BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8293_g1_i1 len=2496 path=[1:0-2389 5372:2390-2495]

Length=2496
                                                                      Score     E

ref|XP_010324303.1|  PREDICTED: disease resistance protein RPM1-like   1060   0.0      
ref|XP_006366513.1|  PREDICTED: disease resistance protein RPM1-like   1052   0.0      
gb|EYU27097.1|  hypothetical protein MIMGU_mgv1a025766mg                894   0.0      
gb|KHN40409.1|  Disease resistance protein RPM1                         765   0.0      
ref|XP_010056216.1|  PREDICTED: disease resistance protein RPM1-like    763   0.0      
ref|XP_003517650.1|  PREDICTED: disease resistance protein RPM1-like    762   0.0      
ref|XP_009373508.1|  PREDICTED: disease resistance protein RPM1-like    757   0.0      
ref|XP_006587620.1|  PREDICTED: disease resistance protein RPM1-like    756   0.0      
ref|XP_011018453.1|  PREDICTED: disease resistance protein RPM1-like    751   0.0      
ref|XP_007158212.1|  hypothetical protein PHAVU_002G133600g             750   0.0      
ref|XP_008238137.1|  PREDICTED: disease resistance protein RPM1-like    746   0.0      
ref|XP_008373504.1|  PREDICTED: disease resistance protein RPM1-like    745   0.0      
ref|XP_008348395.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    744   0.0      
gb|AFP82245.1|  NBS-LRR type disease resistance protein                 743   0.0      
ref|XP_007040757.1|  Nbs-lrr resistance protein                         742   0.0      
ref|XP_008342592.1|  PREDICTED: disease resistance protein RPM1-like    740   0.0      
gb|KDP33396.1|  hypothetical protein JCGZ_12852                         739   0.0      
ref|XP_007210392.1|  hypothetical protein PRUPE_ppa000961mg             739   0.0      
ref|XP_008238134.1|  PREDICTED: disease resistance protein RPM1-l...    734   0.0      
ref|XP_008238135.1|  PREDICTED: disease resistance protein RPM1-l...    733   0.0      
ref|XP_009346318.1|  PREDICTED: disease resistance protein RPM1-like    732   0.0      
ref|XP_007040756.1|  Nbs-lrr resistance protein                         730   0.0      
ref|XP_004301665.1|  PREDICTED: disease resistance protein RPM1-like    729   0.0      
ref|XP_009345346.1|  PREDICTED: disease resistance protein RPM1-like    730   0.0      
ref|XP_010056217.1|  PREDICTED: disease resistance protein RPM1-l...    729   0.0      
ref|XP_007211256.1|  hypothetical protein PRUPE_ppa019283mg             727   0.0      
ref|XP_008238138.1|  PREDICTED: disease resistance protein RPM1-like    726   0.0      
ref|XP_010056220.1|  PREDICTED: disease resistance protein RPM1-like    725   0.0      
gb|AES95654.2|  disease resistance protein (CC-NBS-LRR class) fam...    725   0.0      
ref|XP_004301648.1|  PREDICTED: disease resistance protein RPM1-like    725   0.0      
ref|XP_003534302.1|  PREDICTED: disease resistance protein RPM1-like    721   0.0      
ref|XP_003612696.1|  Nbs-lrr resistance protein                         720   0.0      
ref|XP_004300176.1|  PREDICTED: disease resistance protein RPM1-like    718   0.0      
ref|XP_007211130.1|  hypothetical protein PRUPE_ppa026111mg             717   0.0      
ref|XP_008373505.1|  PREDICTED: disease resistance protein RPM1-like    719   0.0      
ref|XP_008238139.1|  PREDICTED: disease resistance protein RPM1-like    718   0.0      
ref|XP_003631469.1|  PREDICTED: disease resistance protein RPM1-like    716   0.0      
ref|XP_003612691.1|  Disease resistance protein RPP8                    717   0.0      
ref|XP_009373507.1|  PREDICTED: disease resistance protein RPM1-like    717   0.0      
gb|KCW72844.1|  hypothetical protein EUGRSUZ_E01296                     716   0.0      
ref|XP_007210391.1|  hypothetical protein PRUPE_ppa000953mg             716   0.0      
ref|XP_010056219.1|  PREDICTED: disease resistance protein RPM1-like    714   0.0      
ref|XP_007158211.1|  hypothetical protein PHAVU_002G133600g             707   0.0      
ref|XP_008238133.1|  PREDICTED: disease resistance protein RPM1-like    712   0.0      
ref|XP_011018452.1|  PREDICTED: disease resistance protein RPM1-like    711   0.0      
ref|XP_003612692.1|  Nbs-lrr resistance protein                         710   0.0      
ref|XP_003612695.1|  Disease resistance protein RPP8                    709   0.0      
ref|NP_001235671.1|  NBS-LRR type disease resistance protein            709   0.0      
ref|XP_006368329.1|  NBS-LRR resistance gene-like protein ARGH35        709   0.0      
gb|KHN40407.1|  Disease resistance protein RPM1                         708   0.0      
ref|XP_011018457.1|  PREDICTED: disease resistance protein RPM1-like    708   0.0      
emb|CAN74463.1|  hypothetical protein VITISV_032893                     707   0.0      Vitis vinifera
gb|ABF81442.1|  NBS-LRR type disease resistance protein                 707   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004301647.1|  PREDICTED: disease resistance protein RPM1-like    704   0.0      
ref|XP_004300177.1|  PREDICTED: disease resistance protein RPM1-l...    700   0.0      
gb|KCW72841.1|  hypothetical protein EUGRSUZ_E01293                     698   0.0      
ref|XP_009373504.1|  PREDICTED: disease resistance protein RPM1-l...    698   0.0      
ref|XP_007040755.1|  Nbs-lrr resistance protein, putative               697   0.0      
ref|XP_010110397.1|  Disease resistance protein RPM1                    697   0.0      
ref|XP_011028248.1|  PREDICTED: uncharacterized protein LOC105128333    719   0.0      
ref|XP_004512454.1|  PREDICTED: disease resistance protein RPM1-like    691   0.0      
ref|XP_010650011.1|  PREDICTED: disease resistance protein RPM1-l...    690   0.0      
ref|XP_007040754.1|  Nbs-lrr resistance protein, putative               690   0.0      
ref|XP_008373506.1|  PREDICTED: disease resistance protein RPM1-like    690   0.0      
ref|XP_003612687.1|  Disease resistance protein RPM1                    690   0.0      
ref|XP_007158209.1|  hypothetical protein PHAVU_002G133400g             689   0.0      
ref|XP_007211004.1|  hypothetical protein PRUPE_ppa020740mg             686   0.0      
ref|XP_007210591.1|  hypothetical protein PRUPE_ppa016482mg             684   0.0      
ref|XP_007210578.1|  hypothetical protein PRUPE_ppa015762mg             684   0.0      
ref|XP_008380435.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    683   0.0      
ref|XP_004300178.1|  PREDICTED: disease resistance protein RPM1-l...    679   0.0      
ref|XP_010056215.1|  PREDICTED: disease resistance protein RPM1-like    678   0.0      
ref|XP_010054113.1|  PREDICTED: disease resistance protein RPM1-l...    677   0.0      
ref|XP_004301646.1|  PREDICTED: disease resistance protein RPM1-like    676   0.0      
gb|KCW72843.1|  hypothetical protein EUGRSUZ_E01295                     673   0.0      
ref|XP_002303452.1|  hypothetical protein POPTR_0003s09790g             676   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004300174.1|  PREDICTED: disease resistance protein RPM1-like    671   0.0      
ref|XP_010054114.1|  PREDICTED: disease resistance protein RPM1-l...    668   0.0      
ref|XP_010058435.1|  PREDICTED: disease resistance protein RPM1-like    662   0.0      
ref|XP_010056221.1|  PREDICTED: disease resistance protein RPM1-like    661   0.0      
ref|XP_010271941.1|  PREDICTED: disease resistance protein RPM1-like    676   0.0      
gb|KCW72839.1|  hypothetical protein EUGRSUZ_E01291                     657   0.0      
ref|XP_010054112.1|  PREDICTED: disease resistance protein RPM1-like    658   0.0      
ref|XP_002303451.2|  NBS-LRR resistance gene-like protein ARGH35        657   0.0      Populus trichocarpa [western balsam poplar]
gb|ABF81450.1|  NBS-LRR type disease resistance protein                 656   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002521805.1|  leucine-rich repeat-containing protein 2, lr...    648   0.0      Ricinus communis
ref|XP_010054922.1|  PREDICTED: disease resistance protein RPM1-like    647   0.0      
ref|XP_004301649.1|  PREDICTED: disease resistance protein RPM1-like    639   0.0      
ref|XP_002521806.1|  Disease resistance protein RPM1, putative          640   0.0      Ricinus communis
gb|KDP33397.1|  hypothetical protein JCGZ_12853                         636   0.0      
ref|XP_010054111.1|  PREDICTED: disease resistance protein RPM1-like    635   0.0      
gb|KCW72845.1|  hypothetical protein EUGRSUZ_E01297                     630   0.0      
gb|ABF81444.1|  NBS-LRR type disease resistance protein                 633   0.0      Populus trichocarpa [western balsam poplar]
gb|KCW72846.1|  hypothetical protein EUGRSUZ_E01298                     631   0.0      
dbj|BAJ53254.1|  JHL25P11.3                                             631   0.0      
dbj|BAJ53255.1|  JHL25P11.7                                             627   0.0      
gb|KDP27335.1|  hypothetical protein JCGZ_20267                         625   0.0      
ref|XP_002303450.2|  hypothetical protein POPTR_0003s09770g             628   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP27334.1|  hypothetical protein JCGZ_20266                         628   0.0      
ref|XP_006368518.1|  NBS-LRR resistance gene-like protein ARGH35        629   0.0      
gb|KCW78487.1|  hypothetical protein EUGRSUZ_D02629                     626   0.0      
ref|XP_010054887.1|  PREDICTED: disease resistance protein RPM1-like    626   0.0      
emb|CAN75824.1|  hypothetical protein VITISV_004157                     642   0.0      Vitis vinifera
ref|XP_010054923.1|  PREDICTED: disease resistance protein RPM1-like    620   0.0      
ref|XP_010271768.1|  PREDICTED: disease resistance protein RPM1-l...    619   0.0      
gb|KCW78491.1|  hypothetical protein EUGRSUZ_D02634                     615   0.0      
ref|XP_009591994.1|  PREDICTED: disease resistance protein RPM1-like    603   0.0      
gb|KCW78242.1|  hypothetical protein EUGRSUZ_D02431                     614   0.0      
gb|KCW72847.1|  hypothetical protein EUGRSUZ_E01301                     615   0.0      
ref|XP_010056222.1|  PREDICTED: disease resistance protein RPM1-like    612   0.0      
ref|XP_010058436.1|  PREDICTED: disease resistance protein RPM1-like    615   0.0      
gb|KDP40943.1|  hypothetical protein JCGZ_24942                         612   0.0      
ref|XP_010271761.1|  PREDICTED: disease resistance protein RPM1-l...    608   0.0      
ref|XP_010056223.1|  PREDICTED: disease resistance protein RPM1-like    606   0.0      
ref|XP_010271767.1|  PREDICTED: disease resistance protein RPM1-l...    606   0.0      
emb|CDP07913.1|  unnamed protein product                                605   0.0      
ref|XP_010271762.1|  PREDICTED: disease resistance protein RPM1-l...    602   0.0      
gb|KCW90007.1|  hypothetical protein EUGRSUZ_A02202                     598   0.0      
ref|XP_010058431.1|  PREDICTED: disease resistance protein RPM1-like    600   0.0      
ref|XP_010023627.1|  PREDICTED: disease resistance protein RPM1-like    597   0.0      
gb|KCW72848.1|  hypothetical protein EUGRSUZ_E01302                     593   0.0      
gb|ABF81446.1|  NBS-NBS-LRR type disease resistance protein             620   0.0      Populus trichocarpa [western balsam poplar]
