BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82999_g1_i1 len=951 path=[929:0-950]

Length=951
                                                                      Score     E

ref|XP_009774976.1|  PREDICTED: uncharacterized protein At4g22758...    147   2e-39   
ref|XP_009586821.1|  PREDICTED: uncharacterized protein At4g22758...    140   6e-37   
ref|XP_002270144.3|  PREDICTED: uncharacterized protein At4g22758       129   8e-33   Vitis vinifera
emb|CBI33520.3|  unnamed protein product                                129   1e-32   
ref|XP_006357767.1|  PREDICTED: uncharacterized protein LOC102592157    127   2e-32   
ref|XP_009774977.1|  PREDICTED: uncharacterized protein At4g22758...    127   4e-32   
ref|XP_010032694.1|  PREDICTED: uncharacterized protein At4g22758...    127   6e-32   
ref|XP_007033029.1|  Uncharacterized protein TCM_019175                 126   2e-31   
gb|KDP33165.1|  hypothetical protein JCGZ_13430                         125   5e-31   
ref|XP_009586822.1|  PREDICTED: uncharacterized protein LOC104084618    123   9e-31   
ref|XP_011073847.1|  PREDICTED: uncharacterized protein LOC105158703    124   1e-30   
ref|XP_010032695.1|  PREDICTED: uncharacterized protein At4g22758       124   1e-30   
gb|KCW52148.1|  hypothetical protein EUGRSUZ_J01593                     122   4e-30   
ref|XP_011099466.1|  PREDICTED: uncharacterized protein At4g22758...    120   2e-29   
ref|XP_004231982.2|  PREDICTED: uncharacterized protein At4g22758...    119   3e-29   
ref|XP_009586817.1|  PREDICTED: uncharacterized protein LOC104084614    119   5e-29   
ref|XP_006430618.1|  hypothetical protein CICLE_v10012986mg             119   6e-29   
ref|XP_002534031.1|  conserved hypothetical protein                     119   6e-29   Ricinus communis
ref|XP_010044204.1|  PREDICTED: uncharacterized protein At4g22758       119   7e-29   
ref|XP_006482133.1|  PREDICTED: uncharacterized protein LOC102630256    118   1e-28   
emb|CDP02694.1|  unnamed protein product                                117   2e-28   
ref|XP_010109006.1|  hypothetical protein L484_027203                   117   3e-28   
ref|XP_002527797.1|  conserved hypothetical protein                     114   2e-27   Ricinus communis
ref|XP_002284639.1|  PREDICTED: uncharacterized protein At4g22758       113   5e-27   Vitis vinifera
ref|XP_004503136.1|  PREDICTED: uncharacterized protein LOC101504281    112   2e-26   
ref|XP_010670141.1|  PREDICTED: uncharacterized protein At4g22758...    112   4e-26   
emb|CAN65811.1|  hypothetical protein VITISV_031711                     111   5e-26   Vitis vinifera
ref|XP_008229193.1|  PREDICTED: uncharacterized protein LOC103328...    111   5e-26   
ref|XP_004297386.1|  PREDICTED: uncharacterized protein LOC101305...    110   5e-26   
gb|KDP38078.1|  hypothetical protein JCGZ_04721                         109   1e-25   
ref|XP_010066603.1|  PREDICTED: uncharacterized protein LOC104453692    109   2e-25   
ref|XP_008221421.1|  PREDICTED: uncharacterized protein LOC103321407    108   3e-25   
ref|XP_009351504.1|  PREDICTED: uncharacterized protein At4g22758...    108   3e-25   
ref|XP_007223777.1|  hypothetical protein PRUPE_ppa013143mg             108   6e-25   
ref|XP_002315875.1|  hypothetical protein POPTR_0010s12090g             106   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_009349522.1|  PREDICTED: uncharacterized protein At4g22758...    106   2e-24   
ref|XP_010681883.1|  PREDICTED: uncharacterized protein LOC104896789    106   2e-24   
gb|EPS61325.1|  hypothetical protein M569_13473                         107   3e-24   
ref|XP_008467130.1|  PREDICTED: uncharacterized protein LOC103504558    106   3e-24   
ref|XP_008356300.1|  PREDICTED: uncharacterized protein LOC103420001    106   3e-24   
ref|XP_006301002.1|  hypothetical protein CARUB_v10021392mg             106   3e-24   
ref|XP_010667680.1|  PREDICTED: uncharacterized protein LOC104884693    107   3e-24   
ref|XP_007163388.1|  hypothetical protein PHAVU_001G230600g             106   3e-24   
ref|XP_010095717.1|  hypothetical protein L484_002689                   105   3e-24   
ref|XP_003552877.1|  PREDICTED: uncharacterized protein LOC100810542    106   3e-24   
ref|XP_003537448.2|  PREDICTED: uncharacterized protein LOC100775979    106   4e-24   
gb|KEH34623.1|  senescence-associated protein, putative                 105   5e-24   
ref|XP_010274728.1|  PREDICTED: uncharacterized protein At4g22758       105   5e-24   
ref|XP_011070610.1|  PREDICTED: uncharacterized protein At4g22758...    104   8e-24   
gb|KHN17944.1|  hypothetical protein glysoja_017995                     105   9e-24   
ref|XP_011038615.1|  PREDICTED: uncharacterized protein At4g22758...    104   9e-24   
ref|XP_010552701.1|  PREDICTED: uncharacterized protein At4g22758       105   9e-24   
ref|XP_004237906.1|  PREDICTED: uncharacterized protein At4g22758...    105   1e-23   
ref|XP_009334449.1|  PREDICTED: uncharacterized protein At4g22758...    105   1e-23   
ref|XP_010916501.1|  PREDICTED: uncharacterized protein LOC105041292    104   1e-23   
ref|XP_010471079.1|  PREDICTED: uncharacterized protein At4g22758...    104   1e-23   
ref|XP_008343057.1|  PREDICTED: uncharacterized protein LOC103405829    104   1e-23   
ref|XP_004150595.1|  PREDICTED: uncharacterized protein LOC101204652    104   1e-23   
gb|ABK96329.1|  unknown                                                 103   2e-23   Populus trichocarpa x Populus deltoides
gb|AFK34092.1|  unknown                                                 103   2e-23   
ref|XP_006355080.1|  PREDICTED: uncharacterized protein LOC102584968    103   2e-23   
gb|KHG14735.1|  hypothetical protein F383_02623                         103   2e-23   
emb|CDX68330.1|  BnaA07g23700D                                          103   2e-23   
gb|EPS58431.1|  hypothetical protein M569_16381                         103   2e-23   
ref|XP_009104937.1|  PREDICTED: uncharacterized protein At4g22758...    103   3e-23   
ref|XP_008782287.1|  PREDICTED: uncharacterized protein LOC103701859    103   3e-23   
ref|XP_007216024.1|  hypothetical protein PRUPE_ppa014882mg             102   3e-23   
ref|NP_001236932.1|  uncharacterized protein LOC100499853               102   4e-23   
emb|CDY23481.1|  BnaC06g24500D                                          102   5e-23   
ref|XP_011023710.1|  PREDICTED: uncharacterized protein At4g22758...    102   5e-23   
ref|XP_010415767.1|  PREDICTED: uncharacterized protein At4g22758...    102   5e-23   
gb|EYU30083.1|  hypothetical protein MIMGU_mgv1a016062mg                102   6e-23   
ref|XP_004504564.1|  PREDICTED: uncharacterized protein LOC101507525    102   7e-23   
ref|NP_565000.1|  uncharacterized protein                               102   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364850.1|  PREDICTED: uncharacterized protein LOC102578189    102   1e-22   
ref|XP_009139746.1|  PREDICTED: uncharacterized protein At4g22758       102   1e-22   
ref|XP_010553810.1|  PREDICTED: uncharacterized protein LOC104823786    101   1e-22   
ref|NP_001236734.1|  uncharacterized protein LOC100305791               101   1e-22   
ref|XP_010096674.1|  hypothetical protein L484_025423                   101   2e-22   
ref|XP_008809820.1|  PREDICTED: uncharacterized protein LOC103721401    101   2e-22   
ref|XP_006469193.1|  PREDICTED: uncharacterized protein LOC102613615    100   2e-22   
ref|XP_004236949.1|  PREDICTED: uncharacterized protein LOC101244859    100   3e-22   
ref|XP_002888795.1|  hypothetical protein ARALYDRAFT_894896             100   3e-22   
gb|KHG22133.1|  hypothetical protein F383_27486                         100   3e-22   
ref|XP_006448227.1|  hypothetical protein CICLE_v10017117mg             100   4e-22   
ref|XP_002311509.2|  hypothetical protein POPTR_0008s13080g             100   5e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010926482.1|  PREDICTED: uncharacterized protein LOC105048744    100   6e-22   
ref|XP_007045195.1|  Uncharacterized protein isoform 1                  100   7e-22   
dbj|BAB33412.1|  putative senescence-associated protein                 101   8e-22   Pisum sativum [garden pea]
ref|XP_007153400.1|  hypothetical protein PHAVU_003G031800g           99.4    8e-22   
gb|KGN57466.1|  hypothetical protein Csa_3G190360                     99.0    1e-21   
emb|CDY01710.1|  BnaC04g30420D                                        99.0    1e-21   
ref|XP_006390840.1|  hypothetical protein EUTSA_v10019542mg           98.6    2e-21   
ref|XP_011002783.1|  PREDICTED: uncharacterized protein LOC105109699  99.0    2e-21   
gb|AFK44881.1|  unknown                                               98.6    2e-21   
ref|XP_008229194.1|  PREDICTED: uncharacterized protein LOC103328...  98.6    2e-21   
emb|CDP00803.1|  unnamed protein product                              98.2    2e-21   
ref|XP_009600493.1|  PREDICTED: uncharacterized protein At4g22758...  98.2    2e-21   
gb|EPS67816.1|  hypothetical protein M569_06958                       97.4    3e-21   
ref|XP_010554411.1|  PREDICTED: uncharacterized protein At4g22758...  97.8    3e-21   
ref|XP_009127827.1|  PREDICTED: uncharacterized protein At4g22758...  97.4    4e-21   
ref|XP_010264360.1|  PREDICTED: uncharacterized protein At4g22758...  97.4    4e-21   
ref|XP_002305866.2|  hypothetical protein POPTR_0004s08870g           97.4    5e-21   Populus trichocarpa [western balsam poplar]
emb|CDY09482.1|  BnaC02g20240D                                        97.1    6e-21   
ref|XP_004498287.1|  PREDICTED: uncharacterized protein LOC101497295  96.7    9e-21   
gb|AGU36354.1|  hypothetical protein                                  94.4    3e-20   
ref|XP_003589658.1|  hypothetical protein MTR_1g031680                95.1    3e-20   
ref|XP_010435612.1|  PREDICTED: uncharacterized protein LOC104719388  95.1    4e-20   
gb|KFK33374.1|  hypothetical protein AALP_AA5G005100                  95.5    4e-20   
ref|XP_002875078.1|  hypothetical protein ARALYDRAFT_322499           94.0    7e-20   
gb|AGU36357.1|  hypothetical protein                                  93.2    7e-20   
gb|AGU36353.1|  hypothetical protein                                  93.2    7e-20   
gb|AGU36351.1|  hypothetical protein                                  92.8    8e-20   
ref|XP_009105746.1|  PREDICTED: uncharacterized protein At4g22758...  93.2    1e-19   
gb|AAL16139.1|AF428307_1  At1g70780/F5A18_4                           93.6    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|EYU44564.1|  hypothetical protein MIMGU_mgv1a024095mg              93.2    1e-19   
ref|XP_010528538.1|  PREDICTED: uncharacterized protein LOC104805613  93.6    1e-19   
gb|AGU36367.1|  hypothetical protein                                  92.0    2e-19   
ref|XP_009605387.1|  PREDICTED: uncharacterized protein LOC104099956  92.4    2e-19   
ref|XP_007047987.1|  Uncharacterized protein TCM_001138               95.1    2e-19   
gb|EYU44567.1|  hypothetical protein MIMGU_mgv1a024765mg              92.4    2e-19   
ref|XP_010440883.1|  PREDICTED: uncharacterized protein At4g22758...  92.4    3e-19   
gb|KFK41506.1|  hypothetical protein AALP_AA2G138600                  92.0    4e-19   
gb|KHN46081.1|  Hypothetical protein glysoja_030082                   91.3    5e-19   
ref|XP_007045196.1|  Uncharacterized protein isoform 2                91.7    5e-19   
gb|AGU36359.1|  hypothetical protein                                  90.1    8e-19   
gb|ACJ84118.1|  unknown                                               90.9    9e-19   Medicago truncatula
gb|ACJ83930.1|  unknown                                               90.9    9e-19   Medicago truncatula
gb|KCW64559.1|  hypothetical protein EUGRSUZ_G02164                   90.1    1e-18   
ref|XP_006405838.1|  hypothetical protein EUTSA_v10027994mg           90.1    1e-18   
ref|XP_002870559.1|  predicted protein                                89.7    2e-18   
emb|CDY71620.1|  BnaC05g50380D                                        89.7    2e-18   
gb|AES99286.2|  senescence-associated protein, putative               90.5    2e-18   
ref|XP_003616328.1|  hypothetical protein MTR_5g078750                90.5    3e-18   
gb|KFK22025.1|  hypothetical protein AALP_AAs45940U000100             89.0    4e-18   
ref|XP_006383328.1|  hypothetical protein POPTR_0005s14530g           88.6    6e-18   
ref|XP_011021386.1|  PREDICTED: uncharacterized protein At4g22758...  88.6    6e-18   
ref|XP_002875080.1|  hypothetical protein ARALYDRAFT_904355           88.2    6e-18   
gb|AFK49206.1|  unknown                                               88.2    7e-18   
ref|XP_006285693.1|  hypothetical protein CARUB_v10007163mg           87.8    8e-18   
ref|XP_009114230.1|  PREDICTED: uncharacterized protein At4g22758...  87.8    8e-18   
gb|EYU33134.1|  hypothetical protein MIMGU_mgv1a016072mg              87.4    1e-17   
ref|XP_006416119.1|  hypothetical protein EUTSA_v10009597mg           87.8    1e-17   
gb|EYU25602.1|  hypothetical protein MIMGU_mgv1a024525mg              87.4    1e-17   
ref|XP_002890566.1|  hypothetical protein ARALYDRAFT_889841           87.0    2e-17   
ref|XP_009101334.1|  PREDICTED: uncharacterized protein At4g22758     87.0    2e-17   
gb|AAM62631.1|  unknown                                               87.4    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198589.1|  uncharacterized protein                             87.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153591.1|  hypothetical protein PHAVU_003G048500g           86.7    4e-17   
gb|ABK28724.1|  unknown                                               87.4    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|EPS58723.1|  hypothetical protein M569_16091                       85.1    4e-17   
emb|CDX91699.1|  BnaC08g06180D                                        86.3    5e-17   
ref|XP_008457016.1|  PREDICTED: uncharacterized protein LOC103496795  86.3    5e-17   
ref|XP_006305759.1|  hypothetical protein CARUB_v10010592mg           85.9    6e-17   
ref|XP_009115559.1|  PREDICTED: uncharacterized protein At4g22758...  85.5    8e-17   
emb|CDY17461.1|  BnaC09g20760D                                        85.1    8e-17   
gb|KGN57775.1|  hypothetical protein Csa_3G292550                     85.1    1e-16   
ref|XP_009110117.1|  PREDICTED: uncharacterized protein At4g22758...  83.2    6e-16   
emb|CDY36234.1|  BnaC07g20880D                                        82.8    6e-16   
ref|XP_006830209.1|  hypothetical protein AMTR_s00130p00016510        82.0    3e-15   
ref|XP_006395882.1|  hypothetical protein EUTSA_v10005108mg           80.5    4e-15   
ref|NP_001046699.1|  Os02g0324700                                     80.5    6e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KDP33166.1|  hypothetical protein JCGZ_13431                       77.8    2e-14   
ref|XP_006647212.1|  PREDICTED: uncharacterized protein LOC102716287  78.2    4e-14   
ref|NP_173728.1|  uncharacterized protein                             77.4    5e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54243.1|  senescence-associated protein                         77.0    7e-14   
ref|XP_004305426.1|  PREDICTED: uncharacterized protein LOC101292530  75.9    2e-13   
ref|XP_010477604.1|  PREDICTED: uncharacterized protein LOC104756680  75.5    3e-13   
ref|XP_010498820.1|  PREDICTED: uncharacterized protein At4g22758...  74.3    7e-13   
ref|XP_010460096.1|  PREDICTED: uncharacterized protein At4g22758...  73.9    1e-12   
ref|XP_004952377.1|  PREDICTED: uncharacterized protein LOC101766815  72.4    5e-12   
ref|XP_006830230.1|  hypothetical protein AMTR_s00130p00053590        70.9    1e-11   
dbj|BAK06204.1|  predicted protein                                    70.9    2e-11   
ref|XP_002868302.1|  predicted protein                                70.9    2e-11   
gb|AAC00605.1|  Unknown protein                                       70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDP17872.1|  unnamed protein product                              72.8    5e-11   
gb|EMS64867.1|  hypothetical protein TRIUR3_17055                     69.7    7e-11   
ref|XP_003572714.1|  PREDICTED: uncharacterized protein At4g22758...  69.3    7e-11   
gb|AFW89732.1|  senescence-associated protein                         68.2    2e-10   
ref|NP_001150485.1|  senescence-associated protein                    67.8    3e-10   Zea mays [maize]
ref|XP_010554413.1|  PREDICTED: uncharacterized protein LOC104824...  66.2    3e-10   
ref|NP_001152495.1|  senescence-associated protein                    67.4    4e-10   Zea mays [maize]
dbj|BAH56891.1|  AT1G70780                                            64.7    1e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AFG57723.1|  hypothetical protein CL2034Contig1_03                 63.2    3e-09   
ref|XP_002967649.1|  hypothetical protein SELMODRAFT_18527            62.4    6e-09   
ref|XP_002967997.1|  hypothetical protein SELMODRAFT_440177           63.2    1e-08   
gb|EPS64875.1|  hypothetical protein M569_09904                       62.0    1e-08   
gb|EPS58433.1|  hypothetical protein M569_16383                       62.0    2e-08   
ref|XP_006849084.1|  hypothetical protein AMTR_s00028p00233650        60.8    3e-08   
gb|EPS60022.1|  hypothetical protein M569_14782                       60.5    6e-08   
gb|EPS70443.1|  hypothetical protein M569_04324                       60.8    7e-08   
dbj|BAB08319.1|  unnamed protein product                              58.9    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992399.1|  hypothetical protein SELMODRAFT_448736           59.7    2e-07   
ref|XP_010445453.1|  PREDICTED: uncharacterized protein LOC104728122  58.5    3e-07   
ref|XP_006833573.1|  hypothetical protein AMTR_s00364p00012660        57.0    1e-06   
ref|XP_002468583.1|  hypothetical protein SORBIDRAFT_01g048430        56.2    3e-06   Sorghum bicolor [broomcorn]
ref|XP_007132381.1|  hypothetical protein PHAVU_011G090100g           55.1    9e-06   
ref|XP_003539807.1|  PREDICTED: uncharacterized protein At4g22758...  53.5    3e-05   
ref|XP_002963924.1|  hypothetical protein SELMODRAFT_28561            51.6    4e-05   
emb|CAC09928.1|  hypothetical protein                                 52.0    1e-04   Catharanthus roseus [chatas]
ref|XP_004487530.1|  PREDICTED: uncharacterized protein At4g22758...  52.0    1e-04   
gb|ABR17412.1|  unknown                                               52.4    1e-04   Picea sitchensis
ref|NP_001241053.1|  uncharacterized protein LOC100801688             51.6    2e-04   
gb|EPS58560.1|  hypothetical protein M569_16253                       48.9    3e-04   
gb|ABB87098.1|  hypothetical protein                                  50.4    3e-04   Solanum tuberosum [potatoes]
ref|XP_006367869.1|  PREDICTED: uncharacterized protein At4g22758...  50.1    5e-04   
ref|XP_009373352.1|  PREDICTED: uncharacterized protein At4g22758...  49.3    6e-04   
ref|XP_009588778.1|  PREDICTED: uncharacterized protein At4g22758...  49.7    7e-04   
ref|XP_010934683.1|  PREDICTED: uncharacterized protein At4g22758...  48.9    9e-04   
ref|XP_004506132.1|  PREDICTED: uncharacterized protein LOC101503425  48.9    9e-04   
gb|KHF98270.1|  hypothetical protein F383_12843                       49.3    0.001   



>ref|XP_009774976.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
sylvestris]
Length=153

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 104/151 (69%), Gaps = 9/151 (6%)
 Frame = +3

Query  294  MEVKMKKSLSEKMTMMQRQKSG--------NKKRLLISINVFGSAGPIRFvvneddkvvg  449
            ME K+ KS SEK+ M +  K G        N  RLLI++NV GSAGP+RFVV+E+DKV  
Sbjct  1    MERKLMKSFSEKICMQKAIKKGEENKKMKKNSTRLLITVNVLGSAGPLRFVVSENDKVAV  60

Query  450  vvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQP  629
            VVD ALK YAR+GRLP+L SD  HFFLYP  +G +AL    SIG+ G RNF+LCKK +QP
Sbjct  61   VVDTALKLYAREGRLPILSSDAKHFFLYPACAGLDALGPLDSIGSLGVRNFILCKKQKQP  120

Query  630  LMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            LMTEGR   +    G + WK+WLTKSF  K+
Sbjct  121  LMTEGRANEIAQ-NGKKGWKAWLTKSFSFKI  150



>ref|XP_009586821.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
tomentosiformis]
Length=153

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 103/151 (68%), Gaps = 9/151 (6%)
 Frame = +3

Query  294  MEVKMKKSLSEKMTMMQRQKSG--------NKKRLLISINVFGSAGPIRFvvneddkvvg  449
            ME K+ KS SEK+ M +  K G        N  RLLI++NV GSAGP+RFVV+E+DKV  
Sbjct  1    MERKLMKSFSEKICMQKAIKKGEENKKVKNNSTRLLITVNVLGSAGPLRFVVSENDKVAV  60

Query  450  vvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQP  629
            VV+ ALKQYAR+GRLP+L S+ + FFLY   +G +AL    SIG  G RNF+LCKK +QP
Sbjct  61   VVNTALKQYAREGRLPILSSNVNDFFLYTTNAGIDALGPLDSIGLVGVRNFILCKKQKQP  120

Query  630  LMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            LMTEGR   +    G + WK+WLTKSF  K+
Sbjct  121  LMTEGRANGIAQ-NGKKGWKAWLTKSFSFKI  150



>ref|XP_002270144.3| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
 ref|XP_010660315.1| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
Length=149

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 101/149 (68%), Gaps = 11/149 (7%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQK---------SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvd  458
            MK+ +S+KM + +RQK         +G   R LIS+NV GS+GPIRFVVNE D +  V+D
Sbjct  1    MKRKMSQKM-LRRRQKKKSFEEQNINGTNNRFLISVNVLGSSGPIRFVVNEGDLIAAVID  59

Query  459  MALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMT  638
             ALK YARQGRLP LGSD + F LY    G +ALS    IG+CG RNF+LCKK  +P M 
Sbjct  60   TALKSYARQGRLPHLGSDINQFLLYCANVGADALSPWELIGSCGGRNFVLCKKQIEPQMR  119

Query  639  EGRPQVVTGLKGTRSWKSWLTKSFFHKMI  725
            E RP+++ G KG+ SWK+WL KSF  K++
Sbjct  120  ETRPEML-GRKGSGSWKTWLNKSFNFKIL  147



>emb|CBI33520.3| unnamed protein product [Vitis vinifera]
Length=145

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 97/144 (67%), Gaps = 1/144 (1%)
 Frame = +3

Query  294  MEVKMKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQ  473
            M  KM +   +K +  ++  +G   R LIS+NV GS+GPIRFVVNE D +  V+D ALK 
Sbjct  1    MSQKMLRRRQKKKSFEEQNINGTNNRFLISVNVLGSSGPIRFVVNEGDLIAAVIDTALKS  60

Query  474  YARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQ  653
            YARQGRLP LGSD + F LY    G +ALS    IG+CG RNF+LCKK  +P M E RP+
Sbjct  61   YARQGRLPHLGSDINQFLLYCANVGADALSPWELIGSCGGRNFVLCKKQIEPQMRETRPE  120

Query  654  VVTGLKGTRSWKSWLTKSFFHKMI  725
            ++ G KG+ SWK+WL KSF  K++
Sbjct  121  ML-GRKGSGSWKTWLNKSFNFKIL  143



>ref|XP_006357767.1| PREDICTED: uncharacterized protein LOC102592157 [Solanum tuberosum]
Length=127

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 3/118 (3%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            RLLI++NV GSAGP+RFVVNE+DKV  VVD ALKQY R+GRLP+L S+ + F LY  ++G
Sbjct  10   RLLITVNVLGSAGPLRFVVNENDKVAKVVDTALKQYGREGRLPILTSNVNDFLLYSASAG  69

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
             +AL AS SIG+ G RNF+LCKK +Q +MTEGR Q   G +G   WK+WLTKSF  K+
Sbjct  70   MDALGASDSIGSLGVRNFILCKKQKQAVMTEGRAQHGNGKRG---WKAWLTKSFNFKI  124



