbjct  84   FGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKA  142

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP G KTNWIMHEYRL   S + N   PP         S+ +   ++ + V+C
Sbjct  143  LVFYRGKPPKGLKTNWIMHEYRLTDASGSTNTSRPPPPPPPVTGGSRAAASLRLDDWVLC  202

Query  342  HVFQKKRVNGKAGEESAEVCGD  277
             +++K        ++ +  C D
Sbjct  203  RIYKKINKAAAGDQQRSTECED  224



>ref|XP_006436908.1| hypothetical protein CICLE_v10033415mg [Citrus clementina]
 gb|ESR50148.1| hypothetical protein CICLE_v10033415mg [Citrus clementina]
Length=126

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 95/126 (75%), Gaps = 10/126 (8%)
 Frame = -1

Query  888  LHFVRDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP  709
             HFVRD   V +LPPGFRFQPT+ E+VFQYL+ K FS  LPA +I  + NI +YDPW+LP
Sbjct  4    FHFVRDG--VTRLPPGFRFQPTDDELVFQYLKCKVFSSPLPAPIIPHI-NIYKYDPWDLP  60

Query  708  GDMEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSI-PMIMGM  532
            G++EQE RYFFS+ EA KYPNG++ +R +++GYWK +  +++ ++    SS I  M+MGM
Sbjct  61   GNLEQE-RYFFSNNEA-KYPNGNRINRATASGYWKATGLDKQILS----SSRINQMLMGM  114

Query  531  KKTLVF  514
            KKTLVF
Sbjct  115  KKTLVF  120



>ref|XP_003635288.1| PREDICTED: NAC transcription factor 25 [Vitis vinifera]
Length=326

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 123/196 (63%), Gaps = 19/196 (10%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL+RK  S+ LP ++I+++ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKRKAASVPLPVTIIADV-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRDR-KYPNGARPNRAATSGYWKATGTDKPILTSNGSQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK--  328
            PP G KTNWIMHEYRL+  + +   P P   +  KK    GSL  ++ + V+C +++K  
Sbjct  127  PPKGIKTNWIMHEYRLIDSTSSNTKP-PGADMGNKK----GSL--RLDDWVLCRIYKKNI  179

Query  327  -KRVNGKAGEESAEVC  283
             +R   +  EES E  
Sbjct  180  SQRPMERDKEESMEAL  195



>gb|AFD54038.1| NAC transcription factor NAM-1 [Aegilops searsii]
Length=405

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 118/202 (58%), Gaps = 7/202 (3%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GD  703
            R  G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP    
Sbjct  25   RQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKAT  83

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              +++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK 
Sbjct  84   FGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKA  142

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C
Sbjct  143  LVFYRGKPPRGLKTNWIMHEYRLTDASGSTTASRPPPPVTGG---SRAAASLRLDDWVLC  199

Query  342  HVFQKKRVNGKAGEESAEVCGD  277
             +++K        ++ +  C D
Sbjct  200  RIYKKINKAAAGDQQRSIECED  221



>gb|AID55350.1| NAC protein 3 [Actinidia arguta]
Length=319

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 111/186 (60%), Gaps = 15/186 (8%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD-MEQEDRYFF  676
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP   M  E  ++F
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKVASAPLPVTIIAEI-DLYKFDPWELPAKAMFGEQEWYF  73

Query  675  SSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKPP  496
             S    KYPNG + +R +++GYWK +  ++  +T  G        +G+KK LVFY GKPP
Sbjct  74   FSPRDRKYPNGARPNRAATSGYWKATGIDKPVLTSSGTQK-----VGVKKALVFYRGKPP  128

Query  495  HGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRVN  316
             G KT+WIMHEYRL+       PP           +++GSL  ++ + V+C +++K   +
Sbjct  129  KGVKTDWIMHEYRLIDNRAKSKPP------EYDAGHNKGSL--RLDDWVLCRIYKKNHPS  180

Query  315  GKAGEE  298
               G E
Sbjct  181  RPIGHE  186



>ref|XP_003624592.1| NAC domain transcription factor [Medicago truncatula]
 gb|AES80810.1| NAC transcription factor-like protein [Medicago truncatula]
Length=340

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 119/199 (60%), Gaps = 23/199 (12%)
 Frame = -1

Query  858  VKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDR  685
              LPPGFRF PT+ E++  YL++K  S+ LP S+I+E+ +I + DPW+LP      +++ 
Sbjct  6    TNLPPGFRFHPTDAELILHYLRKKIASIPLPVSIIAEV-DIYKLDPWDLPAKASFGEKEW  64

Query  684  YFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHIT---CPGKSSSIPMIMGMKKTLVF  514
            YFFS ++  KYPNG + +R +++GYWK + +++  +    C G  S    I+G+KK LVF
Sbjct  65   YFFSPRDR-KYPNGARPNRAAASGYWKATGTDKTIVASLPCGGGRSQ-ENIIGVKKALVF  122

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRLV      N P+        KD S      ++ + V+C ++
Sbjct  123  YKGKPPKGIKTNWIMHEYRLV----DNNKPI------KLKDSS-----MRLDDWVLCRIY  167

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K +    + E S  + G+
Sbjct  168  KKSKCALTSTESSETMVGE  186



>gb|AFD54037.1| NAC transcription factor NAM-1 [Aegilops searsii]
Length=405

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 118/202 (58%), Gaps = 7/202 (3%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GD  703
            R  G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP    
Sbjct  25   RQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKAT  83

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              +++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK 
Sbjct  84   FGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKA  142

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C
Sbjct  143  LVFYRGKPPKGLKTNWIMHEYRLTDASGSTTASRPPPPVTGG---SRAAASLRLDDWVLC  199