gb|KCW72850.1|  hypothetical protein EUGRSUZ_E01306                     589   0.0      
emb|CDP19368.1|  unnamed protein product                                589   0.0      
ref|XP_010271935.1|  PREDICTED: disease resistance protein RPM1-like    583   0.0      
ref|XP_009623392.1|  PREDICTED: disease resistance protein RPM1-like    571   0.0      
ref|XP_010056218.1|  PREDICTED: disease resistance protein RPM1-l...    578   0.0      
emb|CDP13422.1|  unnamed protein product                                583   0.0      
gb|KCW72838.1|  hypothetical protein EUGRSUZ_E01289                     579   0.0      
emb|CDP20055.1|  unnamed protein product                                578   0.0      
ref|XP_010024987.1|  PREDICTED: disease resistance protein RPM1-like    578   0.0      
emb|CDP11700.1|  unnamed protein product                                576   0.0      
ref|XP_008809624.1|  PREDICTED: disease resistance protein RPM1-like    575   0.0      
ref|XP_010027152.1|  PREDICTED: disease resistance protein RPM1-like    576   0.0      
ref|XP_010928130.1|  PREDICTED: disease resistance protein RPM1-like    573   0.0      
gb|KCW78492.1|  hypothetical protein EUGRSUZ_D02635                     572   0.0      
emb|CDP21446.1|  unnamed protein product                                569   0.0      
gb|KCW61558.1|  hypothetical protein EUGRSUZ_H04290                     567   0.0      
gb|KCW61517.1|  hypothetical protein EUGRSUZ_H04242                     569   0.0      
emb|CDP11695.1|  unnamed protein product                                567   0.0      
ref|XP_011098143.1|  PREDICTED: disease resistance protein RPM1-like    565   0.0      
emb|CDP12947.1|  unnamed protein product                                566   0.0      
emb|CDP12939.1|  unnamed protein product                                557   0.0      
gb|KCW61515.1|  hypothetical protein EUGRSUZ_H04240                     563   0.0      
emb|CDP12953.1|  unnamed protein product                                559   0.0      
emb|CDP19454.1|  unnamed protein product                                558   0.0      
ref|XP_011095361.1|  PREDICTED: disease resistance protein RPM1-like    556   1e-180   
emb|CDP20168.1|  unnamed protein product                                549   1e-180   
emb|CDP12951.1|  unnamed protein product                                553   3e-180   
ref|XP_010105407.1|  Disease resistance protein RPM1                    555   4e-180   
emb|CDP12966.1|  unnamed protein product                                555   5e-180   
ref|XP_002265617.2|  PREDICTED: disease resistance protein RPM1         554   7e-180   Vitis vinifera
emb|CDP12946.1|  unnamed protein product                                555   8e-180   
emb|CDP13421.1|  unnamed protein product                                555   8e-180   
emb|CDP15682.1|  unnamed protein product                                551   2e-178   
ref|XP_010102641.1|  Disease resistance protein RPM1                    550   3e-178   
gb|KCW72842.1|  hypothetical protein EUGRSUZ_E01294                     544   2e-177   
emb|CAN62150.1|  hypothetical protein VITISV_018440                     546   5e-177   Vitis vinifera
ref|XP_009415397.1|  PREDICTED: disease resistance protein RPM1-like    546   5e-177   
emb|CDP21814.1|  unnamed protein product                                544   7e-177   
emb|CDP21933.1|  unnamed protein product                                538   4e-176   
ref|XP_009343524.1|  PREDICTED: disease resistance protein RPM1-like    543   5e-176   
gb|KDP40944.1|  hypothetical protein JCGZ_24943                         542   2e-175   
emb|CDP13418.1|  unnamed protein product                                543   2e-175   
ref|XP_002265419.1|  PREDICTED: disease resistance protein RPM1-like    541   5e-175   Vitis vinifera
ref|XP_009374540.1|  PREDICTED: disease resistance protein RPM1-l...    540   5e-174   
gb|KCW61556.1|  hypothetical protein EUGRSUZ_H04288                     538   7e-174   
ref|XP_009374541.1|  PREDICTED: disease resistance protein RPM1-l...    539   9e-174   
ref|XP_010651614.1|  PREDICTED: disease resistance protein RPM1-like    529   8e-173   
ref|XP_008376470.1|  PREDICTED: disease resistance protein RPM1-like    533   8e-173   
emb|CDP19455.1|  unnamed protein product                                536   1e-172   
ref|XP_002265568.1|  PREDICTED: disease resistance protein RPM1-like    534   2e-172   Vitis vinifera
emb|CDP19587.1|  unnamed protein product                                533   1e-171   
ref|XP_009345009.1|  PREDICTED: disease resistance protein RPM1-l...    530   1e-170   
ref|XP_008380436.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    518   2e-170   
emb|CDP11714.1|  unnamed protein product                                521   2e-170   
emb|CDP12967.1|  unnamed protein product                                530   3e-170   
ref|XP_009345010.1|  PREDICTED: disease resistance protein RPM1-l...    529   3e-170   
emb|CDP13423.1|  unnamed protein product                                528   6e-170   
gb|EYU19236.1|  hypothetical protein MIMGU_mgv1a021128mg                528   7e-170   
ref|XP_008376467.1|  PREDICTED: disease resistance protein RPM1-like    528   1e-169   
ref|XP_011012867.1|  PREDICTED: disease resistance protein RPM1-like    527   1e-169   
ref|XP_008376413.1|  PREDICTED: disease resistance protein RPM1-like    529   2e-169   
ref|XP_009346946.1|  PREDICTED: disease resistance protein RPM1-like    527   3e-169   
emb|CDP19404.1|  unnamed protein product                                526   1e-168   
ref|XP_010244175.1|  PREDICTED: disease resistance protein RPM1-like    526   1e-168   
ref|XP_003632405.1|  PREDICTED: disease resistance protein RPM1-l...    523   5e-168   
ref|XP_010027151.1|  PREDICTED: disease resistance protein RPM1-like    521   9e-168   
ref|XP_010092597.1|  Disease resistance protein RPM1                    524   1e-167   
gb|KCW73771.1|  hypothetical protein EUGRSUZ_E02372                     517   2e-167   
ref|XP_010244219.1|  PREDICTED: disease resistance protein RPM1-like    523   3e-167   
emb|CDP19241.1|  unnamed protein product                                514   6e-167   
emb|CDP10113.1|  unnamed protein product                                516   3e-165   
ref|XP_002324939.1|  NBS-LRR resistance gene-like protein ARGH35        514   1e-164   Populus trichocarpa [western balsam poplar]
emb|CDP13416.1|  unnamed protein product                                511   1e-164   
emb|CDP12970.1|  unnamed protein product                                514   1e-163   
emb|CDP20516.1|  unnamed protein product                                511   1e-163   
ref|XP_006387370.1|  hypothetical protein POPTR_1142s00200g             499   3e-163   
gb|ABF81448.1|  NBS-LRR type disease resistance protein                 502   4e-163   Populus trichocarpa [western balsam poplar]
emb|CDP21655.1|  unnamed protein product                                503   2e-162   
ref|XP_009349723.1|  PREDICTED: disease resistance protein RPM1-like    508   4e-162   
emb|CDP19598.1|  unnamed protein product                                505   4e-162   
emb|CDP12974.1|  unnamed protein product                                509   2e-161   
emb|CDP11697.1|  unnamed protein product                                499   6e-161   
emb|CDP06250.1|  unnamed protein product                                502   8e-161   
emb|CDP20972.1|  unnamed protein product                                498   8e-161   
ref|XP_010092366.1|  Disease resistance protein RPM1                    507   1e-160   
emb|CDP20946.1|  unnamed protein product                                501   2e-160   
ref|XP_006388619.1|  hypothetical protein POPTR_0137s00230g             499   6e-160   
ref|XP_010652498.1|  PREDICTED: disease resistance protein RPM1-l...    500   1e-159   
ref|XP_010092359.1|  Disease resistance protein RPM1                    502   2e-159   
ref|XP_011011151.1|  PREDICTED: disease resistance protein RPM1-like    500   2e-159   
emb|CDP11699.1|  unnamed protein product                                494   2e-159   
ref|XP_004498891.1|  PREDICTED: disease resistance protein RPM1-l...    500   8e-159   
gb|ABF81443.1|  NBS-LRR type disease resistance protein                 498   1e-158   Populus trichocarpa [western balsam poplar]
emb|CDP13419.1|  unnamed protein product                                495   2e-158   
ref|XP_006368333.1|  hypothetical protein POPTR_0001s017003g            486   6e-158   
ref|XP_007220267.1|  hypothetical protein PRUPE_ppa001015mg             495   3e-157   
emb|CAN60255.1|  hypothetical protein VITISV_025806                     494   4e-157   Vitis vinifera
ref|XP_007010980.1|  Cc-nbs-lrr resistance protein, putative            494   4e-157   
ref|XP_009346947.1|  PREDICTED: disease resistance protein RPM1-like    494   7e-157   
ref|XP_009345017.1|  PREDICTED: disease resistance protein RPM1-like    494   1e-156   
ref|XP_006382354.1|  NBS-LRR resistance gene-like protein ARGH35        491   4e-156   
ref|XP_010683684.1|  PREDICTED: disease resistance protein RPM1-l...    492   1e-155   
ref|XP_002532244.1|  Disease resistance protein RPM1, putative          491   1e-155   Ricinus communis
ref|XP_010101799.1|  Disease resistance protein RPM1                    489   4e-155   
ref|XP_010683682.1|  PREDICTED: disease resistance protein RPM1-l...    492   8e-155   
ref|XP_003633333.1|  PREDICTED: disease resistance protein RPM1-like    488   1e-154   
ref|XP_010263181.1|  PREDICTED: disease resistance protein RPM1-like    488   2e-154   
ref|XP_003588998.1|  NBS-containing resistance-like protein             488   3e-154   
ref|XP_006388340.1|  hypothetical protein POPTR_0221s00220g             487   4e-154   
ref|XP_009374542.1|  PREDICTED: disease resistance protein RPM1-l...    481   4e-153   
ref|XP_003526348.1|  PREDICTED: disease resistance protein RPM1-like    485   4e-153   
ref|XP_004499780.1|  PREDICTED: disease resistance protein RPM1-like    484   4e-153   
emb|CAN80288.1|  hypothetical protein VITISV_006820                     503   7e-153   Vitis vinifera
ref|XP_008377937.1|  PREDICTED: disease resistance protein RPM1-like    482   2e-152   
ref|XP_010107827.1|  Disease resistance protein RPM1                    480   1e-151   
emb|CDP18957.1|  unnamed protein product                                480   1e-151   
ref|XP_002531395.1|  Disease resistance protein RPM1, putative          478   1e-151   Ricinus communis
gb|ABO15685.1|  NBS-NBS-LRR type disease resistance protein             478   4e-151   Ipomoea batatas [batate]
emb|CDP15677.1|  unnamed protein product                                478   4e-151   
ref|XP_011000333.1|  PREDICTED: disease resistance protein RPM1-l...    478   1e-150   
emb|CDP21579.1|  unnamed protein product                                471   2e-150   
ref|XP_002275317.3|  PREDICTED: disease resistance protein RPM1-like    476   4e-150   Vitis vinifera
ref|XP_010093226.1|  Disease resistance protein RPM1                    476   4e-150   
ref|XP_006659408.1|  PREDICTED: disease resistance protein RPM1-like    476   4e-150   