>ref|XP_009774977.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
sylvestris]
Length=131

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R LI++NV GSAGP+RFVV+E+DKV GVV++ALKQYAR+GRLP+LG   + FF YP ++G
Sbjct  12   RFLITVNVLGSAGPLRFVVSENDKVAGVVEIALKQYAREGRLPVLGFHVNDFFFYPASAG  71

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
             +AL    SIG+ G RNF+LCKK +QPLMTEGR   +    G + WK+WLTKSF  K+
Sbjct  72   LDALGPLESIGSVGVRNFILCKKQKQPLMTEGRANGIA-QNGKKGWKAWLTKSFSFKI  128



>ref|XP_010032694.1| PREDICTED: uncharacterized protein At4g22758-like [Eucalyptus 
grandis]
 gb|KCW52147.1| hypothetical protein EUGRSUZ_J01592 [Eucalyptus grandis]
Length=155

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 102/148 (69%), Gaps = 10/148 (7%)
 Frame = +3

Query  303  KMKKSLSEKMTMMQRQKSGN--------KKRLLISINVFGSAGPIRFvvneddkvvgvvd  458
            KMK++LSEK  +MQ+ K  N        K R L+++NV GSAGPIRFVV EDD V  V+ 
Sbjct  7    KMKRNLSEKSLLMQKHKKKNSSDDQGSKKNRFLVTVNVLGSAGPIRFVVKEDDLVSAVIQ  66

Query  459  MALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMT  638
             ALK YAR+GRLP+LG+D ++F L+   +  +AL+ S +IG+ G RNF+LCKK  QP MT
Sbjct  67   TALKTYAREGRLPVLGTDVNNFVLHAAANS-DALNPSEAIGSQGGRNFVLCKKQIQPQMT  125

Query  639  EGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            E R ++++  K + SWK+WL KSF  K+
Sbjct  126  EARSEMISH-KRSGSWKAWLNKSFSFKI  152



>ref|XP_007033029.1| Uncharacterized protein TCM_019175 [Theobroma cacao]
 gb|EOY03955.1| Uncharacterized protein TCM_019175 [Theobroma cacao]
Length=148

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 100/147 (68%), Gaps = 9/147 (6%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGNKK-------RLLISINVFGSAGPIRFvvneddkvvgvvdMA  464
            MK+++ EK+     +K GN+        R LI+INV GSAGP+RF+VNEDD V  V+D+A
Sbjct  2    MKRNVHEKIMPQTHKKKGNENKNVKKSTRFLITINVLGSAGPLRFLVNEDDLVAAVIDVA  61

Query  465  LKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEG  644
            LK YAR+GRLP+LG DP+ F LY   +G +ALS    IG+ G RNF+LCKK  QP MTE 
Sbjct  62   LKSYAREGRLPVLGLDPNKFLLYCANAGSDALSPWEKIGSQGRRNFVLCKKQVQPQMTEA  121

Query  645  RPQVVTGLKGTRSWKSWLTKSFFHKMI  725
            R +++   KG+  WK+WL KSF  K++
Sbjct  122  RSEIIAQ-KGS-GWKAWLNKSFSFKIL  146



>gb|KDP33165.1| hypothetical protein JCGZ_13430 [Jatropha curcas]
Length=153

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 99/153 (65%), Gaps = 13/153 (8%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGNKK----------RLLISINVFGSAGPIRFvvneddkvvgvv  455
            MK++L  +  M+ RQK+ NKK          R LIS+NV GSAGPI+FVV EDD V  V+
Sbjct  2    MKRNLMGEKLMLNRQKNNNKKSIDEKKNKKNRFLISVNVIGSAGPIKFVVKEDDDVASVI  61

Query  456  dMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQ-PL  632
            D++LK Y R+GRLP+LGSD H+F LY   +GF+A+     IG  GERNF+LCKK    P 
Sbjct  62   DISLKTYCREGRLPVLGSDAHNFLLYCPKAGFDAMKPWEPIGRSGERNFVLCKKREMPPQ  121

Query  633  MTEGRPQVVTGLKGTRSWKSWLTKSFFHKMILT  731
            MTE R +++     T  WK+WL KSF +  IL+
Sbjct  122  MTEARSEMIE--HKTPGWKAWLNKSFINFKILS  152



>ref|XP_009586822.1| PREDICTED: uncharacterized protein LOC104084618 [Nicotiana tomentosiformis]
Length=133

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +3

Query  348  QKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFF  527
            QK     R LI+INV GSAGP+RFVV+E+DKV GVV+ AL QYAR+GRLP+LGS+ + FF
Sbjct  7    QKPIKNTRFLITINVLGSAGPLRFVVSENDKVAGVVETALNQYAREGRLPILGSEVNDFF  66

Query  528  LYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKS  707
             Y  ++G + L    SIG+ G RNF+LCKK ++ LMTEGR   +    G R WK+WLTKS
Sbjct  67   FYSASAGLDGLGPLDSIGSAGVRNFILCKKQKKLLMTEGRANAIA-QNGKRGWKAWLTKS  125

Query  708  FFHKM  722
            F  K+
Sbjct  126  FNFKI  130



>ref|XP_011073847.1| PREDICTED: uncharacterized protein LOC105158703 [Sesamum indicum]
Length=175

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R LI+INVFGSAGPIRFVVNED+   GV++ ALK YA+QGRLP+LGSD   FFLYPV +G
Sbjct  57   RFLITINVFGSAGPIRFVVNEDETAQGVIETALKLYAKQGRLPVLGSDISSFFLYPVNAG  116

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKMI  725
            FEAL  S  IG+ G RNF+LCK   +P MTE R Q++   KG++ W++W  KS   K++
Sbjct  117  FEALKLSEVIGSRGARNFVLCKNQSKPHMTEARSQLIK-RKGSQ-WRAWFQKSLTFKIL  173



>ref|XP_010032695.1| PREDICTED: uncharacterized protein At4g22758 [Eucalyptus grandis]
Length=150

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 101/146 (69%), Gaps = 9/146 (6%)
 Frame = +3

Query  303  KMKKSLSEKMTMMQRQK-------SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdM  461
            KMK+++SEK  +MQ++K       S NK R L+ INV GS GPIRFVV +DD V GV+  
Sbjct  7    KMKRNVSEKSLLMQKRKKNSDDNQSTNKNRFLVIINVLGSTGPIRFVVKKDDLVSGVIQT  66

Query  462  ALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTE  641
            ALK YAR+GRLP+LG+D ++F L+   + + AL  + +IG+   RNF+LCKK  QP MTE
Sbjct  67   ALKTYAREGRLPVLGTDVNNFILHD-AADYAALHPAEAIGSREGRNFVLCKKQIQPQMTE  125

Query  642  GRPQVVTGLKGTRSWKSWLTKSFFHK  719
             R ++++  KG+ SWK+WL KSF  K
Sbjct  126  ARSEMIS-RKGSGSWKAWLNKSFSFK  150



>gb|KCW52148.1| hypothetical protein EUGRSUZ_J01593 [Eucalyptus grandis]
Length=143

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 100/145 (69%), Gaps = 9/145 (6%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQK-------SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMA  464
            MK+++SEK  +MQ++K       S NK R L+ INV GS GPIRFVV +DD V GV+  A
Sbjct  1    MKRNVSEKSLLMQKRKKNSDDNQSTNKNRFLVIINVLGSTGPIRFVVKKDDLVSGVIQTA  60

Query  465  LKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEG  644
            LK YAR+GRLP+LG+D ++F L+   + + AL  + +IG+   RNF+LCKK  QP MTE 
Sbjct  61   LKTYAREGRLPVLGTDVNNFILHD-AADYAALHPAEAIGSREGRNFVLCKKQIQPQMTEA  119

Query  645  RPQVVTGLKGTRSWKSWLTKSFFHK  719
            R ++++  KG+ SWK+WL KSF  K
Sbjct  120  RSEMIS-RKGSGSWKAWLNKSFSFK  143



>ref|XP_011099466.1| PREDICTED: uncharacterized protein At4g22758-like [Sesamum indicum]
Length=151

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 95/151 (63%), Gaps = 9/151 (6%)
 Frame = +3

Query  294  MEVKMKKSLSEKMTMMQRQKSGN-------KKRLLISINVFGSAGPIRFvvneddkvvgv  452
            M  K ++S+S+K  + +  +            R LISINVFGSAGPIRFVV+EDD   GV
Sbjct  1    MATKTRRSISDKALLRKLTQKKKKKDDKSKNNRFLISINVFGSAGPIRFVVDEDDNAAGV  60

Query  453  vdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPL  632
            +   LK YAR+GRLP+LGSD + F +YPV +GF+AL    +IG+ G RNF+LCK   +P 
Sbjct  61   IQTTLKIYAREGRLPVLGSDINCFVIYPVNAGFDALKPWEAIGSRGVRNFLLCKNQSKPN  120

Query  633  MTEGRPQVVTGLKGTRSWKSWLTKSFFHKMI  725
            MTE R QV    +  R W++WL  S   K++
Sbjct  121  MTEARSQVAD--RKGRGWRTWLQNSLTLKIL  149



>ref|XP_004231982.2| PREDICTED: uncharacterized protein At4g22758-like [Solanum lycopersicum]
Length=113

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 84/113 (74%), Gaps = 4/113 (4%)
 Frame = +3

Query  384  INVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALS  563
            +NV GSAGP+RFVVNE+D V  VVD ALKQY+R+GRLPLL S+ + F LY  T+G +AL 
Sbjct  2    VNVLGSAGPLRFVVNENDMVAKVVDTALKQYSREGRLPLLSSNVNDFLLYSATAGMDALG  61

Query  564  ASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            AS  IG+ G RNF+LCKK +Q +MTEGR   V G  G R WK+WLTKSF  K+
Sbjct  62   ASDLIGSLGVRNFILCKKQKQAMMTEGR---VHG-NGKRGWKAWLTKSFSFKI  110



>ref|XP_009586817.1| PREDICTED: uncharacterized protein LOC104084614 [Nicotiana tomentosiformis]
Length=144

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = +3

Query  294  MEVKMKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQ  473
            MEVK+ KS SEK++M +  K     R LI++NV GSAGP+RFVV+E+DKV  VVD ALKQ
Sbjct  1    MEVKLTKSFSEKISMQKPIKKVKVTRFLITVNVLGSAGPLRFVVSENDKVASVVDTALKQ  60

Query  474  YARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQ  653
            YAR+GRLP+L S+ + FFLY  T G +AL    SIG+   RNF+LCK+ +  +MT+ R  
Sbjct  61   YAREGRLPILSSNINDFFLYSATDGIDALGPLDSIGSLRVRNFILCKRQKH-VMTKERAH  119

Query  654  VVTGLKGTRSWKSWLTKSF  710
             +    G   W +WL KSF
Sbjct  120  GIAQ-NGKGGWIAWLIKSF  137



>ref|XP_006430618.1| hypothetical protein CICLE_v10012986mg [Citrus clementina]
 gb|ESR43858.1| hypothetical protein CICLE_v10012986mg [Citrus clementina]
 gb|KDO50842.1| hypothetical protein CISIN_1g031575mg [Citrus sinensis]
Length=157

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 95/153 (62%), Gaps = 16/153 (10%)
 Frame = +3

Query  306  MKKSLSEKMTMMQ--------------RQKSGNKKRLLISINVFGSAGPIRFvvneddkv  443
            MK +++EKM  +Q                 +  K R LI++NV GSAGPIRF+VN +D V
Sbjct  2    MKSNVNEKMMPIQVHNKKLKPRDDINHNNNNVKKSRFLITVNVLGSAGPIRFLVNGNDLV  61

Query  444  vgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNR  623
              V+D ALK +AR+GRLP+LG D   F LY    G +ALS S  IG+CG RNF+LCKK+ 
Sbjct  62   ASVIDTALKTFAREGRLPVLGFDVDKFLLYCANEGSDALSPSEQIGSCGGRNFLLCKKHL  121

Query  624  QPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            Q  MTEGR + V   KG+  WK+WL KSF  K+
Sbjct  122  QSQMTEGRAKTVAE-KGS-GWKAWLNKSFTFKI  152



>ref|XP_002534031.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28351.1| conserved hypothetical protein [Ricinus communis]
Length=152

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 106/151 (70%), Gaps = 13/151 (9%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSG--------NKK---RLLISINVFGSAGPIRFvvneddkvvgv  452
            MK+++S+K+ + +++K          NKK   R LISINV GSAGP+RFVVNED+ V GV
Sbjct  2    MKRNVSQKLMLYKQKKKDDDHTKTNHNKKNISRFLISINVLGSAGPLRFVVNEDELVAGV  61

Query  453  vdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPL  632
            +D ALK Y+R+GRLP+LGSD ++F LY   +G +AL+   +IG+ G RNF+LCKK R+  
Sbjct  62   IDTALKTYSREGRLPVLGSDVNNFLLYCANAGSDALNPWEAIGSHGGRNFVLCKKQREAQ  121

Query  633  MTEGRPQVVTGLKGTRSWKSWLTKSFFHKMI  725
            MTEGR + +T  K +  WK+WL KSF  K++
Sbjct  122  MTEGRSE-MTAHKAS-GWKAWLHKSFSFKVL  150



>ref|XP_010044204.1| PREDICTED: uncharacterized protein At4g22758 [Eucalyptus grandis]
 gb|KCW86246.1| hypothetical protein EUGRSUZ_B02935 [Eucalyptus grandis]
Length=138

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 87/129 (67%), Gaps = 2/129 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ +S    RLLISINV GSAGPIRFVV E++ V  V+D ALK YAR+GRLP+LGSD + 
Sbjct  7    KKNQSAKGNRLLISINVLGSAGPIRFVVGEEELVAAVIDTALKSYAREGRLPVLGSDLND  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR--PQVVTGLKGTRSWKSW  695
            F LY  TSG +ALS    IG+ G RNF+LCKK +  ++ + R  P      KG  SWKSW
Sbjct  67   FLLYCPTSGSDALSPWDMIGSPGARNFLLCKKPKTDVVADDRRSPDAGIARKGNGSWKSW  126

Query  696  LTKSFFHKM  722
            + KSF  K+
Sbjct  127  INKSFSLKV  135



>ref|XP_006482133.1| PREDICTED: uncharacterized protein LOC102630256 [Citrus sinensis]
Length=157

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 88/137 (64%), Gaps = 2/137 (1%)
 Frame = +3

Query  312  KSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGR  491
            K L  +  +     +  K R LI++NV GSAGPIRF+VN +D V  V+D ALK +AR+GR
Sbjct  18   KKLKPRDDINHNNNNVKKSRFLITVNVLGSAGPIRFLVNGNDLVASVIDTALKTFAREGR  77

Query  492  LPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLK  671
            LP+LG D   F LY    G  ALS S  IG+CG RNF+LCKK+ Q  MTEGR + V   K
Sbjct  78   LPVLGFDVDKFLLYCANEGSNALSPSEQIGSCGGRNFLLCKKHLQSQMTEGRAKTVAE-K  136

Query  672  GTRSWKSWLTKSFFHKM  722
            G+  WK+WL KSF  K+
Sbjct  137  GS-GWKAWLNKSFTFKI  152



>emb|CDP02694.1| unnamed protein product [Coffea canephora]
Length=143

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +3

Query  375  LISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFE  554
            LI+INV GSAGP+RFVVNE+D V GV+D ALK YARQ RLP+LGSD + FFLYP  +G +
Sbjct  25   LITINVLGSAGPVRFVVNENDTVSGVIDAALKLYARQERLPVLGSDVNSFFLYPANAGLD  84

Query  555  ALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSW-KSWLTKSFFHKMI  725
            AL+ S SIG  G RNF+LCKK R+P MTE R ++++  K + SW K+W  KS   KM+
Sbjct  85   ALNLSESIGLQGVRNFVLCKKQRRPQMTEARSEMISR-KRSGSWVKAWFNKSLSSKML  141



>ref|XP_010109006.1| hypothetical protein L484_027203 [Morus notabilis]
 gb|EXC20646.1| hypothetical protein L484_027203 [Morus notabilis]
Length=149

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +3

Query  363  KKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVT  542
            K+RLLI++NV GSAGP+RFVVNEDD V  V++ AL+ YAR+GRLPLLG+  + F LY   
Sbjct  27   KRRLLITVNVLGSAGPMRFVVNEDDVVSSVIETALRSYAREGRLPLLGTHSNDFLLYCAN  86

Query  543  SGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            +G +ALS  + IG+ G RNFMLCKK RQ  +T+ +P  +   KG   WKSWL   F  K+
Sbjct  87   AGSDALSPLAQIGSQGVRNFMLCKKQRQLQVTDRKPSDLIAQKGISCWKSWLNNPFTFKL  146

Query  723  I  725
            +
Sbjct  147  L  147



>ref|XP_002527797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34607.1| conserved hypothetical protein [Ricinus communis]
Length=138

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 86/128 (67%), Gaps = 1/128 (1%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + Q +    R LIS+ V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LGSD + 
Sbjct  8    KNQAAAKGNRFLISVTVLGSAGPIRFVVNEEELVASVIDTALKSYAREGRLPILGSDLND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEG-RPQVVTGLKGTRSWKSWL  698
            FFLY   +G EALS   +IG+ G RNFMLCKK +   + +G RP      KG+ SWKSW+
Sbjct  68   FFLYCANAGSEALSPWETIGSFGFRNFMLCKKPQPVKVDDGARPHAAITQKGSGSWKSWI  127

Query  699  TKSFFHKM  722
             KS   K+
Sbjct  128  NKSLNLKI  135



>ref|XP_002284639.1| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
 emb|CBI26875.3| unnamed protein product [Vitis vinifera]
Length=139

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 89/131 (68%), Gaps = 6/131 (5%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + Q +G   RLLISINV GSAGPIRFVV+ED+ V  V+D ALK YAR+GRLP+LGSD ++
Sbjct  8    KNQSAGKANRLLISINVLGSAGPIRFVVSEDELVAAVIDTALKSYAREGRLPILGSDLNN  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKK----NRQPLMTEGRPQVVTGLKGTRSWK  689
            F LY   +G +ALS   +IG+ G RNFMLCKK    N   +  EGR  +    KG+ SWK
Sbjct  68   FLLYCSNAGSDALSPWETIGSNGTRNFMLCKKPQPQNTTEVGVEGRAGMPR--KGSGSWK  125

Query  690  SWLTKSFFHKM  722
            +W+ KS   K+
Sbjct  126  AWINKSLNLKI  136



>ref|XP_004503136.1| PREDICTED: uncharacterized protein LOC101504281 [Cicer arietinum]
Length=142

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQ  485
            MKKS+ EK      QK+GN KR L++IN+ GS+GPIRFVVNE + V GV+D ALK YAR+
Sbjct  2    MKKSVFEKNRNRGDQKAGNNKRFLVTINIMGSSGPIRFVVNEKELVSGVIDTALKSYARE  61

Query  486  GRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTG  665
            GRLP+LG +  +F LY   + F AL+    IG+   RNF+LCKK   P M E + ++ + 
Sbjct  62   GRLPVLGFNASNFLLYHPNAEFYALNPLEPIGSYEGRNFVLCKKQVHPSMKEPQSELRSQ  121

Query  666  LKGTRSWKSWLTKSFFHKMI  725
             K    WK+WL KSF  K++
Sbjct  122  -KSNGGWKAWLNKSFVSKIL  140



>ref|XP_010670141.1| PREDICTED: uncharacterized protein At4g22758-like [Beta vulgaris 
subsp. vulgaris]
Length=160

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 4/148 (3%)
 Frame = +3

Query  288  IYMEVKMKKSLSEKMTMMQRQKSG--NKKRLLISINVFGSAGPIRFvvneddkvvgvvdM  461
            I+   K K S+ +K       K    N KR LI +NV GSAGP++FVVNE+D V GV+++
Sbjct  11   IFSSEKQKSSIMKKSNCFDCHKENINNNKRFLIIVNVLGSAGPLKFVVNEEDLVGGVIEI  70

Query  462  ALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKK-NRQPLMT  638
            ALK Y ++GRLP LGSD   F +Y   +G +ALS    IG+CG RNF+LCKK  +QP MT
Sbjct  71   ALKIYDKEGRLPALGSDNTKFLIYCANAGSDALSPWDEIGSCGSRNFVLCKKPEQQPNMT  130

Query  639  EGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            E R  +++  K + +WKSW  KS   K+
Sbjct  131  ESRSHLIS-RKRSANWKSWFNKSLSFKI  157



>emb|CAN65811.1| hypothetical protein VITISV_031711 [Vitis vinifera]
Length=137

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + Q +G   RLLISINV GSAGPIRFVV+ED+ V  V+D ALK YAR+GRLP+LGSD ++
Sbjct  8    KNQSAGKANRLLISINVLGSAGPIRFVVSEDELVAAVIDTALKSYAREGRLPILGSDLNN  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKK----NRQPLMTEGRPQVVTGLKGTRSWK  689
            F LY   +G +ALS   +IG+ G RNFMLCKK    N   +  EGR  +    KG+ SWK
Sbjct  68   FLLYCSNAGSDALSPWETIGSNGXRNFMLCKKPQPQNTTEVGVEGRAGMPR--KGSGSWK  125

Query  690  SWLTKS  707
            +W+  S
Sbjct  126  AWINNS  131



>ref|XP_008229193.1| PREDICTED: uncharacterized protein LOC103328575 isoform X1 [Prunus 
mume]
Length=153

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 94/147 (64%), Gaps = 9/147 (6%)
 Frame = +3

Query  309  KKSLSEKMTMMQRQKSGN--------KKRLLISINVFGSAGPIRFvvneddkvvgvvdMA  464
            ++++ E+ T+ Q+ K  N        K R LI++NV GSAGPIRFVVNEDD V GV+D A
Sbjct  4    RRNVLERTTLQQKHKKINNNEVHSVKKNRFLITVNVVGSAGPIRFVVNEDDLVAGVIDTA  63

Query  465  LKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEG  644
            LK YAR+GRLPLLGSD   F LY   +G +ALS   SIG+ G RNF+L KK R       
Sbjct  64   LKSYAREGRLPLLGSDVKDFLLYCANAGSDALSPWESIGSHGGRNFVLSKKQRAVQNVAE  123

Query  645  RPQVVTGLKGT-RSWKSWLTKSFFHKM  722
            R   +T  KG+  SWK+WL KSF  K+
Sbjct  124  RKPEMTAPKGSVSSWKAWLNKSFPFKI  150



>ref|XP_004297386.1| PREDICTED: uncharacterized protein LOC101305256 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004297387.1| PREDICTED: uncharacterized protein LOC101305256 isoform 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_004297388.1| PREDICTED: uncharacterized protein LOC101305256 isoform 3 [Fragaria 
vesca subsp. vesca]
Length=138

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 83/128 (65%), Gaps = 1/128 (1%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + Q +    R LISI V GSAGPIRFVVNE+  V  V+D ALK YAR+GRLP+LGSD + 
Sbjct  8    KSQAAAKGNRFLISITVLGSAGPIRFVVNEEALVAAVIDTALKSYAREGRLPILGSDLNE  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR-PQVVTGLKGTRSWKSWL  698
            F LY  T+G +ALS   +IG+ G RNFMLCKK +   M +   P      KG+ SWK+W+
Sbjct  68   FMLYCPTAGPDALSPWDTIGSQGSRNFMLCKKPQPVKMVDAEIPAATISRKGSGSWKAWI  127

Query  699  TKSFFHKM  722
             KS   K+
Sbjct  128  NKSLNLKI  135



>gb|KDP38078.1| hypothetical protein JCGZ_04721 [Jatropha curcas]
Length=138

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 2/129 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ +     R LIS+ V GSAGPIRFVVNE + V  ++D ALK YAR+GRLP+LGSD + 
Sbjct  7    KKNQPAKGNRFLISVTVLGSAGPIRFVVNEREIVAVIIDTALKSYAREGRLPVLGSDLND  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPL--MTEGRPQVVTGLKGTRSWKSW  695
            FFLY   +G  ALS   +IG+ G RNFMLCKK +Q +    + RP      KG+ SWKSW
Sbjct  67   FFLYCPNAGSGALSPWETIGSLGSRNFMLCKKPQQQVKAAEDPRPNAAITRKGSGSWKSW  126

Query  696  LTKSFFHKM  722
            + KS   K+
Sbjct  127  INKSLNLKI  135



>ref|XP_010066603.1| PREDICTED: uncharacterized protein LOC104453692 [Eucalyptus grandis]
Length=140

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = +3

Query  357  GNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYP  536
            GN  RLLISINV GS GPIRFVV+ED+ V  V+D AL+ YA QGRLP+LGSDP  F LY 
Sbjct  17   GNVSRLLISINVMGSPGPIRFVVSEDELVSSVIDTALRTYAHQGRLPILGSDPGDFLLYC  76

Query  537  VTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFH  716
              +  +ALS   +IG+ G RNF+L KK +     EG P    G KG+  WK+W+ KS   
Sbjct  77   ANAESDALSPWETIGSQGARNFLLWKKQKAEEADEGSPPSAIGRKGS-GWKAWINKSLNL  135