Query  342  HVFQKKRVNGKAGEESAEVCGD  277
             +++K        ++ +  C D
Sbjct  200  RIYKKINKAAAGDQQRSIECED  221



>ref|XP_007025712.1| NAC domain containing protein 25 [Theobroma cacao]
 gb|EOY28334.1| NAC domain containing protein 25 [Theobroma cacao]
Length=351

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 113/181 (62%), Gaps = 17/181 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL+RK  S  LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKRKAASAPLPVTIIAEV-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRDR-KYPNGARPNRAATSGYWKATGTDKPIVTSNGNQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KTNWIMHEYRLV  +    P +      A     +GSL  ++ + V+C +++K  
Sbjct  127  PPKGIKTNWIMHEYRLVDNNSTSKPQI------ADVANRKGSL--RLDDWVLCRIYKKNN  178

Query  321  V  319
             
Sbjct  179  T  179



>ref|XP_003528438.1| PREDICTED: NAC transcription factor 25-like [Glycine max]
 gb|KHN07294.1| NAC domain-containing protein 18 [Glycine soja]
Length=362

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 114/177 (64%), Gaps = 15/177 (8%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRYF  679
            LPPGFRF PT++E+V  YL+RK  S  LP ++I+++ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKRKAASAPLPVAIIADV-DLYKFDPWELPSKATFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FSPRD-RKYPNGARPNRAATSGYWKATGTDKPILTTYGHHK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            P G KTNWIMHEYRLV  S   +   PP   H KK+    SL  ++ + V+C +++K
Sbjct  128  PKGVKTNWIMHEYRLVDDSFNSSSKPPPLVPHNKKN----SL--RLDDWVLCRIYKK  178



>gb|AGC27313.1| NAC domain protein 10 [Gossypium hirsutum]
Length=349

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 112/194 (58%), Gaps = 17/194 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDR--YF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +R  YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKATSAPLPVAIIAEV-DLYKFDPWELPAKATFGEREWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS +E  KYPNG + +R +++GYWK + +++  +   G        +G+KK LVFY GKP
Sbjct  74   FSPRER-KYPNGARPNRAATSGYWKATGTDKPVLNSKGTQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL        PP           Y + SL  ++ + V+C +++K   
Sbjct  128  PKGIKTNWIMHEYRLPDNKNNNKPP------GCDLGYKKNSL--RLDDWVLCRIYKKNNT  179

Query  318  NGKAGEESAEVCGD  277
            N   G E  E   D
Sbjct  180  NRPLGYEKDEAIDD  193



>gb|AFD54036.1| NAC transcription factor NAM-1 [Aegilops searsii]
Length=405

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 118/202 (58%), Gaps = 7/202 (3%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GD  703
            R  G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP    
Sbjct  25   RQRGSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKAT  83

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              +++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK 
Sbjct  84   FGEQEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKA  142

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C
Sbjct  143  LVFYRGKPPKGLKTNWIMHEYRLTDASGSTTASRPPPPVTGG---SRAAASLRLDDWVLC  199

Query  342  HVFQKKRVNGKAGEESAEVCGD  277
             +++K        ++ +  C D
Sbjct  200  RIYKKINKAAAGDQQRSIECED  221



>ref|XP_008240449.1| PREDICTED: NAC transcription factor 25 [Prunus mume]
Length=384

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 110/185 (59%), Gaps = 16/185 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E++  YL +K  S  LP S+I+E+ +I ++DPW LP      +++ YF
Sbjct  9    LPPGFRFHPTDEELILHYLTKKVASTPLPVSIIAEV-DIYKFDPWELPAKAAFGEKEWYF  67

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +   G   ++    G+KK LVFY G+P
Sbjct  68   FSPRDR-KYPNGARPNRAAASGYWKATGTDKTIVASLGGRQNV----GVKKALVFYKGRP  122

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL        P  P  +    K      L  ++ + V+C +++K  V
Sbjct  123  PKGIKTNWIMHEYRL--------PENPNNYTTTSKTMKLKDLSMRLDDWVLCRIYKKSNV  174

Query  318  NGKAG  304
            +  A 
Sbjct  175  SSSAA  179



>gb|KEH31125.1| NAC transcription factor-like protein [Medicago truncatula]
Length=344

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 115/185 (62%), Gaps = 21/185 (11%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRYF  679
            LPPGFRF PT++E+V  YL+RK  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKRKAASAPLPVAIIAEI-DLYKFDPWELPSKASFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FSPRD-RKYPNGARPNRAATSGYWKATGTDKPILTSDGNQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAI--------SPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            P G KTNWIMHEYRL+          + +  PPLP    H   +  + SL  ++ + V+C
Sbjct  128  PKGVKTNWIMHEYRLITDHNNHHSYNATSKTPPLPS--DHPPNNNKKNSL--RLDDWVLC  183

Query  342  HVFQK  328
             +++K
Sbjct  184  RIYKK  188



>ref|XP_010416688.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
Length=252

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 106/184 (58%), Gaps = 26/184 (14%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPG-DMEQE  691
            G  ++ PPGFRF PT++E+V  YL RK  S  +PA +I+EL ++ RYDPW+LP   +  E
Sbjct  5    GADLQFPPGFRFHPTDEELVLMYLCRKCASQPIPAPIITEL-DLYRYDPWDLPAMALYGE  63

Query  690  DRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFY  511
              ++F S    KYPNG + +R +  GYWK + ++        K   +P  +G+KK LVFY
Sbjct  64   KEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGAD--------KPIGLPKPVGIKKALVFY  115

Query  510  YGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQ  331
             GKPP+G KTNWIMHEYRL  +               +    + SL  ++ + V+C ++ 
Sbjct  116  SGKPPNGEKTNWIMHEYRLADVD--------------RSVRKKNSL--RLDDWVLCRIYN  159