ref|XP_009605820.1|  PREDICTED: disease resistance protein RPM1-like    476   5e-150   
gb|EEE68711.1|  hypothetical protein OsJ_27368                          474   7e-150   Oryza sativa Japonica Group [Japonica rice]
emb|CDP15857.1|  unnamed protein product                                473   7e-150   
ref|XP_006368330.1|  hypothetical protein POPTR_0001s01670g             468   1e-149   
ref|XP_011000332.1|  PREDICTED: disease resistance protein RPM1-l...    475   2e-149   
ref|XP_008234483.1|  PREDICTED: disease resistance protein RPM1-like    474   2e-149   
ref|XP_009366894.1|  PREDICTED: disease resistance protein RPM1-like    475   3e-149   
ref|XP_006377973.1|  NBS-LRR resistance gene-like protein ARGH34        474   3e-149   
ref|XP_007148786.1|  hypothetical protein PHAVU_005G014200g             474   4e-149   
ref|NP_001061834.1|  Os08g0424700                                       473   5e-149   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008244610.1|  PREDICTED: disease resistance protein RPM1-like    473   7e-149   
ref|XP_006377974.1|  hypothetical protein POPTR_0011s16850g             474   3e-148   
ref|XP_006368520.1|  hypothetical protein POPTR_0001s03710g             461   4e-148   
ref|XP_002525518.1|  Disease resistance protein RPM1, putative          471   8e-148   Ricinus communis
emb|CDP15684.1|  unnamed protein product                                468   2e-147   
ref|XP_007200228.1|  hypothetical protein PRUPE_ppa015444mg             469   2e-147   
ref|XP_006382612.1|  NBS-LRR resistance gene-like protein ARGH34        469   2e-147   
ref|XP_007201577.1|  hypothetical protein PRUPE_ppa018814mg             469   3e-147   
emb|CAN63708.1|  hypothetical protein VITISV_010416                     471   3e-147   Vitis vinifera
emb|CAN70306.1|  hypothetical protein VITISV_024233                     476   3e-147   Vitis vinifera
ref|XP_003598409.1|  NBS-containing resistance-like protein             469   5e-147   
gb|KEH32912.1|  LRR and NB-ARC domain disease resistance protein        468   1e-146   
emb|CDP12952.1|  unnamed protein product                                461   2e-146   
ref|XP_008377926.1|  PREDICTED: disease resistance protein RPM1-like    466   2e-146   
ref|XP_009605823.1|  PREDICTED: disease resistance protein RPM1-like    466   2e-146   
ref|XP_008236582.1|  PREDICTED: disease resistance protein RPM1-like    467   2e-146   
ref|XP_010093722.1|  Disease resistance protein RPM1                    467   2e-146   
ref|XP_011036771.1|  PREDICTED: disease resistance protein RPM1-like    466   3e-146   
ref|XP_008358255.1|  PREDICTED: disease resistance protein RPM1-like    466   3e-146   
ref|XP_008348709.1|  PREDICTED: disease resistance protein RPM1-like    466   4e-146   
ref|XP_006388617.1|  hypothetical protein POPTR_0137s002101g            455   5e-146   
gb|KCW61555.1|  hypothetical protein EUGRSUZ_H04287                     464   6e-146   
ref|XP_010101775.1|  Disease resistance protein RPM1                    464   2e-145   
ref|XP_003598415.1|  NBS resistance protein                             465   2e-145   
gb|AES68659.2|  NBS-LRR type disease resistance protein                 464   3e-145   
ref|XP_008244572.1|  PREDICTED: disease resistance protein RPM1-like    463   4e-145   
ref|XP_004250512.1|  PREDICTED: disease resistance protein RPM1-like    463   4e-145   
gb|KEH33986.1|  LRR and NB-ARC domain disease resistance protein        462   6e-145   
ref|XP_002301573.2|  Disease resistance protein RPM1                    462   7e-145   
ref|XP_011007006.1|  PREDICTED: disease resistance protein RPM1-l...    462   7e-145   
ref|XP_007200018.1|  hypothetical protein PRUPE_ppa024623mg             462   8e-145   
ref|XP_006353282.1|  PREDICTED: disease resistance protein RPM1-like    461   3e-144   
gb|KEH32914.1|  LRR and NB-ARC domain disease resistance protein        461   4e-144   
gb|KEH32975.1|  disease resistance protein (CC-NBS-LRR class) fam...    461   8e-144   
gb|KEH15652.1|  NB-ARC domain disease resistance protein                461   9e-144   
emb|CDP15687.1|  unnamed protein product                                455   9e-144   
ref|XP_009800866.1|  PREDICTED: disease resistance protein RPM1-like    459   1e-143   
gb|KDP29947.1|  hypothetical protein JCGZ_18516                         459   1e-143   
ref|XP_010271880.1|  PREDICTED: disease resistance protein RPM1-like    459   1e-143   
emb|CDP19244.1|  unnamed protein product                                452   2e-143   
ref|XP_003557063.2|  PREDICTED: disease resistance protein RPM1-like    459   2e-143   
ref|XP_010091747.1|  Disease resistance protein RPM1                    459   3e-143   
ref|XP_002275042.1|  PREDICTED: disease resistance protein RPM1         457   3e-143   
ref|XP_003598408.1|  NBS-containing resistance-like protein             464   5e-143   
gb|KEH32974.1|  disease resistance protein (CC-NBS-LRR class) fam...    459   6e-143   
ref|XP_008244577.1|  PREDICTED: disease resistance protein RPM1-like    458   7e-143   
ref|XP_009345322.1|  PREDICTED: disease resistance protein RPM1-l...    457   7e-143   
gb|KHN26405.1|  Disease resistance protein RPM1                         457   8e-143   
ref|XP_009605821.1|  PREDICTED: disease resistance protein RPM1-like    457   9e-143   
gb|KEH32977.1|  NBS-LRR type disease resistance protein                 457   9e-143   
ref|XP_008369904.1|  PREDICTED: disease resistance protein RPM1-like    456   1e-142   
ref|XP_009345321.1|  PREDICTED: disease resistance protein RPM1-l...    456   2e-142   
gb|AAT09451.1|  putative NBS-LRR type disease resistance protein        456   2e-142   
ref|XP_007199001.1|  hypothetical protein PRUPE_ppa001076mg             456   3e-142   
ref|XP_002275080.2|  PREDICTED: disease resistance protein RPM1-like    455   3e-142   
ref|XP_009805068.1|  PREDICTED: disease resistance protein RPM1-like    455   5e-142   
ref|XP_010650379.1|  PREDICTED: uncharacterized protein LOC100244008    471   1e-141   
ref|XP_010092291.1|  Disease resistance protein RPM1                    454   1e-141   
ref|XP_007200806.1|  hypothetical protein PRUPE_ppa025273mg             453   2e-141   
ref|XP_004515441.1|  PREDICTED: disease resistance protein RPM1-like    454   2e-141   
ref|XP_004499777.1|  PREDICTED: disease resistance protein RPM1-like    454   3e-141   
ref|XP_010249752.1|  PREDICTED: disease resistance protein RPM1-l...    453   3e-141   
ref|XP_006388615.1|  hypothetical protein POPTR_0137s00200g             444   5e-141   
gb|KCW61526.1|  hypothetical protein EUGRSUZ_H04248                     451   5e-141   
emb|CDP19597.1|  unnamed protein product                                451   5e-141   
ref|XP_008236579.1|  PREDICTED: disease resistance protein RPM1-like    452   6e-141   
ref|XP_009368543.1|  PREDICTED: disease resistance protein RPM1-like    452   1e-140   
ref|XP_007207111.1|  hypothetical protein PRUPE_ppa019580mg             451   1e-140   
ref|XP_008244573.1|  PREDICTED: disease resistance protein RPM1-like    451   1e-140   
ref|XP_006385268.1|  hypothetical protein POPTR_0003s02290g             445   1e-140   
gb|KEH32909.1|  NBS-LRR type disease resistance protein                 452   2e-140   
ref|XP_007200168.1|  hypothetical protein PRUPE_ppa016569mg             449   7e-140   
ref|XP_003638210.1|  NBS-containing resistance-like protein             468   7e-140   
emb|CDP21812.1|  unnamed protein product                                444   9e-140   
gb|KHN43798.1|  Disease resistance protein RPM1                         449   1e-139   
gb|KEH32965.1|  NBS-LRR type disease resistance protein                 449   1e-139   
ref|XP_006452699.1|  hypothetical protein CICLE_v10007381mg             449   2e-139   
ref|XP_002275296.2|  PREDICTED: disease resistance protein RPM1-like    447   2e-139   
ref|XP_002275153.3|  PREDICTED: disease resistance protein RPM1-l...    448   3e-139   
gb|AES68665.2|  NB-ARC domain disease resistance protein                448   4e-139   
ref|XP_008244611.1|  PREDICTED: disease resistance protein RPM1-like    449   5e-139   
ref|XP_010253838.1|  PREDICTED: disease resistance protein RPM1-like    447   6e-139   
ref|XP_011095817.1|  PREDICTED: disease resistance protein RPM1-like    447   6e-139   
ref|XP_009368517.1|  PREDICTED: disease resistance protein RPM1-like    447   9e-139   
ref|XP_003598414.1|  NBS-containing resistance-like protein             448   1e-138   
ref|XP_008353305.1|  PREDICTED: disease resistance protein RPM1-like    446   1e-138   
ref|XP_007199178.1|  hypothetical protein PRUPE_ppa020021mg             444   2e-138   
ref|XP_004289882.1|  PREDICTED: disease resistance protein RPM1-like    444   3e-138   
ref|XP_006382333.1|  hypothetical protein POPTR_0005s011202g            438   5e-138   
ref|XP_003551547.1|  PREDICTED: disease resistance protein RPM1-like    444   6e-138   
ref|XP_007200039.1|  hypothetical protein PRUPE_ppa024232mg             443   8e-138   
ref|XP_010274895.1|  PREDICTED: disease resistance protein RPM1-like    444   8e-138   
gb|KHM99665.1|  Disease resistance protein RPM1                         444   9e-138   
ref|XP_004295455.1|  PREDICTED: disease resistance protein RPM1-like    444   1e-137   
ref|XP_007199343.1|  hypothetical protein PRUPE_ppa024644mg             443   1e-137   
ref|XP_007201503.1|  hypothetical protein PRUPE_ppa014877mg             442   3e-137   
ref|XP_003530717.1|  PREDICTED: disease resistance protein RPM1-l...    443   3e-137   
gb|KEH32907.1|  disease resistance protein (CC-NBS-LRR class) fam...    442   3e-137   
gb|KHN27362.1|  Disease resistance protein RPM1                         442   3e-137   
ref|XP_008343742.1|  PREDICTED: disease resistance protein RPM1-like    441   3e-137   
gb|KDP45612.1|  hypothetical protein JCGZ_17219                         440   2e-136   
gb|EYU27491.1|  hypothetical protein MIMGU_mgv1a017723mg                438   5e-136   
ref|XP_008783237.1|  PREDICTED: disease resistance protein RPM1-like    441   8e-136   
gb|KDO61258.1|  hypothetical protein CISIN_1g047503mg                   438   2e-135   
ref|XP_006446117.1|  hypothetical protein CICLE_v10014223mg             437   2e-135   
ref|XP_006607025.1|  PREDICTED: disease resistance protein RPM1-like    437   2e-135   
ref|XP_007201146.1|  hypothetical protein PRUPE_ppa016226mg             437   3e-135   
ref|XP_007029822.1|  Disease resistance protein RPM1, putative is...    437   3e-135   
ref|XP_006470608.1|  PREDICTED: disease resistance protein RPM1-like    437   4e-135   
ref|XP_007146566.1|  hypothetical protein PHAVU_006G051500g             437   4e-135   
ref|XP_010092356.1|  Disease resistance protein RPM1                    437   8e-135   
gb|AHG28981.1|  NBS-LRR protein                                         435   1e-134   
ref|XP_003551698.1|  PREDICTED: disease resistance protein RPM1-like    435   2e-134   
emb|CDP12950.1|  unnamed protein product                                429   2e-134   
ref|XP_008377908.1|  PREDICTED: disease resistance protein RPM1-like    431   2e-134   
emb|CBI27244.3|  unnamed protein product                                456   2e-134   