Query  717  KM  722
            K+
Sbjct  136  KI  137



>ref|XP_008221421.1| PREDICTED: uncharacterized protein LOC103321407 [Prunus mume]
Length=138

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 89/136 (65%), Gaps = 6/136 (4%)
 Frame = +3

Query  330  MTMMQRQKSGNK---KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPL  500
            M + +++K+ N     RLLISI V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+
Sbjct  1    MLLYKQKKNPNSAKGNRLLISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPV  60

Query  501  LGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR--PQVVTGLKG  674
            LGSD + F LY   SG +ALS   +IG  G RNFMLCKK  QP+  +    P      KG
Sbjct  61   LGSDLNDFLLYCPNSGPDALSPWDTIGAQGARNFMLCKK-PQPVKMDSDEIPAAAITRKG  119

Query  675  TRSWKSWLTKSFFHKM  722
            + SWK+W+ KS   K+
Sbjct  120  SGSWKAWINKSLNLKI  135



>ref|XP_009351504.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=138

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 82/129 (64%), Gaps = 3/129 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + Q +    RLLISI V GSAGPIRFVVNE + V  V+D ALK YAR+GRLP+LGSD + 
Sbjct  8    KNQSTAKGNRLLISITVLGSAGPIRFVVNEQELVAAVMDTALKSYAREGRLPVLGSDLND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR--PQVVTGLKGTRSWKSW  695
            F LY    G EALS   +IG  G RNFMLCKK  QP+  E    P      KG+ SWK+W
Sbjct  68   FLLYCPAVGPEALSPWDTIGAQGARNFMLCKK-PQPVKMEKDEIPAAAITRKGSGSWKAW  126

Query  696  LTKSFFHKM  722
            + KS   K+
Sbjct  127  INKSLNLKV  135



>ref|XP_007223777.1| hypothetical protein PRUPE_ppa013143mg [Prunus persica]
 gb|EMJ24976.1| hypothetical protein PRUPE_ppa013143mg [Prunus persica]
Length=138

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 89/136 (65%), Gaps = 6/136 (4%)
 Frame = +3

Query  330  MTMMQRQKSGNK---KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPL  500
            M + +++K+ N     RLLISI V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+
Sbjct  1    MLLYKQKKNPNSAKGNRLLISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPV  60

Query  501  LGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR--PQVVTGLKG  674
            LGSD + F LY   +G +ALS   +IG  G RNFMLCKK  QP+  +    P      KG
Sbjct  61   LGSDLNDFLLYCPNAGPDALSPWDTIGAQGARNFMLCKK-PQPVKMDSDEIPAAAITRKG  119

Query  675  TRSWKSWLTKSFFHKM  722
            + SWK+W+ KS   K+
Sbjct  120  SGSWKAWINKSLNLKI  135



>ref|XP_002315875.1| hypothetical protein POPTR_0010s12090g [Populus trichocarpa]
 gb|EEF02046.1| hypothetical protein POPTR_0010s12090g [Populus trichocarpa]
Length=133

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 83/123 (67%), Gaps = 2/123 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R LIS+ V GSAGPIRFVVNE+D VV V++ ALK YAR+GRLP+LGSD + 
Sbjct  7    KKNQAAKGNRFLISVTVLGSAGPIRFVVNEEDLVVAVINTALKSYAREGRLPILGSDLND  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTE--GRPQVVTGLKGTRSWKSW  695
            F LY   +G +A+S   +IG+ G RNFMLCKK +   + E  GR       KG+ SWK+W
Sbjct  67   FLLYCPNAGSDAISPWETIGSLGARNFMLCKKPQHLKVAEKDGRSNAAISQKGSGSWKAW  126

Query  696  LTK  704
            + K
Sbjct  127  INK  129



>ref|XP_009349522.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=138

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 81/129 (63%), Gaps = 3/129 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + Q +    RLLISI V GSAGPIRFVVNE + V  V+D ALK YAR+GRLP+LGSD + 
Sbjct  8    KNQSTAKGNRLLISITVLGSAGPIRFVVNEQELVAAVMDTALKSYAREGRLPVLGSDLND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR--PQVVTGLKGTRSWKSW  695
            F LY    G  ALS   +IG  G RNFMLCKK  QP+  E    P      KG+ SWK+W
Sbjct  68   FLLYCPAVGPAALSPWDTIGAQGARNFMLCKK-PQPVKMEKDEIPAAAITRKGSGSWKAW  126

Query  696  LTKSFFHKM  722
            + KS   K+
Sbjct  127  INKSLNLKV  135



>ref|XP_010681883.1| PREDICTED: uncharacterized protein LOC104896789 [Beta vulgaris 
subsp. vulgaris]
Length=138

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = +3

Query  330  MTMMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            M + +++K+ N K  RLLI++NV GSAGP+RFVVNE + V  V+DMALK YAR+GRLP+L
Sbjct  1    MLLSKQKKAQNSKGNRLLITVNVLGSAGPLRFVVNEKEIVAAVIDMALKSYAREGRLPVL  60

Query  504  GSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKK--NRQPLMTEGRPQVVTGLKGT  677
            GS+ + F LY  T+G +ALS   +IG  G RNF+LC+K   ++    E + +     +G 
Sbjct  61   GSNFNDFQLYCPTAGSDALSPLQTIGVHGARNFLLCRKPQPQEAANVEVKAEAAITRRGN  120

Query  678  RSWKSWLTKSFFHKM  722
             SWKSW+ K+   K+
Sbjct  121  GSWKSWINKTLILKI  135



>gb|EPS61325.1| hypothetical protein M569_13473, partial [Genlisea aurea]
Length=167

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 94/144 (65%), Gaps = 12/144 (8%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSG---NKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQY  476
            +KK+ ++KM +  +QK     N +R LIS+ V GSAGPIRF+VNED+ V  V+  ALK Y
Sbjct  28   LKKTRTKKMLLYNKQKKNVPSNARRFLISVTVLGSAGPIRFIVNEDELVASVITTALKSY  87

Query  477  ARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQV  656
            AR+GRLP+LGSD ++F LY   SG EAL+   +IG+ G RNFML KK     +TE     
Sbjct  88   AREGRLPVLGSDMNNFMLYCPVSGSEALNPWETIGSSGVRNFMLFKKP----VTENS---  140

Query  657  VTGLKGTR--SWKSWLTKSFFHKM  722
            ++G K +R  SWKSW  KS   K+
Sbjct  141  ISGQKPSRKSSWKSWFNKSISRKI  164



>ref|XP_008467130.1| PREDICTED: uncharacterized protein LOC103504558 [Cucumis melo]
Length=139

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = +3

Query  330  MTMMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            M + +++K+ N K  RLLISINV GSAGPIRF+VNE+  V  V+D ALK YAR+GRLP+L
Sbjct  1    MLLYKQKKNQNVKGNRLLISINVLGSAGPIRFIVNEEQLVAAVIDTALKSYAREGRLPIL  60

Query  504  GSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNR-QPLMTEGR--PQVVTGLKG  674
            GSD   F LY   +G +ALS   +IG+ G RNFMLCKK + + +  EG+  P      K 
Sbjct  61   GSDLRDFQLYCPNTGPDALSPWDTIGSHGARNFMLCKKPQPEKVSEEGKSPPGPTIPRKS  120

Query  675  TRSWKSWLTKSFFHKM  722
              SWKSW+ KS   K+
Sbjct  121  AGSWKSWINKSLNLKI  136



>ref|XP_008356300.1| PREDICTED: uncharacterized protein LOC103420001 [Malus domestica]
Length=138

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + Q +    RLLISI V GSAGPIRFVVNE + +  V+D ALK YAR+GR P+LGSD + 
Sbjct  8    KNQSTAKGNRLLISITVLGSAGPIRFVVNEQEVIAAVMDTALKSYAREGRFPVLGSDLND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR--PQVVTGLKGTRSWKSW  695
            F LY    G EALS    IG  G RNFMLCKK  QP+  E    P      KG+ SWK+W
Sbjct  68   FLLYCPAVGPEALSLWDXIGAQGARNFMLCKK-PQPVKMEKDEIPAAAITRKGSGSWKAW  126

Query  696  LTKSFFHKM  722
            + KS   K+
Sbjct  127  INKSLNLKV  135



>ref|XP_006301002.1| hypothetical protein CARUB_v10021392mg [Capsella rubella]
 gb|EOA33900.1| hypothetical protein CARUB_v10021392mg [Capsella rubella]
Length=137

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  342  QRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDP  515
            +++K+ N K  R+LIS+ V GSAGPIRFV  E+D V  V+D ALK YAR+GRLPLLGSD 
Sbjct  6    KQKKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKNYAREGRLPLLGSDF  65

Query  516  HHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSW  695
            + F LY    G EAL+  ++IG+ G RNFMLC+K  +  + E     + G +   S K+W
Sbjct  66   NDFLLYCPMVGPEALNTWNAIGSLGARNFMLCRKPDEKKVEEANNSTINGARKGGSLKAW  125

Query  696  LTKSFFHKM  722
            L KSF  K+
Sbjct  126  LNKSFNLKV  134



>ref|XP_010667680.1| PREDICTED: uncharacterized protein LOC104884693 [Beta vulgaris 
subsp. vulgaris]
Length=169

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = +3

Query  360  NKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPV  539
            N KRLL+ INV GSAGP++FVVNE+D V GV+D +LK YA++ RLP+LGSD  +F LY  
Sbjct  49   NNKRLLVVINVLGSAGPLKFVVNEEDFVGGVIDTSLKLYAKERRLPVLGSDSTNFLLYCA  108

Query  540  TSGFEALSASSSIGNCGERNFMLCKKNRQPL-MTEGRPQVVTGLKGTRSWKSWLTKSFFH  716
             +  +ALS    IG+CG R+F+LCKK  QP  MTE R Q+++  +G  SW++WL KS   
Sbjct  109  NAASDALSPWDEIGSCGGRSFVLCKKPEQPTNMTEARSQMISQKRGG-SWRAWLNKSLSL  167

Query  717  KM  722
            K+
Sbjct  168  KI  169



>ref|XP_007163388.1| hypothetical protein PHAVU_001G230600g [Phaseolus vulgaris]
 gb|ESW35382.1| hypothetical protein PHAVU_001G230600g [Phaseolus vulgaris]
Length=147

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 93/146 (64%), Gaps = 10/146 (7%)
 Frame = +3

Query  312  KSLSEKMTMMQRQKSGNKK--------RLLISINVFGSAGPIRFvvneddkvvgvvdMAL  467
            KS  EKM ++Q+ K G  +        R L++IN+ GSAGPIRFVVNE + V  V++ AL
Sbjct  2    KSGFEKM-VLQKNKKGRYEDEKRKKSTRFLVTINIMGSAGPIRFVVNEKEVVSEVIETAL  60

Query  468  KQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR  647
            K YAR+GRLP+LG D  +FFLY   +GF+ALS    IG+ G RNF+LCKK      T  +
Sbjct  61   KSYAREGRLPVLGFDATNFFLYSANAGFDALSPLEPIGSFGVRNFVLCKKQVYSSNTAPQ  120

Query  648  PQVVTGLKGTRSWKSWLTKSFFHKMI  725
             ++V+  K +  WK+WL KS   K++
Sbjct  121  SELVSQ-KSSGGWKAWLNKSLGLKIL  145



>ref|XP_010095717.1| hypothetical protein L484_002689 [Morus notabilis]
 gb|EXB62017.1| hypothetical protein L484_002689 [Morus notabilis]
Length=130

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 84/125 (67%), Gaps = 4/125 (3%)
 Frame = +3

Query  330  MTMMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            M + +++KS N K  R+LIS+ V GSAGPIRFVVNE + V  V+D ALK YAR+GRLPLL
Sbjct  1    MLLYKQKKSQNAKGNRILISVTVLGSAGPIRFVVNEKELVATVIDTALKCYAREGRLPLL  60

Query  504  GSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRS  683
             SD + F LY   S  EALS   +IG+ G RNFMLCKK  QPL  E   +  T  K + +
Sbjct  61   SSDLNDFLLYCPNSSIEALSPLDTIGSQGTRNFMLCKK-PQPLKIEDDVKESTR-KASGN  118

Query  684  WKSWL  698
            WKSWL
Sbjct  119  WKSWL  123



>ref|XP_003552877.1| PREDICTED: uncharacterized protein LOC100810542 [Glycine max]
 gb|KHN07549.1| hypothetical protein glysoja_019656 [Glycine soja]
Length=150

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 90/148 (61%), Gaps = 9/148 (6%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGN--------KKRLLISINVFGSAGPIRFvvneddkvvgvvdM  461
            MKKS  EKM   + +  G           R L++IN+ GSAGPIRFVVNE + V GV+D 
Sbjct  2    MKKSGFEKMVSQKNKNKGGYDDHQKPRNNRFLVNINIMGSAGPIRFVVNEKELVSGVIDT  61

Query  462  ALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTE  641
            ALK YA +GRLP+LG D  +F LY   +GF+ALS    IG+ G RNF+LCKK  Q     
Sbjct  62   ALKSYAGEGRLPVLGFDATNFLLYCANAGFDALSPLEPIGSLGSRNFVLCKKQVQSSKAA  121

Query  642  GRPQVVTGLKGTRSWKSWLTKSFFHKMI  725
             + ++V+  K    WK+WL KSF  K++
Sbjct  122  PQSELVS-QKSNGGWKAWLNKSFSLKIL  148



>ref|XP_003537448.2| PREDICTED: uncharacterized protein LOC100775979 [Glycine max]
Length=155

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 91/152 (60%), Gaps = 13/152 (9%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGN---------KKRLLISINVFGSAGPIRFvvneddkvvgvvd  458
            MKKS  EKM M+Q+               KR L++IN+ GSAGPIRFVVNE + V GV+D
Sbjct  3    MKKSGFEKMVMLQKNNKNKGSYDDEKPRSKRFLVNINIMGSAGPIRFVVNEKELVSGVID  62

Query  459  MALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMT  638
             ALK Y+R+GRLP+LG D  +F LY   +GF+ALS    IG+ G RNF+LCKK      +
Sbjct  63   TALKSYSREGRLPVLGFDATNFLLYCANAGFDALSPLEPIGSFGVRNFVLCKKQVYS-SS  121

Query  639  EGRPQVVTG---LKGTRSWKSWLTKSFFHKMI  725
            +  PQ         G   WK+WL KSF  K++
Sbjct  122  KAAPQSELASHKSSGGHGWKAWLNKSFGLKIV  153



>gb|KEH34623.1| senescence-associated protein, putative [Medicago truncatula]
Length=141

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 89/140 (64%), Gaps = 1/140 (1%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQ  485
            MKK + EK      QK+    + L++IN+ GS+GPIRFVVNE + V GV+D+ALK YARQ
Sbjct  1    MKKIVFEKNKNRGDQKTSRINKFLVTINIMGSSGPIRFVVNEKELVSGVIDIALKSYARQ  60

Query  486  GRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTG  665
            GRLPLLG +   F LY   +GF+AL+A   IG+   RNF+LCKK       E + ++V+ 
Sbjct  61   GRLPLLGFNAADFLLYYPNAGFDALNALEPIGSYEARNFVLCKKQVNQSNKEPQSELVSP  120

Query  666  LKGTRSWKSWLTKSFFHKMI  725
             K    WK WL KSF  K++
Sbjct  121  -KSKSGWKEWLNKSFSLKIL  139



>ref|XP_010274728.1| PREDICTED: uncharacterized protein At4g22758 [Nelumbo nucifera]
Length=146

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 91/143 (64%), Gaps = 12/143 (8%)
 Frame = +3

Query  330  MTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            M + + +K+    RLLIS+NV GSAGP+RF+VN+++ V  V+D ALK YAR+GRLP+LGS
Sbjct  1    MLLQKPKKNAKGNRLLISVNVLGSAGPLRFLVNDEELVAAVIDTALKSYAREGRLPVLGS  60

Query  510  DPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKK-----------NRQPLMTEGRPQV  656
            D ++F LY   +G +ALS   +IG+ G RNF+LCKK             Q   T G  Q+
Sbjct  61   DLNNFLLYSANAGTDALSPWETIGSRGGRNFVLCKKPQAQPQQPQQPQPQLQTTNGDGQL  120

Query  657  -VTGLKGTRSWKSWLTKSFFHKM  722
             +   KG+ SWK+WL KS   K+
Sbjct  121  TMIARKGSGSWKAWLNKSLNLKI  143



>ref|XP_011070610.1| PREDICTED: uncharacterized protein At4g22758-like [Sesamum indicum]
Length=136

 Score =   104 bits (260),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R LIS+ V GSAGPIRFVVNED+ V  V+D ALK YAR+GRLP+LGSD ++F LY   +G
Sbjct  16   RFLISVTVLGSAGPIRFVVNEDELVAAVIDTALKSYAREGRLPILGSDLNNFMLYCPIAG  75

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
             EALS   +IG+ G RNFMLCKK +     +         KG+ SWK+W  KS   K+
Sbjct  76   TEALSPWETIGSAGVRNFMLCKKPQTENSIDSEKSSAISRKGSGSWKAWFHKSLNLKI  133



>gb|KHN17944.1| hypothetical protein glysoja_017995 [Glycine soja]
Length=155

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 89/151 (59%), Gaps = 11/151 (7%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGN---------KKRLLISINVFGSAGPIRFvvneddkvvgvvd  458
            MKKS  EKM M+Q+               KR L++IN+ GSAGPIRFVVNE + V GV+D
Sbjct  3    MKKSGFEKMVMLQKNNKNKGSYDDEKPRSKRFLVNINIMGSAGPIRFVVNEKELVSGVID  62

Query  459  MALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMT  638
             ALK Y+R+GRLP+LG D  +F LY   +GF+ALS    IG+ G RNF+LCKK       
Sbjct  63   TALKSYSREGRLPVLGFDATNFLLYCANAGFDALSPLEPIGSFGVRNFVLCKKQVYSSSK  122

Query  639  EGRPQVVTGLK--GTRSWKSWLTKSFFHKMI  725
                  +   K  G   WK+WL KSF  K++
Sbjct  123  VAPQSELASHKSSGGHGWKAWLNKSFGLKIV  153



>ref|XP_011038615.1| PREDICTED: uncharacterized protein At4g22758-like [Populus euphratica]
Length=133

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R LIS+ V GSAGPIRFVVNE+D VV V+D ALK YAR+GRLP+LGSD + 
Sbjct  7    KKNQAAKGNRFLISVTVLGSAGPIRFVVNEEDLVVAVIDTALKSYAREGRLPILGSDLND  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTE--GRPQVVTGLKGTRSWKSW  695
            F LY   +  +A+S   +IG+ G RNFMLCKK +   + E  GR       KG+ SWK+W
Sbjct  67   FLLYCPNAASDAISPWETIGSLGARNFMLCKKPQHLKVAEKDGRSNAAISQKGSGSWKAW  126

Query  696  LTK  704
            + K
Sbjct  127  INK  129



>ref|XP_010552701.1| PREDICTED: uncharacterized protein At4g22758 [Tarenaya hassleriana]
Length=142

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 5/132 (4%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++  +    R+LIS+ V GSAGPIRFV  E D V  ++D ALK YAR+GRLP+LGSD + 
Sbjct  8    KKNHTSKGNRILISVTVLGSAGPIRFVAYEGDLVASIIDTALKCYAREGRLPILGSDFND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEG---RPQ--VVTGLKGTRSW  686
            F LY   +G EAL   ++IG+ G RNFMLC+K  +  + +G   RP   +  G KG  SW
Sbjct  68   FLLYCPVAGPEALRPWNTIGSLGARNFMLCRKPEEKKLGDGGDRRPNSTINGGRKGGGSW  127

Query  687  KSWLTKSFFHKM  722
            K+W+ KSF  K+
Sbjct  128  KTWINKSFSLKI  139



>ref|XP_004237906.1| PREDICTED: uncharacterized protein At4g22758-like [Solanum lycopersicum]
Length=155

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = +3

Query  276  VEPRIYMEVKMKKSLSEKMTMMQ--RQKSGNKKRLLISINVFGSAGPIRFvvneddkvvg  449
            +E + +  ++ K  +  KM + +  + ++G   R+LISI V GSAGPIRFVVNE++ V  
Sbjct  2    IENKFWKIIRKKFEIKNKMLLYKPKKNQTGKGNRILISITVLGSAGPIRFVVNEEELVAD  61

Query  450  vvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQP  629
            V+D A+K YAR+GRLP+LGSD  +F LY  ++G EAL    +IG+ G RNFML KK+ Q 
Sbjct  62   VIDTAMKAYAREGRLPVLGSDFSNFVLYCPSAGTEALGPWETIGSLGVRNFMLFKKSSQG  121

Query  630  LMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
              T    +     KG  SWK+W  KS   K+
Sbjct  122  EKTADGGKQSPIRKGAGSWKTWFNKSISSKI  152



>ref|XP_009334449.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=152

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 93/148 (63%), Gaps = 9/148 (6%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGNK-------KRLLISINVFGSAGPIRFvvneddkvvgvvdMA  464
            +K+ + E++ + + +K+           R LI++NV GSAGPIRFVVNEDD V  V+D A
Sbjct  2    LKRKVLERINLQKHKKTSTDAAHTVKTNRFLITVNVLGSAGPIRFVVNEDDLVARVIDTA  61

Query  465  LKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEG  644
            LK YAR+GRLP+LGSD   F L+ V +G +ALS   +IG+ G RNF+L KK +Q      
Sbjct  62   LKSYAREGRLPVLGSDVKDFLLHCVNAGSDALSPWETIGSRGGRNFVLSKKQKQVQNNIA  121

Query  645  -RPQVVTGLKGT-RSWKSWLTKSFFHKM  722
             R   +T  KGT  SWK+W  KSF  K+
Sbjct  122  ERKSEITAPKGTVSSWKAWFNKSFTFKI  149



>ref|XP_010916501.1| PREDICTED: uncharacterized protein LOC105041292 [Elaeis guineensis]
Length=149

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = +3

Query  348  QKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFF  527
             + G  KR LI++NV GSAGP+RF+VN+ + V  V++ ALK YAR+GRLP+LGSD ++F 
Sbjct  24   DRGGASKRFLITVNVLGSAGPLRFLVNDGELVATVINTALKSYAREGRLPVLGSDLNNFL  83

Query  528  LYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKS  707
            LY   S  +AL+   SI + G RNF+LCKK  Q ++ E   +V+ G KG+ SWK+WL KS
Sbjct  84   LYYANSESDALNPLESIDSRGTRNFVLCKK--QGVVDEPASEVL-GRKGSGSWKAWLNKS  140

Query  708  F  710
             
Sbjct  141  L  141



>ref|XP_010471079.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=140

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = +3

Query  342  QRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDP  515
            +++K+ N K  R+LIS+ V GSAGPIRFV  E+D V  V+D ALK YAR+GRLPLLGSD 
Sbjct  6    KQKKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKCYAREGRLPLLGSDF  65

Query  516  HHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR---SW  686
            + F LY    G EALS  ++IG+ G RNFMLC+K  +  + E   +  + + GTR   S 
Sbjct  66   NDFLLYCPMVGPEALSTWNAIGSLGARNFMLCRKPEEKKVEETNGRANSTINGTRKGGSL  125

Query  687  KSWLTKSFFHKM  722
            K+WL KSF  K+
Sbjct  126  KAWLNKSFNLKV  137



>ref|XP_008343057.1| PREDICTED: uncharacterized protein LOC103405829 [Malus domestica]
 ref|XP_008362512.1| PREDICTED: uncharacterized protein LOC103426195 [Malus domestica]
Length=153

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 93/149 (62%), Gaps = 10/149 (7%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGNK-------KRLLISINVFGSAGPIRFvvneddkvvgvvdMA  464
            +K+ + E++ + + +K+           R LI++NV GSAGPIRFVVNEDD V  V+D A
Sbjct  2    LKRKVLERINLQKHKKTSTDATHTVKTNRFLITVNVLGSAGPIRFVVNEDDLVARVIDTA  61

Query  465  LKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTE-  641
            LK YAR+GRLP+LGSD   F L+   +G +ALS   +IG+ G RNF+L KK +Q      
Sbjct  62   LKSYAREGRLPVLGSDVKDFLLHCANAGSDALSPWETIGSRGGRNFVLSKKQKQVQNNNI  121

Query  642  -GRPQVVTGLKGT-RSWKSWLTKSFFHKM  722
              R   +T  KGT  SWK+WL KSF  K+
Sbjct  122  AERKSEITAPKGTVSSWKAWLNKSFTFKI  150



>ref|XP_004150595.1| PREDICTED: uncharacterized protein LOC101204652 [Cucumis sativus]
 ref|XP_004161989.1| PREDICTED: uncharacterized protein LOC101229683 [Cucumis sativus]
 gb|KGN51491.1| hypothetical protein Csa_5G569870 [Cucumis sativus]
Length=139

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = +3

Query  330  MTMMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            M + +++K+ N K  RLLISINV GSAGPIRF+VNE+  V  V+D ALK YAR+GRLP+L
Sbjct  1    MLLYKQKKNQNVKGNRLLISINVLGSAGPIRFIVNEEQLVAAVIDTALKSYAREGRLPIL  60

