BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82967_g1_i1 len=204 path=[1:0-203]

Length=204
                                                                      Score     E

ref|XP_001032358.2|  60s Acidic ribosomal protein                       106   9e-26   Tetrahymena thermophila
dbj|BAG12793.1|  putative ribosomal protein P0                          102   1e-25   Sorogena stoianovitchae
ref|XP_004035413.1|  ribosomal phosphoprotein, putative                 103   2e-24   
ref|XP_002896775.1|  60S acidic ribosomal protein P0                  93.6    4e-21   
ref|XP_008612085.1|  50S ribosomal protein LP0                        93.2    5e-21   
gb|KDO34134.1|  hypothetical protein SPRG_01404                       93.2    5e-21   
ref|XP_009513921.1|  hypothetical protein PHYSODRAFT_353332           92.8    6e-21   
ref|XP_008904900.1|  hypothetical protein PPTG_11356                  92.8    6e-21   
emb|CCA22079.1|  60S acidic ribosomal protein P0 putative             90.1    7e-20   
ref|XP_005784062.1|  hypothetical protein EMIHUDRAFT_456254           90.1    7e-20   
ref|XP_009823852.1|  hypothetical protein H257_02063                  89.4    1e-19   
ref|XP_002140323.1|  60S acidic ribosomal protein P0                  89.0    1e-19   Cryptosporidium muris RN66
ref|XP_008865510.1|  hypothetical protein H310_03433                  89.0    2e-19   
ref|XP_001445033.1|  hypothetical protein                             88.6    2e-19   Paramecium tetraurelia strain d4-2
ref|XP_002960810.1|  hypothetical protein SELMODRAFT_437282           88.6    2e-19   
ref|XP_001447582.1|  hypothetical protein                             88.6    2e-19   Paramecium tetraurelia strain d4-2
ref|XP_001436877.1|  hypothetical protein                             88.6    2e-19   Paramecium tetraurelia strain d4-2
ref|XP_001428998.1|  hypothetical protein                             88.6    3e-19   Paramecium tetraurelia strain d4-2
ref|XP_001448466.1|  hypothetical protein                             88.6    3e-19   Paramecium tetraurelia strain d4-2
ref|XP_005850392.1|  hypothetical protein CHLNCDRAFT_59607            88.2    3e-19   
ref|XP_002974292.1|  hypothetical protein SELMODRAFT_149765           88.2    3e-19   
ref|XP_002983859.1|  hypothetical protein SELMODRAFT_268802           88.2    3e-19   
ref|XP_001439215.1|  hypothetical protein                             87.8    4e-19   Paramecium tetraurelia strain d4-2
ref|XP_004247949.1|  PREDICTED: 60S acidic ribosomal protein P0-like  87.4    6e-19   
gb|EFA86145.1|  ribosomal acidic phosphoprotein P0                    86.7    1e-18   Heterostelium album PN500
ref|XP_009799989.1|  PREDICTED: 60S acidic ribosomal protein P0-like  86.7    1e-18   
gb|KHG21849.1|  60S acidic ribosomal P0-2 -like protein               86.3    1e-18   
gb|KHG01938.1|  60S acidic ribosomal P0-2 -like protein               85.9    1e-18   
gb|EWM28546.1|  60s acidic ribosomal protein p0                       87.4    2e-18   
ref|XP_009592351.1|  PREDICTED: 60S acidic ribosomal protein P0-like  85.9    2e-18   
gb|KDP46515.1|  hypothetical protein JCGZ_08487                       85.9    2e-18   
ref|XP_003573632.1|  PREDICTED: 60S acidic ribosomal protein P0-like  85.9    2e-18   
ref|XP_001712426.1|  rla0                                             85.9    2e-18   Hemiselmis andersenii
gb|ABO31368.1|  60S ribosomal protein                                 85.1    2e-18   Gossypium hirsutum [American cotton]
ref|XP_003063696.1|  predicted protein                                85.9    2e-18   
emb|CBN80296.1|  conserved unknown protein                            85.5    2e-18   
ref|XP_668216.1|  ribosomal P protein                                 85.5    3e-18   Cryptosporidium hominis TU502
gb|EPY32839.1|  large subunit ribosomal protein LP0                   85.5    3e-18   
ref|XP_008779152.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.7    3e-18   
ref|XP_625816.1|  ribosomal protein PO like protein of the L10 fa...  85.5    3e-18   Cryptosporidium parvum Iowa II
gb|EPY24787.1|  large subunit ribosomal protein LP0                   85.5    3e-18   
gb|EPY30204.1|  large subunit ribosomal protein LP0                   85.5    3e-18   
ref|XP_010095082.1|  60S acidic ribosomal protein P0                  85.5    3e-18   
dbj|GAM19306.1|  hypothetical protein SAMD00019534_024810             85.1    3e-18   
ref|XP_008457380.1|  PREDICTED: 60S acidic ribosomal protein P0-like  85.1    4e-18   
ref|XP_003886551.1|  unnamed protein product                          84.0    4e-18   
ref|XP_007163525.1|  hypothetical protein PHAVU_001G241400g           85.1    4e-18   
ref|XP_009619762.1|  PREDICTED: 60S acidic ribosomal protein P0-like  85.1    4e-18   
emb|CAA39657.1|  ribosomal acidic phosphoprotein P0                   85.1    4e-18   Dictyostelium discoideum
ref|XP_006360336.1|  PREDICTED: 60S acidic ribosomal protein P0-like  85.1    4e-18   
ref|XP_004145258.1|  PREDICTED: 60S acidic ribosomal protein P0-2...  85.1    4e-18   
ref|XP_637692.1|  ribosomal acidic phosphoprotein P0                  84.7    5e-18   Dictyostelium discoideum AX4
ref|XP_005707548.1|  60S acidic ribosomal protein P0                  85.1    5e-18   
ref|XP_010685586.1|  PREDICTED: 60S acidic ribosomal protein P0       84.7    5e-18   
ref|XP_010534571.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.7    5e-18   
ref|XP_010534676.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.7    6e-18   
ref|XP_011084927.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.7    6e-18   
ref|XP_009399833.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.7    6e-18   
ref|XP_006848156.1|  hypothetical protein AMTR_s00029p00231170        84.7    6e-18   
ref|XP_010689885.1|  PREDICTED: 60S acidic ribosomal protein P0       84.7    6e-18   
gb|EPS69246.1|  p0 ribosomal protein-like protein                     84.7    6e-18   
ref|XP_007009052.1|  Ribosomal protein L10 family protein isoform 2   84.7    6e-18   
ref|XP_009409427.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.7    6e-18   
ref|XP_009389889.1|  PREDICTED: 60S acidic ribosomal protein P0       84.3    6e-18   
ref|XP_010554654.1|  PREDICTED: 60S acidic ribosomal protein P0       84.3    6e-18   
ref|XP_004307662.1|  PREDICTED: 60S acidic ribosomal protein P0-1...  84.3    6e-18   
gb|KHN36391.1|  60S acidic ribosomal protein P0                       84.3    7e-18   
gb|ABK95701.1|  unknown                                               84.3    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011072152.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.7    7e-18   
ref|XP_007009051.1|  Ribosomal protein L10 family protein isoform 1   84.3    7e-18   
ref|XP_002312149.1|  60S acidic ribosomal protein P0-A                84.3    7e-18   Populus trichocarpa [western balsam poplar]
gb|KHG08087.1|  60S acidic ribosomal P0                               84.3    7e-18   
ref|XP_004490967.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.3    7e-18   
ref|XP_004490966.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.3    7e-18   
ref|XP_002526873.1|  60S acidic ribosomal protein P0, putative        84.3    7e-18   Ricinus communis
gb|AAF34767.1|AF227622_1  60S acidic ribosomal protein PO             84.3    7e-18   Euphorbia esula [wolf's milk]
ref|XP_007222847.1|  hypothetical protein PRUPE_ppa008800mg           84.3    7e-18   
ref|XP_011035984.1|  PREDICTED: 60S acidic ribosomal protein P0       84.3    7e-18   
ref|XP_008799093.1|  PREDICTED: 60S acidic ribosomal protein P0       84.3    7e-18   
gb|KHG25462.1|  60S acidic ribosomal P0                               84.3    7e-18   
ref|XP_010926952.1|  PREDICTED: 60S acidic ribosomal protein P0       84.3    7e-18   
gb|KHN34735.1|  60S acidic ribosomal protein P0                       84.3    7e-18   
ref|XP_002315165.1|  60S acidic ribosomal protein P0-A                84.3    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011042597.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.3    7e-18   
gb|ABK94988.1|  unknown                                               84.3    8e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011076719.1|  PREDICTED: 60S acidic ribosomal protein P0       84.3    8e-18   
emb|CCI41647.1|  unnamed protein product                              86.3    8e-18   
ref|XP_001759592.1|  predicted protein                                84.3    8e-18   
sp|P29764.1|RLA0_OXYRB  RecName: Full=60S acidic ribosomal protei...  84.3    8e-18   Oxybasis rubra [pigweed]
ref|XP_006350830.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.3    8e-18   
emb|CDP16385.1|  unnamed protein product                              84.3    8e-18   
emb|CBI25508.3|  unnamed protein product                              84.0    8e-18   
gb|KFK36893.1|  hypothetical protein AALP_AA4G185700                  84.3    8e-18   
emb|CBI31491.3|  unnamed protein product                              84.0    8e-18   
ref|XP_010941551.1|  PREDICTED: 60S acidic ribosomal protein P0       84.3    8e-18   
gb|EYU43500.1|  hypothetical protein MIMGU_mgv1a010103mg              84.3    8e-18   
gb|AFK46889.1|  unknown                                               84.3    9e-18   
ref|XP_003616595.1|  60S acidic ribosomal protein p0                  84.3    9e-18   
gb|EYU19990.1|  hypothetical protein MIMGU_mgv1a0100892mg             83.6    9e-18   
gb|EYU43501.1|  hypothetical protein MIMGU_mgv1a010103mg              84.3    9e-18   
ref|XP_004241171.1|  PREDICTED: 60S acidic ribosomal protein P0-like  84.0    9e-18   
ref|XP_003876716.1|  putative 60S acidic ribosomal subunit protein    84.3    9e-18   
ref|XP_002268645.1|  PREDICTED: 60S acidic ribosomal protein P0       84.0    9e-18   Vitis vinifera
gb|EMS52841.1|  60S acidic ribosomal protein P0                       83.6    1e-17   
gb|EYU18304.1|  hypothetical protein MIMGU_mgv1a010092mg              84.0    1e-17   
ref|XP_765821.1|  60S acidic ribosomal protein, P0                    84.0    1e-17   Theileria parva strain Muguga
ref|XP_003082807.1|  RLA0_MAIZE 60S acidic ribosomal protein P0 p...  84.0    1e-17   
ref|XP_001759851.1|  predicted protein                                84.0    1e-17   
gb|EYU43502.1|  hypothetical protein MIMGU_mgv1a010103mg              83.2    1e-17   
ref|XP_010256605.1|  PREDICTED: 60S acidic ribosomal protein P0       84.0    1e-17   
gb|EYU22330.1|  hypothetical protein MIMGU_mgv1a019166mg              83.2    1e-17   
sp|P50345.1|RLA0_LUPLU  RecName: Full=60S acidic ribosomal protei...  83.6    1e-17   Lupinus luteus
ref|XP_010067511.1|  PREDICTED: 60S acidic ribosomal protein P0       83.6    1e-17   
ref|XP_004287422.1|  PREDICTED: 60S acidic ribosomal protein P0-1...  83.6    1e-17   
ref|XP_005650079.1|  hypothetical protein COCSUDRAFT_52908            83.6    1e-17   
gb|KFM29126.1|  60S acidic ribosomal protein P0-2                     83.2    1e-17   
gb|KDO69056.1|  hypothetical protein CISIN_1g036252mg                 83.6    2e-17   
ref|XP_006435696.1|  hypothetical protein CICLE_v10033862mg           83.6    2e-17   
gb|KCW65655.1|  hypothetical protein EUGRSUZ_G03042                   83.2    2e-17   
gb|KDP44812.1|  hypothetical protein JCGZ_01312                       83.2    2e-17   
ref|XP_007016138.1|  Ribosomal protein L10 family protein             83.2    2e-17   
gb|KDO69055.1|  hypothetical protein CISIN_1g020952mg                 83.2    2e-17   
emb|CEG01946.1|  Ribosomal protein L10/acidic P0                      83.2    2e-17   
ref|XP_007153264.1|  hypothetical protein PHAVU_003G020600g           83.2    2e-17   
gb|AGV54296.1|  60S acidic ribosomal protein P0                       83.2    2e-17   
ref|XP_010247657.1|  PREDICTED: 60S acidic ribosomal protein P0-like  83.2    2e-17   
gb|EMT02739.1|  60S acidic ribosomal protein P0                       83.2    2e-17   
gb|KHG25720.1|  60S acidic ribosomal P0                               83.2    2e-17   
gb|AFK38760.1|  unknown                                               83.2    2e-17   
ref|NP_001239676.1|  uncharacterized protein LOC100777482             83.2    2e-17   
ref|NP_001238374.1|  60S acidic ribosomal protein P0                  83.2    2e-17   
ref|XP_007157498.1|  hypothetical protein PHAVU_002G074600g           83.2    2e-17   
ref|XP_954430.1|  ribosomal phosphoprotein P0                         82.8    2e-17   Theileria annulata strain Ankara
ref|XP_001565910.1|  putative 60S acidic ribosomal subunit protein    82.8    2e-17   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_010700228.1|  60S ribosomal protein L10/acidic, putative       82.8    2e-17   
ref|XP_004307622.1|  PREDICTED: 60S acidic ribosomal protein P0-1...  82.8    2e-17   
ref|XP_009689105.1|  60S acidic ribosomal protein P0                  82.8    3e-17   
ref|XP_001565909.1|  putative 60S acidic ribosomal subunit protein    82.8    3e-17   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_002960261.1|  hypothetical protein SELMODRAFT_229877           82.8    3e-17   
gb|ADR71236.1|  60S acidic ribosomal protein P0B                      82.8    3e-17   
ref|XP_003538454.1|  PREDICTED: 60S acidic ribosomal protein P0-like  82.8    3e-17   
ref|XP_009764939.1|  PREDICTED: 60S acidic ribosomal protein P0-like  82.8    3e-17   
ref|XP_008463223.1|  PREDICTED: 60S acidic ribosomal protein P0       82.8    3e-17   
ref|XP_004149240.1|  PREDICTED: 60S acidic ribosomal protein P0-like  82.8    3e-17   
gb|ADR71235.1|  60S acidic ribosomal protein P0A                      82.8    3e-17   
ref|XP_003603496.1|  60S acidic ribosomal protein p0                  82.8    3e-17   
gb|KDO69054.1|  hypothetical protein CISIN_1g020952mg                 82.4    3e-17   
ref|XP_004165071.1|  PREDICTED: 60S acidic ribosomal protein P0-like  82.4    3e-17   
gb|AFK39880.1|  unknown                                               82.4    3e-17   
ref|XP_006435697.1|  hypothetical protein CICLE_v10032141mg           82.4    4e-17   
gb|KDD72928.1|  hypothetical protein H632_c2720p0                     82.0    4e-17   
ref|XP_004501267.1|  PREDICTED: 60S acidic ribosomal protein P0-like  82.4    4e-17   
ref|XP_002967451.1|  hypothetical protein SELMODRAFT_87354            82.4    4e-17   
ref|XP_001422456.1|  Cytosolic 80S ribosomal protein P0; Cytosoli...  82.4    4e-17   Ostreococcus lucimarinus CCE9901
ref|XP_002276842.1|  PREDICTED: 60S acidic ribosomal protein P0       82.4    4e-17   Vitis vinifera
dbj|BAF45856.1|  ribosomal phosphoprotein P0                          82.4    4e-17   Babesia microti
gb|AAU10516.1|  60S ribosomal protein                                 82.4    4e-17   Leishmania donovani
gb|EPY24295.1|  large subunit ribosomal protein LP0                   82.0    4e-17   
ref|XP_008392940.1|  PREDICTED: 60S acidic ribosomal protein P0       82.4    4e-17   
emb|CAN76468.1|  hypothetical protein VITISV_030042                   82.0    5e-17   Vitis vinifera