ref|XP_011045053.1|  PREDICTED: disease resistance protein RPM1-like    427   2e-134   
ref|XP_003598410.1|  NBS-containing resistance-like protein             435   4e-134   
ref|XP_006474805.1|  PREDICTED: disease resistance protein RPM1-l...    435   4e-134   
ref|XP_008236578.1|  PREDICTED: disease resistance protein RPM1-like    434   9e-134   
gb|AES70497.2|  NB-ARC domain disease resistance protein                434   1e-133   
ref|XP_006452688.1|  hypothetical protein CICLE_v10010679mg             434   1e-133   
ref|XP_003600246.1|  NBS-containing resistance-like protein             433   3e-133   
emb|CAN63707.1|  hypothetical protein VITISV_010415                     427   8e-133   
ref|XP_006601725.1|  PREDICTED: disease resistance protein isofor...    431   9e-133   
ref|XP_008244608.1|  PREDICTED: disease resistance protein RPM1-like    430   1e-132   
ref|XP_010271932.1|  PREDICTED: disease resistance protein RPM1-like    426   1e-132   
ref|XP_010547073.1|  PREDICTED: disease resistance protein RPM1 i...    429   2e-132   
ref|XP_010092012.1|  Disease resistance protein RPM1                    429   2e-132   
ref|XP_010058856.1|  PREDICTED: disease resistance protein RPM1-like    424   3e-132   
ref|XP_003551565.1|  PREDICTED: disease resistance protein RPM1-like    429   4e-132   
gb|KHN43801.1|  Disease resistance protein RPM1                         435   4e-132   
ref|XP_007201618.1|  hypothetical protein PRUPE_ppa019887mg             428   6e-132   
ref|XP_003551523.1|  PREDICTED: disease resistance protein RPM1-like    428   6e-132   
ref|NP_001235618.1|  disease resistance protein                         428   9e-132   
ref|XP_011007007.1|  PREDICTED: disease resistance protein RPM1-l...    426   5e-131   
ref|XP_008353321.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    424   2e-130   
ref|XP_004295456.1|  PREDICTED: disease resistance protein RPM1-like    423   5e-130   
emb|CAN70423.1|  hypothetical protein VITISV_013576                     422   7e-130   
ref|XP_007208563.1|  hypothetical protein PRUPE_ppa024016mg             422   2e-129   
ref|XP_010528708.1|  PREDICTED: disease resistance protein RPM1-like    421   2e-129   
ref|XP_003556794.1|  PREDICTED: disease resistance protein RPM1-like    422   2e-129   
gb|KHN27360.1|  Disease resistance protein RPM1                         421   2e-129   
emb|CDP05397.1|  unnamed protein product                                410   3e-129   
emb|CDP21346.1|  unnamed protein product                                419   3e-129   
ref|XP_010649366.1|  PREDICTED: disease resistance protein RPM1-l...    420   3e-129   
ref|XP_010937262.1|  PREDICTED: disease resistance protein RPM1-like    422   4e-129   
ref|XP_006660140.1|  PREDICTED: disease resistance protein RPM1-like    420   5e-129   
ref|XP_007206828.1|  hypothetical protein PRUPE_ppa026318mg             420   5e-129   
ref|XP_004244420.1|  PREDICTED: disease resistance protein RPM1-like    421   7e-129   
gb|KEH32961.1|  NBS-LRR type disease resistance protein                 421   9e-129   
gb|AES68664.2|  NB-ARC domain disease resistance protein                420   1e-128   
ref|XP_010092358.1|  Disease resistance protein RPM1                    420   2e-128   
ref|XP_006452696.1|  hypothetical protein CICLE_v10010635mg             417   2e-128   
ref|XP_009417348.1|  PREDICTED: disease resistance protein RPM1-like    419   3e-128   
ref|XP_003600284.1|  Resistance protein                                 417   6e-128   
ref|XP_003598692.1|  NBS-containing resistance-like protein             417   7e-128   
ref|XP_003600281.1|  Resistance protein                                 416   8e-128   
gb|AES70532.2|  LRR and NB-ARC domain disease resistance protein        417   9e-128   
ref|XP_003636776.1|  NBS-containing resistance-like protein             414   1e-127   
ref|XP_003553036.2|  PREDICTED: disease resistance protein RPM1-like    417   1e-127   
ref|XP_007200008.1|  hypothetical protein PRUPE_ppa024705mg             416   2e-127   
ref|XP_010913316.1|  PREDICTED: disease resistance protein RPM1-like    416   3e-127   
emb|CDP21724.1|  unnamed protein product                                406   4e-127   
ref|XP_006361250.1|  PREDICTED: disease resistance protein RPM1-like    416   4e-127   
ref|XP_004293680.1|  PREDICTED: disease resistance protein RPM1-like    416   4e-127   
ref|XP_008235626.1|  PREDICTED: disease resistance protein RPM1-like    414   7e-127   
ref|XP_010529010.1|  PREDICTED: disease resistance protein RPM1-like    409   7e-127   
ref|XP_003600773.1|  NBS-containing resistance-like protein             414   1e-126   
ref|XP_003551528.1|  PREDICTED: disease resistance protein RPM1-like    414   1e-126   
ref|XP_010523649.1|  PREDICTED: disease resistance protein RPM1-like    414   1e-126   
ref|XP_003600282.1|  Disease resistance protein                         414   2e-126   
ref|XP_010249753.1|  PREDICTED: disease resistance protein RPM1-l...    412   3e-126   
ref|XP_006382614.1|  NBS-LRR resistance gene-like protein ARGH34        412   6e-126   
gb|KHN12513.1|  Disease resistance protein RPM1                         413   7e-126   
ref|XP_003600233.1|  NBS-containing resistance-like protein             412   7e-126   
gb|EYU39799.1|  hypothetical protein MIMGU_mgv1a019179mg                410   1e-125   
ref|XP_010064664.1|  PREDICTED: disease resistance protein RPM1-like    411   2e-125   
ref|XP_010644664.1|  PREDICTED: disease resistance protein RPM1-like    411   2e-125   
gb|KHN18114.1|  Disease resistance protein RPM1                         405   2e-125   
ref|XP_008369973.1|  PREDICTED: disease resistance protein RPM1-like    408   3e-125   
ref|XP_009406550.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    407   1e-124   
ref|XP_006603170.1|  PREDICTED: disease resistance protein RPM1-like    408   1e-124   
ref|XP_008777408.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    408   2e-124   
ref|XP_008235615.1|  PREDICTED: disease resistance protein RPM1-like    405   2e-123   
ref|XP_007208568.1|  hypothetical protein PRUPE_ppa023894mg             404   3e-123   
gb|KHN43800.1|  Disease resistance protein RPM1                         405   3e-123   
ref|XP_010547075.1|  PREDICTED: disease resistance protein RPM1 i...    404   4e-123   
ref|XP_007206393.1|  hypothetical protein PRUPE_ppa018088mg             406   4e-123   
ref|XP_008345493.1|  PREDICTED: disease resistance protein RPM1-like    401   1e-122   
ref|XP_010942930.1|  PREDICTED: disease resistance protein RPM1-like    404   2e-122   
gb|EYU39800.1|  hypothetical protein MIMGU_mgv1a026351mg                402   3e-122   
ref|XP_003553021.1|  PREDICTED: disease resistance protein RPM1-like    403   3e-122   
ref|XP_010942931.1|  PREDICTED: disease resistance protein RPM1-like    403   4e-122   
ref|XP_008352767.1|  PREDICTED: disease resistance protein RPM1-like    400   4e-122   
ref|XP_006603174.1|  PREDICTED: disease resistance protein RPM1-like    400   4e-122   
ref|XP_008777694.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    402   5e-122   
ref|XP_007207557.1|  hypothetical protein PRUPE_ppa016524mg             401   7e-122   
ref|XP_011000404.1|  PREDICTED: disease resistance protein RPM1-like    399   8e-122   
ref|XP_010674867.1|  PREDICTED: disease resistance protein RPM1-like    396   2e-121   
ref|XP_010937261.1|  PREDICTED: disease resistance protein RPM1-like    402   2e-121   
gb|KEH33971.1|  LRR and NB-ARC domain disease resistance protein        401   2e-121   
ref|XP_002264069.2|  PREDICTED: probable disease resistance RPP8-...    399   4e-121   
gb|KEH33990.1|  NB-ARC domain disease resistance protein                400   6e-121   
ref|XP_010271933.1|  PREDICTED: disease resistance protein RPM1-like    389   7e-121   
ref|XP_008376993.1|  PREDICTED: disease resistance protein RPM1-like    393   7e-121   
ref|XP_010674868.1|  PREDICTED: disease resistance protein RPM1-like    400   1e-120   
ref|XP_003600237.1|  NBS-containing resistance-like protein             398   1e-120   
ref|XP_010942932.1|  PREDICTED: disease resistance protein RPM1-like    398   2e-120   
ref|XP_010942924.1|  PREDICTED: disease resistance protein RPM1-like    397   2e-120   
ref|XP_003600267.1|  Disease resistance protein                         397   3e-120   
ref|XP_008775378.1|  PREDICTED: disease resistance protein RPM1-like    398   3e-120   
gb|AES70518.2|  LRR and NB-ARC domain disease resistance protein        397   3e-120   
gb|KEH33987.1|  NB-ARC domain disease resistance protein                397   3e-120   
ref|XP_003598413.1|  NBS resistance protein                             397   3e-120   
ref|XP_003600276.1|  Resistance protein                                 397   7e-120   
gb|KEH32960.1|  NBS-LRR type disease resistance protein                 397   7e-120   
ref|XP_006586086.1|  PREDICTED: disease resistance protein RPM1-l...    395   9e-120   
ref|XP_010942941.1|  PREDICTED: disease resistance protein RPM1-like    396   1e-119   
ref|XP_006836732.1|  hypothetical protein AMTR_s00088p00134370          394   3e-119   
ref|XP_003553066.1|  PREDICTED: disease resistance protein RPM1-like    394   4e-119   
ref|XP_008808753.1|  PREDICTED: disease resistance protein RPM1-like    397   1e-118   
ref|XP_002884622.1|  hypothetical protein ARALYDRAFT_478023             393   1e-118   
gb|AAX31149.1|  RXO1 disease resistance protein                         393   1e-118   
ref|XP_010249725.1|  PREDICTED: disease resistance protein RPM1-like    392   2e-118   
emb|CDP11687.1|  unnamed protein product                                380   2e-118   
ref|XP_003577204.1|  PREDICTED: disease resistance protein RPM1-like    392   2e-118   
gb|AGC12574.1|  RPM1                                                    392   2e-118   
gb|AES70479.2|  NB-ARC domain disease resistance protein                392   3e-118   
gb|AGC12570.1|  RPM1                                                    392   3e-118   
ref|XP_003600266.1|  NBS-containing resistance-like protein             392   3e-118   
gb|AGC12580.1|  RPM1                                                    392   3e-118   
gb|AGC12572.1|  RPM1                                                    392   3e-118   
gb|AGC12588.1|  RPM1                                                    392   4e-118   
ref|NP_187360.1|  disease resistance protein RPM1                       392   4e-118   
gb|AAC99466.1|  disease resistance gene homolog 9N                      392   5e-118   
ref|XP_008377947.1|  PREDICTED: disease resistance protein RPM1-like    384   5e-118   
ref|XP_003600228.1|  Cc-nbs resistance protein                          393   6e-118   
ref|XP_010486234.1|  PREDICTED: disease resistance protein RPM1-l...    391   9e-118   
ref|XP_007206369.1|  hypothetical protein PRUPE_ppa017857mg             390   1e-117   
ref|XP_008378403.1|  PREDICTED: disease resistance protein RPM1-like    389   1e-117   
ref|XP_008235888.1|  PREDICTED: disease resistance protein RPM1-like    397   1e-117   
gb|EYU39798.1|  hypothetical protein MIMGU_mgv1a019216mg                389   2e-117   
gb|AAD41050.1|AF122982_1  NBS/LRR disease resistance protein RPM1       390   3e-117   