Query  504  GSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNR-QPLMTEGRPQVVTGL--KG  674
            GSD   F LY   +G +ALS   +IG+ G RNFMLCKK + + +  EG+      +  K 
Sbjct  61   GSDLRDFQLYCPNTGPDALSPWDTIGSHGARNFMLCKKPQPEKVPEEGKTPSGPAIPRKS  120

Query  675  TRSWKSWLTKSFFHKM  722
              SWKSW+ KS   K+
Sbjct  121  AGSWKSWINKSLNLKI  136



>gb|ABK96329.1| unknown [Populus trichocarpa x Populus deltoides]
Length=133

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R LIS+ V GSAGPIRFVVNE+D VV V++ ALK YAR+GRLP+LGSD + 
Sbjct  7    KKNQAAKGNRFLISVTVLGSAGPIRFVVNEEDLVVAVINTALKSYAREGRLPILGSDLND  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTE--GRPQVVTGLKGTRSWKSW  695
            F LY   +G +A+S   +IG+ G R FMLCKK +   + E  GR       KG+ SWK+W
Sbjct  67   FLLYCPDAGSDAISPWETIGSLGARKFMLCKKPQHLKVAEKDGRSNAAISQKGSGSWKAW  126

Query  696  LTK  704
            + K
Sbjct  127  INK  129



>gb|AFK34092.1| unknown [Medicago truncatula]
 gb|KEH34622.1| senescence-associated protein, putative [Medicago truncatula]
Length=138

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 89/139 (64%), Gaps = 1/139 (1%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQ  485
            MKK + EK      QK+    R L++IN+ GS+GP+RFVVNE + V GV+D ALK YARQ
Sbjct  1    MKKIVFEKNKNSGDQKTSRINRFLVTINIMGSSGPLRFVVNEKELVSGVIDTALKSYARQ  60

Query  486  GRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTG  665
            GRLP+LG +  +FFLY   SGF+AL+    IG+   RNF+LCKK       E + ++++ 
Sbjct  61   GRLPVLGFEATNFFLYHPNSGFDALNPMEPIGSYEVRNFVLCKKQMYLSRKESQSELISP  120

Query  666  LKGTRSWKSWLTKSFFHKM  722
             K    WKSWL KSF  K+
Sbjct  121  -KRKGGWKSWLNKSFSFKI  138



>ref|XP_006355080.1| PREDICTED: uncharacterized protein LOC102584968 [Solanum tuberosum]
Length=143

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 88/135 (65%), Gaps = 7/135 (5%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ +SG   RLLISI V GSAGPIRFVVNE + V  V+D+ALK YAR+ RLP+LGS+ ++
Sbjct  7    KKIQSGKGNRLLISITVVGSAGPIRFVVNEKELVANVIDIALKNYAREERLPVLGSNFNN  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKK--NRQPLMTEGRP-----QVVTGLKGTR  680
            F LY  T   E LS   +IG+ G RNF+L KK  +  P++   +P     QVV   KG+ 
Sbjct  67   FVLYCPTVVTEDLSPWETIGSLGVRNFVLVKKPQSENPILDAKQPILDGKQVVMARKGSG  126

Query  681  SWKSWLTKSFFHKMI  725
            SWK+W  KS   K++
Sbjct  127  SWKAWFNKSLSRKIV  141



>gb|KHG14735.1| hypothetical protein F383_02623 [Gossypium arboreum]
Length=137

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 87/129 (67%), Gaps = 2/129 (2%)
 Frame = +3

Query  342  QRQKSGNK-KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPH  518
            Q++  G K  RLLIS+ V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LGS+ +
Sbjct  6    QKKNQGPKGNRLLISVTVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVLGSNLN  65

Query  519  HFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNR-QPLMTEGRPQVVTGLKGTRSWKSW  695
             F LY  ++G +ALS   +IG+ G RNFMLCKK R + +  +G+       K + +WK+W
Sbjct  66   DFLLYCPSAGSDALSPWETIGSQGARNFMLCKKPRTEKVKDDGKAAESINRKASGNWKAW  125

Query  696  LTKSFFHKM  722
              KS   K+
Sbjct  126  FNKSLNLKI  134



>emb|CDX68330.1| BnaA07g23700D [Brassica napus]
Length=142

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R+LIS+ V GSAGPIRFV  E+D V  V+D ALK YAR+GRLPLLGSD + 
Sbjct  8    KKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKCYAREGRLPLLGSDFND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMT-----EGRPQVVTGLKGTRSW  686
            F LY    G EALSA S+IG+ G RNF LC+K  +  +      EGR   + G +   S 
Sbjct  68   FLLYCPMVGPEALSAWSAIGSLGARNFTLCRKPEEKKVVKEGEGEGRSNSINGARKGGSL  127

Query  687  KSWLTKSFFHKM  722
            K+W+ KSF  K+
Sbjct  128  KAWINKSFNLKV  139



>gb|EPS58431.1| hypothetical protein M569_16381, partial [Genlisea aurea]
Length=124

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            + LI INV GS+GP+RF+V  +D V  V++ ALK Y R+GR+P++G+D   F LYP  +G
Sbjct  4    KFLIVINVLGSSGPVRFLVRVEDNVKTVIENALKVYRREGRIPVIGTDSDDFLLYPAHNG  63

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLM-TEGRPQVVTGLKGTRSWKSWLTKSFFHKMI  725
            F+ +   + IG+CG + F+LCKK +   M TEGR Q V+  KG   + +WL KS   K++
Sbjct  64   FKPVDVCAEIGSCGGQKFVLCKKQKGGCMTTEGRTQSVSYRKGNNKFSAWLKKSLSLKIL  123



>ref|XP_009104937.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
Length=142

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R+LIS+ V GSAGPIRFV  E+D V  V+D ALK YAR+GRLPLLGSD + 
Sbjct  8    KKNQNAKGNRILISVTVLGSAGPIRFVAFEEDLVASVIDTALKCYAREGRLPLLGSDFND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMT-----EGRPQVVTGLKGTRSW  686
            F LY    G EALSA S+IG+ G RNF LC+K  +  +      EGR   + G +   S 
Sbjct  68   FLLYCPMVGPEALSAWSAIGSLGARNFTLCRKPEEKKVVKEGEGEGRSNSINGARKGGSL  127

Query  687  KSWLTKSFFHKM  722
            K+W+ KSF  K+
Sbjct  128  KAWINKSFNLKV  139



>ref|XP_008782287.1| PREDICTED: uncharacterized protein LOC103701859 [Phoenix dactylifera]
Length=147

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 91/143 (64%), Gaps = 6/143 (4%)
 Frame = +3

Query  294  MEVKMKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQ  473
            +++K+KK+           ++G   R LI++NV GSAGPIRF+VNE + V  V+  ALK 
Sbjct  8    LQIKLKKNRQLPRGRGGGNRAGASNRCLITVNVLGSAGPIRFLVNEGEMVGTVISTALKS  67

Query  474  YARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQ  653
            YAR+GRLP+LGSD ++F LY   SG +ALS   SI + G RNF+LCKK     + + R  
Sbjct  68   YAREGRLPVLGSDFNNFLLY---SGSDALSPWESIDSRGTRNFVLCKKEG---VVDERAS  121

Query  654  VVTGLKGTRSWKSWLTKSFFHKM  722
             V G KG+ SW++WL KS   ++
Sbjct  122  QVLGRKGSGSWRTWLNKSLSFRI  144



>ref|XP_007216024.1| hypothetical protein PRUPE_ppa014882mg, partial [Prunus persica]
 gb|EMJ17223.1| hypothetical protein PRUPE_ppa014882mg, partial [Prunus persica]
Length=121

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = +3

Query  372  LLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGF  551
             LI++NV GS GPIRFVVNEDD V GV+D ALK YAR+GRLPLLGSD   F LY   +G 
Sbjct  1    FLITVNVVGSTGPIRFVVNEDDLVAGVIDTALKSYAREGRLPLLGSDVKDFLLYCANAGS  60

Query  552  EALSASSSIGNCGERNFMLCKKNRQPL-MTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            +ALS   SIG+ G RNF+L KK R    +TE +P++        SWK+WL KSF  K+
Sbjct  61   DALSPWESIGSHGGRNFVLSKKQRAVQNVTERKPEMTAPKGSVSSWKAWLNKSFPFKI  118



>ref|NP_001236932.1| uncharacterized protein LOC100499853 [Glycine max]
 gb|ACU13908.1| unknown [Glycine max]
Length=135

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = +3

Query  330  MTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            +TM +++K+ N KRLLISINV GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LG+
Sbjct  2    LTMSKQKKNQNAKRLLISINVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVLGN  61

Query  510  DPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWK  689
            +   F LY    G +ALS    IG+ G RNF+L KK       +G   +     G+ SWK
Sbjct  62   NTTGFVLYCPHLGSDALSPWERIGSHGVRNFVLFKKPEGVADVDGSTALSRSSTGSGSWK  121

Query  690  SWLTKSFFHKM  722
            +W  KS   K+
Sbjct  122  AWFNKSLNLKI  132



>emb|CDY23481.1| BnaC06g24500D [Brassica napus]
Length=140

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 83/130 (64%), Gaps = 3/130 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R+LIS+ V GSAGPIRFV  E+D V  VVD ALK YAR+GRLPLLGSD + 
Sbjct  8    KKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVVDTALKCYAREGRLPLLGSDFND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMT---EGRPQVVTGLKGTRSWKS  692
            F LY    G EALSA S+IG+ G RNF LC+K     +    +G+   + G K   S K+
Sbjct  68   FLLYCPMFGPEALSAWSAIGSLGARNFTLCRKPEDTKVVKEGDGKSNSINGAKKGGSLKA  127

Query  693  WLTKSFFHKM  722
            W+ KSF  K+
Sbjct  128  WINKSFSLKV  137



>ref|XP_011023710.1| PREDICTED: uncharacterized protein At4g22758-like [Populus euphratica]
Length=138

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ +    KR LIS+ V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LGSD + 
Sbjct  7    KKNQVAKGKRFLISVTVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPILGSDLND  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQ-PLMTEGRPQVVTGLK-GTRSWKSW  695
            F LY   +  +A+S   +IG+ G RNFMLCKK +    + +GR      +K G+ SWK+W
Sbjct  67   FLLYCRNAASDAISPWETIGSLGARNFMLCKKPQHLKAVDDGRSTSAFSMKGGSGSWKAW  126

Query  696  LTKSFFHKM  722
            + KS   K+
Sbjct  127  INKSLNLKI  135



>ref|XP_010415767.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
 ref|XP_010427868.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=140

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 87/132 (66%), Gaps = 5/132 (4%)
 Frame = +3

Query  342  QRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDP  515
            +++K+ N K  R+LIS+ V GSAGPIRFV  E+D V  V+D ALK YAR+GRLPLLGSD 
Sbjct  6    KQKKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKCYAREGRLPLLGSDF  65

Query  516  HHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR---SW  686
            + F LY    G EALS  ++IG+ G RNFMLC+K  +  + E   +  + + G R   S 
Sbjct  66   NDFLLYCPMVGPEALSTWNAIGSLGARNFMLCRKPEEKKVEETNGRANSTINGARKGGSL  125

Query  687  KSWLTKSFFHKM  722
            K+WL KSF  K+
Sbjct  126  KAWLNKSFNLKV  137



>gb|EYU30083.1| hypothetical protein MIMGU_mgv1a016062mg [Erythranthe guttata]
Length=136

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 87/136 (64%), Gaps = 8/136 (6%)
 Frame = +3

Query  330  MTMMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            M + +++KS   K  R L+ + V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+L
Sbjct  1    MLLYKQKKSQPSKGNRFLVCVTVLGSAGPIRFVVNENELVATVIDTALKSYAREGRLPIL  60

Query  504  GSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQV---VTGLKG  674
            GSD + F LY   +G EALS   +IG+ G RNFMLCKK   P  TE   +V       KG
Sbjct  61   GSDLNKFMLYCPIAGTEALSPWETIGSVGVRNFMLCKK---PQTTEDSDEVEKSAMSRKG  117

Query  675  TRSWKSWLTKSFFHKM  722
            + SW++W  KS   K+
Sbjct  118  SGSWRAWFHKSLSLKI  133



>ref|XP_004504564.1| PREDICTED: uncharacterized protein LOC101507525 [Cicer arietinum]
Length=137

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 84/133 (63%), Gaps = 3/133 (2%)
 Frame = +3

Query  330  MTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            +T  ++  + N  RLLISINV GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LG+
Sbjct  3    LTKQKKNHNANATRLLISINVLGSAGPIRFVVNEEELVATVIDTALKSYAREGRLPVLGN  62

Query  510  DPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGL--KGTRS  683
            D   F LY    G +AL    +IG+ G RNFMLCKK  Q    +G     T +  +G  S
Sbjct  63   DIRTFALYCPHVGSDALRPWDTIGSHGARNFMLCKK-PQASDADGAGNETTTISRRGGGS  121

Query  684  WKSWLTKSFFHKM  722
            WK+W  KS   K+
Sbjct  122  WKAWFNKSLNLKI  134



>ref|NP_565000.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD55493.1|AC008148_3 Unknown protein [Arabidopsis thaliana]
 gb|AAG40399.1|AF325047_1 At1g70780 [Arabidopsis thaliana]
 gb|AAG52330.1|AC011663_9 unknown protein; 8615-9128 [Arabidopsis thaliana]
 gb|AAK83590.1| At1g70780/F5A18_4 [Arabidopsis thaliana]
 gb|AAN31119.1| At1g70780/F5A18_4 [Arabidopsis thaliana]
 gb|AEE35114.1| uncharacterized protein AT1G70780 [Arabidopsis thaliana]
Length=140

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 86/132 (65%), Gaps = 5/132 (4%)
 Frame = +3

Query  342  QRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDP  515
            +++K+ N K  R+LIS+ V GSAGPIRFV  EDD V  V+D ALK YAR+GRLPLLGSD 
Sbjct  6    KQKKNQNAKGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKGYAREGRLPLLGSDF  65

Query  516  HHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR---SW  686
            + F LY    G EALS   +IG+ G RNFMLC+K  +  + E   +  + + G R   S 
Sbjct  66   NDFLLYCPMVGPEALSTWDAIGSLGARNFMLCRKPEEKKVEESNGRSDSTINGARKGGSL  125

Query  687  KSWLTKSFFHKM  722
            K+W+ KSF  K+
Sbjct  126  KAWINKSFNLKV  137



>ref|XP_006364850.1| PREDICTED: uncharacterized protein LOC102578189 [Solanum tuberosum]
Length=136

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 83/127 (65%), Gaps = 0/127 (0%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++G   R+LISI V GSAGPIRFVVNE++ V  V+D A+K YAR+GRLP+LGSD  +
Sbjct  7    KKNQTGKGNRILISITVLGSAGPIRFVVNEEELVADVIDTAMKAYAREGRLPVLGSDFSN  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLT  701
            F LY  ++G EAL    +IG+ G RNFML KK+ Q   T    +     KG  SWK+W  
Sbjct  67   FVLYCPSAGTEALGPWETIGSLGVRNFMLFKKSSQGENTVDDGKQSPIRKGAGSWKTWFN  126

Query  702  KSFFHKM  722
            KS   K+
Sbjct  127  KSISRKI  133



>ref|XP_009139746.1| PREDICTED: uncharacterized protein At4g22758 [Brassica rapa]
 emb|CDX74563.1| BnaA04g08260D [Brassica napus]
Length=142

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 85/122 (70%), Gaps = 3/122 (2%)
 Frame = +3

Query  363  KKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVT  542
            KK++L+S+NV GS GPIRF+VNEDDKV  V++ ALK YARQGR+P+LG D ++F  Y  +
Sbjct  5    KKKILVSVNVLGSVGPIRFLVNEDDKVSSVINTALKTYARQGRIPVLGFDVNNFIFYSNS  64

Query  543  SGFEALSASSSIGNCGERNFMLCKKNRQPL-MTEGRPQVVTGLKGTRSWKSWLTKSFFHK  719
            +GF+ L+    IG+ GE NF+LCK+ R+PL   EGR +  +  +  + WK+ L +S   +
Sbjct  65   AGFKTLNPQEKIGSMGETNFLLCKREREPLEKVEGREE--SKAREGKGWKNRLRRSLLGE  122

Query  720  MI  725
             +
Sbjct  123  FL  124



>ref|XP_010553810.1| PREDICTED: uncharacterized protein LOC104823786 [Tarenaya hassleriana]
Length=140

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 76/125 (61%), Gaps = 2/125 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            +R ++    R L+SINV GSAGPIRFVV ED+ V  V+  ALK Y R+ RLP+LGSD H 
Sbjct  9    KRNQNSKGNRFLVSINVLGSAGPIRFVVKEDETVANVMVYALKSYTRERRLPVLGSDIHD  68

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQ--VVTGLKGTRSWKSW  695
            F LY   S  EAL     IG  G RNF+LCKK     + E +    +VT  K + SWK+W
Sbjct  69   FVLYSPYSAAEALKPWEMIGVTGSRNFILCKKPETGEVGESKSSTPLVTNRKTSGSWKAW  128

Query  696  LTKSF  710
            L KS 
Sbjct  129  LNKSL  133



>ref|NP_001236734.1| uncharacterized protein LOC100305791 [Glycine max]
 gb|ACU13651.1| unknown [Glycine max]
Length=137

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 86/134 (64%), Gaps = 3/134 (2%)
 Frame = +3

Query  330  MTMMQRQKSG--NKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            M M +++KS   N KRLLISINV GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+L
Sbjct  1    MLMSKQKKSQIQNAKRLLISINVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  60

Query  504  GSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVT-GLKGTR  680
            G++   F LY    G +ALS    IG+ G RNFMLCKK       +G    ++   +G  
Sbjct  61   GNNTTGFALYCPHLGSDALSPWDRIGSHGVRNFMLCKKPEGVADVDGDASGISRSSRGIG  120

Query  681  SWKSWLTKSFFHKM  722
            SWK+W  KS   K+
Sbjct  121  SWKAWFNKSLNLKI  134



>ref|XP_010096674.1| hypothetical protein L484_025423 [Morus notabilis]
 gb|EXB65342.1| hypothetical protein L484_025423 [Morus notabilis]
Length=157

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 89/151 (59%), Gaps = 12/151 (8%)
 Frame = +3

Query  309  KKSLSEKMTMMQR--QKSGN--------KKRLLISINVFGSAGPIRFvvneddkvvgvvd  458
            K +LS+K+ +  R  QK  N        K + LI+INV G AGP+RFVVNEDD V  V+D
Sbjct  5    KANLSKKLMLASRNKQKKNNIIGYCCTPKNKFLITINVLGCAGPLRFVVNEDDVVDSVID  64

Query  459  MALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPL--  632
             ALK YARQ RLP+L S  + F LY   + FEALS S+ IG+ G RNFML KK  QP   
Sbjct  65   TALKLYARQRRLPVLVSHANDFLLYCANAEFEALSPSAQIGSQGVRNFMLGKKKMQPQMR  124

Query  633  MTEGRPQVVTGLKGTRSWKSWLTKSFFHKMI  725
            MT+ +       KG   WKSW    F  K++
Sbjct  125  MTDRKSSDPNAQKGISCWKSWFNNLFTFKLL  155



>ref|XP_008809820.1| PREDICTED: uncharacterized protein LOC103721401 [Phoenix dactylifera]
Length=147

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R LI++NV GSAGP+RF+VN+ + V  V+  ALK YAR+GRLP+LGSD ++F LY   SG
Sbjct  29   RFLITVNVLGSAGPLRFLVNDGELVTNVIHTALKSYAREGRLPVLGSDFNNFLLYCANSG  88

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSF  710
             +AL+   +I   G RNF+LCKK R   + +     V G KG+ SWK+WL KS 
Sbjct  89   SDALNPLEAIDFRGTRNFVLCKKQR---VVDEPASEVLGRKGSGSWKTWLNKSL  139



>ref|XP_006469193.1| PREDICTED: uncharacterized protein LOC102613615 [Citrus sinensis]
 gb|KDO64605.1| hypothetical protein CISIN_1g032525mg [Citrus sinensis]
Length=139

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 83/130 (64%), Gaps = 3/130 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R+LISI V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LGSD + 
Sbjct  7    KKAQAAKGNRILISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVLGSDLND  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTE-GRPQVVTGLK--GTRSWKS  692
            F LY   +G  ALS   +IG  G RNF+LCKK +     E GR       +  G+ SWK+
Sbjct  67   FVLYCSNAGSGALSPWDTIGRHGMRNFLLCKKQQTEKTAENGRLDNAIARRGSGSGSWKA  126

Query  693  WLTKSFFHKM  722
            W+ KS   K+
Sbjct  127  WINKSLMFKI  136



>ref|XP_004236949.1| PREDICTED: uncharacterized protein LOC101244859 [Solanum lycopersicum]
Length=144

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (65%), Gaps = 10/137 (7%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++G   RLLISI V GSAGPIRFVVNE + V  V+D+ALK YAR+ RLP+LGS+ ++
Sbjct  7    KKIQAGKGNRLLISITVVGSAGPIRFVVNEKELVADVIDIALKNYAREERLPVLGSNFNN  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKK---------NRQPLMTEGRPQVVTGLKG  674
            F LY  T+  E LS   +IG+ G RNF+L KK          +Q  + +G+ QVV   KG
Sbjct  67   FVLYCPTAVTEDLSPWETIGSLGVRNFVLVKKPQSENPILNGKQQRILDGK-QVVMARKG  125

Query  675  TRSWKSWLTKSFFHKMI  725
            + SWK+W  KS   K++
Sbjct  126  SGSWKAWFNKSLSRKIV  142



>ref|XP_002888795.1| hypothetical protein ARALYDRAFT_894896 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65054.1| hypothetical protein ARALYDRAFT_894896 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 84/130 (65%), Gaps = 3/130 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R+LIS+ V GSAGPIRFV  EDD V  V+D ALK YAR+GRLPLLGSD + 
Sbjct  8    KKNQNAKGNRILISVTVLGSAGPIRFVAFEDDLVASVIDTALKCYAREGRLPLLGSDFND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR---SWKS  692
            F LY    G EAL+  ++IG+ G RNFMLC+K  +  + E   +  + + G R   S K+
Sbjct  68   FLLYCPMVGPEALTTWNAIGSLGARNFMLCRKPEEKKVEESNGRSNSNINGARKGGSLKA  127

Query  693  WLTKSFFHKM  722
            W+ KSF  K+
Sbjct  128  WINKSFNLKV  137



>gb|KHG22133.1| hypothetical protein F383_27486 [Gossypium arboreum]
Length=138

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 90/134 (67%), Gaps = 3/134 (2%)
 Frame = +3

Query  330  MTMMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            M + +++KS   K  RLL+SI V GSAGPIRFVVNE++ V  V+D ALK YAR+GR P+L
Sbjct  1    MVLYKQKKSQGPKGNRLLVSITVLGSAGPIRFVVNEEELVSSVIDTALKAYAREGRRPVL  60

Query  504  GSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKK-NRQPLMTEGRPQVVTGLKGTR  680
            GS    FFLY  ++G +AL+   +IG+ G RNF+LC+K + + +  +GR       KG+ 
Sbjct  61   GSAISDFFLYCPSAGSDALNPWETIGSQGARNFILCRKPSNEKMEDDGRSANSITGKGSG  120

Query  681  SWKSWLTKSFFHKM  722
            +WK+W+ KS   K+
Sbjct  121  NWKAWINKSLNLKI  134



>ref|XP_006448227.1| hypothetical protein CICLE_v10017117mg [Citrus clementina]
 gb|ESR61467.1| hypothetical protein CICLE_v10017117mg [Citrus clementina]
Length=139

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+LISI V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LGSD + F LY   +G
Sbjct  16   RILISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVLGSDLNDFVLYCSNAG  75

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTE-GRPQVVTGLK--GTRSWKSWLTKSFFHK  719
              ALS   +IG  G RNF+LCKK +     E GR       +  G+ SWK+W+ KS   K
Sbjct  76   SGALSPWDTIGRHGMRNFLLCKKQQTEKTAENGRLDNAIARRGSGSGSWKAWINKSLMFK  135

Query  720  M  722
            +
Sbjct  136  I  136



>ref|XP_002311509.2| hypothetical protein POPTR_0008s13080g [Populus trichocarpa]
 gb|EEE88876.2| hypothetical protein POPTR_0008s13080g [Populus trichocarpa]
Length=146

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 83/129 (64%), Gaps = 2/129 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ +    KR L+S+ V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LGSD + 
Sbjct  7    KKNQVAKGKRFLLSVTVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPILGSDLND  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQ-PLMTEGRPQVVTGLK-GTRSWKSW  695
            F LY   +  +A+S   +IG+ G RNFMLCKK +      +GR       K G+ SWK+W
Sbjct  67   FLLYCRNAASDAISPWETIGSLGARNFMLCKKPQHLKAADDGRSTAAFAQKGGSGSWKAW  126

Query  696  LTKSFFHKM  722
            + KS   K+
Sbjct  127  INKSLNLKI  135



>ref|XP_010926482.1| PREDICTED: uncharacterized protein LOC105048744 [Elaeis guineensis]
Length=147