gb|EPY22906.1|  large subunit ribosomal protein LP0                   82.0    5e-17   
emb|CAN80537.1|  hypothetical protein VITISV_003812                   82.0    5e-17   Vitis vinifera
ref|XP_002525622.1|  60S acidic ribosomal protein P0, putative        82.0    5e-17   Ricinus communis
ref|XP_008360784.1|  PREDICTED: 60S acidic ribosomal protein P0       82.0    5e-17   
ref|XP_009350848.1|  PREDICTED: 60S acidic ribosomal protein P0-like  82.0    6e-17   
ref|XP_009344598.1|  PREDICTED: 60S acidic ribosomal protein P0       82.0    6e-17   
dbj|BAE71263.1|  putative 60S acidic ribosomal protein P0             82.0    6e-17   Trifolium pratense [peavine clover]
emb|CCF73339.1|  unnamed protein product                              82.0    6e-17   
gb|AAF13353.1|AF121339_1  acidic ribosomal phosphoprotein P0          81.6    7e-17   Eufolliculina uhligi
ref|XP_003721948.1|  putative 60S acidic ribosomal subunit protein    81.6    7e-17   
ref|XP_001466374.1|  putative 60S acidic ribosomal subunit protein    81.6    7e-17   Leishmania infantum JPCM5
ref|XP_002370628.1|  60S acidic ribosomal protein P0                  81.3    1e-16   Toxoplasma gondii ME49
gb|EJK52423.1|  hypothetical protein THAOC_28299                      81.3    1e-16   
ref|XP_008889338.1|  ribosomal protein RPP0                           81.3    1e-16   
gb|ACJ84880.1|  unknown                                               81.3    1e-16   Medicago truncatula
gb|AFP65300.1|  60S acidic ribosomal protein P0                       80.9    1e-16   
ref|NP_181530.1|  60S acidic ribosomal protein P0-1                   80.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CCW71061.1|  unnamed protein product                              80.9    1e-16   
ref|XP_010517390.1|  PREDICTED: 60S acidic ribosomal protein P0-1...  80.9    1e-16   
ref|XP_002784721.1|  ribosomal P protein, putative                    80.9    1e-16   Perkinsus marinus ATCC 50983
ref|XP_006411245.1|  hypothetical protein EUTSA_v10016954mg           80.9    1e-16   
ref|XP_010508934.1|  PREDICTED: 60S acidic ribosomal protein P0-1     80.9    1e-16   
ref|XP_002881693.1|  60S acidic ribosomal protein P0                  80.9    1e-16   
ref|XP_672283.1|  hypothetical protein                                80.1    1e-16   Plasmodium berghei ANKA
emb|CDY24932.1|  BnaC03g22400D                                        80.5    2e-16   
emb|CDY60988.1|  BnaA03g56530D                                        80.5    2e-16   
gb|EPY24983.1|  large subunit ribosomal protein LP0                   80.5    2e-16   
ref|XP_008351783.1|  PREDICTED: uncharacterized protein LOC103415220  83.2    2e-16   
ref|XP_009133397.1|  PREDICTED: 60S acidic ribosomal protein P0-1     80.5    2e-16   
gb|EZG47334.1|  60S acidic ribosomal protein P0                       80.5    2e-16   
ref|XP_009039052.1|  hypothetical protein AURANDRAFT_60208            80.1    2e-16   
ref|XP_741984.1|  ribosomal phosphoprotein P0                         79.3    2e-16   Plasmodium chabaudi chabaudi
ref|XP_004829972.1|  60S acidic ribosomal protein P0, putative        80.1    2e-16   
sp|P39096.1|RLA0_LEICH  RecName: Full=60S acidic ribosomal protei...  80.1    2e-16   Leishmania chagasi
emb|CDY67524.1|  BnaAnng24540D                                        79.7    2e-16   
gb|AAM21934.1|  ribosomal phosphoprotein P0                           80.1    2e-16   Plasmodium berghei ANKA
ref|XP_679654.1|  ribosomal phosphoprotein P0                         80.1    2e-16   Plasmodium berghei ANKA
ref|XP_009041647.1|  hypothetical protein AURANDRAFT_39285            80.1    3e-16   
gb|AAD56335.1|AC009326_22  putative 60S acidic ribosomal protein,...  79.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AFK37198.1|  unknown                                               80.1    3e-16   
ref|XP_002765467.1|  ribosomal P protein, putative                    80.1    3e-16   Perkinsus marinus ATCC 50983
dbj|BAH57858.1|  60S acidic ribosomal protein P0                      79.7    3e-16   Babesia rodhaini
emb|CAE84233.1|  ribosomal phosphoprotein                             79.7    3e-16   Plasmodium falciparum
ref|XP_008816121.1|  60S acidic ribosomal protein P0                  79.7    3e-16   
ref|NP_001078125.1|  60S acidic ribosomal protein P0-2                79.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486703.1|  PREDICTED: 60S acidic ribosomal protein P0-3     79.7    4e-16   
emb|CDS47367.1|  60S acidic ribosomal protein P0, putative            79.7    4e-16   
emb|CDO65105.1|  60S acidic ribosomal protein P0, putative            79.7    4e-16   
ref|XP_001615417.1|  60S acidic ribosomal protein P0                  79.7    4e-16   Plasmodium vivax Sal-1
ref|XP_004222525.1|  60S acidic ribosomal protein P0                  79.7    4e-16   
ref|XP_001347984.1|  60S ribosomal protein P0                         79.7    4e-16   Plasmodium falciparum 3D7
ref|XP_008624852.1|  60S acidic ribosomal protein P0                  79.7    4e-16   
ref|NP_187531.1|  60S acidic ribosomal protein P0-2                   79.7    4e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63644.1|  putative 60S acidic ribosomal protein P0              79.7    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407706.1|  hypothetical protein EUTSA_v10021147mg           79.7    4e-16   
gb|EUD72932.1|  60S acidic ribosomal protein P0                       79.7    4e-16   
ref|XP_010464557.1|  PREDICTED: 60S acidic ribosomal protein P0-3...  79.7    4e-16   
gb|KGQ11932.1|  60S acidic ribosomal protein P0                       79.7    4e-16   
ref|XP_001738409.1|  60S acidic ribosomal protein P0                  79.0    4e-16   Entamoeba dispar SAW760
ref|XP_726106.1|  ribosomal protein L10                               79.7    4e-16   Plasmodium yoelii yoelii 17XNL
ref|XP_010486773.1|  PREDICTED: 60S acidic ribosomal protein P0-3...  79.7    4e-16   
ref|XP_006298124.1|  hypothetical protein CARUB_v10014186mg           79.7    4e-16   
ref|XP_002259307.1|  ribosomal phosphoprotein                         79.7    4e-16   Plasmodium knowlesi strain H
ref|XP_010464828.1|  PREDICTED: 60S acidic ribosomal protein P0-3...  79.7    4e-16   
ref|XP_002882720.1|  60S acidic ribosomal protein P0                  79.7    4e-16   
ref|XP_006298147.1|  hypothetical protein CARUB_v10014197mg           79.7    4e-16   
gb|KFK38515.1|  hypothetical protein AALP_AA3G123100                  79.7    4e-16   
gb|KFK38306.1|  hypothetical protein AALP_AA3G096900                  79.7    4e-16   
ref|XP_008593493.1|  60S acidic ribosomal protein P0                  79.7    4e-16   
emb|CDY53103.1|  BnaCnng24330D                                        79.7    4e-16   
ref|NP_187734.1|  60S acidic ribosomal protein P0-3                   79.7    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884720.1|  60S acidic ribosomal protein P0                  79.7    4e-16   
ref|XP_010469822.1|  PREDICTED: 60S acidic ribosomal protein P0-3...  79.3    4e-16   
ref|XP_010486480.1|  PREDICTED: 60S acidic ribosomal protein P0-3...  79.3    4e-16   
emb|CDY07906.1|  BnaC03g36170D                                        79.3    4e-16   
dbj|BAN37454.1|  60S acidic ribosomal protein P0, putative            79.3    4e-16   
dbj|BAN39915.1|  60S acidic ribosomal protein P0, putative            79.3    4e-16   
dbj|BAN37452.1|  60S acidic ribosomal protein P0, putative            79.3    4e-16   
gb|AAM65265.1|  60S acidic ribosomal protein P0-C                     79.3    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123454.1|  PREDICTED: 60S acidic ribosomal protein P0-2...  79.3    5e-16   
dbj|BAN40137.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
dbj|BAN40100.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
dbj|BAN39624.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
ref|XP_009135066.1|  PREDICTED: 60S acidic ribosomal protein P0-2...  79.3    5e-16   
dbj|BAN39755.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
ref|XP_009146942.1|  PREDICTED: 60S acidic ribosomal protein P0-2     79.3    5e-16   
dbj|BAN38149.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
gb|AAY83294.1|  60s acidic ribosomal protein-like                     79.3    5e-16   Babesia sp. WA1
ref|XP_009041887.1|  hypothetical protein AURANDRAFT_39351            79.3    5e-16   
dbj|BAN38491.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
ref|XP_649340.1|  60S acidic ribosomal protein P0                     79.3    5e-16   Entamoeba histolytica HM-1:IMSS
dbj|BAN39927.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
dbj|BAN39606.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
emb|CDX73962.1|  BnaA03g30850D                                        79.3    5e-16   
dbj|BAN38993.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
ref|XP_001734355.1|  60S acidic ribosomal protein P0                  79.3    5e-16   Entamoeba dispar SAW760
ref|XP_001740880.1|  60S acidic ribosomal protein P0                  79.3    5e-16   Entamoeba dispar SAW760
dbj|BAN38267.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
dbj|BAN37785.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
dbj|BAN39575.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
dbj|BAN39226.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
dbj|BAN38349.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
dbj|BAN38629.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
dbj|BAN39831.1|  60S acidic ribosomal protein P0, putative            79.3    5e-16   
ref|XP_004360815.1|  ribosomal acidic phosphoprotein P0               81.6    5e-16   
emb|CAF18552.1|  ribosomal phosphoprotein                             79.0    6e-16   Plasmodium falciparum
ref|XP_002505583.1|  predicted protein                                79.0    6e-16   Micromonas commoda
emb|CDS29774.1|  deoxyribonuclease                                    79.0    7e-16   
ref|XP_002440235.1|  hypothetical protein SORBIDRAFT_09g028230        79.0    7e-16   Sorghum bicolor [broomcorn]
ref|XP_002776556.1|  60S acidic ribosomal protein P0, putative        79.0    7e-16   Perkinsus marinus ATCC 50983
ref|XP_006697000.1|  ribosomal protein P0-like protein                79.0    7e-16   
ref|XP_004037130.1|  ribosomal phosphoprotein, putative               79.0    7e-16   
ref|XP_001744531.1|  hypothetical protein                             79.0    7e-16   Monosiga brevicollis MX1
dbj|BAN39332.1|  60S acidic ribosomal protein P0, putative            79.0    7e-16   
ref|XP_003710994.1|  60S acidic ribosomal protein P0                  78.6    8e-16   
ref|XP_001733424.1|  60S acidic ribosomal protein P0                  79.3    8e-16   Entamoeba dispar SAW760
sp|P39097.1|RLA0_LEIIN  RecName: Full=60S acidic ribosomal protei...  78.6    9e-16   Leishmania infantum
ref|XP_006296009.1|  hypothetical protein CARUB_v10025153mg           78.2    1e-15   
gb|EJU04978.1|  hypothetical protein DACRYDRAFT_20548                 78.2    1e-15   
emb|CCC52720.1|  putative 60S acidic ribosomal subunit protein        78.2    1e-15   
ref|XP_004996745.1|  arbp-prov protein                                77.8    2e-15   
ref|XP_001697060.1|  acidic ribosomal protein P0                      78.2    2e-15   
gb|KHN34734.1|  60S acidic ribosomal protein P0                       77.0    2e-15   
gb|EKF31979.1|  60S acidic ribosomal protein P0                       77.8    2e-15   
gb|AAK69358.1|AF390866_1  ribosomal phosphoprotein P0                 77.8    2e-15   
gb|ABB29723.1|  ribosomal protein P0 large subunit                    77.0    2e-15   
ref|XP_003292089.1|  60S acidic ribosomal protein P0                  77.8    2e-15   
emb|CDW75798.1|  acidic ribosomal p0 protein                          78.2    2e-15   
dbj|BAN38628.1|  60S acidic ribosomal protein P0, putative            77.4    2e-15   
ref|XP_003885784.1|  60S acidic ribosomal protein P0                  77.4    2e-15   
dbj|GAA88658.1|  60S acidic ribosomal protein P0                      77.4    2e-15   
ref|XP_003304726.1|  60S acidic ribosomal protein P0                  77.0    3e-15   
ref|XP_007677907.1|  hypothetical protein BAUCODRAFT_578183           77.4    3e-15   
sp|Q967Y7.1|RLA0_EIMTE  RecName: Full=60S acidic ribosomal protei...  77.0    3e-15   
gb|AAY19282.1|  acidic ribosomal P0 protein                           76.3    4e-15   
ref|XP_001388852.1|  60S acidic ribosomal protein P0                  77.0    4e-15   
gb|KIH93991.1|  large subunit ribosomal protein LP0                   77.0    4e-15   
emb|CBH17108.1|  60S acidic ribosomal subunit protein, putative       77.0    4e-15   
emb|CBH17107.1|  60S acidic ribosomal subunit protein, putative       77.0    4e-15   
gb|ERS98948.1|  60S acidic ribosomal protein P0                       76.6    4e-15   
ref|XP_002583698.1|  60S acidic ribosomal protein P0                  76.6    4e-15   
ref|XP_828289.1|  60S acidic ribosomal subunit protein                77.0    4e-15   
ref|XP_005710258.1|  60S acidic ribosomal protein P0                  77.0    4e-15   
ref|XP_009219733.1|  60S acidic ribosomal protein P0                  76.6    4e-15   
emb|CBV76074.1|  60S acidic ribosomal protein P0                      76.6    5e-15   
emb|CCC94791.1|  putative 60S acidic ribosomal subunit protein        76.6    5e-15   
ref|XP_002489404.1|  60S acidic ribosomal protein P0                  76.6    5e-15   
ref|XP_006671596.1|  60S acidic ribosomal protein P0                  76.6    5e-15   
emb|CCX32801.1|  Similar to 60S acidic ribosomal protein P0; acc....  76.6    5e-15   
ref|XP_821118.1|  60S acidic ribosomal protein P0                     76.6    5e-15   
ref|XP_009314379.1|  60S acidic ribosomal subunit protein             76.6    5e-15   
ref|XP_007513516.1|  60S acidic ribosomal protein P0                  76.3    6e-15   
gb|AEE99002.1|  acidic ribosomal protein P0                           76.6    6e-15   
ref|XP_007299429.1|  hypothetical protein STEHIDRAFT_72429            76.3    6e-15   
gb|ACJ22896.1|  60S acidic ribosomal protein P0                       73.9    7e-15   
dbj|BAF91357.1|  ribosomal phosphoprotein P0                          76.3    7e-15   
gb|KFY93688.1|  hypothetical protein V500_03569                       76.3    7e-15   
gb|ACA14450.1|  ribosomal phosphoprotein P0                           75.9    8e-15   
ref|XP_007745995.1|  60S acidic ribosomal protein P0                  75.9    8e-15   
ref|XP_004336616.1|  ribosomal protein L10, putative                  76.3    8e-15   
ref|XP_007263197.1|  hypothetical protein FOMMEDRAFT_131718           75.9    8e-15   
dbj|BAF45423.1|  ribosomal phosphoprotein P0                          75.9    8e-15   
ref|XP_009160725.1|  60S acidic ribosomal protein P0                  75.9    8e-15   
dbj|BAB39163.1|  ribosomal P0 subunit protein                         76.3    8e-15   