Query  330  KKRV  319
            KK V
Sbjct  160  KKGV  163



>gb|AID55349.1| NAC protein 2 [Actinidia arguta]
Length=316

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 110/177 (62%), Gaps = 17/177 (10%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPG--DMEQEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKVASAPLPVAIIAEI-DLYKFDPWELPAKSTFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS +   KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FSPRN-RKYPNGARPNRAATSGYWKATGTDKPVLTSSGTQK-----VGVKKALVFYLGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            P G KTNWIMHEYRL+       PP           +++GSL  ++   V+C +++K
Sbjct  128  PKGVKTNWIMHEYRLIDNEAKSKPP------GYDAGHNKGSL--RLDEWVLCRIYKK  176



>ref|XP_010100577.1| NAC domain-containing protein 29 [Morus notabilis]
 gb|EXB82820.1| NAC domain-containing protein 29 [Morus notabilis]
Length=345

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 115/181 (64%), Gaps = 16/181 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL+RK  S+ LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKRKASSVPLPVTIIAEV-DLYKFDPWELPSKASFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRDR-KYPNGARPNRAATSGYWKATGTDKPILTSNGTQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KTNWIMHEYRLV       P LP +  H   D  + SL  ++ + V+C +++K  
Sbjct  127  PPKGIKTNWIMHEYRLV--DNITKPKLPDH--HTSTD-KKASL--RLDDWVLCRIYKKNN  179

Query  321  V  319
             
Sbjct  180  A  180



>emb|CDP05873.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 112/181 (62%), Gaps = 17/181 (9%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRY  682
            +LPPGFRF PT++E+V  YL++K  S  LP S+I+E+ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKKKAASAPLPVSIIAEV-DLYKFDPWELPAKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRD-RKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KTNWIMHEYRLV    +  PP             +GSL  ++ + V+C +++K  
Sbjct  127  PPKGIKTNWIMHEYRLVDNKTSIKPP------GCDIGNKKGSL--RLDDWVLCRIYKKNN  178

Query  321  V  319
             
Sbjct  179  T  179



>ref|XP_007148205.1| hypothetical protein PHAVU_006G188900g [Phaseolus vulgaris]
 gb|ESW20199.1| hypothetical protein PHAVU_006G188900g [Phaseolus vulgaris]
Length=355

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 110/177 (62%), Gaps = 11/177 (6%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRYF  679
            LPPGFRF PT++E+V  YL+RK  S+ LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  18   LPPGFRFHPTDEELVVHYLKRKADSVPLPVAIIAEV-DLYKFDPWELPSKATFGEQEWYF  76

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +S+GYWK + ++   +   G        +G+KK LVFY GKP
Sbjct  77   FSPRD-RKYPNGARPNRAASSGYWKATGTDRPILASHGHHK-----VGVKKALVFYGGKP  130

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            P G KTNWIMHEYRL++ S       P       +   + SL  ++ + V+C +++K
Sbjct  131  PKGVKTNWIMHEYRLISTSSNSTSKPPSLPADHARSTKKNSL--RLDDWVLCRIYKK  185



>ref|XP_003543257.1| PREDICTED: NAC domain-containing protein 18 [Glycine max]
Length=375

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 111/180 (62%), Gaps = 16/180 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEV-DLYKFDPWELPAKAAFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            F+ ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FTPRDR-KYPNGARPNRAATSGYWKATGTDKPVLTSGGTQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL    P   PP P   L  KK+        ++ + V+C +++K   
Sbjct  128  PRGIKTNWIMHEYRLTDNKPNNRPP-PGCDLGNKKN------TLRLDDWVLCRIYKKSNT  180



>gb|KHN36793.1| NAC domain-containing protein 18 [Glycine soja]
Length=375

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 111/180 (62%), Gaps = 16/180 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEV-DLYKFDPWELPAKAAFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            F+ ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FTPRD-RKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL    P   PP P   L  KK+        ++ + V+C +++K   
Sbjct  128  PRGIKTNWIMHEYRLADNKPNNRPP-PGCDLGNKKN------TLRLDDWVLCRIYKKSNT  180



>ref|XP_006467845.1| PREDICTED: NAC transcription factor 25-like [Citrus sinensis]
 gb|KDO75851.1| hypothetical protein CISIN_1g017854mg [Citrus sinensis]
Length=365

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 114/181 (63%), Gaps = 13/181 (7%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEV-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILTSKGNQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KTNWIMHEYR+V       P  PP+ L A     + SL  ++ + V+C +++K  
Sbjct  127  PPKGIKTNWIMHEYRIVDNISGTKP--PPHQLPADLANKKHSL--RLDDWVLCRIYKKNN  182

Query  321  V  319
             
Sbjct  183  A  183



>ref|XP_001773542.1| predicted protein [Physcomitrella patens]
 gb|EDQ61580.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 110/180 (61%), Gaps = 22/180 (12%)
 Frame = -1

Query  858  VKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD--MEQEDR  685
            ++LPPGFRF PT++E+V  YL RKT S +    VI+EL ++ +YDPW+LPG   + + + 
Sbjct  13   IELPPGFRFHPTDEELVLHYLWRKTESATFSIPVITEL-DLYKYDPWDLPGKAILGEGEW  71

Query  684  YFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYG  505
            YFFS ++  KYPNG + +R +++G+WK + ++    T  G    I    G+KK LVFY G
Sbjct  72   YFFSPRD-RKYPNGARPNRAAASGFWKATGTDRPVHTSRGTLQKI----GVKKALVFYKG  126

Query  504  KPPHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            + P G KT W+MHEYRL   ISP+ N    P           GSL  ++ + V+C +F+K
Sbjct  127  RAPKGVKTTWVMHEYRLADGISPSSNTTRKP-----------GSL--RLDDWVLCRIFKK  173



>ref|XP_002463039.1| hypothetical protein SORBIDRAFT_02g036620 [Sorghum bicolor]
 gb|EER99560.1| hypothetical protein SORBIDRAFT_02g036620 [Sorghum bicolor]
Length=418