>ref|XP_010324303.1| PREDICTED: disease resistance protein RPM1-like [Solanum lycopersicum]
Length=971

 Score =  1060 bits (2740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/798 (67%), Positives = 647/798 (81%), Gaps = 7/798 (1%)
 Frame = +1

Query  1     ANDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD  180
             ANDRR DALLLEE E+VGIENP ++LI  L++DDP LKV+SVVGMGGSGKTTLVK VY+D
Sbjct  174   ANDRRGDALLLEEAELVGIENPTQQLIGWLVEDDPRLKVVSVVGMGGSGKTTLVKKVYED  233

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               VKK+F S AWITVS++FKVEEVLKDMIQQL+ E+KQP PEG+ +M++N+LK I K FL
Sbjct  234   ATVKKNFNSLAWITVSKSFKVEEVLKDMIQQLYDEVKQPAPEGLNTMSSNRLKTIAKVFL  293

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
               R YV+VFDDVW+ + WEAI++ LP    G R +++TRL+DVAS  S +TNGY+YE+ P
Sbjct  294   QSRTYVLVFDDVWSIQAWEAIRYALPDVNDGSRVILTTRLLDVASFCSIETNGYVYEVKP  353

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             LS E SW L C+KAFH  SCPSHL  I + ILK+CGGLPLAIVA+GGVLATKN+ NI EW
Sbjct  354   LSTEESWILFCQKAFHGFSCPSHLESISRNILKKCGGLPLAIVAVGGVLATKNRNNIREW  413

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
             G L HSLGP+ + ND+FES+RI+LLLSFNDLP YLK CF+YLSIYPED+LIE N+LIY+W
Sbjct  414   GMLNHSLGPELDCNDKFESMRIVLLLSFNDLPYYLKPCFLYLSIYPEDYLIERNTLIYRW  473

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFVKQK  +TVE+VA+GYL ELINRSLI PV+ NDDGSMK GRIHDLYRE+ILSKS 
Sbjct  474   ITEGFVKQKERRTVEDVADGYLNELINRSLIHPVQYNDDGSMKLGRIHDLYRELILSKSR  533

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             D NF  T+DE    WPEK R LS+HG LGN Q+KR  TKLRSLLTF V D Q  S + Q+
Sbjct  534   DDNFTATVDEHNKLWPEKTRRLSMHGMLGNLQVKRSVTKLRSLLTFGVADPQSLSCISQV  593

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
             L S R+++VLDL+   L+++PE +FQL HLRYLSLR+T VKVLPRSI +L+ LEILDLK 
Sbjct  594   LGSSRMLRVLDLRGAPLKMIPETVFQLFHLRYLSLRNTNVKVLPRSIGRLKQLEILDLKQ  653

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T VTELPVEILKL++LRHL+VYSHVS++YLPYNCSPGFKA +G+G L +L+KLVY+EA P
Sbjct  654   THVTELPVEILKLENLRHLLVYSHVSYSYLPYNCSPGFKAFRGIGALRALQKLVYIEATP  713

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             G+G + E+G L EL+RLCILKLR EDG+ VCSSI+KL KL SLNLKS+EE  +LD++Y++
Sbjct  714   GSGILREVGMLGELRRLCILKLRKEDGRTVCSSIQKLRKLESLNLKSVEEHEILDLSYMA  773