ref|XP_821117.1|  60S acidic ribosomal protein P0                     75.9    9e-15   
ref|XP_002175920.1|  60S acidic ribosomal protein Rpp0                75.9    9e-15   
gb|EKG03452.1|  60S acidic ribosomal protein P0                       75.9    1e-14   
gb|ESS66847.1|  60S acidic ribosomal protein P0                       75.9    1e-14   
ref|XP_004257285.1|  60S acidic ribosomal protein P0, putative        75.9    1e-14   
ref|XP_004255778.1|  60S acidic ribosomal protein P0, putative        75.9    1e-14   
ref|XP_002295206.1|  predicted protein                                75.9    1e-14   
emb|CCU98827.1|  unnamed protein product                              75.5    1e-14   
gb|ADE76171.1|  unknown                                               75.1    1e-14   
gb|AAX89497.1|  acidic ribosomal P0 protein                           75.5    1e-14   
gb|AAM18123.1|AF498365_1  putative phosphoriboprotein P0              75.1    1e-14   
emb|CBK20650.2|  unnamed protein product                              77.0    1e-14   
ref|XP_001610383.1|  phosphoriboprotein P0                            75.1    1e-14   
ref|XP_008023552.1|  hypothetical protein SETTUDRAFT_105953           75.1    1e-14   
dbj|BAC10912.1|  putative 60S acidic ribosomal protein P0             74.3    2e-14   
ref|XP_004296403.1|  PREDICTED: 60S acidic ribosomal protein P0-like  75.1    2e-14   
emb|CCU76147.1|  60S acidic ribosomal protein P0                      75.1    2e-14   
gb|EPQ65973.1|  ribosomal protein P0                                  75.1    2e-14   
gb|KEQ82295.1|  hypothetical protein M438DRAFT_376307                 75.1    2e-14   
gb|KEQ99070.1|  hypothetical protein AUEXF2481DRAFT_45936             75.1    2e-14   
ref|XP_001269653.1|  60S acidic ribosomal protein P0                  75.1    2e-14   
ref|XP_003659216.1|  hypothetical protein MYCTH_2295945               75.1    2e-14   
ref|XP_007393561.1|  hypothetical protein PHACADRAFT_171498           74.7    2e-14   
gb|KDQ19333.1|  hypothetical protein BOTBODRAFT_153218                74.7    2e-14   
ref|NP_001080134.1|  ribosomal protein, large, P0                     74.7    2e-14   
ref|XP_660338.1|  RLA0_NEUCR 60S acidic ribosomal protein P0          74.7    2e-14   
ref|XP_003652382.1|  60S acidic ribosomal protein P0                  74.7    2e-14   
ref|XP_009608105.1|  PREDICTED: 60S acidic ribosomal protein P0       75.1    2e-14   
ref|XP_004239781.1|  PREDICTED: 60S acidic ribosomal protein P0       74.7    2e-14   
ref|XP_007734559.1|  large subunit ribosomal protein LP0              74.7    2e-14   
ref|XP_001805396.1|  hypothetical protein SNOG_15237                  74.7    2e-14   
gb|KFY50365.1|  hypothetical protein V496_09388                       74.7    2e-14   
emb|CAA46199.1|  ribosomal PO protein                                 74.7    2e-14   
gb|KFY30298.1|  hypothetical protein V493_02023                       74.7    2e-14   
gb|AAI51696.1|  RPLP0 protein                                         74.7    2e-14   
gb|EYE91481.1|  60S acidic ribosomal protein P0                       74.7    3e-14   
emb|CDP14047.1|  unnamed protein product                              74.7    3e-14   
gb|KFY09270.1|  hypothetical protein V491_08285                       74.3    3e-14   
gb|EGC46260.1|  60S acidic ribosomal protein P0                       74.3    3e-14   
gb|KFY45028.1|  hypothetical protein V494_01200                       74.3    3e-14   
gb|ABC47964.1|  ribosomal phosphoprotein large PO subunit             72.4    3e-14   
emb|CBK23042.2|  unnamed protein product                              74.7    3e-14   
gb|KFY10856.1|  hypothetical protein V492_04803                       74.3    3e-14   
ref|XP_007762076.1|  60S acidic ribosomal protein P0                  74.3    3e-14   
ref|XP_001880688.1|  60S acidic ribosomal protein P0                  74.3    3e-14   
ref|XP_001819941.1|  60S acidic ribosomal protein P0                  74.3    3e-14   
dbj|GAM38073.1|  ribosomal protein                                    74.3    3e-14   
ref|XP_011126772.1|  hypothetical protein AOL_s00188g222              74.3    3e-14   
ref|XP_001937964.1|  60S acidic ribosomal protein P0                  74.3    3e-14   
ref|XP_003171414.1|  60S acidic ribosomal protein P0                  74.3    3e-14   
gb|EER43325.1|  ribosomal protein P0                                  74.3    3e-14   
ref|XP_958183.1|  60S acidic ribosomal protein P0                     74.3    3e-14   
gb|AAY19280.1|  acidic ribosomal P0 protein                           74.7    3e-14   
ref|XP_003838902.1|  similar to 60s acidic ribosomal protein P0       74.3    3e-14   
gb|KEQ77160.1|  60S acidic ribosomal protein P0                       74.3    3e-14   
ref|XP_002150177.1|  60S acidic ribosomal protein P0                  74.3    3e-14   
ref|XP_008715372.1|  60S acidic ribosomal protein P0                  74.3    3e-14   
ref|XP_007827185.1|  60S acidic ribosomal protein P0                  74.3    3e-14   
gb|AIC58418.1|  RPLP0P2                                               74.3    3e-14   
ref|XP_006900213.1|  PREDICTED: 60S acidic ribosomal protein P0-like  73.9    3e-14   
ref|XP_002484085.1|  60S acidic ribosomal protein P0                  74.3    3e-14   
ref|XP_002184623.1|  predicted protein                                73.9    3e-14   
gb|EHL03649.1|  putative 60S acidic ribosomal protein P0              75.1    3e-14   
gb|AID52928.1|  60S acidic ribosomal protein P0                       74.3    4e-14   
ref|XP_002846137.1|  60S acidic ribosomal protein P0                  74.3    4e-14   
dbj|BAJ92405.1|  predicted protein                                    74.3    4e-14   
dbj|BAJ94456.1|  predicted protein                                    74.3    4e-14   
ref|XP_007800632.1|  60S acidic ribosomal protein P0                  74.3    4e-14   
gb|EMT17099.1|  60S acidic ribosomal protein P0                       74.3    4e-14   
gb|KFH47971.1|  60S acidic ribosomal protein P0-like protein          73.9    4e-14   
gb|AFW74478.1|  hypothetical protein ZEAMMB73_076912                  73.2    4e-14   
ref|XP_001541016.1|  60S acidic ribosomal protein P0                  74.3    4e-14   
gb|EIF47803.1|  60s acidic ribosomal protein p0                       74.3    4e-14   
gb|EPX73582.1|  60S acidic ribosomal protein Rpp0                     73.9    4e-14   
gb|ESL05794.1|  large subunit ribosomal protein LP0                   74.7    4e-14   
ref|XP_002154455.2|  PREDICTED: 60S acidic ribosomal protein P0-like  74.3    4e-14   
gb|EGE00113.1|  ribosomal protein P0                                  73.9    4e-14   
ref|XP_001908695.1|  hypothetical protein                             73.9    4e-14   
dbj|BAF91359.1|  ribosomal phosphoprotein P0                          73.9    4e-14   
gb|KDQ24641.1|  hypothetical protein PLEOSDRAFT_1090404               73.9    4e-14   
gb|ELR04637.1|  60S acidic ribosomal protein P0                       73.9    4e-14   
ref|XP_003239629.1|  60S acidic ribosomal protein P0                  73.6    4e-14   
gb|AFX73002.1|  deoxyribonuclease                                     74.3    4e-14   
ref|XP_002674994.1|  predicted protein                                74.3    4e-14   
gb|EJY79897.1|  Acidic ribosomal protein P0                           74.3    4e-14   
gb|KFA61469.1|  hypothetical protein S40285_03436                     73.9    4e-14   
gb|KEQ65203.1|  hypothetical protein M437DRAFT_42356                  73.9    4e-14   
gb|AFM87695.1|  ribosomal protein, large, P0                          73.6    4e-14   
gb|EGE05266.1|  ribosomal protein P0                                  73.9    5e-14   
gb|EMD31324.1|  hypothetical protein CERSUDRAFT_100519                73.9    5e-14   
gb|EZF33986.1|  60S acidic ribosomal protein P0                       73.9    5e-14   
ref|XP_387003.1|  RLA0_NEUCR 60S acidic ribosomal protein P0          73.9    5e-14   
gb|EGU89062.1|  hypothetical protein FOXB_00411                       73.9    5e-14   
ref|XP_003032365.1|  60S acidic ribosomal protein P0                  73.9    5e-14   
gb|EWG43878.1|  60S acidic ribosomal protein P0                       73.9    5e-14   
ref|XP_007684728.1|  hypothetical protein COCMIDRAFT_33843            73.9    5e-14   
ref|XP_007842195.1|  60s acidic ribosomal protein p0                  74.3    5e-14   
gb|EZF25360.1|  60S acidic ribosomal protein P0                       73.9    5e-14   
ref|XP_001220197.1|  60S acidic ribosomal protein P0                  73.9    5e-14   
gb|KFY79564.1|  hypothetical protein V499_01436                       73.9    5e-14   
ref|XP_006676559.1|  hypothetical protein BATDEDRAFT_15859            73.9    5e-14   
sp|Q9DG68.1|RLA0_RANSY  RecName: Full=60S acidic ribosomal protei...  73.9    5e-14   
gb|KFX88947.1|  hypothetical protein V490_07313                       74.3    5e-14   
gb|KFY36632.1|  hypothetical protein V495_07713                       74.3    5e-14   
gb|ESL05410.1|  large subunit ribosomal protein LP0                   73.9    5e-14   
gb|AFM86008.1|  ribosomal protein, large, P0                          73.9    5e-14   
gb|AFM86828.1|  ribosomal protein, large, P0                          73.9    5e-14   
gb|EME44173.1|  hypothetical protein DOTSEDRAFT_71859                 73.9    5e-14   
ref|XP_002958097.1|  hypothetical protein VOLCADRAFT_84328            73.9    5e-14   
ref|XP_011115731.1|  hypothetical protein H072_10253                  73.6    5e-14   
gb|AAS49564.1|  ribosomal protein Large P0                            73.2    6e-14   
gb|KFX97316.1|  hypothetical protein O988_04925                       73.9    6e-14   
gb|AAF21661.1|  acidic ribosomal phosphoprotein P0                    72.4    6e-14   
ref|XP_003017716.1|  hypothetical protein ARB_04599                   73.9    6e-14   
gb|ACQ57902.1|  60S acidic ribosomal protein P0                       73.6    6e-14   
gb|EHK40862.1|  hypothetical protein TRIATDRAFT_258952                73.6    6e-14   
ref|XP_007362337.1|  60S acidic ribosomal protein P0                  73.6    6e-14   
gb|AFK10546.1|  ribosomal protein, large, P0                          73.6    6e-14   
ref|XP_004051392.1|  PREDICTED: 60S acidic ribosomal protein P0-like  72.8    6e-14   
emb|CCG83300.1|  60S acidic ribosomal protein Rpp0                    73.6    6e-14   
gb|AFM89459.1|  ribosomal protein, large, P0                          73.6    6e-14   
gb|EMD94481.1|  hypothetical protein COCHEDRAFT_1020389               73.6    6e-14   
ref|XP_007580369.1|  putative 60s acidic ribosomal protein p0 pro...  73.6    6e-14   
gb|EPQ15063.1|  60S acidic ribosomal protein P0                       72.0    6e-14   
ref|XP_007913139.1|  putative 60s acidic ribosomal protein p0 pro...  73.6    7e-14   
gb|EQL02415.1|  60S acidic ribosomal protein P0                       73.6    7e-14   
gb|EPE06365.1|  60s acidic ribosomal protein p0                       73.6    7e-14   
gb|AFM89472.1|  ribosomal protein, large, P0                          73.6    7e-14   
ref|XP_003024960.1|  hypothetical protein TRV_00881                   73.9    7e-14   
ref|NP_001279963.1|  ribosomal protein, large, P0                     73.6    7e-14   
gb|AFM89518.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM88893.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM87759.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM86948.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM85484.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|ABB29594.1|  ribosomal protein P0 large subunit                    73.2    7e-14   
gb|AFM87081.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM86570.1|  ribosomal protein, large, P0                          73.6    7e-14   
emb|CDP06275.1|  unnamed protein product                              72.8    7e-14   
emb|CDH51891.1|  60s acidic ribosomal protein p0                      73.2    7e-14   
gb|AFM86528.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM89484.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM85937.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM85775.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|KEY70589.1|  hypothetical protein S7711_02193                      73.6    7e-14   
gb|AIJ27190.1|  60S acidic ribosomal protein P0                       72.4    7e-14   
gb|AHK09712.1|  60S acidic ribosomal protein P0                       72.4    7e-14   
gb|AFM86966.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM86675.1|  ribosomal protein, large, P0                          73.6    7e-14   
gb|AFM86580.1|  ribosomal protein, large, P0                          73.6    7e-14   
ref|XP_002796942.1|  60S acidic ribosomal protein P0                  73.6    7e-14   
ref|XP_001265158.1|  60S acidic ribosomal protein P0                  73.6    7e-14   
emb|CDO74988.1|  hypothetical protein BN946_scf184945.g60             73.2    8e-14   
gb|EKG21991.1|  Ribosomal protein L10/acidic P0                       73.6    8e-14   
ref|XP_006205714.1|  PREDICTED: 60S acidic ribosomal protein P0-like  72.4    8e-14   
gb|AFM86819.1|  ribosomal protein, large, P0                          73.2    8e-14   
gb|AFM86446.1|  ribosomal protein, large, P0                          73.2    8e-14   
ref|XP_009545405.1|  hypothetical protein HETIRDRAFT_409064           73.2    8e-14   
ref|XP_007798790.1|  putative 60s acidic ribosomal protein p0 pro...  73.2    8e-14   
ref|XP_004464729.1|  PREDICTED: 60S acidic ribosomal protein P0       72.8    8e-14   
pdb|4W22|QQ  Chain q, Structure Of The 80s Mammalian Ribosome Bou...  72.4    8e-14   
gb|AFM90832.1|  ribosomal protein, large, P0                          73.2    8e-14   
gb|AFM88521.1|  ribosomal protein, large, P0                          73.2    8e-14   
gb|AFM87161.1|  ribosomal protein, large, P0                          73.2    8e-14   
gb|AFM85590.1|  ribosomal protein, large, P0                          73.2    8e-14   
ref|XP_004972933.1|  PREDICTED: 60S acidic ribosomal protein P0-like  73.2    8e-14   
ref|XP_004194395.1|  Piso0_004886                                     73.2    8e-14   
gb|KHJ33364.1|  putative 60s acidic ribosomal protein p0              73.2    8e-14   
ref|XP_004958562.1|  PREDICTED: 60S acidic ribosomal protein P0-like  73.2    8e-14   
ref|XP_007709005.1|  hypothetical protein COCCADRAFT_2324             73.2    8e-14   
ref|XP_007696720.1|  hypothetical protein COCSADRAFT_157383           73.2    8e-14   
gb|KGO75426.1|  Ribosomal protein L10/acidic P0                       73.2    8e-14   
ref|XP_002620604.1|  60S acidic ribosomal protein P0                  73.2    8e-14   
ref|XP_006039721.1|  PREDICTED: 60S acidic ribosomal protein P0-like  72.4    9e-14   
emb|CEJ95041.1|  Putative 60S acidic ribosomal protein P0             73.2    9e-14   
gb|EJT49600.1|  60S acidic ribosomal protein                          73.2    9e-14   