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 120/195 (62%), Gaps = 16/195 (8%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRYF  679
            LPPGFRF PT++E+V  YL++K  S+ LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  27   LPPGFRFHPTDEELVVHYLKKKAASVPLPVAIIAEV-DLYKFDPWELPDKATFGEQEWYF  85

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +   G    +    G+KK LVFY GKP
Sbjct  86   FSPRD-RKYPNGARPNRAATSGYWKATGTDKPIMASGGNREKV----GVKKALVFYRGKP  140

Query  498  PHGSKTNWIMHEYRLV-AISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            P G KTNWIMHEYRL  A S   + P PP  +   K  S      ++ + V+C +++K  
Sbjct  141  PKGLKTNWIMHEYRLADAASSTTSRPPPPCNVGGGKATS-----LRLDDWVLCRIYKKIN  195

Query  321  VNGKAGEESAEVCGD  277
              G AGE S + C D
Sbjct  196  KLG-AGERSMD-CED  208



>ref|XP_006449287.1| hypothetical protein CICLE_v10015688mg [Citrus clementina]
 gb|ESR62527.1| hypothetical protein CICLE_v10015688mg [Citrus clementina]
Length=365

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 114/181 (63%), Gaps = 13/181 (7%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  14   QLPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEV-DLYKFDPWELPSKATFGEQEWY  72

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GK
Sbjct  73   FFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILTSKGNQK-----VGVKKALVFYGGK  126

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KTNWIMHEYR+V       P  PP+ L A     + SL  ++ + V+C +++K  
Sbjct  127  PPKGIKTNWIMHEYRIVDNISGTKP--PPHQLPADLANKKHSL--RLDDWVLCRIYKKNN  182

Query  321  V  319
             
Sbjct  183  A  183



>ref|XP_004505006.1| PREDICTED: NAC transcription factor 25-like [Cicer arietinum]
Length=364

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 115/188 (61%), Gaps = 27/188 (14%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRYF  679
            LPPGFRF PT++E+V  YL+RK  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKRKAASAPLPVAIIAEI-DLYKFDPWELPSKASFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +T  G      M +G+KK LVFY GKP
Sbjct  74   FSPRDR-KYPNGARPNRAATSGYWKATGTDKPILTTDGH-----MKVGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAI---------SPAGNPPLP--PYFLHAKKDYSQGSLMQQIGNL  352
            P G KTNWIMHEYRL+           + +  PPLP  P  L+ K          ++ + 
Sbjct  128  PKGVKTNWIMHEYRLITDHNHNIHSYNATSKTPPLPADPPNLNKKNSL-------RLDDW  180

Query  351  VICHVFQK  328
            V+C +++K
Sbjct  181  VLCRIYKK  188



>gb|KHG20342.1| NAC domain-containing 18 -like protein [Gossypium arboreum]
Length=349

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 112/194 (58%), Gaps = 17/194 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDMEQEDR--YF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +R  YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKATSAPLPVAIIAEV-DLYKFDPWELPAKATFGEREWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +   G        +G+KK LVFY GKP
Sbjct  74   FSPRDR-KYPNGARPNRAATSGYWKATGTDKPVLNSKGTQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL        PP           Y + SL  ++ + V+C +++K   
Sbjct  128  PKGIKTNWIMHEYRLPDNKNNNKPP------GCDLGYKKNSL--RLDDWVLCRIYKKNNT  179

Query  318  NGKAGEESAEVCGD  277
            N   G E  E   D
Sbjct  180  NRPLGYEKDEAMDD  193



>gb|AEI98790.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 7/199 (4%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K     LP ++I+E+ ++ ++DPW LP      +
Sbjct  31   GSAPELPPGFRFHPTDEELVVHYLKKKADKAPLPVTIIAEV-DLYKFDPWELPEKATFGE  89

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK LVF
Sbjct  90   QEWYFFSPRD-RKYPNGARLNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVF  148

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C ++
Sbjct  149  YRGKPPKGLKTNWIMHEYRLTDASGSTTTSRPPPPVTGG---SRAAASLRLDDWVLCRIY  205

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K        ++ +  C D
Sbjct  206  KKINKAAAGDQQRSTECED  224



>gb|AEI98794.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   138 bits (347),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 7/199 (4%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K     LP ++I+E+ ++ ++DPW LP      +
Sbjct  31   GSAPELPPGFRFHPTDEELVVHYLKKKADKAPLPVTIIAEV-DLYKFDPWELPEKATFGE  89

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK LVF
Sbjct  90   QEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVF  148

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C ++
Sbjct  149  YRGKPPKGLKTNWIMHEYRLTDASGSTTTSRPPPPVTGG---SRAAASLRLDDWVLCRIY  205

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K        ++ +  C D
Sbjct  206  KKINKAAAGDQQRSTECED  224



>ref|XP_008782755.1| PREDICTED: NAC domain-containing protein 68-like [Phoenix dactylifera]
Length=310

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 111/188 (59%), Gaps = 25/188 (13%)
 Frame = -1

Query  876  RDDGKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD--  703
            RD    + LPPGFRF PT++E+V  YL RK     LP  +I+E+ ++ +YDPW+LPG   
Sbjct  10   RDAEAELNLPPGFRFHPTDEELVVHYLCRKIACQCLPVPIIAEV-DLYKYDPWDLPGKAF  68

Query  702  MEQEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKT  523
              Q++ YFF+ ++  KYPNG + +R +  GYWK ++  +K +T PG    +    G+KK 
Sbjct  69   FGQKEWYFFTPRD-RKYPNGSRPNRAAGRGYWK-ATGADKPVTPPGSGRPL----GIKKA  122

Query  522  LVFYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVIC  343
            LVFY+GK P G KT+WIMHEYRL   + A N               + SL  ++ + V+C
Sbjct  123  LVFYHGKAPKGIKTDWIMHEYRLADTNRAAN--------------KKNSL--RLDDWVLC  166