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = +3

Query  276  VEPRIYMEVKMKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvv  455
            V P + +++K  + L  +     R  + N  R LI++ V GSAGPIRF+VNE + V  V+
Sbjct  4    VAPSLQIKLKKNRQLLPRGGGGNRGGASN--RFLITVTVLGSAGPIRFLVNEGEVVTTVI  61

Query  456  dMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLM  635
              ALK YAR+GRLP+LGSD ++F LY   SG +ALS   SI + G+RNF+LCKK  + ++
Sbjct  62   STALKSYAREGRLPVLGSDFNNFLLY---SGSDALSPWESIDSRGKRNFVLCKK--EGVV  116

Query  636  TEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
             E   Q++ G KG+ SW++WL KS   ++
Sbjct  117  DEPASQML-GRKGSGSWRTWLNKSLSFRI  144



>ref|XP_007045195.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY01027.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=163

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 90/138 (65%), Gaps = 8/138 (6%)
 Frame = +3

Query  300  VKMKKSLSEKMT-----MMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvd  458
            V+++K   EK+T     +  ++K+   K  RLLISI V GSAGPIRFVVNE++ V  V+D
Sbjct  2    VRVEKKAEEKITWGKFVLFSKKKNQGAKGNRLLISITVLGSAGPIRFVVNEEELVAAVID  61

Query  459  MALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLM-  635
             ALK YAR+GRLP+LGSD + F LY   +G +ALS   +IG+ G RNFMLCKK +   M 
Sbjct  62   TALKSYAREGRLPVLGSDLNDFHLYCPCAGSDALSPWETIGSQGARNFMLCKKPKTEKME  121

Query  636  TEGRPQVVTGLKGTRSWK  689
             +GR       KG+ +WK
Sbjct  122  DDGRSTGAITRKGSGNWK  139



>dbj|BAB33412.1| putative senescence-associated protein [Pisum sativum]
Length=221

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 77/118 (65%), Gaps = 12/118 (10%)
 Frame = +3

Query  318  LSEKMTMMQRQKS--GNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGR  491
            L EKM M + +K+   N KRLLISINVFGSAGPIRFVV E++ V  V+D ALK YAR+GR
Sbjct  34   LIEKMLMNKHKKNQNANAKRLLISINVFGSAGPIRFVVKEEELVAAVIDTALKSYAREGR  93

Query  492  LPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTG  665
            LP+LG D   F LY    G +ALS   +IG+ G RNFMLCKK          PQ  TG
Sbjct  94   LPVLGGDIRTFALYCPLVGSDALSPWDTIGSVGARNFMLCKK----------PQATTG  141



>ref|XP_007153400.1| hypothetical protein PHAVU_003G031800g [Phaseolus vulgaris]
 gb|ESW25394.1| hypothetical protein PHAVU_003G031800g [Phaseolus vulgaris]
Length=138

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 87/135 (64%), Gaps = 4/135 (3%)
 Frame = +3

Query  330  MTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            M +++++K+ N +R LISINV GSAGPIRF+VNE+D V  V++ ALK YAR+GRLPLLG+
Sbjct  1    MLLIKQKKNQNVRRFLISINVLGSAGPIRFLVNEEDHVAAVIETALKSYAREGRLPLLGT  60

Query  510  DPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKK---NRQPLMTEGR-PQVVTGLKGT  677
            D   F LY    G +AL    +IG+ G RNF LC+K     +  + +G  P      +G+
Sbjct  61   DNAGFSLYCPHLGPDALRPWDTIGSHGARNFTLCRKAANADEAAVDDGSGPTAALPRRGS  120

Query  678  RSWKSWLTKSFFHKM  722
             +W+SW  KS   K+
Sbjct  121  GTWRSWFNKSLNLKI  135



>gb|KGN57466.1| hypothetical protein Csa_3G190360 [Cucumis sativus]
Length=131

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 87/140 (62%), Gaps = 11/140 (8%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQ  485
            MK+SLS      +R  +   KR+LI+INV GS+GP+RFVV E+D V  V+ +ALK YARQ
Sbjct  1    MKRSLSNN-NKHRRDDAKEIKRVLITINVMGSSGPLRFVVKEEDLVCEVIHIALKSYARQ  59

Query  486  GRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTG  665
             RLPLLG+DP +F LY   S   AL+ + +IG+   RNF+LCKK       EG       
Sbjct  60   ARLPLLGTDPTNFLLY---SSNIALNPNEAIGSKQARNFVLCKK-------EGTTPKRMT  109

Query  666  LKGTRSWKSWLTKSFFHKMI  725
            +K +  WK+W+ KS   K++
Sbjct  110  IKESHGWKAWINKSLNFKIL  129



>emb|CDY01710.1| BnaC04g30420D [Brassica napus]
Length=142

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 81/122 (66%), Gaps = 3/122 (2%)
 Frame = +3

Query  363  KKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVT  542
            KK+ L+S+NV GS GPIRF+VNEDD V  V++ ALK YARQGR+P+LG D ++F  Y  +
Sbjct  5    KKKFLVSVNVLGSVGPIRFLVNEDDNVSSVINTALKTYARQGRIPVLGLDVNNFIFYSNS  64

Query  543  SGFEALSASSSIGNCGERNFMLCKKNRQPL-MTEGRPQVVTGLKGTRSWKSWLTKSFFHK  719
            +GF  L+    IG+  E NF+LCK+ R+PL   EGR +  +  +  + WK+ L +S   +
Sbjct  65   AGFNTLNPQEKIGSMDETNFLLCKREREPLEKVEGREE--SKAREGKGWKNRLRRSLLGE  122

Query  720  MI  725
             +
Sbjct  123  FL  124



>ref|XP_006390840.1| hypothetical protein EUTSA_v10019542mg [Eutrema salsugineum]
 dbj|BAJ34604.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ28126.1| hypothetical protein EUTSA_v10019542mg [Eutrema salsugineum]
Length=141

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R+LIS+ V GSAGPIRFV  E+D V  V+D ALK YAR+GRLPLLGSD + 
Sbjct  8    KKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKCYAREGRLPLLGSDFND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKK--NRQPLMTEGRPQ--VVTGLKGTRSWK  689
            F LY    G EALS  ++IG+ G RNFMLC+K   ++   T GR    +  G +   S K
Sbjct  68   FLLYCPMVGPEALSTWNAIGSLGARNFMLCRKPEEKKKEATNGRSSSTINGGARKGGSLK  127

Query  690  SWLTKSFFHKM  722
            +W+ KSF  K+
Sbjct  128  AWINKSFSLKV  138



>ref|XP_011002783.1| PREDICTED: uncharacterized protein LOC105109699 [Populus euphratica]
Length=148

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 87/138 (63%), Gaps = 8/138 (6%)
 Frame = +3

Query  303  KMKKSLSEKMTMMQRQ-----KSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMAL  467
            KMK+++SEKM M+++Q         K R L+S+N  GSAGPIRFVVN DD V GV+D AL
Sbjct  3    KMKRNVSEKM-MLKKQIKNKKGDDKKNRFLVSVNFLGSAGPIRFVVNGDDLVSGVIDTAL  61

Query  468  KQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR  647
            K YAR GRLP+LG D + F LY      +AL+    IG+   RNF+LCKK  QP MTE R
Sbjct  62   KTYARGGRLPVLGFDVNKFLLYCANPASDALNPREPIGSQEGRNFLLCKKQLQPQMTELR  121

Query  648  PQVVTGLKGTRSWKSWLT  701
              +V   K    WK+ +T
Sbjct  122  SDIVA--KKPSGWKALMT  137



>gb|AFK44881.1| unknown [Lotus japonicus]
Length=138

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 86/140 (61%), Gaps = 17/140 (12%)
 Frame = +3

Query  336  MMQRQK---SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLG  506
            +M +QK   + N  RLLISINV GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LG
Sbjct  2    LMNKQKKNLNANAMRLLISINVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVLG  61

Query  507  SDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVV-----TGL-  668
            +D   F LY    G +ALS    IG+ G RNFMLCKK       +G P V      T L 
Sbjct  62   TDTTGFALYCPHVGSDALSPWDRIGSHGARNFMLCKK------PQGSPGVAEFAGTTPLP  115

Query  669  --KGTRSWKSWLTKSFFHKM  722
              + + SWK+W  KS   K+
Sbjct  116  RRRSSGSWKAWFNKSLSLKI  135



>ref|XP_008229194.1| PREDICTED: uncharacterized protein LOC103328575 isoform X2 [Prunus 
mume]
Length=145

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 89/147 (61%), Gaps = 17/147 (12%)
 Frame = +3

Query  309  KKSLSEKMTMMQRQKSGN--------KKRLLISINVFGSAGPIRFvvneddkvvgvvdMA  464
            ++++ E+ T+ Q+ K  N        K R LI++NV GSAGPIRFVVNEDD V GV+D A
Sbjct  4    RRNVLERTTLQQKHKKINNNEVHSVKKNRFLITVNVVGSAGPIRFVVNEDDLVAGVIDTA  63

Query  465  LKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEG  644
            LK YAR+GRLPLLGSD   F LY   +G        S G+ G RNF+L KK R       
Sbjct  64   LKSYAREGRLPLLGSDVKDFLLYCANAG--------SDGSHGGRNFVLSKKQRAVQNVAE  115

Query  645  RPQVVTGLKGT-RSWKSWLTKSFFHKM  722
            R   +T  KG+  SWK+WL KSF  K+
Sbjct  116  RKPEMTAPKGSVSSWKAWLNKSFPFKI  142



>emb|CDP00803.1| unnamed protein product [Coffea canephora]
Length=138

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 86/135 (64%), Gaps = 4/135 (3%)
 Frame = +3

Query  330  MTMMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            M + +++  G  K  RLLISI V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+L
Sbjct  1    MLLQKKKTQGAAKGNRLLISITVMGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  60

Query  504  GSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGL--KGT  677
            G+D ++F LY   +  EALS   +IG+ G RNFMLCKK     M+    Q    +  K +
Sbjct  61   GTDLNNFMLYCPCATTEALSPWETIGSLGFRNFMLCKKPETQKMSGDGNQTSPSMSRKSS  120

Query  678  RSWKSWLTKSFFHKM  722
             +WK+W  KS   K+
Sbjct  121  GNWKAWFNKSLNLKV  135



>ref|XP_009600493.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
tomentosiformis]
 ref|XP_009757100.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
sylvestris]
Length=136

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 77/128 (60%), Gaps = 0/128 (0%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ + G   RLLISI V GSAGPIRFVV E+D V  V++ ALK YAR+GRLP+LGSD ++
Sbjct  7    KKIQQGKGNRLLISITVLGSAGPIRFVVKEEDLVADVINTALKNYAREGRLPVLGSDLNN  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLT  701
            F LY      E LS   +IG+ G RNF+L KK +         Q     K   SWK+W  
Sbjct  67   FVLYCPAVTTEVLSPWETIGSVGVRNFVLFKKPQAENAILDGKQAAMARKRAASWKAWFN  126

Query  702  KSFFHKMI  725
            KS   K++
Sbjct  127  KSLTRKIV  134



>gb|EPS67816.1| hypothetical protein M569_06958, partial [Genlisea aurea]
Length=134

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTS  545
            +R+LIS+   GSAGPIRF+VNED+ V  V+  ALK YAR+GRLP+LGSD ++F LY   S
Sbjct  15   RRILISVGFLGSAGPIRFIVNEDEPVASVITTALKLYAREGRLPILGSDMNNFMLYCPIS  74

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSF  710
            G+EAL    +IG+ G RNF+L KK +    +    +  +  KG RSWKSW  KSF
Sbjct  75   GYEALRPLETIGSTGVRNFILFKKPQAAEKSSINGE-KSSHKGGRSWKSWFNKSF  128



>ref|XP_010554411.1| PREDICTED: uncharacterized protein At4g22758-like isoform X1 
[Tarenaya hassleriana]
Length=135

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 77/123 (63%), Gaps = 4/123 (3%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            +R ++    R L+SINV GSAGPIRFVV ED+ V  V+D AL+ YAR+GRLP+LGSD + 
Sbjct  8    KRNQNPKGNRFLVSINVLGSAGPIRFVVKEDETVANVMDCALRCYAREGRLPVLGSDIND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLT  701
            F LY   S  E L     IG+ G RNF+LCKK  +     G P   +  K + SW++WL 
Sbjct  68   FVLYSPYSAAEELKPWERIGSRGWRNFVLCKKKPE----SGTPSASSSRKASWSWRAWLN  123

Query  702  KSF  710
            KS 
Sbjct  124  KSI  126



>ref|XP_009127827.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY03721.1| BnaA02g15160D [Brassica napus]
Length=131

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 9/130 (7%)
 Frame = +3

Query  330  MTMMQRQKSGNK-KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLG  506
            M +  +QK   K  R+LIS+ V GSAGPIRF+  E+D V  V+D ALK YAR+GRLPLLG
Sbjct  1    MLLYNKQKKNAKGNRILISVTVLGSAGPIRFLAYEEDLVASVIDTALKCYAREGRLPLLG  60

Query  507  SDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR--  680
            SD + F LY    G E++SA   IG+ G RNF LC+K       E + +VV    G R  
Sbjct  61   SDFNDFILYCPMVGPESISAWKGIGSLGARNFTLCRK------PEEKNKVVKEGDGARKG  114

Query  681  SWKSWLTKSF  710
            S+K+W+ KSF
Sbjct  115  SFKAWINKSF  124



>ref|XP_010264360.1| PREDICTED: uncharacterized protein At4g22758-like [Nelumbo nucifera]
Length=137

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 88/134 (66%), Gaps = 8/134 (6%)
 Frame = +3

Query  336  MMQRQK----SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            ++ +QK    S    RLLI++NV GSAGP+RF+VNED+ V  V+D  LK YAR+GRLP+L
Sbjct  4    LLHKQKKNPHSSKGNRLLITVNVLGSAGPLRFLVNEDELVAAVIDTTLKSYAREGRLPVL  63

Query  504  GSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKK-NRQPLMTEGRPQVVTGLKGTR  680
            GSD ++F LY   +G +ALS   +IG+ G RNF+L KK  RQ   T+G    +   KG+ 
Sbjct  64   GSDLNNFRLYSANAGTDALSHWETIGSRGGRNFVLFKKPQRQLEATKGN---IIARKGSS  120

Query  681  SWKSWLTKSFFHKM  722
             WK+WL +S   K+
Sbjct  121  RWKAWLHRSLNLKI  134



>ref|XP_002305866.2| hypothetical protein POPTR_0004s08870g [Populus trichocarpa]
 gb|EEE86377.2| hypothetical protein POPTR_0004s08870g [Populus trichocarpa]
Length=148

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 87/138 (63%), Gaps = 8/138 (6%)
 Frame = +3

Query  303  KMKKSLSEKMTMMQRQ-----KSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMAL  467
            KMK+++SEKM M+++Q         K R L+S+N  GSAGPIRFVVN DD V GV+D AL
Sbjct  3    KMKRNVSEKM-MLKKQIKNKKGDDKKNRFLVSVNFLGSAGPIRFVVNGDDLVSGVIDTAL  61

Query  468  KQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR  647
            K YAR GRLP+LG D + F LY      +AL+    IG+   RNF+LCKK  QP MTE R
Sbjct  62   KTYARGGRLPVLGFDVNKFLLYCANPPSDALNPREPIGSQEGRNFVLCKKQLQPQMTEMR  121

Query  648  PQVVTGLKGTRSWKSWLT  701
              +V   K    WK+ +T
Sbjct  122  SDIVA--KKPSGWKALMT  137



>emb|CDY09482.1| BnaC02g20240D [Brassica napus]
Length=135

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = +3

Query  330  MTMMQRQKSGNK-KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLG  506
            M +  +QK   K  R+LIS+ V GSAGPIRF+  E+D V  V+D ALK YAR+GRLPLLG
Sbjct  1    MLLYNKQKKNAKGNRILISVTVLGSAGPIRFLAYEEDLVASVIDTALKCYAREGRLPLLG  60

Query  507  SDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR--  680
            SD + F LY    G E++SA   IG+ G RNF LC+K       E + +VV    G R  
Sbjct  61   SDFNDFILYCPMVGPESMSAWKGIGSLGARNFTLCRK------PEEKNKVVKEGDGARKG  114

Query  681  -SWKSWLTKSF  710
             S+K+W+ KSF
Sbjct  115  GSFKAWINKSF  125



>ref|XP_004498287.1| PREDICTED: uncharacterized protein LOC101497295 [Cicer arietinum]
Length=140

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 83/136 (61%), Gaps = 7/136 (5%)
 Frame = +3

Query  336  MMQRQK-----SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPL  500
            +M +QK     + NK+RLLISINV GSAGPIRFVVNE++ V  V++  LK YAR+GRLP+
Sbjct  2    LMNKQKKTQITNNNKRRLLISINVMGSAGPIRFVVNEEELVAAVIETTLKSYAREGRLPV  61

Query  501  LGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGL--KG  674
            LGSD + F LY    G   LS    IG+ G RNF+LCK  +            T L  +G
Sbjct  62   LGSDNNAFCLYCPLLGSAVLSPWDKIGSHGARNFVLCKNPQATNEAADGGSGTTSLSRRG  121

Query  675  TRSWKSWLTKSFFHKM  722
            + SW++W  KS   K+
Sbjct  122  SGSWRAWFNKSLNLKV  137



>gb|AGU36354.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36362.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36363.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36364.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36368.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36369.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36370.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36371.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36372.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36373.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36374.1| hypothetical protein, partial [Helianthus annuus]
Length=109

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            RLLISI V GSAGPIRFVVN ++ V  V+D ALK YAR+GRLP+LGS+ + F LY   +G
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPL--MTEGRPQVVTGL--KGTRSW  686
             EALS   +IG+ G RNFMLCKK +  +  + +G+P V  G+  K + SW
Sbjct  61   TEALSPVEAIGSFGVRNFMLCKKPQAVVEEVGDGKP-VTVGITRKNSGSW  109



>ref|XP_003589658.1| hypothetical protein MTR_1g031680 [Medicago truncatula]
 ref|XP_003609749.1| hypothetical protein MTR_4g121810 [Medicago truncatula]
 gb|ABD32641.1| Senescence-associated protein, putative [Medicago truncatula]
 gb|AES59909.1| senescence-associated protein, putative [Medicago truncatula]
 gb|AFK43979.1| unknown [Medicago truncatula]
Length=141

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 84/134 (63%), Gaps = 11/134 (8%)
 Frame = +3

Query  330  MTMMQRQKSGN----KKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLP  497
            M + +++K+ N    K+RLLISINV GSAGPIRFVVNE++ V  V+D  LK YAR+GRLP
Sbjct  1    MLLSKQKKNQNANNAKRRLLISINVLGSAGPIRFVVNEEELVEAVIDTTLKSYAREGRLP  60

Query  498  LLGSDPHHFFLY-PVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGL--  668
            +LG+D   FFLY P      ALS    IG+ G RNF+LCKK  Q    E   +  +G   
Sbjct  61   VLGNDHSAFFLYCPHLGSDAALSPWDKIGSHGARNFVLCKK-PQAATNEAAAEDGSGTSS  119

Query  669  ---KGTRSWKSWLT  701
               +G+ SWKSW  
Sbjct  120  LPRRGSGSWKSWFN  133



>ref|XP_010435612.1| PREDICTED: uncharacterized protein LOC104719388 [Camelina sativa]
Length=144

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 84/145 (58%), Gaps = 11/145 (8%)
 Frame = +3

Query  306  MKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQ  485
            MKK ++    +    K  N K LL+S+NV GS GPIRF+ NE+D+V  V++  LK YARQ
Sbjct  1    MKKEMNRIANVKGVMKGKNNKLLLVSVNVLGSVGPIRFLANEEDEVSTVINTTLKAYARQ  60

Query  486  GRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTG  665
            GR+P+LG D  +F  Y + +GF  L     IG+    NF++CKK  +PL        V G
Sbjct  61   GRIPVLGFDVDNFIFYSINAGFNTLHPEEKIGSMDVTNFLMCKKESRPLAK------VEG  114

Query  666  LKGTRS-----WKSWLTKSFFHKMI  725
            ++ +++     WK+ L +S   K++
Sbjct  115  IRESKARIGHGWKTRLLRSILGKIL  139



>gb|KFK33374.1| hypothetical protein AALP_AA5G005100 [Arabis alpina]
Length=170

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 79/145 (54%), Gaps = 1/145 (1%)
 Frame = +3

Query  279  EPRIYMEVKMKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvd  458
            E R  +    K     +  +   +KS  + R L+SI   GSAGPIRF+V ED+ V  V+D
Sbjct  19   ENRFLVTTHKKSKTENRFLVTTHKKSKTENRFLVSITFLGSAGPIRFLVKEDETVSNVID  78

Query  459  MALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMT  638
             ALK YAR+GRLPLLGSD   F LY   S  EA +    IG+ G RNF+L KK+      
Sbjct  79   YALKSYAREGRLPLLGSDSSFFLLYCPYSAPEAFNPWGKIGSTGSRNFVLSKKSEADQNI  138

Query  639  EGRPQVVTGLKGTRS-WKSWLTKSF  710
             G     T +K   + WK+WL KS 
Sbjct  139  GGSSVETTTIKKISAKWKAWLNKSL  163



>ref|XP_002875078.1| hypothetical protein ARALYDRAFT_322499 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51337.1| hypothetical protein ARALYDRAFT_322499 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + QKS    R L+SI V GSAGPIRFVV ED+ V  V+D ALK YAR+GRLPLLGSD   
Sbjct  9    KNQKSKTTNRFLVSITVLGSAGPIRFVVKEDETVANVIDYALKCYAREGRLPLLGSDSSF  68

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLT  701
            F LY   S  EA      IG+ G RNF+L KK  +    E      T  K +  WK+WL 
Sbjct  69   FLLYCPYSASEAFDPWGKIGSTGSRNFVLSKK-LETQKIEDSVMTTTIRKTSGRWKAWLN  127

Query  702  KSF  710
            KS 
Sbjct  128  KSL  130



>gb|AGU36357.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            RLLISI V GSAGPIRFVVN ++ V  V+D ALK YAR+GRLP+LGS+ + F LY   +G
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  549  FEALSASSSIGNCGERNFMLCKKNRQ-PLMTEGRPQVVTGL--KGTRSW  686
             EALS   +IG+ G RNFMLCKK +    + +G+P V  G+  K + SW
Sbjct  61   TEALSPVEAIGSFGVRNFMLCKKPQAVEEVGDGKP-VTAGITRKNSGSW  108



>gb|AGU36353.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36355.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36356.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36358.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36360.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36361.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36365.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36366.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            RLLISI V GSAGPIRFVVN ++ V  V+D ALK YAR+GRLP+LGS+ + F LY   +G
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  549  FEALSASSSIGNCGERNFMLCKKNRQ-PLMTEGRPQVVTGL--KGTRSW  686
             EALS   +IG+ G RNFMLCKK +    + +G+P V  G+  K + SW
Sbjct  61   TEALSPVEAIGSFGVRNFMLCKKPQAVEEVGDGKP-VTVGITRKNSGSW  108



>gb|AGU36351.1| hypothetical protein, partial [Helianthus argophyllus]
 gb|AGU36352.1| hypothetical protein, partial [Helianthus argophyllus]
Length=109

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            RLLISI V GSAGPIRFVVN ++ V  V+D ALK YAR+GRLP+LGS+ + F LY   +G
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPL--MTEGRPQVV  659
             EALS   +IG+ G RNFMLCKK +  +  + +G+P  V
Sbjct  61   TEALSPVEAIGSFGVRNFMLCKKPQAVVEEVGDGKPVTV  99



>ref|XP_009105746.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY11545.1| BnaC06g31940D [Brassica napus]
 emb|CDX96277.1| BnaA07g28880D [Brassica napus]
Length=131

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = +3

Query  330  MTMMQRQKSGNK-KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLG  506
            M +  +QK   K  R+LIS+ V GSAGPIRFV  EDD V  V+D ALK YAR+GRLPLLG
Sbjct  1    MLLYNKQKKNAKGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKCYAREGRLPLLG  60

Query  507  SDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSW  686
            SD + F LY    G EALSA ++IG+ G RNF LCKK  +  + +       G +   S+
Sbjct  61   SDFNDFLLYCPMVGPEALSAWNAIGSLGARNFTLCKKPEEKKVVKEG----NGARKGGSF  116

Query  687  KSWLTKSFFHKM  722
            K+W+ KSF  K+
Sbjct  117  KAWINKSFSLKV  128



>gb|AAL16139.1|AF428307_1 At1g70780/F5A18_4 [Arabidopsis thaliana]
Length=149

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = +3

Query  342  QRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDP  515
            +++K+ N K  R+LIS+ V GSAGPIRFV  EDD V  V+D ALK YAR+GRLPLLGSD 
Sbjct  6    KQKKNQNAKGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKGYAREGRLPLLGSDF  65

Query  516  HHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR  680
            + F LY    G EALS   +IG+ G RNFMLC+K  +  + E   +  + + G R
Sbjct  66   NDFLLYCPMVGPEALSTWDAIGSLGARNFMLCRKPEEKKVEESNGRSDSTINGAR  120



>gb|EYU44564.1| hypothetical protein MIMGU_mgv1a024095mg [Erythranthe guttata]
Length=138