>ref|XP_001032358.2| 60s Acidic ribosomal protein [Tetrahymena thermophila]
 gb|AAY19283.1| acidic ribosomal P0 protein [Tetrahymena thermophila]
 gb|EAR84695.2| 60S acidic ribosomal protein P0 [Tetrahymena thermophila SB210]
Length=324

 Score =   106 bits (264),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +A  +V IP GPTG+DPSQI+FFH L+ISTKIQKGQIEITKE +VC KGKKIGNSE ++L
Sbjct  134  VAQKDVMIPPGPTGMDPSQINFFHALSISTKIQKGQIEITKEVQVCTKGKKIGNSEVSLL  193

Query  24   SKLNIKPF  1
             K+NI+PF
Sbjct  194  EKMNIQPF  201



>dbj|BAG12793.1| putative ribosomal protein P0 [Sorogena stoianovitchae]
Length=153

 Score =   102 bits (255),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +  I  GPTG+DPSQI+FFH L+I TKI KGQIEITKEF+V  KGKKIGNSE+A+L
Sbjct  3    VAPIDFVIAPGPTGMDPSQIAFFHALSIPTKINKGQIEITKEFRVATKGKKIGNSESALL  62

Query  24   SKLNIKPF  1
             KLN+KPF
Sbjct  63   QKLNLKPF  70



>ref|XP_004035413.1| ribosomal phosphoprotein, putative [Ichthyophthirius multifiliis]
 gb|EGR31927.1| ribosomal phosphoprotein, putative [Ichthyophthirius multifiliis]
Length=326

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +A  +V IP GPT +DPSQI+FFH L ISTKIQKGQIEITKE  VC KGKKIGNSE A+L
Sbjct  136  IAQKDVFIPPGPTNMDPSQINFFHALQISTKIQKGQIEITKEVHVCVKGKKIGNSEVALL  195

Query  24   SKLNIKPF  1
             K+N++PF
Sbjct  196  EKMNVQPF  203



>ref|XP_002896775.1| 60S acidic ribosomal protein P0 [Phytophthora infestans T30-4]
 gb|EEY66710.1| 60S acidic ribosomal protein P0 [Phytophthora infestans T30-4]
Length=318

 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P GPTG DP Q SFF  L I+TKIQKGQIEI  E  +  KG+K+GNSEAA+L
Sbjct  116  IAPVDVIVPPGPTGADPGQTSFFQALQIATKIQKGQIEIVTEVMLTRKGEKVGNSEAALL  175

Query  24   SKLNIKPF  1
             KL+IKPF
Sbjct  176  QKLDIKPF  183



>ref|XP_008612085.1| 50S ribosomal protein LP0 [Saprolegnia diclina VS20]
 gb|EQC34679.1| 50S ribosomal protein LP0 [Saprolegnia diclina VS20]
Length=316

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V  PAGPTG DP Q SFF  L I TKIQKGQIEI  +  + +KG+K+GNSEAA+L
Sbjct  116  IAPVDVWCPAGPTGCDPGQTSFFQALQIGTKIQKGQIEIVSDVLLTKKGEKVGNSEAALL  175

Query  24   SKLNIKPF  1
             KLNI+PF
Sbjct  176  QKLNIRPF  183



>gb|KDO34134.1| hypothetical protein SPRG_01404 [Saprolegnia parasitica CBS 223.65]
Length=317

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V  PAGPTG DP Q SFF  L I TKIQKGQIEI  +  + +KG+K+GNSEAA+L
Sbjct  116  VAPVDVWCPAGPTGCDPGQTSFFQALQIGTKIQKGQIEIVSDVLLTKKGEKVGNSEAALL  175

Query  24   SKLNIKPF  1
             KLNI+PF
Sbjct  176  QKLNIRPF  183



>ref|XP_009513921.1| hypothetical protein PHYSODRAFT_353332 [Phytophthora sojae]
 gb|EGZ26646.1| hypothetical protein PHYSODRAFT_353332 [Phytophthora sojae]
Length=317

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P GPTG DP Q SFF  L I+TKIQKGQIEI  E  +  KG+K+GNSEAA+L
Sbjct  116  IAPVDVIVPPGPTGADPGQTSFFQALQIATKIQKGQIEIVTEVLLTRKGEKVGNSEAALL  175

Query  24   SKLNIKPF  1
             KL+IKPF
Sbjct  176  QKLDIKPF  183



>ref|XP_008904900.1| hypothetical protein PPTG_11356 [Phytophthora parasitica INRA-310]
 gb|ETI47684.1| hypothetical protein F443_08148 [Phytophthora parasitica P1569]
 gb|ETK87619.1| hypothetical protein L915_07975 [Phytophthora parasitica]
 gb|ETL41017.1| hypothetical protein L916_07899 [Phytophthora parasitica]
 gb|ETL94197.1| hypothetical protein L917_07795 [Phytophthora parasitica]
 gb|ETM47425.1| hypothetical protein L914_07863 [Phytophthora parasitica]
 gb|ETN09754.1| hypothetical protein PPTG_11356 [Phytophthora parasitica INRA-310]
 gb|ETO76399.1| hypothetical protein F444_08202 [Phytophthora parasitica P1976]
 gb|ETP17487.1| hypothetical protein F441_08122 [Phytophthora parasitica CJ01A1]
 gb|ETP45519.1| hypothetical protein F442_08087 [Phytophthora parasitica P10297]
Length=317

 Score = 92.8 bits (229),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P GPTG DP Q SFF  L I+TKIQKGQIEI  E  +  KG+K+GNSEAA+L
Sbjct  116  IAPVDVIVPPGPTGADPGQTSFFQALQIATKIQKGQIEIVTEVLLTRKGEKVGNSEAALL  175

Query  24   SKLNIKPF  1
             KL+IKPF
Sbjct  176  QKLDIKPF  183



>emb|CCA22079.1| 60S acidic ribosomal protein P0 putative [Albugo laibachii Nc14]
Length=318

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +APA+V +P G TG DP Q SFF  L I+TKIQKGQIEI  E  + ++G+K+GNSEAA+L
Sbjct  116  VAPADVVVPPGSTGCDPGQTSFFQALQIATKIQKGQIEIVSEVLLIKEGEKVGNSEAALL  175

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  176  QKLNINPF  183



>ref|XP_005784062.1| hypothetical protein EMIHUDRAFT_456254 [Emiliania huxleyi CCMP1516]
 gb|EOD31633.1| hypothetical protein EMIHUDRAFT_456254 [Emiliania huxleyi CCMP1516]
Length=317

 Score = 90.1 bits (222),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +APA  TIP GPTGLDP+Q SFF  LNI+TKI KG IEI  + +V + G K+G SEAA+L
Sbjct  117  IAPASCTIPKGPTGLDPAQTSFFQALNIATKINKGSIEIINDCEVIKVGNKVGTSEAALL  176

Query  24   SKLNIKPF  1
            +KL +KPF
Sbjct  177  TKLGVKPF  184



>ref|XP_009823852.1| hypothetical protein H257_02063 [Aphanomyces astaci]
 gb|ETV87053.1| hypothetical protein H257_02063 [Aphanomyces astaci]
Length=316

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V  PAGPTG DP Q SFF  L I TKIQKGQIEI  +  + + G+K+GNSEA +L
Sbjct  116  VAPVDVWCPAGPTGCDPGQTSFFQALQIGTKIQKGQIEIVADVLLTKAGEKVGNSEAVLL  175

Query  24   SKLNIKPF  1
             KLNI+PF
Sbjct  176  QKLNIRPF  183



>ref|XP_002140323.1| 60S acidic ribosomal protein P0 [Cryptosporidium muris RN66]
 gb|EEA05974.1| 60S acidic ribosomal protein P0, putative [Cryptosporidium muris 
RN66]
Length=308

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +VT+PAG TGLDPSQ SFF  L I+TKI KGQ+EI  +  + E+GKK+  S+A +L
Sbjct  116  IAPCDVTVPAGATGLDPSQTSFFQALGIATKIVKGQVEIQSDVHLIEEGKKVTASQAVLL  175

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  176  QKLNIKPF  183



>ref|XP_008865510.1| hypothetical protein H310_03433 [Aphanomyces invadans]
 gb|ETW05733.1| hypothetical protein H310_03433 [Aphanomyces invadans]
Length=316

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V  PAGPTG DP Q SFF  L I TKIQKGQIEI  +  + + G+K+GNSEA +L
Sbjct  116  IAPIDVWCPAGPTGCDPGQTSFFQALQIGTKIQKGQIEIVADVLLTKAGEKVGNSEAVLL  175

Query  24   SKLNIKPF  1
             KLNI+PF
Sbjct  176  QKLNIRPF  183



>ref|XP_001445033.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK77636.1| unnamed protein product [Paramecium tetraurelia]
Length=278

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DP+ I FFH L I TKI+KGQI+ITK+F V + G+K+G S+A +L
Sbjct  135  IAPIDVVIPPGPTGMDPASIQFFHALQIPTKIEKGQIQITKDFVVLKTGQKVGQSQAVLL  194

Query  24   SKLNIKPF  1
             KL  KPF
Sbjct  195  QKLGKKPF  202



>ref|XP_002960810.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
 gb|EFJ38349.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
Length=321