Query  342  HVFQKKRV  319
             ++ KK V
Sbjct  167  RLYNKKNV  174



>gb|AEI98789.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 7/199 (4%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K     LP ++I+E+ ++ ++DPW LP      +
Sbjct  31   GSAPELPPGFRFHPTDEELVVHYLKKKAGKAPLPVTIIAEV-DLYKFDPWELPEKATFGE  89

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK LVF
Sbjct  90   QEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVF  148

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C ++
Sbjct  149  YRGKPPKGLKTNWIMHEYRLTDASGSTTTSRPPPPVTGG---SRAAASLRLDDWVLCRIY  205

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K        ++ +  C D
Sbjct  206  KKINKAAAGDQQRSTECED  224



>gb|AEI98791.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
 gb|AEI98792.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
 gb|AEI98796.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
 gb|AEI98797.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
 gb|AEI98798.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 7/199 (4%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K     LP ++I+E+ ++ ++DPW LP      +
Sbjct  31   GSAPELPPGFRFHPTDEELVVHYLKKKADKAPLPVTIIAEV-DLYKFDPWELPEKATFGE  89

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK LVF
Sbjct  90   QEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVF  148

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C ++
Sbjct  149  YRGKPPKGLKTNWIMHEYRLTDASGSTTTSRPPPPVTGG---SRAAASLRLDDWVLCRIY  205

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K        ++ +  C D
Sbjct  206  KKINKAAAGDQQRSTECED  224



>gb|AGL39678.1| NAC transcription factor 022 [Jatropha curcas]
 gb|KDP29100.1| hypothetical protein JCGZ_16489 [Jatropha curcas]
Length=295

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 116/188 (62%), Gaps = 21/188 (11%)
 Frame = -1

Query  858  VKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD-MEQEDRY  682
            + LPPGFRF P+++E++  YL+ K  S +LPA++I+EL ++ +Y+PW+LP   +  +D +
Sbjct  9    IHLPPGFRFHPSDEELIVHYLKNKVASRTLPATIIAEL-DLYKYNPWDLPKKALFGDDEW  67

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            +F +    KYPNG + +R +++GYWK + +++  +T  G  S     +G+KK LVFY G+
Sbjct  68   YFFTPRDRKYPNGARPNRAAASGYWKATGTDKPILTSRGTLS-----IGVKKALVFYKGR  122

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KT+WIMHEYRL+  + A NP              +GS+  ++ + V+C V QK  
Sbjct  123  PPKGIKTDWIMHEYRLLQTTVAYNPK------------RKGSM--RLDDWVLCRVRQKSS  168

Query  321  VNGKAGEE  298
            +     E+
Sbjct  169  LPRSTWED  176



>ref|XP_002887684.1| ANAC032 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63943.1| ANAC032 [Arabidopsis lyrata subsp. lyrata]
Length=250

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 113/194 (58%), Gaps = 30/194 (15%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME---  697
            G  ++ PPGFRF PT++E+V  YL RK  S  +PA +I+EL ++ RYDPW+LP DM    
Sbjct  5    GADLQFPPGFRFHPTDEELVLMYLCRKCASQPIPAPIITEL-DLYRYDPWDLP-DMALYG  62

Query  696  QEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLV  517
            +++ YFFS ++  KYPNG + +R +  GYWK + ++        K    P  +G+KK LV
Sbjct  63   EKEWYFFSPRD-RKYPNGSRPNRAAGTGYWKATGAD--------KPIGRPKPVGIKKALV  113

Query  516  FYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHV  337
            FY GKPP+G KTNWIMHEYRL  +               +    + SL  ++ + V+C +
Sbjct  114  FYSGKPPNGEKTNWIMHEYRLADVD--------------RSVRKKNSL--RLDDWVLCRI  157

Query  336  FQKKRVNGKAGEES  295
            + KK V  K   E+
Sbjct  158  YNKKGVIEKQRSEN  171



>gb|AEI98788.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 7/199 (4%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K     LP ++I+E+ ++ ++DPW LP      +
Sbjct  31   GSAPELPPGFRFHPTDEELVVHYLKKKADKAPLPVTIIAEV-DLYKFDPWELPEKATFGE  89

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK LVF
Sbjct  90   QEWYFFSPRD-RKYPNGARPNRAATSGYWKAAGTDKPILASGTGCGLVREKLGVKKALVF  148

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C ++
Sbjct  149  YRGKPPKGLKTNWIMHEYRLTDASGSTTTSRPPPPVTGG---SRAAASLRLDDWVLCRIY  205

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K        ++ +  C D
Sbjct  206  KKINKAAAGDQQRSTECED  224



>gb|AGV29510.1| putative NAC domain class transcription factor, partial [Tamarix 
hispida]
Length=186

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 116/186 (62%), Gaps = 19/186 (10%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD--MEQEDRYF  679
            LPPGFRF PT++E++  YL+RK  S  LP ++I+E+ ++ + DPW LP      +++ YF
Sbjct  1    LPPGFRFHPTDEELIVHYLKRKAASSPLPVAIIAEV-DLYKSDPWELPSKAIFGEQEWYF  59

Query  678  FSSKE---ATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYY  508
            FS ++     +YPNG + +R +++GYWK + +++  ++    + + P  +G+KK LVFY 
Sbjct  60   FSPRDRKYPNQYPNGARPNRAATSGYWKATGTDKPILST---NDTPPRKVGVKKALVFYG  116

Query  507  GKPPHGSKTNWIMHEYRLVAISPAGNPP------LPPYFLHAKKDYSQGSLMQQIGNLVI  346
            GKPP G KT+WIMHEYRL+  S  G PP      +PP       D  + SL  ++ + V+
Sbjct  117  GKPPRGIKTDWIMHEYRLLDSSSGGPPPACLFKSIPPRL--DGTDSKKPSL--RLDDWVL  172