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            +R  S   +R LISINV GSAGPIRFVV+++DK   V++  LK+Y R+GRLP+LGS    
Sbjct  7    KRPNSSGGERFLISINVIGSAGPIRFVVSKNDKADSVIETVLKKYGREGRLPILGSVVTS  66

Query  522  FFLYPV-TSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRS-WKSW  695
            FFLYP   +GF AL  + +IG+ G RNF+LCK N     +       +   G +S W++W
Sbjct  67   FFLYPANAAGFYALKGTEAIGSRGLRNFVLCKINNSNNNSNSNGSPSSVSVGKQSGWRAW  126

Query  696  LTKSFFHKMI  725
            L KS   K++
Sbjct  127  LQKSLSIKIL  136



>ref|XP_010528538.1| PREDICTED: uncharacterized protein LOC104805613 [Tarenaya hassleriana]
Length=147

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R L+S+NV GSAGP+RF+V+E+D+V  V+D AL+ YAR+ R P+LG    +F LY  +SG
Sbjct  25   RFLVSVNVLGSAGPLRFLVDEEDEVSVVIDTALRAYAREDRFPVLGLHARNFLLYSASSG  84

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSF-FHKMI  725
            F AL     IG+   R+F+LCKK +     EGR +  T  +    WK+WL K F  H +I
Sbjct  85   FNALIPQEKIGSVEGRDFLLCKKEQLSSENEGRGE--TRARRGHGWKAWLLKPFKLHDLI  142



>gb|AGU36367.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            RLLISI V GSAGPIRFVVN ++ V  V+D ALK YAR+GRLP+LGS+ + F LY   +G
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVT-GL--KGTRSW  686
             EALS   +IG+ G RNFMLCKK  Q +   G  ++VT G+  K + SW
Sbjct  61   TEALSPVEAIGSFGVRNFMLCKK-PQAVEEVGDGKLVTVGITRKNSGSW  108



>ref|XP_009605387.1| PREDICTED: uncharacterized protein LOC104099956 [Nicotiana tomentosiformis]
Length=119

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 77/129 (60%), Gaps = 19/129 (15%)
 Frame = +3

Query  330  MTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            M++ + +K  N  R LI+++V   AG I              D ALK+YAR+GRL + GS
Sbjct  1    MSLQKPKKKLNNTRFLITVDVI--AGFI--------------DTALKKYAREGRLLVPGS  44

Query  510  DPHHFFLYPVTSGFEA--LSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRS  683
            +   FFLYPV +G +   +  S  IG+ G RNF+LCKK +QP MTEG  + ++  KG  S
Sbjct  45   NVDSFFLYPVNAGPDDTPMGPSDEIGSQGVRNFILCKKQKQPQMTEGSAEEISH-KGRSS  103

Query  684  WKSWLTKSF  710
            WKSWL KSF
Sbjct  104  WKSWLNKSF  112



>ref|XP_007047987.1| Uncharacterized protein TCM_001138 [Theobroma cacao]
 gb|EOX92144.1| Uncharacterized protein TCM_001138 [Theobroma cacao]
Length=228

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 92/146 (63%), Gaps = 8/146 (5%)
 Frame = +3

Query  285  RIYMEVKMKKSLSEKMTMMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvd  458
            R  + +  + S  E M + +++K+ + K  RLLISI   GSAGPIRF+VNE++ V  V+D
Sbjct  76   RCCVTIMTQASFLECMAVYRQKKNQDPKGNRLLISITFLGSAGPIRFIVNEEELVAAVID  135

Query  459  MALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLM-  635
             ALK YAR+GRLP+LGS+ + F LY  ++G +ALS   ++ + G RNF LCKK R   M 
Sbjct  136  TALKSYAREGRLPVLGSNLNDFLLYCPSAGSDALSPWETVISQGARNFKLCKKPRTEKMD  195

Query  636  TEGRPQ---VVTGLKGTRSWKSWLTK  704
             +GR     + T   G  +WK+W+ K
Sbjct  196  DDGRSSTQAITTNEDG--NWKAWINK  219



>gb|EYU44567.1| hypothetical protein MIMGU_mgv1a024765mg [Erythranthe guttata]
Length=138

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 81/130 (62%), Gaps = 2/130 (2%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            +R  S   +R LIS+NV GSAGPIRFVV+ ++K   V++  LK+Y R+GRLP+LGS    
Sbjct  7    KRPNSSGGERFLISVNVIGSAGPIRFVVSRNEKADSVIETVLKKYGREGRLPILGSVVTS  66

Query  522  FFLYPV-TSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRS-WKSW  695
            FFLYP   +GF AL  + +IG+ G RNF+LCK N     +       +   G +S W++W
Sbjct  67   FFLYPANAAGFYALEGTEAIGSRGLRNFVLCKINNSNSNSNSNESSSSMTVGKQSGWRAW  126

Query  696  LTKSFFHKMI  725
            L KS   K++
Sbjct  127  LQKSLSIKIL  136



>ref|XP_010440883.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=141

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 82/140 (59%), Gaps = 11/140 (8%)
 Frame = +3

Query  309  KKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQG  488
            KK ++    + +  K  N K LL+S+NV GS GPIRF+ NE+D+V  V++  LK YARQG
Sbjct  7    KKEMNRIANVKRVMKGKNNKLLLVSVNVLGSVGPIRFLANEEDEVSTVINTTLKAYARQG  66

Query  489  RLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGL  668
            R+P+LG D  +F  Y + +GF  L     IG+    NF++CKK  +PL      + V G+
Sbjct  67   RIPVLGFDVDNFIFYSINAGFNTLHPEEKIGSMDVTNFLMCKKEPRPL------EKVEGI  120

Query  669  KGTRS-----WKSWLTKSFF  713
            + +++     WK+ L +S  
Sbjct  121  RKSKARVGHGWKTRLLRSIL  140



>gb|KFK41506.1| hypothetical protein AALP_AA2G138600 [Arabis alpina]
Length=143

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 83/133 (62%), Gaps = 6/133 (5%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ ++    R+LIS+ V GSAGPIR + NE+D V  V+D+ALK YAR+GRLP+LGSD + 
Sbjct  8    KKNQTAKGNRILISVTVLGSAGPIRILANEEDLVASVIDVALKNYAREGRLPILGSDFND  67

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQ------VVTGLKGTRS  683
            F LY    G EALS+ S+IG  G RNF LC+K  +  + EG  +         G +   S
Sbjct  68   FLLYCPMVGPEALSSWSAIGLLGARNFTLCRKPEEKKVEEGNGRSNSNVNGGGGGRKGGS  127

Query  684  WKSWLTKSFFHKM  722
             K+W+ KSF  K+
Sbjct  128  LKAWINKSFSLKV  140



>gb|KHN46081.1| Hypothetical protein glysoja_030082 [Glycine soja]
Length=133

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +3

Query  330  MTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            +TM +++K+ N KRLLISINV GSAGPIRFVVNE++ V  V+D A   YAR+GRLP+LG+
Sbjct  2    LTMSKQKKNQNAKRLLISINVLGSAGPIRFVVNEEELVAAVIDTA--SYAREGRLPVLGN  59

Query  510  DPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWK  689
            +   F LY    G +ALS    IG+ G RNF+L KK       +G   +    +G+ SWK
Sbjct  60   NTTGFVLYCPHLGSDALSPWERIGSHGVRNFVLFKKPEGVADVDGSTALSRSSRGSGSWK  119

Query  690  SWLTKSFFHKM  722
            +W  KS   K+
Sbjct  120  AWFNKSLNLKI  130



>ref|XP_007045196.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY01028.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=145

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 79/125 (63%), Gaps = 9/125 (7%)
 Frame = +3

Query  342  QRQKSGNK-KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPH  518
            Q++  G K  RLLISI V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LGSD +
Sbjct  1    QKKNQGAKGNRLLISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVLGSDLN  60

Query  519  HFFLYPVTSG-------FEALSASSSIGNCGERNFMLCKKNRQPLM-TEGRPQVVTGLKG  674
             F LY   +G         ALS   +IG+ G RNFMLCKK +   M  +GR       KG
Sbjct  61   DFHLYCPCAGSDGRFIQIHALSPWETIGSQGARNFMLCKKPKTEKMEDDGRSTGAITRKG  120

Query  675  TRSWK  689
            + +WK
Sbjct  121  SGNWK  125



>gb|AGU36359.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            RLLISI V GSAGPIRFVVNE++ V  V+D ALK YAR+GRLP+LGS+ + F LY   +G
Sbjct  1    RLLISITVIGSAGPIRFVVNEEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  549  FEALSASSSIGNCGERNFMLCKKNRQ-PLMTEGRPQVVTGL--KGTRSW  686
             EALS   +IG+ G  NFMLCKK +    + +G+P V  G+  K + SW
Sbjct  61   TEALSPVEAIGSFGVGNFMLCKKPQAVEEVGDGKP-VTVGITRKNSGSW  108



>gb|ACJ84118.1| unknown [Medicago truncatula]
Length=141

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 83/134 (62%), Gaps = 11/134 (8%)
 Frame = +3

Query  330  MTMMQRQKSGN----KKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLP  497
            M + +++K+ N    K+RLLISINV GSAGPIRFVVNE++ V  V+D  LK YAR+GRLP
Sbjct  1    MLLSKQKKNQNANNAKRRLLISINVLGSAGPIRFVVNEEELVEAVIDTTLKSYAREGRLP  60

Query  498  LLGSDPHHFFLY-PVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGL--  668
            +LG+D   FFLY P      ALS    IG+ G RNF+L KK  Q    E   +  +G   
Sbjct  61   VLGNDHSAFFLYCPHLGSDAALSPWDKIGSHGARNFVLYKK-PQAATNEAAAEDGSGTSS  119

Query  669  ---KGTRSWKSWLT  701
               +G+ SWKSW  
Sbjct  120  LPRRGSGSWKSWFN  133



>gb|ACJ83930.1| unknown [Medicago truncatula]
Length=139

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 80/134 (60%), Gaps = 8/134 (6%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + Q + + ++LLI+INV GSAGPIRFVV+E D VV V+D ALK YAR+GRLP+LG D   
Sbjct  7    KNQNAKDARKLLININVLGSAGPIRFVVSEGDLVVTVIDTALKSYAREGRLPILGKDVTS  66

Query  522  FFLYPVTSGFEALSASSSIGN-CGERNFMLCKK----NRQPLMTEGRPQVVTGLKGTRSW  686
            F LY    G +ALS   +IG+  G RNFMLCKK    NR   M      V    +   S 
Sbjct  67   FALYCQHVGSDALSPLDTIGSHGGARNFMLCKKPETTNR---MANADGAVALARRRNGSL  123

Query  687  KSWLTKSFFHKMIL  728
            K+W  KS     +L
Sbjct  124  KNWFNKSLSSVYVL  137



>gb|KCW64559.1| hypothetical protein EUGRSUZ_G02164 [Eucalyptus grandis]
Length=112

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 1/110 (1%)
 Frame = +3

Query  393  FGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASS  572
             GS GPIRFVV+ED+ V  V+D AL+ YA QGRLP+LGSDP  F LY   +  +ALS   
Sbjct  1    MGSPGPIRFVVSEDELVSSVIDTALRTYAHQGRLPILGSDPGDFLLYCANAESDALSPWE  60

Query  573  SIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            +IG+ G RNF+L KK +     EG P    G KG+  WK+W+ KS   K+
Sbjct  61   TIGSQGARNFLLWKKQKAEEADEGSPPSAIGRKGS-GWKAWINKSLNLKI  109



>ref|XP_006405838.1| hypothetical protein EUTSA_v10027994mg [Eutrema salsugineum]
 gb|ESQ47291.1| hypothetical protein EUTSA_v10027994mg [Eutrema salsugineum]
Length=121

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = +3

Query  363  KKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVT  542
            KK+LL+++ V GS GPIRF+ NEDDKV  V++ ALK YARQGR+P+LG D  +F  Y + 
Sbjct  5    KKKLLVNVKVLGSVGPIRFLANEDDKVSSVINTALKTYARQGRIPVLGFDVDNFIFYSIN  64

Query  543  SGFEALSASSSIGNCGERNFMLCKKNRQPL-MTEGRPQVVTGLKGTRSWKSWLTK  704
             GF  L+    IG+    NF+LCKK R+P+   +GR +  +  +    WKS L +
Sbjct  65   GGFNTLNPHEKIGSMDVTNFLLCKKERRPMEKVQGRRE--SKARAGHGWKSRLLR  117



>ref|XP_002870559.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=121

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +3

Query  357  GNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYP  536
            G  K+LL+S+NV GS GPIRF+ NEDD+V  V++  LK YARQGR+P+LG D  +F  Y 
Sbjct  3    GKNKKLLVSVNVLGSVGPIRFLANEDDEVSNVINTTLKAYARQGRIPVLGFDVDNFIFYS  62

Query  537  VTSGFEALSASSSIGNCGERNFMLCKKNRQP  629
            + +GF  L+    IG+  E NF+LCKK   P
Sbjct  63   INAGFNTLNPQEKIGSMDETNFLLCKKEPNP  93



>emb|CDY71620.1| BnaC05g50380D [Brassica napus]
Length=138

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 3/131 (2%)
 Frame = +3

Query  339  MQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPH  518
            +++++     R+LIS+   GS GPIRFV NE D V  V+D ALK YAR+GRLP+LGSD +
Sbjct  5    LKKREVVKGNRILISVTFLGSPGPIRFVANEGDLVAAVIDTALKCYAREGRLPILGSDFN  64

Query  519  HFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTE---GRPQVVTGLKGTRSWK  689
             F  Y    G EALS   +IG+ G RNFMLC+K  +    E   GR          RS++
Sbjct  65   DFLFYCPMVGPEALSPWEAIGSLGARNFMLCEKPGEKKKVEEENGRSSFPINGARKRSFR  124

Query  690  SWLTKSFFHKM  722
            +W+ KSF  K+
Sbjct  125  AWINKSFSLKV  135



>gb|AES99286.2| senescence-associated protein, putative [Medicago truncatula]
Length=166

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+LISIN+ GS+GP+  VVNEDD V  V++ +LK YARQGRLP+LGSD  +F +Y     
Sbjct  41   RILISINIVGSSGPLTMVVNEDDAVCDVIEKSLKSYARQGRLPILGSDVTNFDIYCSNDV  100

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKS  692
             +ALS S  IG+ G R F+LC+K   P  TE R +++   KG+ SWKS
Sbjct  101  SDALSPSEPIGSFGTRKFVLCEKPPSPTKTEARSKMM-ARKGSGSWKS  147



>ref|XP_003616328.1| hypothetical protein MTR_5g078750 [Medicago truncatula]
Length=180

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+LISIN+ GS+GP+  VVNEDD V  V++ +LK YARQGRLP+LGSD  +F +Y     
Sbjct  55   RILISINIVGSSGPLTMVVNEDDAVCDVIEKSLKSYARQGRLPILGSDVTNFDIYCSNDV  114

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKS  692
             +ALS S  IG+ G R F+LC+K   P  TE R +++   KG+ SWKS
Sbjct  115  SDALSPSEPIGSFGTRKFVLCEKPPSPTKTEARSKMM-ARKGSGSWKS  161



>gb|KFK22025.1| hypothetical protein AALP_AAs45940U000100 [Arabis alpina]
Length=139

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+LIS+   GS GPIRFV  E D V GV+D ALK YAR+GRLP+LGSD + F  Y    G
Sbjct  17   RILISVTFLGSPGPIRFVAYEGDLVAGVIDTALKCYAREGRLPILGSDFNDFLFYCPMIG  76

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR--SWKSWLTKSFFHKM  722
              ALS   +IG+ G RNFMLCKK  +  + E   +    + G R  S+K+W+ KSF  K+
Sbjct  77   PGALSPWEAIGSLGARNFMLCKKPVEKKVEENNGRSGFTINGARKGSFKAWINKSFSLKV  136



>ref|XP_006383328.1| hypothetical protein POPTR_0005s14530g [Populus trichocarpa]
 gb|ERP61125.1| hypothetical protein POPTR_0005s14530g [Populus trichocarpa]
Length=134

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 2/110 (2%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R LISI+  GSAGPIR VVN DD V G++  ALK YAR+GRLP+LG D  +F LY V + 
Sbjct  19   RFLISISFLGSAGPIRVVVNGDDLVSGIISTALKIYAREGRLPVLGFDASNFLLYCVNAA  78

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWL  698
             +AL+    IG+   RNF+LCKK  Q   TE R +++   K    WK+W+
Sbjct  79   SDALNPWEPIGSHEGRNFVLCKKQVQQETTEVRAEIIA--KKPSGWKAWI  126



>ref|XP_011021386.1| PREDICTED: uncharacterized protein At4g22758-like [Populus euphratica]
Length=143

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 85/139 (61%), Gaps = 8/139 (6%)
 Frame = +3

Query  303  KMKKSLSEKMTMMQRQKSGNKK-----RLLISINVFGSAGPIRFvvneddkvvgvvdMAL  467
            K K+++SEKM ++Q+Q    K      R LISI+  GSAGPIR VVN DD V G++  AL
Sbjct  3    KSKRNVSEKM-LLQKQNKNKKGDDKKNRFLISISFLGSAGPIRVVVNGDDLVSGIISTAL  61

Query  468  KQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR  647
            K YAR+GRLP+LG D  +F LY V +  +AL+    IG+   R+F+LCKK  Q   TE R
Sbjct  62   KIYAREGRLPVLGFDVSNFLLYCVNAASDALNPWEPIGSHEGRSFVLCKKQLQQETTEVR  121

Query  648  PQVVTGLKGTRSWKSWLTK  704
              +    K    WK+W+ +
Sbjct  122  AGITA--KKPSGWKAWMAQ  138



>ref|XP_002875080.1| hypothetical protein ARALYDRAFT_904355 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51339.1| hypothetical protein ARALYDRAFT_904355 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + QK    KR L+SINV GSAGPIRFVV ED+ V  V+D ALK YAR+GRLPLLGSD   
Sbjct  9    RNQKLKTTKRFLVSINVLGSAGPIRFVVKEDETVANVIDYALKCYAREGRLPLLGSDSSF  68

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLT  701
            F LY      +A     +IG+ G RNF+L KK    L T+     V         K+WL 
Sbjct  69   FLLYCPYYASQAFDPWGNIGSTGSRNFVLSKK----LETQNLEDSVMTTTAIWRLKAWLN  124

Query  702  KSF  710
            KS 
Sbjct  125  KSL  127



>gb|AFK49206.1| unknown [Medicago truncatula]
Length=138

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 71/105 (68%), Gaps = 5/105 (5%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            + Q + + ++LLI+INV GSAGPIRFVV+E D V  V+D ALK YAR+GRLP+LG D   
Sbjct  7    KNQNAKDARKLLININVLGSAGPIRFVVSEGDLVATVIDTALKSYAREGRLPILGKDVTS  66

Query  522  FFLYPVTSGFEALSASSSIGNC-GERNFMLCKK----NRQPLMTE  641
            F LY    G +ALS   +IG+  G RNFMLCKK    NR P+  E
Sbjct  67   FALYCQHVGSDALSPLDTIGSHGGARNFMLCKKPETTNRWPMPME  111



>ref|XP_006285693.1| hypothetical protein CARUB_v10007163mg [Capsella rubella]
 gb|EOA18591.1| hypothetical protein CARUB_v10007163mg [Capsella rubella]
Length=123

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 73/127 (57%), Gaps = 12/127 (9%)
 Frame = +3

Query  351  KSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFL  530
            K  N K+LL+S+NV GS GPIRF+ NEDD+V  +++  LK YARQGR+P+LG D  +F  
Sbjct  2    KGKNNKKLLVSVNVLGSVGPIRFLANEDDEVSRIINTTLKAYARQGRVPVLGFDVDNFIF  61

Query  531  YPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKG------TRSWKS  692
            Y +  GF  L     I +    NF+LCKK  +PL      + V G++G         WK+
Sbjct  62   YSINPGFNTLHPQEKISSMDITNFLLCKKEPRPL------EEVEGVRGGSKARIVHGWKN  115

Query  693  WLTKSFF  713
             L +S  
Sbjct  116  RLLRSLL  122



>ref|XP_009114230.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY04091.1| BnaA09g18690D [Brassica napus]
Length=134

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 76/128 (59%), Gaps = 5/128 (4%)
 Frame = +3

Query  336  MMQRQKSGNKKRL---LISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLG  506
            +  +QK  +K ++   L+SI+  GSAGPIRFVV ED+ V  V++ ALK YAR+GRLPLLG
Sbjct  2    VYNKQKKAHKSKINKFLVSISFIGSAGPIRFVVKEDETVSHVIEYALKCYAREGRLPLLG  61

Query  507  SDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSW  686
            SD  +F LY      EA +    IG+ G RNF+L KK+    + +        + G   W
Sbjct  62   SDSSYFLLYCPYCAAEAFNPCGKIGSIGSRNFVLSKKSDAQSLGDSVGTTTRKISGR--W  119

Query  687  KSWLTKSF  710
            K+WL KS 
Sbjct  120  KAWLNKSL  127



>gb|EYU33134.1| hypothetical protein MIMGU_mgv1a016072mg [Erythranthe guttata]
Length=135

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTS  545
            KR LISI V GSAGPIRFVVNEDD V  V+D A+K YARQGRLP+LGSD + F LY   +
Sbjct  15   KRFLISITVLGSAGPIRFVVNEDDLVGAVMDTAMKSYARQGRLPVLGSDLNAFMLYSPFA  74

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            G +AL     IG+ G R+F+LCKK  Q  M           KG+ S +++  KS   K+
Sbjct  75   GTQALLPCEKIGSAGIRDFILCKK-PQIEMAITDDNNKASPKGSGSLRAFFNKSLHVKI  132



>ref|XP_006416119.1| hypothetical protein EUTSA_v10009597mg [Eutrema salsugineum]
 gb|ESQ34472.1| hypothetical protein EUTSA_v10009597mg [Eutrema salsugineum]
Length=142

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 78/123 (63%), Gaps = 5/123 (4%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+LIS+   GSAGPIRFV NE D V  V+D ALK YAR+GRLP+LGSD + F  Y    G
Sbjct  17   RILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAREGRLPILGSDFNDFLFYCPMVG  76

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR-----SWKSWLTKSFF  713
             EALS   +IG  G RNFMLCKK  +  + EG  +    + G+R     S+K+W+ KSF 
Sbjct  77   PEALSPWEAIGLLGARNFMLCKKPEEKKVEEGNGRSNFPINGSRKRAGGSFKAWINKSFS  136

Query  714  HKM  722
             K+
Sbjct  137  LKV  139



>gb|EYU25602.1| hypothetical protein MIMGU_mgv1a024525mg [Erythranthe guttata]
Length=135

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTS  545
            KR LISI V GSAGPIRFVVNEDD V  V+D A+K YARQGRLP+LGSD + F LY   +
Sbjct  15   KRFLISITVLGSAGPIRFVVNEDDLVGAVMDTAMKSYARQGRLPVLGSDLNAFMLYSPFA  74

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFHKM  722
            G +AL     IG+ G R+F+LCKK  Q  M           KG+ S +++  KS   K+
Sbjct  75   GTQALLPCEKIGSAGIRDFILCKK-PQIEMAITDDNNKASPKGSGSLRAFFNKSLHVKI  132



>ref|XP_002890566.1| hypothetical protein ARALYDRAFT_889841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66825.1| hypothetical protein ARALYDRAFT_889841 [Arabidopsis lyrata subsp. 
lyrata]
Length=141

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 74/123 (60%), Gaps = 5/123 (4%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+LIS+   GSAGPIRFV NE D V  V+D ALK YAR+GRLP+LGSD + F  Y    G
Sbjct  16   RILISVTFLGSAGPIRFVANESDLVAAVIDTALKCYAREGRLPILGSDFNDFVFYCPMVG  75

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR-----SWKSWLTKSFF  713
              ALS   +IG+ G RNFMLCKK  +  +     +      G R     S+K+W+ KSF 
Sbjct  76   PAALSPWEAIGSVGVRNFMLCKKPEEKKVEGDNGRSNFPNNGARKGSGGSFKAWINKSFS  135

Query  714  HKM  722
             K+
Sbjct  136  LKV  138



>ref|XP_009101334.1| PREDICTED: uncharacterized protein At4g22758 [Brassica rapa]
 emb|CDY17663.1| BnaA06g34820D [Brassica napus]
Length=143

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 73/126 (58%), Gaps = 4/126 (3%)
 Frame = +3

Query  345  RQKSGNK---KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDP  515
            +QK  +K    R L+SI+  GSAGPIRFVV ED+ V  V+D ALK YAR+GRLPLLGSD 
Sbjct  11   KQKKTHKSKINRFLVSISFLGSAGPIRFVVKEDETVSNVIDYALKCYAREGRLPLLGSDS  70

Query  516  HHFFLYPVTSGFEALSASSSIGNCGERNFMLCKK-NRQPLMTEGRPQVVTGLKGTRSWKS  692
              F LY      EA +    IG+ G RNF+L KK   Q L         T  K +  WK+
Sbjct  71   SFFLLYSPYYAVEAFNPWGKIGSTGSRNFVLSKKLEAQNLGGSVDTSTTTIRKTSGKWKA  130