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +VTIP G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKGTVEIVSSVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_001447582.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK80185.1| unnamed protein product [Paramecium tetraurelia]
Length=323

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DP+ I FFH L I TKI+KGQI+ITK+F V + G+K+G S+A +L
Sbjct  134  VAPIDVVIPPGPTGMDPASIQFFHALQIPTKIEKGQIQITKDFVVLKTGQKVGQSQAVLL  193

Query  24   SKLNIKPF  1
             KL  KPF
Sbjct  194  QKLGKKPF  201



>ref|XP_001436877.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK69480.1| unnamed protein product [Paramecium tetraurelia]
Length=323

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DP+ I FFH L I TKI+KGQI+ITK+F V + G+K+G S+A +L
Sbjct  134  IAPIDVVIPPGPTGMDPASIQFFHALQIPTKIEKGQIQITKDFVVLKTGQKVGQSQAVLL  193

Query  24   SKLNIKPF  1
             KL  KPF
Sbjct  194  QKLGKKPF  201



>ref|XP_001428998.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK61600.1| unnamed protein product [Paramecium tetraurelia]
Length=323

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DP+ I FFH L I TKI+KGQI+ITK+F V + G+K+G S+A +L
Sbjct  134  VAPIDVVIPPGPTGMDPASIQFFHALQIPTKIEKGQIQITKDFVVLKTGQKVGQSQAVLL  193

Query  24   SKLNIKPF  1
             KL  KPF
Sbjct  194  QKLGKKPF  201



>ref|XP_001448466.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK81069.1| unnamed protein product [Paramecium tetraurelia]
Length=323

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DP+ I FFH L I TKI+KGQI+ITK+F V + G+K+G S+A +L
Sbjct  134  VAPIDVVIPPGPTGMDPASIQFFHALQIPTKIEKGQIQITKDFVVLKTGQKVGQSQAVLL  193

Query  24   SKLNIKPF  1
             KL  KPF
Sbjct  194  QKLGKKPF  201



>ref|XP_005850392.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
 gb|EFN58290.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
Length=314

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +VTIP G TG+DPSQ SFF  LNI TKI KG +EIT +  + + G K+G SEA +L
Sbjct  118  VAPNDVTIPGGNTGMDPSQTSFFQVLNIPTKINKGSVEITADVHLIKTGDKVGASEATLL  177

Query  24   SKLNIKPF  1
            +KL IKPF
Sbjct  178  AKLGIKPF  185



>ref|XP_002974292.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
 ref|XP_002985667.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ13245.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ24514.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
Length=318

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +VTIP G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKGTVEIVSSVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_002983859.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
 gb|EFJ14871.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
Length=322

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +VTIP G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKGTVEIVSSVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_001439215.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK71818.1| unnamed protein product [Paramecium tetraurelia]
Length=306

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DP+ I FFH L I TKI+KGQI+ITK+F V + G+K+G S+A +L
Sbjct  117  VAPIDVVIPPGPTGMDPASIQFFHALQIPTKIEKGQIQITKDFVVLKTGQKVGQSQAVLL  176

Query  24   SKLNIKPF  1
             KL  KPF
Sbjct  177  QKLGKKPF  184



>ref|XP_004247949.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=320

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI+TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  IAPVDVIVPPGNTGLDPSQTSFFQVLNIATKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>gb|EFA86145.1| ribosomal acidic phosphoprotein P0 [Polysphondylium pallidum 
PN500]
Length=307

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
             AP +V +PAGPTGL+P+Q SF   L I+TKI KGQI+I KE  + + G+K+G SEA +L
Sbjct  115  FAPVDVIVPAGPTGLEPTQTSFLQDLKIATKINKGQIDIEKEVHLIKVGQKVGASEATLL  174

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  175  QKLNIKPF  182



>ref|XP_009799989.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=319

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EIT   ++ +KG+K+G+SE+A+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEITIPVEIIKKGEKVGSSESALL  178

Query  24   SKLNIKPF  1
            SKL IKPF
Sbjct  179  SKLGIKPF  186



>gb|KHG21849.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=237

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG+K+G+SEAA+L
Sbjct  35   VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTAVELIRKGEKVGSSEAALL  94

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  95   SKLGIRPF  102



>gb|KHG01938.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=253

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG+K+G+SEAA+L
Sbjct  51   VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTAVELIRKGEKVGSSEAALL  110

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  111  SKLGIRPF  118



>gb|EWM28546.1| 60s acidic ribosomal protein p0 [Nannochloropsis gaditana]
Length=421

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            LAP  V +P GPTG DP Q SFF  L I+TKI KGQIEIT   ++ ++G K+GNSEA +L
Sbjct  218  LAPCNVIVPPGPTGCDPGQTSFFQALQIATKITKGQIEITTAVQILKEGDKVGNSEAILL  277

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  278  QKLNILPF  285



>ref|XP_009592351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=319

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI +G +EIT   ++ +KG+K+G+SE+A+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINRGTVEITIPVEIIKKGEKVGSSESALL  178

Query  24   SKLNIKPF  1
            SKL IKPF
Sbjct  179  SKLGIKPF  186



>gb|KDP46515.1| hypothetical protein JCGZ_08487 [Jatropha curcas]
Length=319

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P GPTGLDPS  SFF  LNI TKI KG +EI     + +KG+K+G+SE+A+L
Sbjct  119  IAPIDVVVPPGPTGLDPSMTSFFQALNIPTKINKGSVEIVTAVDLIKKGEKVGSSESALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLQIRPF  186



>ref|XP_003573632.1| PREDICTED: 60S acidic ribosomal protein P0-like [Brachypodium 
distachyon]
Length=323

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q SFF  LNI TKI KG +EI     + +KG K+G+SEAA+L
Sbjct  122  IAPIDVVVPAGNTGLDPTQTSFFQVLNIPTKINKGTVEIIANVDLIKKGDKVGSSEAALL  181

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  182  AKLGIRPF  189



>ref|XP_001712426.1| rla0 [Hemiselmis andersenii]
 gb|ABW98101.1| rla0 [Hemiselmis andersenii]
Length=309

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +A  EV IPAGPT L P   SFF  LNI TKIQKGQIEI    K+ EKGK +GNSEAA+L
Sbjct  113  IAQNEVIIPAGPTELPPDGTSFFQALNIPTKIQKGQIEIQDPIKLIEKGKVVGNSEAALL  172

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  173  KKLNIVPF  180



>gb|ABO31368.1| 60S ribosomal protein [Gossypium hirsutum]
Length=228

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG+K+G+SEAA+L
Sbjct  115  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTAVELIRKGEKVGSSEAALL  174

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  175  SKLGIRPF  182



>ref|XP_003063696.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52069.1| predicted protein [Micromonas pusilla CCMP1545]
Length=315

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP EV IPAGPTG++PSQ  FF  LNI+TKI KG IEI  +FK  E G+K+ +S A +L
Sbjct  118  IAPCEVVIPAGPTGMEPSQTGFFQVLNIATKINKGAIEILSDFKCVEAGEKVTSSAATLL  177

Query  24   SKLNIKPF  1
             K+   PF
Sbjct  178  GKMGFTPF  185



>emb|CBN80296.1| conserved unknown protein [Ectocarpus siliculosus]
Length=285

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P GPTG DP Q SFF  L + TKI KGQIEIT +  +  KG+K+G+SEAA+L
Sbjct  79   IAPIDVMVPPGPTGCDPGQTSFFQVLQVPTKITKGQIEITTQVFLVPKGQKVGSSEAALL  138

Query  24   SKLNIKPF  1
             KL+I+PF
Sbjct  139  QKLSIRPF  146



>ref|XP_668216.1| ribosomal P protein [Cryptosporidium hominis TU502]
Length=310

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP  V +PAG TGLDPSQ SFF  L I+TKI KGQ+EI  +  + ++GKK+  S+A +L
Sbjct  116  IAPCNVVVPAGATGLDPSQTSFFQALGIATKIVKGQVEIQSDVNLIDEGKKVTASQAVLL  175

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  176  QKLNIKPF  183



>gb|EPY32839.1| large subunit ribosomal protein LP0 [Angomonas deanei]
Length=306

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IPAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS AA+L
Sbjct  105  IAPCDVIIPAGNTGMEPTQTSFFQALNIATKIAKGTVEIVSEKKVLSTGDKVDNSTAALL  164

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  165  QKLNISPF  172



>ref|XP_008779152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Phoenix dactylifera]
Length=221

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  20   VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  79

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  80   AKLGIRPF  87



>ref|XP_625816.1| ribosomal protein PO like protein of the L10 family [Cryptosporidium 
parvum Iowa II]
 gb|EAK87938.1| ribosomal protein PO like protein of the L10 family [Cryptosporidium 
parvum Iowa II]
Length=318

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP  V +PAG TGLDPSQ SFF  L I+TKI KGQ+EI  +  + ++GKK+  S+A +L
Sbjct  124  IAPCNVVVPAGATGLDPSQTSFFQALGIATKIVKGQVEIQSDVNLIDEGKKVTASQAVLL  183

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  184  QKLNIKPF  191



>gb|EPY24787.1| large subunit ribosomal protein LP0 [Angomonas deanei]
 gb|EPY39905.1| large subunit ribosomal protein LP0 [Angomonas deanei]
 gb|EPY40370.1| large subunit ribosomal protein LP0 [Angomonas deanei]
 gb|EPY41767.1| large subunit ribosomal protein LP0 [Angomonas deanei]
Length=324

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IPAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS AA+L
Sbjct  123  IAPCDVIIPAGNTGMEPTQTSFFQALNIATKIAKGTVEIVSEKKVLSTGDKVDNSTAALL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>gb|EPY30204.1| large subunit ribosomal protein LP0 [Angomonas deanei]
Length=324

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IPAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS AA+L
Sbjct  123  IAPCDVIIPAGNTGMEPTQTSFFQALNIATKIAKGTVEIVSEKKVLSTGDKVDNSTAALL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>ref|XP_010095082.1| 60S acidic ribosomal protein P0 [Morus notabilis]
 gb|EXB58188.1| 60S acidic ribosomal protein P0 [Morus notabilis]
Length=320

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>dbj|GAM19306.1| hypothetical protein SAMD00019534_024810 [Acytostelium subglobosum 
LB1]
Length=309

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
             AP +V +PAGPTG++P+Q SF   L I+TKI KGQI+I +E  + + G+K+G SEA +L
Sbjct  115  FAPNDVIVPAGPTGMEPTQTSFLQELKIATKINKGQIDIEREVHLIKAGQKVGASEATLL  174

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  175  QKLNIKPF  182



>ref|XP_008457380.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis melo]
Length=320

 Score = 85.1 bits (209),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>ref|XP_003886551.1| unnamed protein product, partial [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ40974.1| unnamed protein product, partial [Leishmania mexicana MHOM/GT/2001/U1103]
Length=200

 Score = 84.0 bits (206),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L
Sbjct  1    IAPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVEIVTEKKVLNTGDKVDNSTATLL  60

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  61   QKLNISPF  68



>ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
 gb|ESW35519.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
Length=317

 Score = 85.1 bits (209),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG+K+G+SEAA+L
Sbjct  119  IAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLAIRPF  186



>ref|XP_009619762.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=323

 Score = 85.1 bits (209),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPVDVIVPTGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>emb|CAA39657.1| ribosomal acidic phosphoprotein P0 [Dictyostelium discoideum]
Length=305

 Score = 85.1 bits (209),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
             AP +V IPAGPTG++P+Q SF   L I+TKI +GQI+I  E  + + G+K+G SEA +L
Sbjct  115  FAPNDVIIPAGPTGMEPTQTSFLQDLKIATKINRGQIDIVNEVHIIKTGQKVGASEATLL  174

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  175  QKLNIKPF  182



>ref|XP_006360336.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=320

 Score = 85.1 bits (209),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI +G +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPVDVIVPPGNTGLDPSQTSFFQVLNIPTKINRGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>ref|XP_004145258.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004152959.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004168551.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 gb|KGN65800.1| hypothetical protein Csa_1G530120 [Cucumis sativus]
Length=320

 Score = 85.1 bits (209),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>ref|XP_637692.1| ribosomal acidic phosphoprotein P0 [Dictyostelium discoideum 
AX4]
 sp|P22685.2|RLA0_DICDI RecName: Full=60S acidic ribosomal protein P0 [Dictyostelium 
discoideum]
 gb|EAL64177.1| ribosomal acidic phosphoprotein P0 [Dictyostelium discoideum 
AX4]
Length=305

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
             AP +V IPAGPTG++P+Q SF   L I+TKI +GQI+I  E  + + G+K+G SEA +L
Sbjct  115  FAPNDVIIPAGPTGMEPTQTSFLQDLKIATKINRGQIDIVNEVHIIKTGQKVGASEATLL  174

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  175  QKLNIKPF  182



>ref|XP_005707548.1| 60S acidic ribosomal protein P0 [Galdieria sulphuraria]
 gb|EME31028.1| 60S acidic ribosomal protein P0 [Galdieria sulphuraria]
Length=346

 Score = 85.1 bits (209),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
             A  +V IPAGPTG++P+  SFF  LNI TKI KGQIEI  +  + ++G+++GNSE  +L
Sbjct  115  FAQCDVVIPAGPTGMEPTMTSFFQALNIPTKINKGQIEIQSDVTLLKEGQRVGNSEQTLL  174

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  175  QKLNIKPF  182



>ref|XP_010685586.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=324

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEA +L
Sbjct  123  VAPIDVVIPPGNTGLDPSQTSFFQALNIPTKINKGTVEIITPVEIIKKGDKVGSSEAMLL  182

Query  24   SKLNIKPF  1
            SKL IKPF
Sbjct  183  SKLAIKPF  190



>ref|XP_010534571.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=321

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_010534676.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=320

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  118  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_011084927.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=315

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>ref|XP_009399833.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_006848156.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
 gb|ERN09737.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
Length=322

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_010689885.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=321

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|EPS69246.1| p0 ribosomal protein-like protein, partial [Genlisea aurea]
Length=329

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  126  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  185

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  186  AKLGIRPF  193



>ref|XP_007009052.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
 gb|EOY17862.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
Length=321

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  120  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  179

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  180  AKLGIRPF  187



>ref|XP_009409427.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_009389889.1| PREDICTED: 60S acidic ribosomal protein P0 [Musa acuminata subsp. 
malaccensis]
Length=319