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPPPLLQRLYL+G++ K+P WI+ L +LVKIYFRW+ L +DPL++LQDLPNLVHLEFLVG
Sbjct  774   SPPPLLQRLYLTGHIVKLPAWIQDLNSLVKIYFRWTHLSEDPLKYLQDLPNLVHLEFLVG  833

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             YTG  ++F  GKFQ L+LLN D LE LR V IGEGA+PHLEKLVIQRC  L +VP GIEC
Sbjct  834   YTGRELYFEQGKFQRLKLLNFDMLEGLRQVTIGEGAVPHLEKLVIQRCALLETVPTGIEC  893

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETS---  2325
             L NL+ LEFFDM D+FI T  PDK G D  KVSHI EV+YTYW+DGCW V+S++E     
Sbjct  894   LLNLKVLEFFDMPDEFIMTLRPDKLGADAWKVSHIREVFYTYWRDGCWMVHSLKEKENNH  953

Query  2326  -SGPETAV-KISGRRNSL  2373
              S P  AV +  GRRNSL
Sbjct  954   ISDPSGAVTRTYGRRNSL  971



>ref|XP_006366513.1| PREDICTED: disease resistance protein RPM1-like [Solanum tuberosum]
Length=949

 Score =  1052 bits (2721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/798 (67%), Positives = 645/798 (81%), Gaps = 7/798 (1%)
 Frame = +1

Query  1     ANDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD  180
             ANDRR DALLLEE E+VGIENP ++LI  L++DDP LKV+SVVGMGGSGKTTLVK VY+D
Sbjct  152   ANDRRGDALLLEEAELVGIENPTQQLIGWLVEDDPRLKVVSVVGMGGSGKTTLVKKVYED  211

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               VKK+F S AWITVS++FKVEEVLKDMIQQL+ E+KQP PEG+ +M++N+LK I K FL
Sbjct  212   AAVKKNFSSLAWITVSKSFKVEEVLKDMIQQLYDEVKQPAPEGLNTMSSNRLKTIAKVFL  271

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
               R YV+VFDDVWT + WEAI+H LP   +G R +++TRL+DVAS  S +TNGY+YE+ P
Sbjct  272   QSRTYVLVFDDVWTIQAWEAIRHALPDVNNGSRVILTTRLLDVASFCSIETNGYVYEVKP  331

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             LS E SW L C+KAFH  SCPSHL  I + ILK+CGGLPLA+VA+GGVLATKN+ NI EW
Sbjct  332   LSTEESWILFCQKAFHGYSCPSHLESISRNILKKCGGLPLAVVAVGGVLATKNRNNIREW  391

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
             G L HSLGP+ + ND+FES+RI+LLLSFNDLP YLK CF+YLSIYPEDHLIE N+LIY+W
Sbjct  392   GMLNHSLGPELDSNDKFESMRIVLLLSFNDLPYYLKPCFLYLSIYPEDHLIERNTLIYRW  451

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFVKQK  +TVE+VA+ YL ELINRSLI PV+ NDDGSMK GRIHDLYRE+ILSKS 
Sbjct  452   ITEGFVKQKVRRTVEDVADSYLNELINRSLIHPVQYNDDGSMKLGRIHDLYRELILSKSR  511

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             D NF  T+DE    WPEK R LS+HG LGN Q+KR  TKLRSLLTF V D Q  S + Q+
Sbjct  512   DDNFTATVDEHNKLWPEKTRWLSMHGMLGNLQVKRSVTKLRSLLTFGVADPQSLSCISQV  571

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
             L S R+++VLDL+   L ++PE +FQL HLRYLSLR+T VKVLPRSI +L+ LEILDLK 
Sbjct  572   LGSSRMLRVLDLRGAPLNMIPETVFQLFHLRYLSLRNTNVKVLPRSIGRLKQLEILDLKQ  631

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T+VTELPVEILKL++LRHL+VYSHVS++YLPYNCSPGFKA +G+G L +L+KLVY+EA P
Sbjct  632   TYVTELPVEILKLENLRHLLVYSHVSYSYLPYNCSPGFKAFRGIGALRALQKLVYIEATP  691

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             G+G ++E+G L EL+RLCILKLR EDG  VCSSI+KL KL SLNLKS+EE  +LD++YLS
Sbjct  692   GSGILKEVGMLGELRRLCILKLRKEDGWTVCSSIQKLHKLESLNLKSVEEHEILDLSYLS  751

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPPPLLQRLYL+G++  +P WI+ L +LVKIYFRW+ L +DPL++LQDLPNLVHLEFLVG
Sbjct  752   SPPPLLQRLYLTGHIVMLPAWIQDLNSLVKIYFRWTHLTEDPLKYLQDLPNLVHLEFLVG  811

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             YTG+ ++F  GKFQ L+LLNLDKLE LR V IGEGA+PHLEKLVIQRC  L +VP GIE 
Sbjct  812   YTGKELYFEQGKFQRLKLLNLDKLEGLRQVTIGEGAVPHLEKLVIQRCALLETVPTGIEY  871

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQE-----  2319
             L NL+ LEFFDM D+FI T  P+K G D  KVSHI EV+YTYW+DGCW V+S++E     
Sbjct  872   LLNLKVLEFFDMPDEFIMTLRPEKLGADAWKVSHIPEVFYTYWRDGCWMVHSLKEKEKNQ  931

Query  2320  TSSGPETAVKISGRRNSL  2373
              S       +  GRRNSL
Sbjct  932   ISDQSGAVTRTYGRRNSL  949



>gb|EYU27097.1| hypothetical protein MIMGU_mgv1a025766mg, partial [Erythranthe 
guttata]
Length=938

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/776 (59%), Positives = 593/776 (76%), Gaps = 6/776 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKD-DPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             DRR DALLLEE E+VGI+ P+K L++ L++  D  LKV++VVGMGG GKTTLVK V+DD 
Sbjct  162   DRRGDALLLEEGELVGIDGPKKHLVAWLVEGGDSRLKVVAVVGMGGLGKTTLVKKVFDDA  221

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGS--MNANKLKVIVKEF  351
              VKKHFQ+HAWITVSQ+F VEE+LKD   QLF ++K P P  M S  MN N+LK I+K+F
Sbjct  222   AVKKHFQNHAWITVSQSFNVEELLKDTAHQLFDQMKMPFPPEMSSSYMNGNRLKAIIKDF  281

Query  352   LLRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMT  531
             L  R+Y++VFDD+W+ + WE+IK+ LP +  G   +++TR +DVASS S + NGY+Y++ 
Sbjct  282   LRGRRYILVFDDIWSIQAWESIKYALPNDDRGSCVILTTRFLDVASSCSVENNGYVYKLN  341

Query  532   PLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             PLSEE SW L CRKAF ++SCP+HLT+I   IL+RCGGLPLAIVAI GVL+TK +TNI+E
Sbjct  342   PLSEEESWILFCRKAFQSNSCPNHLTDICLNILRRCGGLPLAIVAISGVLSTKKETNIDE  401

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W  L + LG +   NDQ ES+R ILLLSFN LP YLK CFMYLS YPEDHLIEHN+L+ Q
Sbjct  402   WKMLNNGLGSELGSNDQLESMRNILLLSFNYLPYYLKPCFMYLSNYPEDHLIEHNTLVRQ  461

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EGFV+ K G+  E+VA+GYL ELINRSL+ PV+ NDDGS+K   IHDLYREIILSKS
Sbjct  462   WIAEGFVRAKEGRIAEQVAQGYLNELINRSLLHPVRTNDDGSVKVSCIHDLYREIILSKS  521

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              D NFVTT  E   AWP++ R +S+HG+L  +++KR GT+L SLL+F+V DS+  S ++Q
Sbjct  522   RDQNFVTTTAERNMAWPKRVRRISIHGSLEKSEVKRYGTRLCSLLSFSVGDSRSISGMLQ  581

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             ++ S R++KVLDL    LE  PE I +L HLRYL LR+T +K LPRSI+KL+ LE LDLK
Sbjct  582   LIKSSRMLKVLDLTGVPLEKFPEVILELFHLRYLCLRNTWIKKLPRSIEKLQKLETLDLK  641

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
              T++TELP  ILKLQ+LR L+VY HV  +Y+ YN   GFKA KG+G L SL+KL ++EA 
Sbjct  642   GTYITELPAGILKLQYLRQLLVYHHVPGSYMAYNYVHGFKALKGIGCLKSLQKLCFIEAC  701

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              G+  ++EIG + ELKR+ I KLRTED   +CSS+E L+ L SL L+++E + +LD+ YL
Sbjct  702   YGSTVLKEIGTMTELKRISITKLRTEDCAVLCSSVENLVNLSSLGLRAMEGE-ILDLQYL  760

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPPP LQRLYL G M K+PHWI+S+ +LVK+Y RWS+L +DPLEHLQDLPNLVH+EFL 
Sbjct  761   SSPPPFLQRLYLGGKMEKLPHWIQSIHSLVKVYLRWSRLSNDPLEHLQDLPNLVHIEFLE  820

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G+ + F AGKF+ L+LL LDKLE LR V++ EG+ P LEKL+IQRC+ L S+P GIE
Sbjct  821   AYIGQKLCFKAGKFRKLKLLGLDKLEALREVIVEEGSAPLLEKLIIQRCSSLESLPVGIE  880

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQE  2319
              L NL+ +EFFDM + FI    P K G++Y KV+H+ EVY+TYW++GCWEV ++ +
Sbjct  881   RLMNLKVVEFFDMPERFILQLSPRKTGDEYWKVAHVPEVYHTYWRNGCWEVYALDD  936



>gb|KHN40409.1| Disease resistance protein RPM1 [Glycine soja]
Length=946

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/779 (52%), Positives = 547/779 (70%), Gaps = 7/779 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D+R DALLL+  ++VGI+ P+K+LI  L+   P  KVISV GMGG GKTTLVK V+DD 
Sbjct  148   HDQRGDALLLDNTDLVGIDRPKKKLIGWLINGCPARKVISVTGMGGMGKTTLVKKVFDDP  207

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V+KHF++  W+TVSQ+ K+EE+L+D+ ++LF+E+++P+PEGM SM ++KLK+I+K+ L 
Sbjct  208   EVRKHFKACVWVTVSQSCKIEELLRDLGRKLFSEIRRPIPEGMESMCSDKLKMIIKDLLQ  267