Query  693  WLTKSF  710
            WL KS 
Sbjct  131  WLNKSL  136



>gb|AAM62631.1| unknown [Arabidopsis thaliana]
Length=182

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTS  545
            K+LL+S+NV GS GPIRF+ NEDD+V   ++  LK YARQGR+P+LG D  +F  Y + +
Sbjct  16   KKLLVSVNVLGSVGPIRFLANEDDEVSSAINTTLKAYARQGRIPVLGFDVDNFIFYSINA  75

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQPL-----MTEGRPQVVTGLKGT  677
            GF  L     IG+    NF++CKK  +PL     + E R ++  G K T
Sbjct  76   GFNTLHPQEKIGSMDVTNFLMCKKEPRPLEKVEGIRESRARIGHGWKTT  124



>ref|NP_198589.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08318.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE66196.1| unknown [Arabidopsis thaliana]
 gb|AED94224.1| uncharacterized protein AT5G37730 [Arabidopsis thaliana]
Length=182

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTS  545
            K+LL+S+NV GS GPIRF+ NEDD+V   ++  LK YARQGR+P+LG D  +F  Y + +
Sbjct  16   KKLLVSVNVLGSVGPIRFLANEDDEVSSAINTTLKAYARQGRIPVLGFDVDNFIFYSINA  75

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQPL-----MTEGRPQVVTGLKGT  677
            GF  L     IG+    NF++CKK  +PL     + E R ++  G K T
Sbjct  76   GFNTLHPQEKIGSMDVTNFLMCKKEPRPLEKVEGIRESRARIGHGWKTT  124



>ref|XP_007153591.1| hypothetical protein PHAVU_003G048500g [Phaseolus vulgaris]
 gb|ESW25585.1| hypothetical protein PHAVU_003G048500g [Phaseolus vulgaris]
Length=147

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 79/138 (57%), Gaps = 11/138 (8%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            ++ +  N +RLLISINV GS+GPIRFVVNE++ V  VV  ALK YAR+GRLP+LG D   
Sbjct  7    KKSQKANARRLLISINVLGSSGPIRFVVNEEEHVGAVVGTALKFYAREGRLPILGKDTTG  66

Query  522  FFLYPVTSGFEALSASSSIGNCGERNFMLCKK-----NRQPLMTEGRP------QVVTGL  668
            F LY      +ALS    IG+ G RNFMLCKK     +R     +G        +  +  
Sbjct  67   FALYCPHLASDALSPWERIGSHGVRNFMLCKKEAESDSRGVAEEDGSESGNSNGKHSSSS  126

Query  669  KGTRSWKSWLTKSFFHKM  722
            +G  SWK W   S   K+
Sbjct  127  RGNGSWKGWFNISLNLKI  144



>gb|ABK28724.1| unknown [Arabidopsis thaliana]
Length=183

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTS  545
            K+LL+S+NV GS GPIRF+ NEDD+V   ++  LK YARQGR+P+LG D  +F  Y + +
Sbjct  16   KKLLVSVNVLGSVGPIRFLANEDDEVSSAINTTLKAYARQGRIPVLGFDVDNFIFYSINA  75

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQPL-----MTEGRPQVVTGLKGT  677
            GF  L     IG+    NF++CKK  +PL     + E R ++  G K T
Sbjct  76   GFNTLHPQEKIGSMDVTNFLMCKKEPRPLEKVEGIRESRARIGHGWKTT  124



>gb|EPS58723.1| hypothetical protein M569_16091, partial [Genlisea aurea]
Length=100

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTS  545
            +R+L+S+ V GSAGPIRFVV+ED+ V  V+  ALK YAR+GRLPLLG+D ++F LY   S
Sbjct  5    RRILVSLTVIGSAGPIRFVVDEDETVSAVIRTALKLYAREGRLPLLGTDINNFMLYCPVS  64

Query  546  GFEALSASSSIGNCGERNFMLCKKNR  623
            G EAL+    IG  G RNFML KK R
Sbjct  65   GSEALNPWDKIGYAGVRNFMLFKKPR  90



>emb|CDX91699.1| BnaC08g06180D [Brassica napus]
Length=147

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 74/125 (59%), Gaps = 5/125 (4%)
 Frame = +3

Query  363  KKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVT  542
            + R+LIS+   GSAGPIRFV  E D V  V+D ALK YAR+GRLP+LGSD + F  Y   
Sbjct  20   ENRILISVAFLGSAGPIRFVAYEGDLVANVIDTALKCYAREGRLPVLGSDFNDFLFYCPM  79

Query  543  SGFEALSASSSIGNCGERNFMLC-----KKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKS  707
             G EALS   +IG+ G RNFMLC     +K +      GR          RS+++W+ KS
Sbjct  80   VGPEALSPWEAIGSLGARNFMLCEKPEEEKKKVEEEDSGRSSFPINGARKRSFRAWINKS  139

Query  708  FFHKM  722
            F  K+
Sbjct  140  FSLKV  144



>ref|XP_008457016.1| PREDICTED: uncharacterized protein LOC103496795 [Cucumis melo]
Length=149

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 75/122 (61%), Gaps = 6/122 (5%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R L+SINV GS GP+RFV NEDD V  V+  +L  YARQGRLP+LG++  +FFLY V   
Sbjct  24   RFLVSINVLGSTGPVRFVANEDDLVCEVIKTSLTLYARQGRLPILGTNVDNFFLYRVNDE  83

Query  549  -FEALSASSSIGNCGERNFMLCKK---NRQPLMTEGRPQVVTGLKGTRSWKSWLTKSFFH  716
              +ALS   SIG+   R+F+LCKK   +   L+ E   +     KG  SWK WL KS  +
Sbjct  84   KRDALSPRESIGSKQVRHFLLCKKQGTSHSLLLNEKTSRQREKEKG--SWKRWLNKSLNY  141

Query  717  KM  722
             +
Sbjct  142  SI  143



>ref|XP_006305759.1| hypothetical protein CARUB_v10010592mg [Capsella rubella]
 gb|EOA38657.1| hypothetical protein CARUB_v10010592mg [Capsella rubella]
Length=142

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTS  545
             R+LIS+   GSAGPIRFV NE D V  V+D ALK YAR+GRLP+LGSD + F  Y    
Sbjct  14   NRILISVTFLGSAGPIRFVANEGDLVAAVIDTALKCYAREGRLPILGSDFNDFVFYCPMV  73

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQ----VVTGLK---GTRSWKSWLTK  704
            G  ALS   +IG+ G RNFMLCKK  +    EG        + G +   G RS+K+W+ K
Sbjct  74   GPGALSPWEAIGSVGVRNFMLCKKKPEEKKVEGNNGRSSFTINGARKGAGGRSFKAWINK  133

Query  705  SFFHKM  722
            SF  K+
Sbjct  134  SFSLKV  139



>ref|XP_009115559.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY21419.1| BnaA09g30080D [Brassica napus]
Length=138

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 78/131 (60%), Gaps = 3/131 (2%)
 Frame = +3

Query  339  MQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPH  518
            +++++     R+LIS+   GS GPIRFV  E D V  V+D ALK YAR+GRLP+LGSD +
Sbjct  5    LKKREVVKGNRILISVTFLGSPGPIRFVAYEGDLVAAVIDTALKCYAREGRLPILGSDFN  64

Query  519  HFFLYPVTSGFEALSASSSIGNCGERNFMLC---KKNRQPLMTEGRPQVVTGLKGTRSWK  689
             F  Y    G EALS   +IG+ G RNFMLC   ++ ++     GR          RS++
Sbjct  65   DFIFYCPMVGPEALSPWEAIGSLGARNFMLCEKSEEKKKLEEENGRSSFPINGARKRSFR  124

Query  690  SWLTKSFFHKM  722
            +W+ KSF  K+
Sbjct  125  AWINKSFSLKV  135



>emb|CDY17461.1| BnaC09g20760D [Brassica napus]
Length=134

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 76/128 (59%), Gaps = 5/128 (4%)
 Frame = +3

Query  336  MMQRQKSGNKKRL---LISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLG  506
            +  +QK  +K ++   L+SI+  GSAGPIRFVV ED+ V  V++ ALK YA +GRLPLLG
Sbjct  2    VYNKQKKTHKSKINKFLVSISFIGSAGPIRFVVKEDETVSHVIEYALKCYAGEGRLPLLG  61

Query  507  SDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSW  686
            SD  +F LY      EA +    IG+ G RNF+L KK+     T G     T  K +  W
Sbjct  62   SDSSYFLLYCPYCAAEAFNPCGKIGSIGSRNFVLSKKSDA--QTLGDSVGTTTRKISGRW  119

Query  687  KSWLTKSF  710
            K+WL KS 
Sbjct  120  KAWLNKSL  127



>gb|KGN57775.1| hypothetical protein Csa_3G292550 [Cucumis sativus]
Length=151

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 72/122 (59%), Gaps = 4/122 (3%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R L+SINV GS GPIRFV NEDD V  ++  +L  YARQ RLP+LG++  +F L+ V   
Sbjct  24   RFLVSINVIGSTGPIRFVANEDDLVCEIIKTSLTLYARQARLPILGTNVDNFILFCVNDE  83

Query  549  -FEALSASSSIGNCGERNFMLCKKNRQP---LMTEGRPQVVTGLKGTRSWKSWLTKSFFH  716
              +ALS   SIG+   R+F+LCKK   P   L+ E   +     KG   WK WL KS  +
Sbjct  84   KRDALSPRESIGSKQVRHFLLCKKQGSPHSLLLNEKMSRQREEEKGRNHWKKWLNKSLSY  143

Query  717  KM  722
             +
Sbjct  144  SI  145



>ref|XP_009110117.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY41461.1| BnaA08g20630D [Brassica napus]
Length=147

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 8/125 (6%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+LIS+   GSAGPIRFV  E D V  V+D ALK YAR+GRLP+LGSD + F  Y    G
Sbjct  21   RILISVAFLGSAGPIRFVAYEGDLVANVIDTALKCYAREGRLPILGSDFNDFLFYCPMVG  80

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLM-----TEGRPQV--VTGLKGTRSWKSWLTKS  707
             EALS   +IG+ G RNFMLC+K  +          GR     + G +  RS+++W+ KS
Sbjct  81   PEALSPWEAIGSLGARNFMLCEKPEEEKKKIEEQDNGRRSSFPINGAR-KRSFRAWINKS  139

Query  708  FFHKM  722
            F  K+
Sbjct  140  FSLKV  144



>emb|CDY36234.1| BnaC07g20880D [Brassica napus]
Length=134

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 72/127 (57%), Gaps = 10/127 (8%)
 Frame = +3

Query  342  QRQKSGNK---KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSD  512
             +QK  +K    R L+SI+  GSAGPIRFVV ED+ V  V+D ALK YAR+GRLPLLGSD
Sbjct  7    NKQKKTHKSKINRFLVSISFLGSAGPIRFVVKEDETVSNVIDYALKCYAREGRLPLLGSD  66

Query  513  PHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR-SWK  689
               F LY      EA +    IG+ G RNF+L K         G     T ++ T   WK
Sbjct  67   SSFFLLYSPYYAVEAFNPWGKIGSTGLRNFVLSKN------LGGSVDTTTTIRKTSGKWK  120

Query  690  SWLTKSF  710
            +WL KS 
Sbjct  121  AWLNKSL  127



>ref|XP_006830209.1| hypothetical protein AMTR_s00130p00016510 [Amborella trichopoda]
 gb|ERM97625.1| hypothetical protein AMTR_s00130p00016510 [Amborella trichopoda]
Length=174

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 75/118 (64%), Gaps = 5/118 (4%)
 Frame = +3

Query  345  RQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHF  524
            R+K+     +LISINV  S GP+RF+V  DD V  V+D AL+ YAR+GRLP+LG++ ++F
Sbjct  52   RKKNQVANLMLISINVQESTGPLRFLVRVDDTVGSVIDTALRSYAREGRLPVLGTNFNNF  111

Query  525  FLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKG---TRSWK  689
            +L+   S F+ALS    IG  G RNF+LCKK +Q  + E   Q   G +G    R WK
Sbjct  112  YLHCANSEFKALSPVEPIGMHGGRNFVLCKKQQQEHIDEEHQQ--QGRRGGMLKRHWK  167



>ref|XP_006395882.1| hypothetical protein EUTSA_v10005108mg [Eutrema salsugineum]
 gb|ESQ33168.1| hypothetical protein EUTSA_v10005108mg [Eutrema salsugineum]
Length=137

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 70/115 (61%), Gaps = 3/115 (3%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R L+SI+  GSAGPIRFVV ED+ V  V+D AL+ YAR+GRLPLLGSD   F LY   S 
Sbjct  18   RFLVSISFLGSAGPIRFVVREDETVANVIDYALRCYAREGRLPLLGSDSSFFLLYCPYSA  77

Query  549  FEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGL-KGTRSWKSWLTKSF  710
             EA++    IG  G R+F+L KK+       G     T + K +  WK+WL KS 
Sbjct  78   AEAINPWGKIGLTGSRSFVLSKKSEA--QNHGSSVETTTIRKISGRWKAWLNKSL  130



>ref|NP_001046699.1| Os02g0324700 [Oryza sativa Japonica Group]
 dbj|BAD15683.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08613.1| Os02g0324700 [Oryza sativa Japonica Group]
 gb|EAY85624.1| hypothetical protein OsI_06997 [Oryza sativa Indica Group]
 gb|EAZ22820.1| hypothetical protein OsJ_06497 [Oryza sativa Japonica Group]
 dbj|BAG96682.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87438.1| unnamed protein product [Oryza sativa Japonica Group]
Length=152

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +3

Query  354  SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLY  533
            SG + R+L+++ V GSAGP+RF+++E + V G++  AL+ YAR+GR+PLLG+D   F LY
Sbjct  19   SGGRARMLVTVTVLGSAGPLRFLIDEGETVAGLIRAALRCYAREGRMPLLGADAAGFLLY  78

Query  534  PVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTE-GRPQVV  659
                G +ALSA   I   G R+F+L +K  +  M + GRP++ 
Sbjct  79   TANGGSDALSADEKIYFNGCRSFLLWQKAARDTMAKGGRPELA  121



>gb|KDP33166.1| hypothetical protein JCGZ_13431 [Jatropha curcas]
Length=110

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 11/93 (12%)
 Frame = +3

Query  309  KKSLSEKMTMMQRQKSGNKK----------RLLISINVFGSAGPIRFvvneddkvvgvvd  458
            + ++ EK+ M+ RQ S NKK          R LIS+NV GSAGPIRFVV EDD V  V+D
Sbjct  4    RNAMGEKL-MLNRQNSSNKKSIDEKKNKKNRFLISVNVIGSAGPIRFVVKEDDDVSSVID  62

Query  459  MALKQYARQGRLPLLGSDPHHFFLYPVTSGFEA  557
            ++LK Y R+GRLP+LGSD ++F LY   +GF+ 
Sbjct  63   ISLKTYCREGRLPVLGSDANNFLLYCPKAGFDV  95



>ref|XP_006647212.1| PREDICTED: uncharacterized protein LOC102716287 [Oryza brachyantha]
Length=149

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +3

Query  354  SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLY  533
            SG + R+L+++ V GSAGP+RF+++E + V G++  AL+ YAR+GR+PLLG+D   F LY
Sbjct  17   SGGRARMLVTVTVLGSAGPLRFLIDEGETVAGLIRAALRCYAREGRMPLLGADAAGFLLY  76

Query  534  PVTSGFEALSASSSIGNCGERNFMLCKK-NRQPLMTEGRPQVVT  662
                G +AL+A   I   G R+F+L +K  R      GRP++  
Sbjct  77   TANGGSDALNADEKIYFNGCRSFLLWQKAARDAAAKGGRPELAN  120



>ref|NP_173728.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO22759.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42426.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30348.1| uncharacterized protein AT1G23150 [Arabidopsis thaliana]
Length=141

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+LIS+   GSAGPIRFV NE D V  V+D ALK YAR+GRLP+LGSD + F  Y    G
Sbjct  15   RILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAREGRLPILGSDFNDFVFYCPMVG  74

Query  549  FEALSASSSIGNCGERNFMLC  611
              ALS   +IG+ G RNFMLC
Sbjct  75   PGALSPWEAIGSVGVRNFMLC  95



>gb|AGV54243.1| senescence-associated protein [Phaseolus vulgaris]
Length=138

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 77/135 (57%), Gaps = 4/135 (3%)
 Frame = +3

Query  330  MTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            M +++++K+ N +R LISINV GSAGPIRF+VNE+D V  V++ ALK YAR+GRLPLLG+
Sbjct  1    MLLIKQKKNQNVRRFLISINVLGSAGPIRFLVNEEDHVAAVIETALKSYAREGRLPLLGT  60

Query  510  DPHHFFLYPVTSGFEALSA-SSSIGNCGERNFML---CKKNRQPLMTEGRPQVVTGLKGT  677
            D   F LY    G +AL     +    GE    L      +   +     P      +G+
Sbjct  61   DNAGFSLYCPHLGTDALKPWGYNWITWGEEFHALQEGANADEAAVDDGSGPTAALPRRGS  120

Query  678  RSWKSWLTKSFFHKM  722
             +W+SW  KS   K+
Sbjct  121  GTWRSWFNKSLNLKI  135



>ref|XP_004305426.1| PREDICTED: uncharacterized protein LOC101292530 [Fragaria vesca 
subsp. vesca]
Length=142

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 74/131 (56%), Gaps = 9/131 (7%)
 Frame = +3

Query  336  MMQRQKS----GNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL  503
            ++ +QKS    G+   +LI I+V GS GPIRFVVN+ + V  V+  ALK Y R GRLP+L
Sbjct  2    LLYKQKSKEVKGDNNMMLIRISVVGSTGPIRFVVNKKELVGVVIQRALKSYERDGRLPVL  61

Query  504  GSDPHHFFLYPVT-SGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR  680
            GSD   F LY  T +G +ALS   +IG+    NF LCKK   P  T+  P         +
Sbjct  62   GSDLKDFVLYCTTAAGTDALSPWETIGSREGVNFTLCKK---PPTTQPMPLAAAASGHKK  118

Query  681  SW-KSWLTKSF  710
            S  K W+ KS 
Sbjct  119  SLIKGWINKSL  129



>ref|XP_010477604.1| PREDICTED: uncharacterized protein LOC104756680 [Camelina sativa]
 ref|XP_010477605.1| PREDICTED: uncharacterized protein LOC104756680 [Camelina sativa]
Length=145

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+LIS+   GSAGPIRFV NE D V  V+D ALK YA++GRLP+LGSD   F  Y    G
Sbjct  15   RILISVTFLGSAGPIRFVANEGDLVAAVIDTALKCYAKEGRLPILGSDFKDFVFYCPLVG  74

Query  549  FEALSASSSIGNCGERNFMLC  611
              ALS   +IG+ G RNFMLC
Sbjct  75   PGALSPWEAIGSLGVRNFMLC  95



>ref|XP_010498820.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
 ref|XP_010498821.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=146

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +3

Query  336  MMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            ++ ++KS   K  R+LIS+   GSAGPIRFV NE D V  V+D ALK YA++GRLP+LGS
Sbjct  2    LLYKKKSQIVKGNRILISVTFLGSAGPIRFVANEGDLVAAVIDTALKCYAKEGRLPILGS  61

Query  510  DPHHFFLYPVTSGFEALSASSSIGNCGERNFMLC  611
            D   F LY    G  AL    +IG+ G RNFMLC
Sbjct  62   DFKDFVLYCPLVGPGALLPWEAIGSLGVRNFMLC  95



>ref|XP_010460096.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
 ref|XP_010460097.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=143

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 80/139 (58%), Gaps = 10/139 (7%)
 Frame = +3

Query  336  MMQRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            ++ ++KS   K  R+LIS+   GSAGPIRFV NE D V  V+D ALK YA++GRLP+L S
Sbjct  2    LLYKKKSQIVKGNRILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAKEGRLPILAS  61

Query  510  DPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGR--------PQVVTG  665
            D   F LY    G  AL    +IG+ G RNFMLCKK  +    EG              G
Sbjct  62   DFKDFVLYCPLVGPGALLPWEAIGSLGVRNFMLCKKPEEEKKVEGDNGRSNFPINGARKG  121

Query  666  LKGTRSWKSWLTKSFFHKM  722
              G RS+K+W+ KSF  K+
Sbjct  122  GAGGRSFKAWINKSFSLKV  140



>ref|XP_004952377.1| PREDICTED: uncharacterized protein LOC101766815 [Setaria italica]
Length=161

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = +3

Query  354  SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLY  533
            +G++ R+L+++ V GSAGP+RF+V+E + V G++  AL+ YAR+GR+PLLG+ P  F LY
Sbjct  30   TGSRARVLVTVTVLGSAGPLRFLVDEGETVTGLIRAALRCYAREGRMPLLGAAPADFLLY  89

Query  534  PVTSGFEALSASSSIGNCGERNFMLCKK-NRQPLMTEG--RPQVVTGLKGTRSWKSWLTK  704
                  +AL A   I   G R+F+L +K  RQ +  +    P   T   G +    W  K
Sbjct  90   TANGRSDALMADERISFNGCRSFLLWQKAARQAVANDAGSEPLSATSSPGRKVSGGW--K  147

Query  705  SFFHKMILT  731
               +K +LT
Sbjct  148  GGLNKFLLT  156



>ref|XP_006830230.1| hypothetical protein AMTR_s00130p00053590 [Amborella trichopoda]
 gb|ERM97646.1| hypothetical protein AMTR_s00130p00053590 [Amborella trichopoda]
Length=135

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 5/87 (6%)
 Frame = +3

Query  372  LLISINVFGSAG-----PIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYP  536
            +LISIN+  S G     P+RF+V  DD V  V+  AL+ YARQGRLP+LG++   FFLY 
Sbjct  48   MLISINIHESTGHLLSCPLRFLVRVDDTVFTVIQTALRSYARQGRLPVLGNNSDDFFLYC  107

Query  537  VTSGFEALSASSSIGNCGERNFMLCKK  617
              S F ALS    IG  G RNF+L KK
Sbjct  108  ANSDFIALSPVVPIGRTGGRNFLLYKK  134



>dbj|BAK06204.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=154

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 79/150 (53%), Gaps = 10/150 (7%)
 Frame = +3

Query  294  MEVKMKKSLSEKMTMMQ---RQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMA  464
            M V +  +L  K+  ++   +  +    R+L+++ V GSAGP+RF+V+E + V G++  A
Sbjct  1    MAVAVPSTLPMKLRRVEPRGKAAAAGVARVLVTVTVLGSAGPLRFLVDEGESVNGLIRSA  60

Query  465  LKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEG  644
            L+ YAR+GR+PLLG+D  +F LY      +AL +   I   G R+FML +K         
Sbjct  61   LRFYAREGRMPLLGADAANFLLYTANGRSDALKSDERISFNGCRSFMLWQKTVAD-KNGS  119

Query  645  RPQVVT------GLKGTRSWKSWLTKSFFH  716
             P V T      G KG   WK  L K   +
Sbjct  120  EPVVATTVNSSPGRKGIGGWKFGLNKILLN  149



>ref|XP_002868302.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44561.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=165

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 68/115 (59%), Gaps = 4/115 (3%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFF-LYPVTS  545
            RLL+SI V GS GPIRFVVNED+ V  V+D+ L+ YARQGRLPL  S    FF LY   S
Sbjct  28   RLLVSIKVVGSTGPIRFVVNEDETVTNVIDITLRCYARQGRLPLFSSHSTSFFLLYSPYS  87

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSWKSWLTKSF  710
              + L+  + IG+ G  NF++CK +    +     +  TG K    W++WL  S 
Sbjct  88   PNQPLNPCTRIGSTGSMNFIMCKNSEAENLEVSLDR--TG-KIIGKWRAWLKNSL  139



>gb|AAC00605.1| Unknown protein [Arabidopsis thaliana]
Length=151

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 10/92 (11%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLY-PV-  539
             R+LIS+   GSAGPIRFV NE D V  V+D ALK YAR+GRLP+LGSD + F  Y P+ 
Sbjct  14   NRILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAREGRLPILGSDFNDFVFYCPMV  73

Query  540  --------TSGFEALSASSSIGNCGERNFMLC  611
                    T  F ++    +IG+ G RNFMLC
Sbjct  74   GPGGNLSNTQSFSSVFPWEAIGSVGVRNFMLC  105



>emb|CDP17872.1| unnamed protein product [Coffea canephora]
Length=410

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = +3

Query  375  LISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFE  554
            LI+IN+ GS GPIRFVVNEDD V   +D A K YA Q R P+ GSD + F LYP  +G +
Sbjct  314  LITINILGSTGPIRFVVNEDDTVSEGMDAAQKLYAHQERFPVFGSDVNSFLLYPANAGLD  373

Query  555  ALSASSSIGNCGERNFMLCKKNRQPLMT  638
            +    + +     RN +LCKK RQP MT
Sbjct  374  SRDLVNPLLTYM-RNLVLCKKQRQPQMT  400



>gb|EMS64867.1| hypothetical protein TRIUR3_17055 [Triticum urartu]
Length=189

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 70/126 (56%), Gaps = 10/126 (8%)
 Frame = +3