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_010554654.1| PREDICTED: 60S acidic ribosomal protein P0 [Tarenaya hassleriana]
Length=320

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  118  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>gb|KHN36391.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=321

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIMKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLAIRPF  186



>gb|ABK95701.1| unknown [Populus trichocarpa]
Length=322

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_011072152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=330

 Score = 84.7 bits (208),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>ref|XP_007009051.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
 gb|EOY17861.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
Length=320

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEE89516.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=322

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|KHG08087.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_002526873.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF35504.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=320

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|AAF34767.1|AF227622_1 60S acidic ribosomal protein PO [Euphorbia esula]
Length=317

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  116  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  175

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  176  AKLGIRPF  183



>ref|XP_007222847.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
 ref|XP_008222707.1| PREDICTED: 60S acidic ribosomal protein P0 [Prunus mume]
 gb|EMJ24046.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
Length=319

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_011035984.1| PREDICTED: 60S acidic ribosomal protein P0 [Populus euphratica]
Length=320

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_008799093.1| PREDICTED: 60S acidic ribosomal protein P0 [Phoenix dactylifera]
Length=320

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|KHG25462.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_010926952.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=320

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|KHN34735.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=320

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIMKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLAIRPF  186



>ref|XP_002315165.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEF01336.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=320

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_011042597.1| PREDICTED: 60S acidic ribosomal protein P0-like [Populus euphratica]
Length=321

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|ABK94988.1| unknown [Populus trichocarpa]
 gb|ABK95694.1| unknown [Populus trichocarpa]
Length=320

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_011076719.1| PREDICTED: 60S acidic ribosomal protein P0 [Sesamum indicum]
Length=321

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>emb|CCI41647.1| unnamed protein product [Albugo candida]
Length=518

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +APA+V IP G TG DP Q SFF  L I+TKIQKGQIEI  E  + ++G K+GNSEA +L
Sbjct  116  IAPADVVIPPGSTGCDPGQTSFFQALQIATKIQKGQIEIVSEVLLIKEGDKVGNSEAVLL  175

Query  24   SKLNIKPF  1
             KL+I PF
Sbjct  176  QKLSINPF  183



>ref|XP_001759592.1| predicted protein [Physcomitrella patens]
 gb|EDQ75504.1| predicted protein [Physcomitrella patens]
Length=319

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIAPVELVHKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>sp|P29764.1|RLA0_OXYRB RecName: Full=60S acidic ribosomal protein P0; AltName: Full=Light-induced 
34 kDa protein [Oxybasis rubra]
 emb|CAA33276.1| 34kD light-induced protein [Oxybasis rubra]
Length=321

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_006350830.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=318

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SE+A+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVEIIKKGEKVGSSESALL  178

Query  24   SKLNIKPF  1
            SKL IKPF
Sbjct  179  SKLLIKPF  186



>emb|CDP16385.1| unnamed protein product [Coffea canephora]
Length=322

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SE+A+L
Sbjct  119  IAPDDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGDKVGSSESALL  178

Query  24   SKLNIKPF  1
            SKL ++PF
Sbjct  179  SKLGVRPF  186



>emb|CBI25508.3| unnamed protein product [Vitis vinifera]
Length=292

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  91   VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  150

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  151  AKLGIRPF  158



>gb|KFK36893.1| hypothetical protein AALP_AA4G185700 [Arabis alpina]
Length=318

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>emb|CBI31491.3| unnamed protein product [Vitis vinifera]
Length=292

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  91   VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  150

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  151  AKLGIRPF  158



>ref|XP_010941551.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=321

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|EYU43500.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=322

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>gb|AFK46889.1| unknown [Medicago truncatula]
Length=323

 Score = 84.3 bits (207),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES99553.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score = 84.3 bits (207),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|EYU19990.1| hypothetical protein MIMGU_mgv1a0100892mg, partial [Erythranthe 
guttata]
Length=213

 Score = 83.6 bits (205),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  10   VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALL  69

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  70   SKLGIRPF  77



>gb|EYU43501.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=321

 Score = 84.3 bits (207),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  118  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  178  SKLGIRPF  185



>ref|XP_004241171.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=318

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SE+A+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVEIIKKGEKVGSSESALL  178

Query  24   SKLNIKPF  1
            SKL IKPF
Sbjct  179  SKLLIKPF  186



>ref|XP_003876716.1| putative 60S acidic ribosomal subunit protein [Leishmania mexicana 
MHOM/GT/2001/U1103]
 ref|XP_003886550.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ28241.1| putative 60S acidic ribosomal subunit protein [Leishmania mexicana 
MHOM/GT/2001/U1103]
 emb|CBZ40973.1| unnamed protein product [Leishmania mexicana MHOM/GT/2001/U1103]
Length=322

 Score = 84.3 bits (207),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L
Sbjct  123  IAPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVEIVTEKKVLNTGDKVDNSTATLL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|EMS52841.1| 60S acidic ribosomal protein P0 [Triticum urartu]
Length=263

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI     + +KG K+G+SEAA+L
Sbjct  61   IAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGSVEIVAHVDLIKKGDKVGSSEAALL  120

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  121  AKLGIRPF  128



>gb|EYU18304.1| hypothetical protein MIMGU_mgv1a010092mg [Erythranthe guttata]
Length=322

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>ref|XP_765821.1| 60S acidic ribosomal protein, P0 [Theileria parva strain Muguga]
 gb|EAN33538.1| 60S acidic ribosomal protein, P0, putative [Theileria parva]
Length=321

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP++V IPAG TGLDPSQ SFF  L ISTKI KGQIEI  E  + +K  K+  S A +L
Sbjct  125  IAPSDVFIPAGSTGLDPSQTSFFQALGISTKIVKGQIEIQNEVHLIKKDDKVTASGATLL  184

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  185  QKLNIKPF  192



>ref|XP_003082807.1| RLA0_MAIZE 60S acidic ribosomal protein P0 pir||T03944 acidic 
ribosomal protein P0-maize (ISS) [Ostreococcus tauri]
Length=321

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP EV +PAGPTG++PSQ SFF TLNI+TKI KG IEI  +  V + G ++ +S AA+L
Sbjct  124  IAPVEVVVPAGPTGMEPSQTSFFQTLNIATKINKGSIEILNDIVVLKVGDRVSSSAAALL  183

Query  24   SKLNIKPF  1
            SK+   PF
Sbjct  184  SKMKFTPF  191



>ref|XP_001759851.1| predicted protein [Physcomitrella patens]
 gb|EDQ75355.1| predicted protein [Physcomitrella patens]
Length=318

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIAPVELVHKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|EYU43502.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=242

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  39   VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALL  98

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  99   SKLGIRPF  106



>ref|XP_010256605.1| PREDICTED: 60S acidic ribosomal protein P0 [Nelumbo nucifera]
Length=319

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>gb|EYU22330.1| hypothetical protein MIMGU_mgv1a019166mg, partial [Erythranthe 
guttata]
Length=230

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  13   VAPIDVIVPRGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGNKVGSSEAALL  72

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  73   SKLGIRPF  80



>sp|P50345.1|RLA0_LUPLU RecName: Full=60S acidic ribosomal protein P0 [Lupinus luteus]
 emb|CAA63786.1| P0 ribosomal protein [Lupinus luteus]
Length=322

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_010067511.1| PREDICTED: 60S acidic ribosomal protein P0 [Eucalyptus grandis]
 gb|KCW65656.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=320

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  118  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  118  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIMPVELIKKGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_005650079.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25535.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
Length=319

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP  V +PAG TGLDPSQ SFF  LNI TKI +G +EI  +  + +  +K+G SEA +L
Sbjct  120  VAPNSVVVPAGNTGLDPSQTSFFQALNIPTKINRGTVEIVSDVHLIKASEKVGGSEATLL  179

Query  24   SKLNIKPF  1
            SKL IKPF
Sbjct  180  SKLGIKPF  187



>gb|KFM29126.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
Length=273

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +VT+ AG TG+DPSQ SFF  LNISTKI KG +EI  +  + + G+K+G S+A +L
Sbjct  118  VAPNDVTVYAGNTGMDPSQTSFFQALNISTKINKGTVEIVSDVHLIKPGEKVGASQATLL  177

Query  24   SKLNIKPF  1
            +KL IKPF
Sbjct  178  AKLGIKPF  185



>gb|KDO69056.1| hypothetical protein CISIN_1g036252mg [Citrus sinensis]
Length=318

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG ++G+SE+A+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDRVGSSESALL  178

Query  24   SKLNIKPF  1
            SKL IKPF
Sbjct  179  SKLAIKPF  186



>ref|XP_006435696.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
 ref|XP_006486351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48936.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
Length=318

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG ++G+SE+A+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDRVGSSESALL  178

Query  24   SKLNIKPF  1
            SKL IKPF
Sbjct  179  SKLAIKPF  186



>gb|KCW65655.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=266

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  118  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>gb|KDP44812.1| hypothetical protein JCGZ_01312 [Jatropha curcas]
Length=321

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_007016138.1| Ribosomal protein L10 family protein [Theobroma cacao]
 gb|EOY33757.1| Ribosomal protein L10 family protein [Theobroma cacao]
Length=321

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  IAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLGIRPF  186



>gb|KDO69055.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=318

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>emb|CEG01946.1| Ribosomal protein L10/acidic P0 [Ostreococcus tauri]
Length=311

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP EV +PAGPTG++PSQ SFF TLNI+TKI KG IEI  +  V + G ++ +S AA+L
Sbjct  114  IAPVEVVVPAGPTGMEPSQTSFFQTLNIATKINKGSIEILNDIVVLKVGDRVSSSAAALL  173

Query  24   SKLNIKPF  1
            SK+   PF
Sbjct  174  SKMKFTPF  181



>ref|XP_007153264.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
 gb|ESW25258.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
Length=320

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|AGV54296.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_010247657.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nelumbo nucifera]
Length=320

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG+K+G+SEAA+L
Sbjct  119  IAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|EMT02739.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=322

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI     + +KG K+G+SEA +L
Sbjct  120  IAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGSVEIVAHVDLIKKGDKVGSSEATLL  179

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  180  AKLGIRPF  187



>gb|KHG25720.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=320

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|AFK38760.1| unknown [Lotus japonicus]
Length=322

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  118  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|NP_001239676.1| uncharacterized protein LOC100777482 [Glycine max]
 gb|ACU20858.1| unknown [Glycine max]
 gb|KHN20859.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=319

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|NP_001238374.1| 60S acidic ribosomal protein P0 [Glycine max]
 sp|P50346.1|RLA0_SOYBN RecName: Full=60S acidic ribosomal protein P0 [Glycine max]
 gb|AAB63814.1| acidic ribosomal protein P0 [Glycine max]
Length=320

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_007157498.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
 gb|ESW29492.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
Length=321

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG+K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_954430.1| ribosomal phosphoprotein P0 [Theileria annulata]
 emb|CAI73753.1| ribosomal phosphoprotein P0, putative [Theileria annulata]
Length=309

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP++V IPAG TGLDPSQ SFF  L ISTKI KGQIEI  E  + +K  K+  S A +L
Sbjct  116  IAPSDVFIPAGSTGLDPSQTSFFQALGISTKIVKGQIEIQNEVHLIKKDDKVSASGATLL  175

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  176  QKLNIKPF  183



>ref|XP_001565910.1| putative 60S acidic ribosomal subunit protein [Leishmania braziliensis 
MHOM/BR/75/M2904]
 emb|CAM45430.1| putative 60S acidic ribosomal subunit protein [Leishmania braziliensis 
MHOM/BR/75/M2904]
Length=323

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L
Sbjct  123  IAPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVEIVTEKKVLSTGDKVDNSTATLL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>ref|XP_010700228.1| 60S ribosomal protein L10/acidic, putative [Leishmania panamensis]
 gb|AIN99521.1| 60S ribosomal protein L10/acidic, putative [Leishmania panamensis]
Length=323

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L
Sbjct  123  IAPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVEIVTEKKVLSTGDKVDNSTATLL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  118  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_009689105.1| 60S acidic ribosomal protein P0 [Theileria orientalis strain 
Shintoku]
 dbj|BAM38804.1| 60S acidic ribosomal protein P0 [Theileria orientalis strain 
Shintoku]
Length=313

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP++V IPAG TGLDPSQ SFF  L ISTKI KGQIEI  E  + +K  K+  S A +L
Sbjct  116  IAPSDVYIPAGSTGLDPSQTSFFQALGISTKIVKGQIEIQNEVHLIKKDDKVTASGATLL  175

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  176  QKLNIKPF  183



>ref|XP_001565909.1| putative 60S acidic ribosomal subunit protein [Leishmania braziliensis 
MHOM/BR/75/M2904]
 emb|CAM45429.1| putative 60S acidic ribosomal subunit protein [Leishmania braziliensis 
MHOM/BR/75/M2904]
Length=323

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L
Sbjct  123  IAPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVEIVTEKKVLSTGDKVDNSTATLL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>ref|XP_002960261.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
 gb|EFJ37800.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
Length=323

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +VTI  G TGLDPS  SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVTIQPGSTGLDPSHTSFFQALNIPTKINKGTVEIVSSVELISKGTKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLRIRPF  186



>gb|ADR71236.1| 60S acidic ribosomal protein P0B [Hevea brasiliensis]
Length=320

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_003538454.1| PREDICTED: 60S acidic ribosomal protein P0-like [Glycine max]
Length=320

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEA +L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIMKGDKVGSSEAVLL  178

Query  24   SKLNIKPF  1
            SKL I+PF
Sbjct  179  SKLAIRPF  186



>ref|XP_009764939.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=323

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPVDVIVPTGNTGLDPSQTSFFQVLNIPTKINKGTVEIMTPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_008463223.1| PREDICTED: 60S acidic ribosomal protein P0 [Cucumis melo]
Length=320

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_004149240.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
 gb|KGN50643.1| 60S acidic ribosomal protein PO [Cucumis sativus]
Length=320

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|ADR71235.1| 60S acidic ribosomal protein P0A [Hevea brasiliensis]
Length=320

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_003603496.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES73747.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|KDO69054.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=319

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_004165071.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
Length=320

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|AFK39880.1| unknown [Medicago truncatula]
Length=323