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             R++Y++VFDDVW    WEA+K+ LP    G R MI+TR  D+A +SS ++NG +Y + PL
Sbjct  268   RKRYLVVFDDVWHLYEWEAVKYALPNNNCGSRIMITTRRSDLAFTSSIESNGKVYNLQPL  327

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              E+ +W L CR  F   SCPSHL EI K IL++CGGLPLAIVAI GVLATK+K  I+EW 
Sbjct  328   KEDEAWDLFCRNTFQGHSCPSHLIEICKYILRKCGGLPLAIVAISGVLATKDKRRIDEWD  387

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + +GN + ++ + +L LSFNDLP +LK CF+YLSI+PED+LI+   LI  W 
Sbjct  388   MICRSLGAEIQGNGKLDNFKTVLNLSFNDLPYHLKYCFLYLSIFPEDYLIQRMRLIRLWI  447

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF++ + GKT E+VA+ YL EL+NR+LI   ++  DGS+K  RIHDL REII+ KS D
Sbjct  448   AEGFIEAREGKTKEDVADNYLKELLNRNLIQVAEITFDGSVKTLRIHDLLREIIILKSKD  507

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLG-NAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
              NFV+ + E++ AWPEK R LSVHGTL  + Q  R G++LRSLL F V ++     +   
Sbjct  508   QNFVSIVKEQSMAWPEKIRRLSVHGTLPYHRQQHRSGSQLRSLLMFGVGENLSLGKLFP-  566

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRS-IKKLRMLEILDLK  1431
                C+++ VLD Q   L   P  +  L HLRYLSLR+TKV ++P   I KL  LE LDLK
Sbjct  567   -GGCKLLGVLDYQDAPLNKFPVAVVDLYHLRYLSLRNTKVTMVPGYIIGKLHNLETLDLK  625

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
              T V ELPV+ILKLQ LRHL+VY      Y  +    GFKAP  +G L SL+KL +VEAN
Sbjct  626   KTCVRELPVDILKLQKLRHLLVYQFKVKGYPQFYSKHGFKAPTEIGNLKSLQKLCFVEAN  685

Query  1612  PGNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                G I  ++G+L++L+RL ILKLR EDGKA C SIEKL  L +L++ S  E+ V+D+ +
Sbjct  686   QDCGIITRQLGELSQLRRLGILKLREEDGKAFCLSIEKLTNLHALSVASEGENKVIDLAF  745

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             L SPPP LQRLYLSG + ++P WI+SL +L +++ +WS LK DPL +LQDLP+L HLE L
Sbjct  746   LCSPPPFLQRLYLSGRLQELPSWIQSLHSLARLFLKWSCLKYDPLVYLQDLPSLAHLELL  805

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y G+ +HF  GKF+ L++L LDK + L+ V +GE AMP LE+L I RC  L  VP+GI
Sbjct  806   QVYDGDTLHFVCGKFKKLKVLGLDKFDGLKQVTVGEDAMPCLERLSIGRCQLLKKVPSGI  865

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETS  2325
             E L  L+ LEFFDM D+ + T  P   G+DYCKVSHI  VY TYW+D  W+V ++   S
Sbjct  866   EHLNKLKVLEFFDMPDELMKTICPHGPGKDYCKVSHIPNVYSTYWRDDGWDVYALDSFS  924



>ref|XP_010056216.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
 gb|KCW72840.1| hypothetical protein EUGRSUZ_E01292 [Eucalyptus grandis]
Length=947

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/795 (52%), Positives = 551/795 (69%), Gaps = 13/795 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--  177
             +D R +ALLL++ ++VGIE P+ EL+  LL +    +VISVVGMGG GKTTLVK VY+  
Sbjct  153   HDHRGNALLLDKTDLVGIEQPKNELVERLLDEALGREVISVVGMGGLGKTTLVKQVYEEP  212

Query  178   DVKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             DVKKHF  +AWIT+S++ K+EE+LKDM+ Q+   +++PVP G  +MN++ LK+I+K+ L 
Sbjct  213   DVKKHFTVYAWITLSRSSKIEELLKDMLDQIMRVIRKPVPPGANTMNSHWLKMIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+IV DD W    W+A+KH LP   HG R +I+TR  D+AS+S  +  G +  M PL
Sbjct  273   RRRYLIVLDDAWHIHEWDAVKHALPNNSHGSRVVITTRNADLASTSCKEFYGLVKNMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L CRK F  +SCPSHL EI K IL++C GLPLAIVAI GVLA K+K  I+EW 
Sbjct  333   DPEQSWKLFCRKTFQGNSCPSHLEEICKYILRKCEGLPLAIVAISGVLAAKDKRRIDEWD  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + +GND+ ++LR +L LSF DLP YLK CF++LS++PE H IE   LI  W 
Sbjct  393   VVRRSLRAEIDGNDRLKNLRRVLSLSFGDLPHYLKSCFLHLSVFPEGHQIERRRLIRLWV  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT+EEVAE Y  EL+NRSL+       DG +   RIHD  REII SKS D
Sbjct  453   AEGFVERKEGKTLEEVAEDYFSELLNRSLMQVADTTTDGRVVLCRIHDFQREIITSKSRD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              +F T   E+T  WP+K R LS+H +L +AQ  R  + LRSL  F V D  F    + I+
Sbjct  513   QSFATIAKEQTDTWPDKVRRLSLHNSLQSAQQNRSLSHLRSLYMFGV-DRAF----IDIV  567

Query  1258  SSC--RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
               C  +++ VLDLQ+T L   P ++    +LRYLS R T+VK +P  I +L+ LE LDLK
Sbjct  568   LGCDIKLLNVLDLQATPLSRFPVQVVDWYYLRYLSFRHTEVKTIPTLIGRLQNLETLDLK  627

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA-  1608
             YT VT LPVEILKLQ LRHL+VY + + +YL Y    GFKA   +G L SL+KL Y+EA 
Sbjct  628   YTNVTRLPVEILKLQKLRHLLVYRYENISYLCYKY--GFKALLEIGALQSLQKLCYIEAD  685

Query  1609  NPGNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             N GN  I  E+GKL +L RL ILKLR EDG+A+CSSI KL  LR++++ SIEED +LD+ 
Sbjct  686   NEGNDIIMRELGKLTQLSRLGILKLRKEDGRALCSSIMKLTNLRAISVASIEEDEILDLQ  745

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
             +L+SPP LLQR+YL G +  +P+W+ +L +LVK++ RWS+LKDDPL  LQ LPNLVHLE 
Sbjct  746   HLTSPPQLLQRIYLKGRLEMLPNWLATLHSLVKLHLRWSRLKDDPLISLQSLPNLVHLEL  805

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  Y G+ + F A  F+ LR+L LD  +ELR+V + EGAMP LEKL+IQRC  L  +P+G
Sbjct  806   LQVYEGKTLCFKAKGFKKLRILGLDNFDELRSVEVEEGAMPSLEKLIIQRCKLLEKLPSG  865

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETS  2325
             IE L  L+ LEFFDM D+ +  F+ D++ +DY KV+HI EVYY YW+DG W+V S++ +S
Sbjct  866   IEYLTKLKVLEFFDMPDELVKKFVRDEQDKDYQKVAHIPEVYYGYWRDGGWDVQSIERSS  925

Query  2326  SGPETAVKISGRRNS  2370
              G  +  + SG R++
Sbjct  926   DGDASPRQGSGMRSN  940



>ref|XP_003517650.1| PREDICTED: disease resistance protein RPM1-like [Glycine max]
Length=946

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/779 (52%), Positives = 546/779 (70%), Gaps = 7/779 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D+R DALLL+  ++VGI+ P+K+LI  L+   P  KVISV GMGG GKTTLVK V+DD 
Sbjct  148   HDQRGDALLLDNTDLVGIDRPKKKLIGWLINGCPARKVISVTGMGGMGKTTLVKKVFDDP  207

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V+K F++  W+TVSQ+ K+EE+L+D+ ++LF+E+++P+PEGM SM ++KLK+I+K+ L 
Sbjct  208   EVRKLFKACVWVTVSQSCKIEELLRDLARKLFSEIRRPIPEGMESMCSDKLKMIIKDLLQ  267

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             R++Y++VFDDVW    WEA+K+ LP    G R MI+TR  D+A +SS ++NG +Y + PL
Sbjct  268   RKRYLVVFDDVWHLYEWEAVKYALPNNNCGSRIMITTRRSDLAFTSSIESNGKVYNLQPL  327

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              E+ +W L CR  F   SCPSHL EI K IL++CGGLPLAIVAI GVLATK+K  I+EW 
Sbjct  328   KEDEAWDLFCRNTFQGHSCPSHLIEICKYILRKCGGLPLAIVAISGVLATKDKRRIDEWD  387

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + +GN + ++ + +L LSFNDLP +LK CF+YLSI+PED+LI+   LI  W 
Sbjct  388   MICRSLGAEIQGNGKLDNFKTVLNLSFNDLPYHLKYCFLYLSIFPEDYLIQRMRLIRLWI  447

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF++ + GKT E+VA+ YL EL+NR+LI   ++  DGS+K  RIHDL REII+ KS D
Sbjct  448   AEGFIEAREGKTKEDVADNYLKELLNRNLIQVAEITFDGSVKTLRIHDLLREIIILKSKD  507

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLG-NAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
              NFV+ + E++ AWPEK R LSVHGTL  + Q  R G++LRSLL F V ++     +   
Sbjct  508   QNFVSIVKEQSMAWPEKIRRLSVHGTLPYHRQQHRSGSQLRSLLMFGVGENLSLGKLFP-  566

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRS-IKKLRMLEILDLK  1431
                C+++ VLD Q   L   P  +  L HLRYLSLR+TKV ++P   I KL  LE LDLK
Sbjct  567   -GGCKLLGVLDYQDAPLNKFPVAVVDLYHLRYLSLRNTKVTMVPGYIIGKLHNLETLDLK  625

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
              T V ELPV+ILKLQ LRHL+VY      Y  +    GFKAP  +G L SL+KL +VEAN
Sbjct  626   KTCVRELPVDILKLQKLRHLLVYQFKVKGYPQFYSKHGFKAPTEIGNLKSLQKLCFVEAN  685