Query  345  CHVFQK  328
            C +++K
Sbjct  173  CRIYKK  178



>ref|XP_007161811.1| hypothetical protein PHAVU_001G100200g [Phaseolus vulgaris]
 gb|ESW33805.1| hypothetical protein PHAVU_001G100200g [Phaseolus vulgaris]
Length=345

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 123/216 (57%), Gaps = 33/216 (15%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT+QE++  YL +K  S+ LP S+I+E+ +I + DPW+LP      +++ YF
Sbjct  8    LPPGFRFHPTDQELILHYLSKKVASIPLPVSIIAEV-DIYKLDPWDLPAKATFGEKEWYF  66

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK ++  +K I    +  +    +G+KK LVFY G+P
Sbjct  67   FSPRD-RKYPNGARPNRAAASGYWK-ATGTDKTIVTSLQGGAAQENVGVKKALVFYEGRP  124

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRLV      N P+        KD S      ++ + V+C +++K + 
Sbjct  125  PKGVKTNWIMHEYRLV----DNNKPI------KLKDSS-----MRLDDWVLCRIYKKSKH  169

Query  318  NGKAGEESAEVCGDninisinegenIVDNAEQQLFE  211
               + E +  V               VD AE+ LF+
Sbjct  170  ALTSAEATIGVG-------------EVDQAEEHLFK  192



>gb|AEI98793.1| NAC transcription factor NAM-G1 [Triticum timopheevii subsp. 
timopheevii]
Length=407

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 7/199 (4%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K     LP ++I+E+ ++ ++DPW LP      +
Sbjct  31   GSAPELPPGFRFHPTDEELVVHYLKKKADKAPLPVTIIAEV-DLYKFDPWELPEKATFGE  89

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK LVF
Sbjct  90   QEWYFFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVF  148

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRL   S +     PP  +      S+ +   ++ + V+C ++
Sbjct  149  YRGKPPKGLKTNWIMHEYRLTDASGSTTTSRPPPPVTGG---SRAAASLRLDDWVLCRIY  205

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K        ++ +  C D
Sbjct  206  KKINKAAAGDQQRSTECED  224



>gb|AHC54052.1| transcriptional factor NAC11 [Ammopiptanthus mongolicus]
Length=351

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 123/216 (57%), Gaps = 33/216 (15%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E++  YL +K  S+ LP S+I+E+ +I + DPW LP      +++ YF
Sbjct  8    LPPGFRFHPTDEELIHHYLMKKVASIPLPVSIIAEV-DIYKLDPWELPAKAAFGEKEWYF  66

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK ++  +K I         P  +G+KK LVFY G+P
Sbjct  67   FSPRD-RKYPNGARPNRAAASGYWK-ATGTDKTIVKSLPRGGAPENIGVKKALVFYKGRP  124

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRLV      N P+        KD S      ++ + V+C +++K + 
Sbjct  125  PKGVKTNWIMHEYRLVDT----NRPI------KLKDAS-----MRLDDWVLCRIYKKAKY  169

Query  318  NGKAGEESAEVCGDninisinegenIVDNAEQQLFE  211
               +  ++A V GD             D AE+ LF+
Sbjct  170  T-LSSTDAATVVGDQ------------DQAEENLFK  192



>ref|XP_007159283.1| hypothetical protein PHAVU_002G224900g [Phaseolus vulgaris]
 gb|ESW31277.1| hypothetical protein PHAVU_002G224900g [Phaseolus vulgaris]
Length=350

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 112/177 (63%), Gaps = 15/177 (8%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRYF  679
            LPPGFRF PT++E+V  YL+RK  S  LP ++I+++ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKRKASSTPLPVAIIADV-DLYKFDPWELPSKATFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FSPRDR-KYPNGVRPNRAATSGYWKATGTDKPILTSDGHQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            P G KTNWIMHEYRLV  S       PP     KK+    SL  ++ N V+C +++K
Sbjct  128  PKGVKTNWIMHEYRLVHDSFNSTSKPPPLVPPNKKN----SL--RLDNWVLCRIYKK  178



>ref|XP_002519008.1| transcription factor, putative [Ricinus communis]
 gb|EEF43219.1| transcription factor, putative [Ricinus communis]
Length=355

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 122/193 (63%), Gaps = 19/193 (10%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASAPLPVTIIAEV-DLYKFDPWELPSKATFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +   G        +G+KK LVFY GKP
Sbjct  74   FSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASNGAQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK---  328
            P G KTNWIMHEYRLV  + + + P P + L  KK    GSL  ++ + V+C +++K   
Sbjct  128  PKGIKTNWIMHEYRLVDNNNSSSKP-PGFDLANKK----GSL--RLDDWVLCRIYKKNNS  180

Query  327  KRVNGKAGEESAE  289
            +R   +  E+S E
Sbjct  181  QRTMDRDKEDSME  193



>ref|XP_006302722.1| hypothetical protein CARUB_v10020834mg [Capsella rubella]
 gb|EOA35620.1| hypothetical protein CARUB_v10020834mg [Capsella rubella]
Length=255

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 113/194 (58%), Gaps = 30/194 (15%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME---  697
            G  ++ PPGFRF PT++E+V  YL RK  S  +PA +I+EL ++ RYDPW+LP DM    
Sbjct  5    GADLQFPPGFRFHPTDEELVLMYLCRKCASQPIPAPIITEL-DLYRYDPWDLP-DMALYG  62

Query  696  QEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLV  517
            +++ YFFS ++  KYPNG + +R +  GYWK + ++        K    P  +G+KK LV
Sbjct  63   EKEWYFFSPRD-RKYPNGSRPNRAAGTGYWKATGAD--------KPIGRPKPVGIKKALV  113

Query  516  FYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHV  337
            FY GKPP+G KTNWIMHEYRL  +               +    + SL  ++ + V+C +
Sbjct  114  FYSGKPPNGEKTNWIMHEYRLADVD--------------RSVRKKNSL--RLDDWVLCRI  157