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG  EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTAEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_006435697.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
 ref|XP_006486350.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48937.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
Length=319

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|KDD72928.1| hypothetical protein H632_c2720p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=273

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +VTI AG TG+DPSQ SFF  LN+ TKI KG +EI  +  +   G K+G S+A +L
Sbjct  114  VAPTDVTIYAGNTGMDPSQTSFFQALNVPTKINKGTVEIVSDMHLITAGDKVGASQATLL  173

Query  24   SKLNIKPF  1
            +KL IKPF
Sbjct  174  AKLGIKPF  181



>ref|XP_004501267.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=322

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_002967451.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
 gb|EFJ32050.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
Length=323

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +VTI  G TGLDPS  SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVTIQPGSTGLDPSHTSFFQALNIPTKINKGTVEIVSSVELISKGTKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLRIRPF  186



>ref|XP_001422456.1| Cytosolic 80S ribosomal protein P0; Cytosolic 60S large ribosomal 
subunit protein P0 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00773.1| Cytosolic 80S ribosomal protein P0; Cytosolic 60S large ribosomal 
subunit protein P0 [Ostreococcus lucimarinus CCE9901]
Length=313

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP EV +PAGPTG++PSQ SFF TLNI+TKI KG IEI  +  V + G ++ +S AA+L
Sbjct  117  IAPVEVVVPAGPTGMEPSQTSFFQTLNIATKINKGTIEILNDIVVLQPGDRVSSSAAALL  176

Query  24   SKLNIKPF  1
             K+   PF
Sbjct  177  GKMKFTPF  184



>ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>dbj|BAF45856.1| ribosomal phosphoprotein P0 [Babesia microti]
Length=312

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAGPTG+DPSQ SFF  L ISTKI KGQIEI  +  + +  +K+  S A +L
Sbjct  115  IAPCDVFVPAGPTGMDPSQTSFFQALGISTKIFKGQIEIQSDVHLIKVNEKVNASSAVLL  174

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  175  QKLNIKPF  182



>gb|AAU10516.1| 60S ribosomal protein, partial [Leishmania donovani]
Length=315

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            ++P +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L
Sbjct  115  ISPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVEIVTEKKVLSVGDKVDNSTATLL  174

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  175  QKLNISPF  182



>gb|EPY24295.1| large subunit ribosomal protein LP0 [Strigomonas culicis]
Length=308

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  + KV   G ++ NS AA+L
Sbjct  105  IAPCDVVVPAGNTGMEPTQTSFFQALNIATKIAKGTVEIIADKKVLTTGDRVDNSTAALL  164

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  165  QKLNISPF  172



>ref|XP_008392940.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera]
Length=303

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  102  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  161

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  162  AKLGIRPF  169



>gb|EPY22906.1| large subunit ribosomal protein LP0 [Strigomonas culicis]
Length=326

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  + KV   G ++ NS AA+L
Sbjct  123  IAPCDVVVPAGNTGMEPTQTSFFQALNIATKIAKGTVEIIADKKVLTTGDRVDNSTAALL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera]
Length=320

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++  KG K+G+SEAA+L
Sbjct  119  VAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_002525622.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF36740.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=323

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI     + +KG+K+G+SE+A+L
Sbjct  119  IAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVDIIKKGEKVGSSESALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_008360784.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_009350848.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pyrus x bretschneideri]
Length=321

 Score = 82.0 bits (201),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_009344598.1| PREDICTED: 60S acidic ribosomal protein P0 [Pyrus x bretschneideri]
Length=321

 Score = 82.0 bits (201),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>dbj|BAE71263.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
 dbj|BAE71276.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
Length=321

 Score = 82.0 bits (201),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLAIRPF  186



>emb|CCF73339.1| unnamed protein product [Babesia microti strain RI]
Length=348

 Score = 82.0 bits (201),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAGPTG+DPSQ SFF  L ISTKI KGQIEI  +  + +  +K+  S A +L
Sbjct  150  IAPCDVFVPAGPTGMDPSQTSFFQALGISTKIFKGQIEIQSDVHLIKANEKVTASSATLL  209

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  210  QKLNIKPF  217



>gb|AAF13353.1|AF121339_1 acidic ribosomal phosphoprotein P0 [Eufolliculina uhligi]
Length=324

 Score = 81.6 bits (200),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  GPTG+DPSQ SFF  L I TKI KGQI+I  E  +  K KK+GNSEA +L
Sbjct  126  IAPNDVHVYPGPTGMDPSQTSFFQALGIFTKIVKGQIDIVNELHLIFKDKKVGNSEAVLL  185

Query  24   SKLNIKPF  1
             KL +KPF
Sbjct  186  KKLGVKPF  193



>ref|XP_003721948.1| putative 60S acidic ribosomal subunit protein [Leishmania major 
strain Friedlin]
 ref|XP_003721949.1| putative 60S acidic ribosomal subunit protein [Leishmania major 
strain Friedlin]
 emb|CBZ12206.1| putative 60S acidic ribosomal subunit protein [Leishmania major 
strain Friedlin]
 emb|CBZ12207.1| putative 60S acidic ribosomal subunit protein [Leishmania major 
strain Friedlin]
Length=323

 Score = 81.6 bits (200),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            ++P +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L
Sbjct  123  ISPCDVIVPAGSTGMEPTQTSFFQALNIATKIAKGMVEIVTEKKVLSVGDKVDNSTATLL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>ref|XP_001466374.1| putative 60S acidic ribosomal subunit protein [Leishmania infantum 
JPCM5]
 ref|XP_001466487.1| 60S acidic ribosomal subunit protein [Leishmania infantum JPCM5]
 ref|XP_003862100.1| unnamed protein product [Leishmania donovani]
 emb|CAM69091.1| putative 60S acidic ribosomal subunit protein [Leishmania infantum 
JPCM5]
 emb|CAM69208.1| 60S acidic ribosomal subunit protein [Leishmania infantum JPCM5]
 emb|CBZ35406.1| unnamed protein product [Leishmania donovani]
Length=323

 Score = 81.6 bits (200),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            ++P +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L
Sbjct  123  ISPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVEIVTEKKVLSVGDKVDNSTATLL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>ref|XP_002370628.1| 60S acidic ribosomal protein P0 [Toxoplasma gondii ME49]
 gb|AAO61487.1| ribosomal P protein [Toxoplasma gondii]
 gb|EPR63809.1| ribosomal protein RPP0 [Toxoplasma gondii GT1]
 gb|EPT24685.1| ribosomal protein RPP0 [Toxoplasma gondii ME49]
 gb|ESS28836.1| ribosomal protein RPP0 [Toxoplasma gondii VEG]
 gb|KFG37966.1| ribosomal protein RPP0 [Toxoplasma gondii p89]
 gb|KFG47459.1| ribosomal protein RPP0 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG50750.1| ribosomal protein RPP0 [Toxoplasma gondii FOU]
 gb|KFG64798.1| ribosomal protein RPP0 [Toxoplasma gondii RUB]
 gb|KFH05201.1| ribosomal protein RPP0 [Toxoplasma gondii VAND]
 gb|KFH15825.1| ribosomal protein RPP0 [Toxoplasma gondii MAS]
Length=314

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
             AP +V IPAGPTG+DP   SFF  L I+TKI KGQIEI  E  + ++G K+  S A +L
Sbjct  117  FAPIDVFIPAGPTGMDPGSTSFFQALGIATKIVKGQIEIQNEVHLIKEGDKVTASAATLL  176

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  177  QKLNIKPF  184



>gb|EJK52423.1| hypothetical protein THAOC_28299 [Thalassiosira oceanica]
Length=321

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P GPTG DP Q +FF TL ISTKI +GQIE+T +  +   G+K+  S+AA+L
Sbjct  116  VAPIDVIVPKGPTGCDPGQTAFFQTLQISTKITRGQIEMTNDTHLIAVGEKVTASQAALL  175

Query  24   SKLNIKPF  1
             KLNI+PF
Sbjct  176  QKLNIEPF  183



>ref|XP_008889338.1| ribosomal protein RPP0 [Hammondia hammondi]
 gb|KEP59992.1| ribosomal protein RPP0 [Hammondia hammondi]
Length=314

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
             AP +V IPAGPTG+DP   SFF  L I+TKI KGQIEI  E  + ++G K+  S A +L
Sbjct  117  FAPIDVFIPAGPTGMDPGSTSFFQALGIATKIVKGQIEIQNEVHLIKEGDKVTASAATLL  176

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  177  QKLNIKPF  184



>gb|ACJ84880.1| unknown [Medicago truncatula]
Length=323

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG  EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTAEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I PF
Sbjct  179  AKLGITPF  186



>gb|AFP65300.1| 60S acidic ribosomal protein P0 [Chroomonas mesostigmatica CCMP1168]
Length=312

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +A  +V IPAGPT + P   SFF  LNI TKIQ+GQIEI    K+ EKGK +G+SEAA+L
Sbjct  115  IAQHDVIIPAGPTEISPDGTSFFQALNIPTKIQRGQIEILDPVKIIEKGKIVGSSEAALL  174

Query  24   SKLNIKPF  1
             KLN+ PF
Sbjct  175  KKLNLVPF  182



>ref|NP_181530.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
 sp|O04204.1|RLA01_ARATH RecName: Full=60S acidic ribosomal protein P0-1 [Arabidopsis 
thaliana]
 gb|AAB95286.1| 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAN71918.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEC09763.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
Length=317

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>emb|CCW71061.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=323

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            ++P +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L
Sbjct  123  ISPCDVVVPAGNTGMEPTQTSFFQALNIATKISKGMVEIVSEKKVLSVGDKVDNSTATLL  182

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  183  QKLNISPF  190



>ref|XP_010517390.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Camelina sativa]
Length=318

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_002784721.1| ribosomal P protein, putative [Perkinsus marinus ATCC 50983]
 gb|EER16517.1| ribosomal P protein, putative [Perkinsus marinus ATCC 50983]
Length=318

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +A   V IPAGPT LDPSQ +FF  LNI+TKI KG IEI+ +  +  KG+K+  S+ A+L
Sbjct  119  VAQCNVDIPAGPTSLDPSQTNFFQALNIATKIVKGSIEISNDVALVTKGQKVTASQQALL  178

Query  24   SKLNIKPF  1
             KLNI+PF
Sbjct  179  MKLNIRPF  186



>ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
 gb|ESQ52698.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
Length=317

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_010508934.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Camelina sativa]
Length=318

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_002881693.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57952.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>ref|XP_672283.1| hypothetical protein [Plasmodium berghei strain ANKA]
 emb|CAI04050.1| hypothetical protein PB301503.00.0 [Plasmodium berghei]
Length=228

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQENVHLIKQGEKVSASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>emb|CDY24932.1| BnaC03g22400D [Brassica napus]
Length=319

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>emb|CDY60988.1| BnaA03g56530D [Brassica napus]
Length=318

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|EPY24983.1| large subunit ribosomal protein LP0 [Strigomonas culicis]
 gb|EPY27148.1| large subunit ribosomal protein LP0 [Strigomonas culicis]
Length=312

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  + KV   G ++ NS AA+L
Sbjct  109  IAPCDVVVPAGNTGMEPTQTSFFQALNIATKIAKGTVEIIADKKVLTTGDRVDNSTAALL  168

Query  24   SKLNIKPF  1
             KLNI PF
Sbjct  169  QKLNISPF  176



>ref|XP_008351783.1| PREDICTED: uncharacterized protein LOC103415220 [Malus domestica]
Length=762

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  560  VAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  619

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  620  AKLGIRPF  627



>ref|XP_009133397.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Brassica rapa]
Length=319

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ +KG K+G+SEAA+L
Sbjct  119  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL  178

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  179  AKLGIRPF  186



>gb|EZG47334.1| 60S acidic ribosomal protein P0 [Gregarina niphandrodes]
Length=316

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            LAP +V IP GPTG+DP Q SFF  L I TKI KGQIEI  E  +   G+++  S+A +L
Sbjct  120  LAPCDVYIPPGPTGMDPGQTSFFQQLGIPTKIVKGQIEIQNEVHIVSVGERVSASQAVLL  179

Query  24   SKLNIKPF  1
            SKL+I PF
Sbjct  180  SKLSINPF  187



>ref|XP_009039052.1| hypothetical protein AURANDRAFT_60208 [Aureococcus anophagefferens]
 gb|EGB06096.1| hypothetical protein AURANDRAFT_60208 [Aureococcus anophagefferens]
Length=281

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -1

Query  201  APAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAILS  22
            AP +V +P GPT  DP Q +FF TL I+TKI KG+IEIT    +  KG ++GNSEA +L 
Sbjct  117  APIDVIVPPGPTDCDPGQTNFFQTLQIATKIVKGRIEITNPVNLLRKGDRVGNSEAVLLQ  176

Query  21   KLNIKPF  1
            KL+I PF
Sbjct  177  KLHINPF  183



>ref|XP_741984.1| ribosomal phosphoprotein P0 [Plasmodium chabaudi chabaudi]
 emb|CAH80782.1| ribosomal phosphoprotein P0, putative [Plasmodium chabaudi chabaudi]
Length=212

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQENVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_004829972.1| 60S acidic ribosomal protein P0, putative [Babesia equi]
 dbj|BAF91358.1| ribosomal phosphoprotein P0 [Babesia equi]
 gb|AFZ80306.1| 60S acidic ribosomal protein P0, putative [Babesia equi strain 
WA]
Length=313

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP++V I AG TGLDPSQ SFF  L ISTKI KGQIEI  E  + +K  K+  S A +L
Sbjct  116  IAPSDVFIQAGSTGLDPSQTSFFQALGISTKIVKGQIEIQNEVHLIKKDDKVTASGATLL  175

Query  24   SKLNIKPF  1
             KLNIKPF
Sbjct  176  QKLNIKPF  183



>sp|P39096.1|RLA0_LEICH RecName: Full=60S acidic ribosomal protein P0 [Leishmania chagasi]
 gb|AAA29263.1| ribosomal protein P0 [Leishmania chagasi]
Length=322

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -1

Query  198  PAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAILSK  19
            P +V +PAG TG++P+Q SFF  LNI+TKI KG +EI  E KV   G K+ NS A +L K
Sbjct  124  PCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVEIVTEKKVLSVGDKVDNSTATLLQK  183