Query  375  LISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFE  554
            L+++ V GSAGP+RF+V+E + V G++  AL+ YAR+GR+PLLGSD  +F LY      +
Sbjct  34   LVTVTVLGSAGPLRFLVDEGESVNGLIRAALRCYAREGRMPLLGSDAANFLLYTANGRSD  93

Query  555  ALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVT------GLKGTRSWKSWLTK---S  707
            AL A   I   G R+FML +K          P V T      G KG   WK  L K   +
Sbjct  94   ALKADERISFNGCRSFMLWQKTVAD-NNGSEPVVATTVNSSPGRKGISGWKFGLNKILLN  152

Query  708  FFHKMI  725
            F  K+I
Sbjct  153  FSFKII  158



>ref|XP_003572714.1| PREDICTED: uncharacterized protein At4g22758-like [Brachypodium 
distachyon]
Length=159

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 7/121 (6%)
 Frame = +3

Query  375  LISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFE  554
            L+++ V GSAGP+RF+V+E + V G+V  AL+ YAR+GR+PLLG+D  +F LY      +
Sbjct  34   LVTVTVLGSAGPLRFLVDEGESVSGLVRAALRCYAREGRMPLLGADAANFLLYTANGRSD  93

Query  555  ALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVT-------GLKGTRSWKSWLTKSFF  713
            AL A   I   G R+FML +K  +  +  G    +        G K +  WK  L K   
Sbjct  94   ALKADERISFNGCRSFMLWQKTPRDAVVNGPEAALETAANSSPGRKASGGWKLGLNKILL  153

Query  714  H  716
            +
Sbjct  154  N  154



>gb|AFW89732.1| senescence-associated protein [Zea mays]
Length=170

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+L+++ V GSAGP+RF+V E D V  ++  AL+ YAR+GR+PLLG+DP  F L     G
Sbjct  28   RVLVTVTVLGSAGPLRFIVLEGDTVAALIRGALRCYAREGRMPLLGTDPAGFVLSTANGG  87

Query  549  FEALSASSSIGNCGERNFMLCKK  617
              AL     I   G RNF+L +K
Sbjct  88   SGALGEDERISFNGCRNFLLWQK  110



>ref|NP_001150485.1| senescence-associated protein [Zea mays]
 gb|ACG38410.1| senescence-associated protein [Zea mays]
 gb|ACG39253.1| senescence-associated protein [Zea mays]
Length=170

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+L+++ V GSAGP+RF+V E D V  ++  AL+ YAR+GR+PLLG+DP  F L     G
Sbjct  28   RVLVTVTVLGSAGPLRFIVLEGDTVAALIRGALRCYAREGRMPLLGTDPAGFVLSTANGG  87

Query  549  FEALSASSSIGNCGERNFMLCKK  617
              AL     I   G RNF+L +K
Sbjct  88   SGALGEDERISFNGCRNFLLWQK  110



>ref|XP_010554413.1| PREDICTED: uncharacterized protein LOC104824136 isoform X2 [Tarenaya 
hassleriana]
Length=94

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  342  QRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHH  521
            +R ++    R L+SINV GSAGPIRFVV ED+ V  V+D AL+ YAR+GRLP+LGSD + 
Sbjct  8    KRNQNPKGNRFLVSINVLGSAGPIRFVVKEDETVANVMDCALRCYAREGRLPVLGSDIND  67

Query  522  FFLYPVTSGFEAL  560
            F LY   S  EA+
Sbjct  68   FVLYSPYSAAEAM  80



>ref|NP_001152495.1| senescence-associated protein [Zea mays]
 gb|ACG47884.1| senescence-associated protein [Zea mays]
Length=175

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSG  548
            R+L+++ V GSAGP+RF+V E D V  ++  AL+ YAR+GR+PLLG+DP  F L     G
Sbjct  33   RVLVTVTVLGSAGPLRFIVFEGDTVAALIRGALRCYAREGRMPLLGTDPAGFVLSTANGG  92

Query  549  FEALSASSSIGNCGERNFMLCKK  617
              AL     I   G RNF+L +K
Sbjct  93   SGALGEDERISFNGCRNFLLWQK  115



>dbj|BAH56891.1| AT1G70780 [Arabidopsis thaliana]
Length=93

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = +3

Query  342  QRQKSGNKK--RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDP  515
            +++K+ N K  R+LIS+ V GSAGPIRFV  EDD V  V+D ALK YAR+GRLPLLGSD 
Sbjct  6    KQKKNQNAKGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKGYAREGRLPLLGSDF  65

Query  516  HHFFLY  533
            + F LY
Sbjct  66   NDFLLY  71



>gb|AFG57723.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57724.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57725.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57726.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57727.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57728.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57729.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57730.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57731.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57732.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57733.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57734.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57735.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57736.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57737.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57738.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57739.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
Length=76

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  462  ALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLM  635
            ALK YAR+GRLP+LG +   F LY   SG EA+     +G  G RNF+LCKK+ + LM
Sbjct  15   ALKLYAREGRLPVLGYNAKQFELYCANSGTEAVKPCQVVGALGTRNFLLCKKHEEKLM  72



>ref|XP_002967649.1| hypothetical protein SELMODRAFT_18527, partial [Selaginella moellendorffii]
 gb|EFJ30996.1| hypothetical protein SELMODRAFT_18527, partial [Selaginella moellendorffii]
Length=82

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +3

Query  366  KRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTS  545
            K+ L+++ V GS GP+R VV  D  V  V+ MAL +YA +GR+P LG     F LY    
Sbjct  1    KKTLVTVTVLGSTGPLRMVVTSDATVKEVMKMALLKYAHEGRVPALGRSTREFELYDSQF  60

Query  546  GFEALSASSSIGNCGERNFMLC  611
              +AL     I N G RNF+LC
Sbjct  61   SSQALKPDDRIANMGTRNFVLC  82



>ref|XP_002967997.1| hypothetical protein SELMODRAFT_440177 [Selaginella moellendorffii]
 gb|EFJ31344.1| hypothetical protein SELMODRAFT_440177 [Selaginella moellendorffii]
Length=167

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 65/122 (53%), Gaps = 13/122 (11%)
 Frame = +3

Query  345  RQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHF  524
            + + G   + L+SI+V  SAGP+RFVV+  D V  V+  AL++Y  +GR+P LG+DP  F
Sbjct  35   KSQYGGSHKFLVSISVVDSAGPLRFVVDSSDTVESVIRHALQEYEHEGRIPPLGTDPRPF  94

Query  525  FLYPVTSGFEALSASSSIGN-CGERNFMLCKK---NRQPLMTEGRPQVVTGLKGTRSWKS  692
             LY      EAL     IG+  G R+F+L ++   +R     +  P          SW+S
Sbjct  95   ELYSAHDISEALDDKLRIGDAAGVRDFILHRRPDGDRIAAQKDDHPT---------SWRS  145

Query  693  WL  698
             L
Sbjct  146  RL  147



>gb|EPS64875.1| hypothetical protein M569_09904 [Genlisea aurea]
Length=116

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  348  QKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFF  527
            + SG  +R LI +NVFGS+GP+RF+VN DD V  V+D  L++YA +GRLP LG D   F 
Sbjct  41   EDSGASRRFLIVVNVFGSSGPLRFLVNGDDAVETVIDKTLRRYAHEGRLPALGFDSSDFH  100

Query  528  LYPVTSGFEA  557
            LYP  + F++
Sbjct  101  LYPSDAVFKS  110



>gb|EPS58433.1| hypothetical protein M569_16383 [Genlisea aurea]
Length=129

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 70/134 (52%), Gaps = 8/134 (6%)
 Frame = +3

Query  330  MTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS  509
            M ++   K     + LI + V G + P+RF+V+ DD V  V++  LKQYAR G LP+LGS
Sbjct  1    MALIVSPKKSAAGKFLIVVKVCGRSWPVRFIVSGDDTVKRVIEKTLKQYARLGHLPILGS  60

Query  510  DPHHFFLYPVT-SGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTRSW  686
            D   F LYP   +  E  + +  IG CG R   +C   R P       +V+   K  +S 
Sbjct  61   DSDCFTLYPSDGTDSEGFNPTEKIGACGVR---ICSLRRNPTPAA---KVMHARKENQS-  113

Query  687  KSWLTKSFFHKMIL  728
            +SW+ KS   + I+
Sbjct  114  RSWVHKSLSFRRIM  127



>ref|XP_006849084.1| hypothetical protein AMTR_s00028p00233650 [Amborella trichopoda]
 gb|ERN10665.1| hypothetical protein AMTR_s00028p00233650 [Amborella trichopoda]
Length=101

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = +3

Query  354  SGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLY  533
            S  + +L IS     S GP RF+V  DD V   +  AL+ Y R+GRLP LG++   FF+Y
Sbjct  3    SSKRIKLQISCLFQESTGPPRFLVRVDDTVRTAIQTALRSYPREGRLPFLGNNFDDFFVY  62

Query  534  PVTSGFEALSASSSIGNCGERNFMLCKKNRQ  626
               S F ALS    IG  G RNF+L KK ++
Sbjct  63   CANSDFIALSPVVPIGRTGGRNFLLYKKKQK  93



>gb|EPS60022.1| hypothetical protein M569_14782 [Genlisea aurea]
Length=128

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 14/108 (13%)
 Frame = +3

Query  303  KMKKSLSEKMTMMQRQKS----GNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALK  470
            ++KKS+ EKM      K      +  R L+ INV G  GPI+F+VN D  V  V++ ALK
Sbjct  27   EIKKSVDEKMRRSISDKGLFPPDHSNRYLVIINVVGGTGPIKFLVNRDSNVKSVIEKALK  86

Query  471  QYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCK  614
             Y R+GR P +GSD ++ +LYP          +  IG+ G  + ++CK
Sbjct  87   IYNREGRHPAIGSDTNNLYLYP----------ADVIGSDGITHIIICK  124



>gb|EPS70443.1| hypothetical protein M569_04324 [Genlisea aurea]
Length=167

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 76/139 (55%), Gaps = 9/139 (6%)
 Frame = +3

Query  312  KSLSEKMTMMQRQKSGNKKRLLISINV-FGSAGPIRFvvneddkvvgvvdMALKQYARQG  488
            + +SE   ++      +  + L++I V   S+GP+RF V+ DD V  V+D AL+ Y R+G
Sbjct  31   RRISETSLLLCCNGPKDYTKFLVTIVVGRSSSGPMRFPVSGDDTVEAVIDKALEVYDREG  90

Query  489  RLPLLGSDPHHFFLYPVTSGFEALSASSS-IGNCGERN-FMLCKKNRQPLMTEGRPQVVT  662
            R+P++GSD + F LY    G   L+ S   + NCG  N F + +K      T  R + + 
Sbjct  91   RVPVIGSDRNGFVLYSADGGGHELAPSEKMLANCGGTNKFGMLRK-----ATSMRREPID  145

Query  663  GLKGTRSWKSWLTKSFFHK  719
            G  G+RSW +WL +S   K
Sbjct  146  G-DGSRSWSTWLRRSLSFK  163



>dbj|BAB08319.1| unnamed protein product [Arabidopsis thaliana]
Length=109

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 52/92 (57%), Gaps = 16/92 (17%)
 Frame = +3

Query  357  GNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYP  536
            G  K+LL+S+NV GS GPIRF+ NEDD+V  V++  LK YARQGR+P+LG +        
Sbjct  3    GENKKLLVSVNVLGSVGPIRFLANEDDEVSSVINTTLKAYARQGRIPVLGIE--------  54

Query  537  VTSGFEALSASSSIGNCGERNFMLCKKNRQPL  632
                         IG+    N +LC K  +PL
Sbjct  55   --------YTQEKIGSMDVTNSLLCMKEPRPL  78



>ref|XP_002992399.1| hypothetical protein SELMODRAFT_448736 [Selaginella moellendorffii]
 gb|EFJ06549.1| hypothetical protein SELMODRAFT_448736 [Selaginella moellendorffii]
Length=197

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query  336  MMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDP  515
            + + Q  G+   +L+++ V GS GP+RF+V++ D V  VVD AL+ YAR+GRLPLL    
Sbjct  72   LSKSQGKGDANLMLVTVTVLGSPGPLRFLVDKADTVGRVVDTALRVYAREGRLPLLSK--  129

Query  516  HHFFLYPVTSGFEALSASSSIGNCGERNFMLCKK  617
                LY     F+AL ++  IG  G R F+L +K
Sbjct  130  QLVELYCDNGDFKALDSNECIGVLGTRQFLLYRK  163



>ref|XP_010445453.1| PREDICTED: uncharacterized protein LOC104728122 [Camelina sativa]
Length=135

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +3

Query  363  KKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSD-PHHFFLYPV  539
            + +LL+SI V GS GPIRFVVNED+ V  V+D+ LK YARQGRLP+  S     F LY  
Sbjct  26   ENKLLVSIKVAGSTGPIRFVVNEDESVTNVIDITLKCYARQGRLPIFSSHFTSSFLLYTP  85

Query  540  TSGFEALSASSSIGNCGERNFMLCK  614
             S  + L+  + IG+    NF +CK
Sbjct  86   YSPDKPLNPCTRIGSTLSMNFKMCK  110



>ref|XP_006833573.1| hypothetical protein AMTR_s00364p00012660 [Amborella trichopoda]
 gb|ERM98851.1| hypothetical protein AMTR_s00364p00012660 [Amborella trichopoda]
Length=130

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 61/124 (49%), Gaps = 12/124 (10%)
 Frame = +3

Query  372  LLISINVFGSAGPI-----RFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYP  536
            +LISINV  S G +      F+V  +D V  V+  AL+ +AR GRLP L  +   FFLY 
Sbjct  1    MLISINVHESTGHLLSCNLHFLVRVNDTVRTVIQTALRTHARHGRLPSLRKNSDDFFLYR  60

Query  537  VTSGFEALSASSSIGNCGERNFMLCKKNRQPLM------TEGRPQVVTGLKGTRSWKSWL  698
              S F ALS    IG  G   F+L KK ++          +GR   +     T +WK W+
Sbjct  61   ANSDFIALSPVVPIGRTGGWKFLLYKKKQEEYYFGEHYKQQGRGGGMINRHAT-NWKQWI  119

Query  699  TKSF  710
             KS 
Sbjct  120  NKSL  123



>ref|XP_002468583.1| hypothetical protein SORBIDRAFT_01g048430 [Sorghum bicolor]
 gb|EER95581.1| hypothetical protein SORBIDRAFT_01g048430 [Sorghum bicolor]
Length=172

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = +3

Query  396  GSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSS  575
            GSAGP+RF+V E D V  ++  AL+ YAR+GR+PLLG+DP  F L     G  AL     
Sbjct  41   GSAGPLRFIVLEGDTVAALIRAALRCYAREGRMPLLGTDPAGFVLSTANGGSGALKEDEK  100

Query  576  IGNCGERNFMLCKKN  620
            I   G R+F+L +K 
Sbjct  101  ITFNGCRSFLLWQKT  115



>ref|XP_007132381.1| hypothetical protein PHAVU_011G090100g [Phaseolus vulgaris]
 gb|ESW04375.1| hypothetical protein PHAVU_011G090100g [Phaseolus vulgaris]
Length=195

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS-DPHHFFLYPVTS  545
            +LL+ + + GS GP++ V+  +  V  +V  A+ QY ++GR P+L S DP HF L+    
Sbjct  71   KLLLKVTIMGSLGPVQVVMTTESAVGDLVAAAVNQYIKEGRRPILPSNDPSHFDLHYSQF  130

Query  546  GFEALSASSSIGNCGERNFMLCKK  617
              E+L     + + G RNF LC +
Sbjct  131  TLESLDRKEKLRDIGSRNFYLCPR  154



>ref|XP_003539807.1| PREDICTED: uncharacterized protein At4g22758-like [Glycine max]
Length=195

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS-DPHHFFLYPVTS  545
            +LL+ +   GS GP++ V+  +  V  +V  A++QY ++GR P+L S DP HF L+    
Sbjct  72   KLLLKVTSMGSLGPVQVVMTPESTVGDLVAAAVRQYVKEGRRPILPSNDPSHFDLHYSQF  131

Query  546  GFEALSASSSIGNCGERNFMLCKK  617
              E+L     + + G RNF +C +
Sbjct  132  SLESLDREEKLRDIGSRNFFMCPR  155



>ref|XP_002963924.1| hypothetical protein SELMODRAFT_28561, partial [Selaginella moellendorffii]
 gb|EFJ34257.1| hypothetical protein SELMODRAFT_28561, partial [Selaginella moellendorffii]
Length=74

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = +3

Query  345  RQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHF  524
            + + G   + L+SI+V  SAGP+RFVV+  D V  V+  AL++Y  +GR+P LG+DP  F
Sbjct  1    QSQHGGSHKFLVSISVVDSAGPLRFVVDSSDTVESVIRHALQEYEHEGRIPPLGTDPRPF  60

Query  525  FLY  533
             LY
Sbjct  61   ELY  63



>emb|CAC09928.1| hypothetical protein [Catharanthus roseus]
Length=196

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS-DPHHFFLYPVTS  545
            +LL+++ + GS GPI+ + + +  V  ++  AL+QY+++GR P+L S D   F L+    
Sbjct  78   KLLLNVTIMGSVGPIQVLTSPEATVEDLISAALRQYSKEGRRPILKSTDAAGFDLHYSQF  137

Query  546  GFEALSASSSIGNCGERNFMLCKK  617
              E+L     + + G RNF LC K
Sbjct  138  SLESLHREEKLISLGSRNFFLCPK  161



>ref|XP_004487530.1| PREDICTED: uncharacterized protein At4g22758-like [Cicer arietinum]
Length=205

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (50%), Gaps = 9/105 (9%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSD-PHHFFLYPVTS  545
            +LL+ + V GS GP++ ++  +  V  +V+  ++QY ++GR P+L S     F L+    
Sbjct  67   KLLLKVTVLGSLGPVQMLMKPESTVGDLVEAVVRQYVKEGRRPILPSKFASDFDLHYSQF  126

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQVVTGLKGTR  680
              E+L     +   G RNF LC +N  P           G+ GTR
Sbjct  127  SLESLHREEKVAKLGSRNFFLCPRNTTP--------AAEGISGTR  163



>gb|ABR17412.1| unknown [Picea sitchensis]
Length=247

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 60/115 (52%), Gaps = 5/115 (4%)
 Frame = +3

Query  282  PRIYMEVKMKKSLSEKMTM---MQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgv  452
            P+   E+  +   + KM M   + +  S NK  LL+SI +  S GP+R ++ +D  V  V
Sbjct  81   PKTQPELLNRDDHNMKMKMNNPVDQASSVNK--LLVSITIAQSIGPLRLLLFKDATVEEV  138

Query  453  vdMALKQYARQGRLPLLGSDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKK  617
            +  A   YA++GR  LL +DP  F L+      + L+ +  I + G RNF LC K
Sbjct  139  IKAAFVLYAKEGRKQLLSNDPAAFGLHYSQFSIDCLNPADKIKDLGSRNFFLCPK  193



>ref|NP_001241053.1| uncharacterized protein LOC100801688 [Glycine max]
 gb|ACU19883.1| unknown [Glycine max]
Length=197

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS-DPHHFFLYPVTS  545
            +LL+ +   GS GP++ V+  +  V  +V + ++QY ++GR P+L S DP HF L+    
Sbjct  73   KLLLKVTPMGSLGPVQVVMTPESTVGDLVAVTVRQYVKEGRRPILPSNDPSHFDLHYSQF  132

Query  546  GFEALSASSSIGNCGERNFMLCKK  617
              ++L     + + G RNF LC +
Sbjct  133  SLQSLDREEKLMDIGSRNFFLCPR  156



>gb|EPS58560.1| hypothetical protein M569_16253, partial [Genlisea aurea]
Length=70

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  372  LLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGSDPHHFFLYPVTSGF  551
             L+ +NV GS GP+ F+VN DD V  VV  +L+QYA +GRLP+LG+D + F L    SGF
Sbjct  10   FLVIVNVLGSTGPMIFMVNGDDNVKAVVGKSLRQYAAEGRLPVLGNDSNGFHLCASASGF  69

Query  552  E  554
            +
Sbjct  70   D  70



>gb|ABB87098.1| hypothetical protein [Solanum tuberosum]
Length=190

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS-DPHHFFLYPVTS  545
            +LL+++ +  S GP++ +++ +  V  ++  AL+QY+++GR P+L S D   + L+    
Sbjct  74   KLLLNVTIQRSVGPVQVLISLESTVADLIAAALRQYSKEGRRPVLSSVDAADYDLHYSQF  133

Query  546  GFEALSASSSIGNCGERNFMLCKKN  620
              E+L    ++   G RNF +C KN
Sbjct  134  SLESLEREENLNALGSRNFFMCPKN  158



>ref|XP_006367869.1| PREDICTED: uncharacterized protein At4g22758-like [Solanum tuberosum]
Length=190

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLGS-DPHHFFLYPVTS  545
            +LL+++ +  S GP++ +++ +  V  ++  AL+QY+++GR P+L S D   + L+    
Sbjct  74   KLLLNVTIQRSVGPVQVLISLESTVADLIAAALQQYSKEGRRPVLSSVDAADYDLHYSQF  133

Query  546  GFEALSASSSIGNCGERNFMLCKKN  620
              E+L    ++   G RNF +C KN
Sbjct  134  SLESLEREENLNALGSRNFFMCPKN  158



>ref|XP_009373352.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=161

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 50/88 (57%), Gaps = 1/88 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLG-SDPHHFFLYPVTS  545
            +LL+++ +  S GP++ V++ ++ V  ++  A++ Y R+ R PL+  +DPH F L+    
Sbjct  45   KLLLNVTIERSLGPVQVVMSPENTVRDLIKAAVEIYVREKRRPLVKETDPHRFELHYSQF  104

Query  546  GFEALSASSSIGNCGERNFMLCKKNRQP  629
              E+L A   +   G RNF LC    +P
Sbjct  105  SLESLKADEKLIKLGSRNFFLCCSKSKP  132



>ref|XP_009588778.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
tomentosiformis]
Length=185

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 55/108 (51%), Gaps = 1/108 (1%)
 Frame = +3

Query  333  TMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL-GS  509
            T   R+K     +LL+++N+  S GP+  V++ ++ V  ++  A++ Y ++ R PLL  S
Sbjct  65   TSSAREKQHKLTKLLLNVNIQNSLGPVHVVISPENTVGDLITAAIEIYVKEKRRPLLISS  124

Query  510  DPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNRQPLMTEGRPQ  653
            DP  + L+      E+L     + N G R F LC K    +  +  P+
Sbjct  125  DPRCYELHYSQFSLESLKTEEKLVNLGSRTFFLCPKPSSAVKAKATPR  172



>ref|XP_010934683.1| PREDICTED: uncharacterized protein At4g22758-like [Elaeis guineensis]
Length=158

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLLG-SDPHHFFLYPVTS  545
            +LL+++ +  S GP+  V+  ++ V  +V  A++ Y ++GR PLL  +DP  F L+    
Sbjct  51   KLLLNVTIERSLGPVHVVMPPENTVADLVREAVEAYVKEGRRPLLPRTDPKAFDLHYSQY  110

Query  546  GFEALSASSSIGNCGERNFMLCKK  617
              E+L+    + N G RNF LC K
Sbjct  111  SLESLNPEEKLINLGSRNFFLCSK  134



>ref|XP_004506132.1| PREDICTED: uncharacterized protein LOC101503425 [Cicer arietinum]
Length=159

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = +3

Query  369  RLLISINVFGSAGPIRFvvneddkvvgvvdMALKQYARQGRLPLL-GSDPHHFFLYPVTS  545
            +LL+ + + GS G ++ ++  +  V  ++  A++QY ++GR P+L  SDP  F L+    
Sbjct  37   KLLLKVMIMGSLGAVQVLMTPESSVGDLIAAAVRQYVKEGRRPILPSSDPFRFDLHYSQF  96

Query  546  GFEALSASSSIGNCGERNFMLCKKN  620
              E+L  +  +   G RNF +C K 
Sbjct  97   SLESLDRNEKLREIGSRNFFMCPKK  121



>gb|KHF98270.1| hypothetical protein F383_12843 [Gossypium arboreum]
Length=185

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 59/113 (52%), Gaps = 1/113 (1%)
 Frame = +3

Query  288  IYMEVKMKKSLSEKMTMMQRQKSGNKKRLLISINVFGSAGPIRFvvneddkvvgvvdMAL  467
            + +  ++  S S +  ++    S    +LL+++N+  S GP+  ++  D+ V  ++  A+
Sbjct  43   VAVPARLTTSSSSRFPVVNDGISQRLTKLLLNVNIESSLGPVHVIMPSDNTVNDLIKAAI  102

Query  468  KQYARQGRLPLLG-SDPHHFFLYPVTSGFEALSASSSIGNCGERNFMLCKKNR  623
            + Y ++ R PLL  +DP  F L+      E+L A   + N G RNF LC K R
Sbjct  103  EIYIKEKRRPLLEETDPKLFQLHYSQFCLESLRAGEKLINLGSRNFFLCLKKR  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2084200598424