Query  336  FQKKRVNGKAGEES  295
            + KK V  K   E+
Sbjct  158  YNKKGVIEKRRSEN  171



>gb|KEH38791.1| NAC transcription factor-like protein [Medicago truncatula]
Length=354

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 107/180 (59%), Gaps = 17/180 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEV-DLYKFDPWELPAKATFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FSPRD-RKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL    P   PP          D        ++ + V+C +++K   
Sbjct  128  PRGIKTNWIMHEYRLADNKPNNRPP--------GCDLGNKKNSLRLDDWVLCRIYKKSNT  179



>ref|XP_004487678.1| PREDICTED: NAC domain-containing protein 18-like [Cicer arietinum]
Length=356

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 111/194 (57%), Gaps = 17/194 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASAPLPVAIIAEV-DLYKFDPWELPAKATFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +T  G        +G+KK LVFY GKP
Sbjct  74   FSPRD-RKYPNGARPNRAATSGYWKATGTDKPVLTSGGTQK-----VGVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL    P   PP          D        ++ + V+C +++K   
Sbjct  128  PRGIKTNWIMHEYRLADNKPNNRPP--------GCDLGNKKNSLRLDDWVLCRIYKKSNT  179

Query  318  NGKAGEESAEVCGD  277
            +    E   E   D
Sbjct  180  HWSPVEHDREDSMD  193



>ref|NP_177869.1| NAC domain containing protein 32 [Arabidopsis thaliana]
 gb|AAG51675.1|AC010704_19 GRAB1-like protein; 10550-11502 [Arabidopsis thaliana]
 dbj|BAC43561.1| GRAB1-like protein [Arabidopsis thaliana]
 gb|AAP40365.1| putative GRAB1 protein [Arabidopsis thaliana]
 gb|AEE35979.1| NAC domain containing protein 32 [Arabidopsis thaliana]
Length=253

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 110/186 (59%), Gaps = 30/186 (16%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME---  697
            G  ++ PPGFRF PT++E+V  YL RK  S  +PA +I+EL ++ RYDPW+LP DM    
Sbjct  5    GADLQFPPGFRFHPTDEELVLMYLCRKCASQPIPAPIITEL-DLYRYDPWDLP-DMALYG  62

Query  696  QEDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLV  517
            +++ YFFS ++  KYPNG + +R +  GYWK + ++        K    P  +G+KK LV
Sbjct  63   EKEWYFFSPRD-RKYPNGSRPNRAAGTGYWKATGAD--------KPIGRPKPVGIKKALV  113

Query  516  FYYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHV  337
            FY GKPP+G KTNWIMHEYRL  +               +    + SL  ++ + V+C +
Sbjct  114  FYSGKPPNGEKTNWIMHEYRLADVD--------------RSVRKKNSL--RLDDWVLCRI  157

Query  336  FQKKRV  319
            + KK V
Sbjct  158  YNKKGV  163



>gb|AID55352.1| NAC protein 1 [Actinidia chinensis]
Length=321

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 112/194 (58%), Gaps = 17/194 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++K  S  LP S+I+E+ ++ ++DPW LP      +++ YF
Sbjct  15   LPPGFRFHPTDEELVVHYLKKKAASAPLPVSIIAEV-DLYKFDPWELPAKATFGEQEWYF  73

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK ++  +K +   G S  +    G+KK LVFY GKP
Sbjct  74   FSPRD-RKYPNGARPNRAATSGYWK-ATGTDKPVLSSGGSQKV----GVKKALVFYGGKP  127

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRLV       PP          D +      ++ + V+C +++K  +
Sbjct  128  PKGVKTNWIMHEYRLVENKLNSKPP--------GCDAANKKASLRLDDWVLCRIYKKSNL  179

Query  318  NGKAGEESAEVCGD  277
                  E  +   D
Sbjct  180  PRPMDHERDDTMSD  193



>dbj|BAK04712.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=405

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 116/199 (58%), Gaps = 13/199 (7%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP      +
Sbjct  26   GSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKATFGE  84

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK ++  +K I   G        +G+KK LVF
Sbjct  85   QEWYFFSPRD-RKYPNGARPNRAATSGYWK-ATGTDKPILASGCGREK---VGVKKALVF  139

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRL   S +     PP      +  S      ++ + V+C ++
Sbjct  140  YRGKPPKGLKTNWIMHEYRLTDASSSAATSRPPPVTGGSRAAS-----LRLDDWVLCRIY  194

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K      A ++ +  C D
Sbjct  195  KKINKAAAADQQRSMECED  213



>gb|ABI94356.1| NAC transcription factor NAM-D2 [Aegilops tauschii]
Length=383

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 115/199 (58%), Gaps = 13/199 (7%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP      +
Sbjct  23   GSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKATFGE  81

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK ++  +K I   G        +G+KK LVF
Sbjct  82   QEWYFFSPRD-RKYPNGARPNRAATSGYWK-ATGTDKPIMASGCGREK---VGVKKALVF  136

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRL   S +     PP      +  S      ++ + V+C ++
Sbjct  137  YRGKPPKGLKTNWIMHEYRLTDASSSATTSRPPPVTGGSRAAS-----LRLDDWVLCRIY  191

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K        ++ +  C D
Sbjct  192  KKINKAAAGDQQRSMECED  210



>gb|AEH68228.1| NAC transcription factor [Triticum aestivum]
Length=383

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 115/199 (58%), Gaps = 13/199 (7%)
 Frame = -1

Query  867  GKVVKLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQ  694
            G   +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP      +
Sbjct  23   GSAPELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKATFGE  81