Query  18   LNIKPF  1
            LNI PF
Sbjct  184  LNISPF  189



>emb|CDY67524.1| BnaAnng24540D [Brassica napus]
 emb|CDY67517.1| BnaAnng24470D [Brassica napus]
Length=222

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  17   VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  76

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  77   AKLGIRPF  84



>gb|AAM21934.1| ribosomal phosphoprotein P0 [Plasmodium berghei ANKA]
 emb|CDS46658.1| 60S acidic ribosomal protein P0, putative [Plasmodium berghei 
ANKA]
Length=315

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQENVHLIKQGEKVSASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_679654.1| ribosomal phosphoprotein P0 [Plasmodium berghei strain ANKA]
 emb|CAH95889.1| ribosomal phosphoprotein P0, putative [Plasmodium berghei]
Length=314

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  115  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQENVHLIKQGEKVSASSATLL  174

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  175  QKFNMKPF  182



>ref|XP_009041647.1| hypothetical protein AURANDRAFT_39285 [Aureococcus anophagefferens]
 gb|EGB03645.1| hypothetical protein AURANDRAFT_39285 [Aureococcus anophagefferens]
Length=323

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P GPT  DP Q +FF TL I+TKI KG+IEIT    + + G K+GNSEA +L
Sbjct  116  IAPIDVIVPPGPTDCDPGQTNFFQTLQIATKIVKGRIEITSPVNLLKAGDKVGNSEAVLL  175

Query  24   SKLNIKPF  1
             KL+I PF
Sbjct  176  QKLHINPF  183



>gb|AAD56335.1|AC009326_22 putative 60S acidic ribosomal protein, 5' partial [Arabidopsis 
thaliana]
Length=230

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  28   VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  87

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  88   AKLGIRPF  95



>gb|AFK37198.1| unknown [Lotus japonicus]
Length=312

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            ++P EV IP G TGL+P+Q +F   LNI+TKI KGQI+I  +  +   G+K+GNSEAA+L
Sbjct  112  ISPVEVIIPKGDTGLEPTQTAFLQALNIATKINKGQIQILDDKLLLTVGQKVGNSEAALL  171

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  172  QKLKINPF  179



>ref|XP_002765467.1| ribosomal P protein, putative [Perkinsus marinus ATCC 50983]
 gb|EEQ98184.1| ribosomal P protein, putative [Perkinsus marinus ATCC 50983]
Length=318

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +A   V IPAGPT LDPSQ +FF  LNI+TKI KG IEI+ +  +  KG K+  S+ A+L
Sbjct  119  VAQCNVDIPAGPTSLDPSQTNFFQALNIATKIVKGSIEISNDVALVTKGSKVTASQQALL  178

Query  24   SKLNIKPF  1
             KLNI+PF
Sbjct  179  MKLNIRPF  186



>dbj|BAH57858.1| 60S acidic ribosomal protein P0 [Babesia rodhaini]
Length=311

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P+GPTG+DPSQ SFF  L ISTKI KGQIEI  +  + +  +K+  S A +L
Sbjct  115  IAPCDVFVPSGPTGMDPSQTSFFQALGISTKIFKGQIEIQSDVHLIKANEKVSASSATLL  174

Query  24   SKLNIKPF  1
             KLNI+PF
Sbjct  175  QKLNIRPF  182



>emb|CAE84233.1| ribosomal phosphoprotein [Plasmodium falciparum]
 emb|CAF04072.1| ribosomal phosphoprotein [Plasmodium falciparum]
 emb|CAF04073.1| ribosomal phosphoprotein [Plasmodium falciparum]
 emb|CAF04074.1| ribosomal phosphoprotein [Plasmodium falciparum]
 emb|CAF18553.1| ribosomal phosphoprotein [Plasmodium falciparum]
Length=308

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQEHVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_008816121.1| 60S acidic ribosomal protein P0 [Plasmodium inui San Antonio 
1]
 gb|EUD67150.1| 60S acidic ribosomal protein P0 [Plasmodium inui San Antonio 
1]
Length=316

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQEHVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|NP_001078125.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 gb|AEE74737.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=287

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  85   VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  144

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  145  AKLGIRPF  152



>ref|XP_010486703.1| PREDICTED: 60S acidic ribosomal protein P0-3 [Camelina sativa]
Length=323

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>emb|CDS47367.1| 60S acidic ribosomal protein P0, putative [Plasmodium chabaudi 
chabaudi]
Length=315

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQENVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>emb|CDO65105.1| 60S acidic ribosomal protein P0, putative [Plasmodium reichenowi]
Length=316

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQEHVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_001615417.1| 60S acidic ribosomal protein P0 [Plasmodium vivax Sal-1]
 gb|EDL45690.1| 60S acidic ribosomal protein P0, putative [Plasmodium vivax]
Length=315

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQEHVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_004222525.1| 60S acidic ribosomal protein P0, partial [Plasmodium cynomolgi 
strain B]
 dbj|GAB66578.1| 60S acidic ribosomal protein P0, partial [Plasmodium cynomolgi 
strain B]
Length=311

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQEHVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_001347984.1| 60S ribosomal protein P0 [Plasmodium falciparum 3D7]
 gb|AAN35897.1| 60S ribosomal protein P0 [Plasmodium falciparum 3D7]
 gb|ETW15388.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
 gb|ETW28633.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum FCH/4]
 gb|ETW35827.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum Tanzania 
(2000708)]
 gb|ETW42077.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum NF135/5.C10]
 gb|ETW48651.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum MaliPS096_E11]
 gb|ETW52937.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum Palo Alto/Uganda]
 gb|ETW60665.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR70252.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum 7G8]
 gb|EUT83534.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum Santa 
Lucia]
 gb|EWC75787.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum UGT5.1]
 gb|EWC88043.1| 60S acidic ribosomal protein P0 [Plasmodium falciparum NF54]
Length=316

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQEHVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_008624852.1| 60S acidic ribosomal protein P0 [Plasmodium vinckei vinckei]
 gb|KEG02239.1| 60S acidic ribosomal protein P0 [Plasmodium vinckei vinckei]
Length=315

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQENVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|NP_187531.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 sp|Q42112.2|RLA02_ARATH RecName: Full=60S acidic ribosomal protein P0-2 [Arabidopsis 
thaliana]
 gb|AAF14020.1|AC011436_4 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAK44040.1|AF370225_1 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAL15223.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEE74736.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=320

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>gb|AAM63644.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
Length=320

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_006407706.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49159.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=322

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>gb|EUD72932.1| 60S acidic ribosomal protein P0 [Plasmodium vinckei petteri]
Length=315

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQENVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_010464557.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
 ref|XP_010464558.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>gb|KGQ11932.1| 60S acidic ribosomal protein P0 [Beauveria bassiana D1-5]
Length=312

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  198  PAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAILSK  19
            P +V +PAG TG++P + SFF  LN+ TKI +G IEIT + K+ EKG K+G SEA +L+ 
Sbjct  116  PIDVWVPAGNTGMEPGKTSFFQALNVPTKIARGTIEITTDLKLVEKGLKVGPSEATLLNM  175

Query  18   LNIKPF  1
            LNI PF
Sbjct  176  LNISPF  181



>ref|XP_001738409.1| 60S acidic ribosomal protein P0 [Entamoeba dispar SAW760]
 gb|EDR25265.1| 60S acidic ribosomal protein P0, putative [Entamoeba dispar SAW760]
Length=235

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  42   IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  101

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  102  QKLKINPF  109



>ref|XP_726106.1| ribosomal protein L10 [Plasmodium yoelii yoelii 17XNL]
 gb|EAA17671.1| Ribosomal protein L10, putative [Plasmodium yoelii yoelii]
 gb|ETB57646.1| 60S acidic ribosomal protein P0 [Plasmodium yoelii 17X]
 gb|ETB57647.1| 60S acidic ribosomal protein P0, variant 1 [Plasmodium yoelii 
17X]
 gb|ETB57648.1| 60S acidic ribosomal protein P0, variant 2 [Plasmodium yoelii 
17X]
 gb|ETB57649.1| 60S acidic ribosomal protein P0, variant 3 [Plasmodium yoelii 
17X]
 emb|CDU17969.1| 60S acidic ribosomal protein P0, putative [Plasmodium yoelii]
 emb|CDZ12241.1| 60S acidic ribosomal protein P0, putative [Plasmodium yoelii]
Length=315

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQENVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_010486773.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_006298124.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
 gb|EOA31022.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
Length=323

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_002259307.1| ribosomal phosphoprotein [Plasmodium knowlesi strain H]
 emb|CAQ40080.1| ribosomal phosphoprotein, putative [Plasmodium knowlesi strain 
H]
Length=314

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V IP GPTG+DPS  SFF +L ISTKI KGQIEI +   + ++G+K+  S A +L
Sbjct  116  IAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQENVHLIKQGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             K N+KPF
Sbjct  176  QKFNMKPF  183



>ref|XP_010464828.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_002882720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_006298147.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
 gb|EOA31045.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
Length=322

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>gb|KFK38515.1| hypothetical protein AALP_AA3G123100 [Arabis alpina]
Length=324

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>gb|KFK38306.1| hypothetical protein AALP_AA3G096900 [Arabis alpina]
Length=323

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_008593493.1| 60S acidic ribosomal protein P0 [Beauveria bassiana ARSEF 2860]
 gb|EJP70544.1| 60S acidic ribosomal protein P0 [Beauveria bassiana ARSEF 2860]
Length=331

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -1

Query  198  PAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAILSK  19
            P +V +PAG TG++P + SFF  LN+ TKI +G IEIT + K+ EKG K+G SEA +L+ 
Sbjct  116  PIDVWVPAGNTGMEPGKTSFFQALNVPTKIARGTIEITTDLKLVEKGLKVGPSEATLLNM  175

Query  18   LNIKPF  1
            LNI PF
Sbjct  176  LNISPF  181



>emb|CDY53103.1| BnaCnng24330D [Brassica napus]
Length=323

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|NP_187734.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
 sp|P57691.1|RLA03_ARATH RecName: Full=60S acidic ribosomal protein P0-3 [Arabidopsis 
thaliana]
 gb|AAG50973.1|AC073395_15 60S acidic ribosomal protein, putative; 58619-59992 [Arabidopsis 
thaliana]
 gb|AAL07229.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AAM14140.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AEE75020.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
Length=323

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_002884720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_010469822.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_010486480.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>emb|CDY07906.1| BnaC03g36170D [Brassica napus]
Length=323

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>dbj|BAN37454.1| 60S acidic ribosomal protein P0, putative [Entamoeba histolytica]
Length=316

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  123  IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  182

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  183  QKLKINPF  190



>dbj|BAN39915.1| 60S acidic ribosomal protein P0, putative [Entamoeba histolytica]
Length=316

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  123  IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  182

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  183  QKLKINPF  190



>dbj|BAN37452.1| 60S acidic ribosomal protein P0, putative [Entamoeba histolytica]
Length=316

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  123  IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  182

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  183  QKLKINPF  190



>gb|AAM65265.1| 60S acidic ribosomal protein P0-C [Arabidopsis thaliana]
Length=323

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>ref|XP_009123454.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>dbj|BAN40137.1| 60S acidic ribosomal protein P0, putative [Entamoeba histolytica]
Length=316

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  123  IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  182

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  183  QKLKINPF  190



>dbj|BAN40100.1| 60S acidic ribosomal protein P0, putative [Entamoeba histolytica]
Length=316

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  123  IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  182

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  183  QKLKINPF  190



>dbj|BAN39624.1| 60S acidic ribosomal protein P0, putative [Entamoeba histolytica]
Length=316

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  123  IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  182

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  183  QKLKINPF  190



>ref|XP_009135066.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>dbj|BAN39755.1| 60S acidic ribosomal protein P0, putative [Entamoeba histolytica]
Length=319

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  126  IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  185

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  186  QKLKINPF  193



>ref|XP_009146942.1| PREDICTED: 60S acidic ribosomal protein P0-2 [Brassica rapa]
 emb|CDY44688.1| BnaA05g29180D [Brassica napus]
Length=323

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +  G TGLDPSQ SFF  LNI TKI KG +EI    ++ ++G K+G+SEAA+L
Sbjct  118  VAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL  177

Query  24   SKLNIKPF  1
            +KL I+PF
Sbjct  178  AKLGIRPF  185



>dbj|BAN38149.1| 60S acidic ribosomal protein P0, putative [Entamoeba histolytica]
Length=316

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  123  IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  182

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  183  QKLKINPF  190



>gb|AAY83294.1| 60s acidic ribosomal protein-like [Babesia sp. WA1]
Length=312

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V I AG TG+DPSQ SFF  L ISTKI KGQIEI  +  + +KG+K+  S A +L
Sbjct  116  IAPCDVFISAGATGMDPSQTSFFQALGISTKIVKGQIEIQNDVHLIKKGEKVTASSATLL  175

Query  24   SKLNIKPF  1
             KLN KPF
Sbjct  176  QKLNKKPF  183



>ref|XP_009041887.1| hypothetical protein AURANDRAFT_39351 [Aureococcus anophagefferens]
 gb|EGB03416.1| hypothetical protein AURANDRAFT_39351 [Aureococcus anophagefferens]
Length=323

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +P GPT  DP Q +FF TL I+TKI KG+IEIT    + + G K+GNSEA +L
Sbjct  116  IAPIDVIVPPGPTDCDPGQTNFFQTLQIATKIVKGRIEITSPVNLLKAGDKVGNSEAVLL  175

Query  24   SKLNIKPF  1
             KL+I PF
Sbjct  176  QKLHINPF  183



>dbj|BAN38491.1| 60S acidic ribosomal protein P0, putative [Entamoeba histolytica]
Length=316

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  LAPAEVTIPAGPTGLDPSQISFFHTLNISTKIQKGQIEITKEFKVCEKGKKIGNSEAAIL  25
            +AP +V +PAG TGLDP+Q +F   LNI++KI KGQIEIT E  + ++G+K+G S+A +L
Sbjct  123  IAPNDVIVPAGDTGLDPTQTNFVQALNIASKITKGQIEITSETLLIKEGEKVGVSQAVLL  182

Query  24   SKLNIKPF  1
             KL I PF
Sbjct  183  QKLKINPF  190



Lambda      K        H        a         alpha
   0.316    0.140    0.384    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515927033552