Query  693  EDRYFFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVF  514
            ++ YFFS ++  KYPNG + +R +++GYWK ++  +K I   G        +G+KK LVF
Sbjct  82   QEWYFFSPRD-RKYPNGARPNRAATSGYWK-ATGTDKPIMASGCGREK---VGVKKALVF  136

Query  513  YYGKPPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVF  334
            Y GKPP G KTNWIMHEYRL   S +     PP      +  S      ++ + V+C ++
Sbjct  137  YRGKPPKGLKTNWIMHEYRLTDASSSATTSRPPPVTGGSRAAS-----LRLDDWVLCRIY  191

Query  333  QKKRVNGKAGEESAEVCGD  277
            +K        ++ +  C D
Sbjct  192  KKINKAAAGDQQRSMECED  210



>gb|AFD54031.1| NAC transcription factor NAM-1 [Aegilops bicornis]
Length=408

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 116/195 (59%), Gaps = 4/195 (2%)
 Frame = -1

Query  855  KLPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLP--GDMEQEDRY  682
            +LPPGFRF PT++E+V  YL++K   + LP ++I+E+ ++ ++DPW LP      +++ Y
Sbjct  32   ELPPGFRFHPTDEELVVHYLKKKAAKVPLPVTIIAEV-DLYKFDPWELPEKATFGEQEWY  90

Query  681  FFSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGK  502
            FFS ++  KYPNG + +R +++GYWK + +++  +        +   +G+KK LVFY GK
Sbjct  91   FFSPRD-RKYPNGARPNRAATSGYWKATGTDKPILASGTGCGLVREKLGVKKALVFYRGK  149

Query  501  PPHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKR  322
            PP G KTNWIMHEYRL   S + N   PP         S+ +   ++ + V+C +++K  
Sbjct  150  PPKGLKTNWIMHEYRLTDASGSTNTSRPPPPPPPVTGGSRAAASLRLDDWVLCRIYKKIN  209

Query  321  VNGKAGEESAEVCGD  277
                  ++ +  C D
Sbjct  210  KAAAGDQQRSTECED  224



>ref|XP_011042501.1| PREDICTED: NAC domain-containing protein 18-like [Populus euphratica]
Length=358

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 116/177 (66%), Gaps = 17/177 (10%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E+V  YL++KT S  LP ++I+E+ ++ ++DPW LP      +++ YF
Sbjct  26   LPPGFRFHPTDEELVVHYLKKKTTSAPLPVAIIAEV-DLYKFDPWELPAKATFGEQEWYF  84

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  ++  G        +G+KK LVFY GKP
Sbjct  85   FSPRD-RKYPNGARPNRAATSGYWKATGTDKPVLSSGGTQK-----VGVKKALVFYGGKP  138

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQK  328
            P G KTNWIMHEYRL A +   N P P Y L  KK+    SL  ++ + V+C +++K
Sbjct  139  PKGIKTNWIMHEYRL-ADNKVNNKP-PGYDLGNKKN----SL--RLDDWVLCRIYKK  187



>ref|XP_007202090.1| hypothetical protein PRUPE_ppa007445mg [Prunus persica]
 gb|EMJ03289.1| hypothetical protein PRUPE_ppa007445mg [Prunus persica]
Length=367

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 110/185 (59%), Gaps = 16/185 (9%)
 Frame = -1

Query  852  LPPGFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGDME--QEDRYF  679
            LPPGFRF PT++E++  YL +K  S  LP S+I+E+ +I ++DPW LP      +++ YF
Sbjct  9    LPPGFRFHPTDEELILHYLTKKVASTPLPVSIIAEV-DIYKFDPWELPAKAAFGEKEWYF  67

Query  678  FSSKEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKP  499
            FS ++  KYPNG + +R +++GYWK + +++  +   G   ++    G+KK LVFY G+P
Sbjct  68   FSPRD-RKYPNGARPNRAAASGYWKATGTDKTIVASLGGRQNV----GVKKALVFYKGRP  122

Query  498  PHGSKTNWIMHEYRLVAISPAGNPPLPPYFLHAKKDYSQGSLMQQIGNLVICHVFQKKRV  319
            P G KTNWIMHEYRL        P  P  +    K      L  ++ + V+C +++K  V
Sbjct  123  PKGIKTNWIMHEYRL--------PENPNNYTTTTKTMKLKDLSMRLDDWVLCRIYKKSNV  174

Query  318  NGKAG  304
            +  A 
Sbjct  175  SSSAA  179



>ref|XP_010675608.1| PREDICTED: NAC transcription factor 25 [Beta vulgaris subsp. 
vulgaris]
Length=410

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 114/179 (64%), Gaps = 19/179 (11%)
 Frame = -1

Query  843  GFRFQPTEQEIVFQYLQRKTFSLSLPASVISELPNICRYDPWNLPGD--MEQEDRYFFSS  670
            GFRF PT++E+V  YL+RK  S SLP S+I+E+ ++ ++DPW LP      +++ YFFS 
Sbjct  27   GFRFHPTDEELVVHYLKRKVQSTSLPVSIIAEV-DLYKFDPWELPDKAVFGEQEWYFFSP  85

Query  669  KEATKYPNGDQTSRVSSNGYWKPSSSEEKHITCPGKSSSIPMIMGMKKTLVFYYGKPPHG  490
            ++  KYPNG + +R +++GYWK + +++  +      SS    +G+KK LVFY GKPP G
Sbjct  86   RD-RKYPNGARPNRAATSGYWKATGTDKPVL------SSGSQKVGVKKALVFYGGKPPRG  138

Query  489  SKTNWIMHEYRLVAISPAGNPPLPPYFL-HAKKDYSQGSLMQQIGNLVICHVFQKKRVN  316
             KTNWIMHEYRLV   P   PP   Y L H KK    GSL  ++ + V+C +++K   N
Sbjct  139  VKTNWIMHEYRLVDNKPNNKPPA--YDLCHNKK----GSL--RLDDWVLCRIYKKNNTN  189



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1972844437608