Query  1612  PGNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                G I  ++G+L++L+RL ILKLR EDGKA C SIEKL  L +L++ S  E+ V+D+ +
Sbjct  686   QDCGIITRQLGELSQLRRLGILKLREEDGKAFCLSIEKLTNLHALSVASEGENKVIDLAF  745

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             L SPPP LQRLYLSG + ++P WI+SL +L +++ +WS LK DPL +LQDLP+L HLE L
Sbjct  746   LCSPPPFLQRLYLSGRLQELPSWIQSLHSLARLFLKWSCLKYDPLVYLQDLPSLAHLELL  805

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y G+ +HF  GKF+ L++L LDK + L+ V +GE AMP LE+L I RC  L  VP+GI
Sbjct  806   QVYDGDTLHFVCGKFKKLKVLGLDKFDGLKQVTVGEDAMPCLERLSIGRCQLLKKVPSGI  865

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETS  2325
             E L  L+ LEFFDM D+ + T  P   G+DYCKVSHI  VY TYW+D  W+V ++   S
Sbjct  866   EHLNKLKVLEFFDMPDELMKTICPHGPGKDYCKVSHIPNVYSTYWRDDGWDVYALDSFS  924



>ref|XP_009373508.1| PREDICTED: disease resistance protein RPM1-like [Pyrus x bretschneideri]
Length=941

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/783 (51%), Positives = 544/783 (69%), Gaps = 5/783 (1%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             + DALLLEE ++V I  P+++LI LL+  +P  + ISVVGMGG GKTTLVK VY+D  V+
Sbjct  150   QGDALLLEEVDLVAISEPKRQLIELLMAGEPGRQAISVVGMGGLGKTTLVKQVYEDAKVQ  209

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             K F+ HAWITVSQ+FK++ +L+ ++Q +F  +++PVPE + SMN ++LK  +K+ L + +
Sbjct  210   KRFKVHAWITVSQSFKIKRLLRHIVQNIFQVIRKPVPEEVDSMNTDQLKEKIKKLLQQTR  269

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DD+W   VW+AI H LP   HG R MI+TR   VAS+SS + NG +Y + PLS E
Sbjct  270   YLIVLDDLWNNDVWDAINHALPHNSHGSRVMITTRNTAVASASSMENNGMVYHLEPLSPE  329

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L CRK F  +SCP +L  I + IL++CGGLPLAIVAI  VLATK+K NI+EW A+ 
Sbjct  330   ESWTLFCRKTFPENSCPPNLEGICQSILRKCGGLPLAIVAISAVLATKDKKNIDEWAAVS  389

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              S+G   E N Q ++++ +L LSF+DLP +LK CF+YLSI+P+ + I+H  LI  W  EG
Sbjct  390   GSIGAQIEENGQLDNMKKLLYLSFSDLPYHLKSCFLYLSIFPDLYKIDHMRLIRLWMAEG  449

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FV +K G T EEVAE YL EL++RSLI   ++  DG +K  RIHDL REII  KS + NF
Sbjct  450   FVIEKEGNTPEEVAESYLKELLDRSLIQAAEIATDGRVKSCRIHDLLREIINLKSREQNF  509

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI-LSS  1263
                  E+    P+K R LS+  TL N   KR  + LRSLL F V DS     + ++ L  
Sbjct  510   AAIEKEQGTMCPDKVRRLSIFNTLHNVIPKRTLSHLRSLLIFGVEDSLTEFSIPKLFLKG  569

Query  1264  CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
               ++ VLDLQ   L++ P E+  L  LRYLSLR TKVK +P SI+KL+ LE LDLK++ V
Sbjct  570   LPLLTVLDLQGAPLDMFPREVVNLFLLRYLSLRDTKVKQIPSSIRKLQNLETLDLKHSLV  629

Query  1444  TELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNG  1623
              ELP +IL L+ LRHL+VY +   +Y  +N   G K P G+  L SL+KL ++EAN  NG
Sbjct  630   VELPPDILNLKRLRHLLVYRYEVESYARFNSRFGVKIPAGICGLQSLQKLCFIEANHDNG  689

Query  1624  TI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSP  1800
              +  E+G +N+L+RL I KLRTEDG  VCSS+EKL  LRSL++ S+E+++++D+  +S P
Sbjct  690   ALMAELGGMNQLRRLGIFKLRTEDGVTVCSSVEKLTNLRSLSVSSVEKEMIIDLTQISCP  749

Query  1801  PPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYT  1980
             P  LQRLYL+G +  +PHWI SL NLV+++ +WS+LK+DPL HLQ LPNLVHLE L  Y 
Sbjct  750   PQFLQRLYLTGRLENLPHWISSLHNLVRLFLKWSRLKEDPLVHLQGLPNLVHLELLQVYD  809

Query  1981  GEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLF  2160
             GE +HF  G F SL+LL +DKLE +  +++ +GAMP LEKL+IQRCN L  VP+GIE L 
Sbjct  810   GECLHFKEGGFPSLKLLGIDKLEGVEEIIMDDGAMPCLEKLIIQRCNLLKKVPSGIEHLK  869

Query  2161  NLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGPET  2340
             NL+ LEFFDM D+ I + LPD  GED+ KV+HI  VYY+YW+ G W+VNS++       +
Sbjct  870   NLKLLEFFDMPDELIESLLPDG-GEDHWKVAHIQAVYYSYWRGGGWDVNSLEIIHPATSS  928

Query  2341  AVK  2349
             A++
Sbjct  929   AMR  931



>ref|XP_006587620.1| PREDICTED: disease resistance protein RPM1-like [Glycine max]
Length=948

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/781 (51%), Positives = 543/781 (70%), Gaps = 9/781 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D+R DALLL+  ++VGI+ P+K+LI  L+      KVISV GMGG GKTTLVK V+DD 
Sbjct  148   HDQRGDALLLDNTDLVGIDRPKKQLIGWLINGCTGRKVISVTGMGGMGKTTLVKKVFDDP  207

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V+KHF++  W+TVSQ+ K EE+L+D+ ++LF+E+++P+PEG+ SM ++KLK+I+K+ L 
Sbjct  208   EVRKHFKACVWVTVSQSCKTEELLRDLARKLFSEIRRPIPEGLESMCSDKLKMIIKDLLQ  267

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             R++Y++VFDDVW    WEA+K+ LP    G R MI+TR  ++A +SS ++NG +Y + PL
Sbjct  268   RKRYLVVFDDVWQMYEWEAVKYALPNNNCGSRIMITTRKSNLAFTSSIESNGKVYNLQPL  327

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              E+ +W L CR  F   SCPSHL +I K IL++CGGLPLAIVAI GVLATK+K  I+EW 
Sbjct  328   KEDEAWDLFCRNTFQGHSCPSHLIDICKYILRKCGGLPLAIVAISGVLATKDKHRIDEWD  387

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + +GN + ++ + +L LSFNDLP +LK CF+YLSI+PED+LI+   LI  W 
Sbjct  388   MICRSLGAEIQGNGKLDNFKTVLNLSFNDLPYHLKYCFLYLSIFPEDYLIQRMRLIRLWI  447

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF+K K GKT E+VA+ YL EL+NR+LI   ++  DG +K  RIHDL REII+ KS D
Sbjct  448   AEGFIKAKEGKTKEDVADDYLKELLNRNLIQVAEITSDGRVKTLRIHDLLREIIILKSKD  507

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTL---GNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
              NFV+ + E++ AWPEK R LSVHGTL       + R G++LRSLL F V ++     + 
Sbjct  508   QNFVSVVKEQSIAWPEKIRRLSVHGTLPCHRQQHIHRSGSQLRSLLMFGVGENLSLGKLF  567

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRS-IKKLRMLEILD  1425
                  C+++ VLD Q   L   P  +  L HLRYLSLR+TKV ++P   I KL  LE LD
Sbjct  568   P--GGCKLLGVLDYQDAPLNKFPVAVVDLYHLRYLSLRNTKVTMVPGYIIGKLHNLETLD  625

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVE  1605
             LK T V ELP++ILKLQ LRHL+VY      Y  +    GFKAP  +G L +L+KL +VE
Sbjct  626   LKKTSVRELPLDILKLQKLRHLLVYKFNVKGYAQFYSKHGFKAPTEIGNLKALQKLCFVE  685

Query  1606  ANPGNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
             AN   G  I ++G+L++L+RL ILKLR EDGKA C SIE+L  L +L++ S  E+ V+D+
Sbjct  686   ANQDCGMIIRQLGELSQLRRLGILKLREEDGKAFCLSIERLTNLHALSVASEGENKVIDL  745

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
              +L SPPP LQRLYLSG + ++P WI+SL +L +++ +WS LK DPL +LQDLP+L HLE
Sbjct  746   AFLCSPPPFLQRLYLSGRLQELPSWIQSLHSLARLFLKWSCLKHDPLVYLQDLPSLAHLE  805

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
              +  Y G+ +HF  GKF+ L++L LDK + L+ V +GE AMP LE+L I RC  L  VP+
Sbjct  806   LVQVYDGDTLHFVCGKFKKLKVLGLDKFDGLKQVTVGEDAMPCLERLSIGRCELLKKVPS  865

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQET  2322
             GIE L  L+ LEFFDM D+ + T  P   G+DYCKVSHI  VY TYW+D  W+V ++   
Sbjct  866   GIEHLSKLKVLEFFDMPDELMKTICPHGPGKDYCKVSHIPNVYSTYWRDDGWDVYALDSF  925

Query  2323  S  2325
             S
Sbjct  926   S  926



>ref|XP_011018453.1| PREDICTED: disease resistance protein RPM1-like [Populus euphratica]
Length=944

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/787 (51%), Positives = 544/787 (69%), Gaps = 7/787 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R DALLL+  ++VGIE  + +L+  L+      +V+S+ GMGG GKTTL K VYDD 
Sbjct  151   QDGREDALLLDMTDLVGIEERKSKLVGWLVDGRSGREVVSLTGMGGLGKTTLAKQVYDDA  210

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF  HAWITVS+++K+EE+LKD++QQLFA  ++PVP+ + S N+++LK I+KE L 
Sbjct  211   EVKKHFSVHAWITVSRSYKMEELLKDIVQQLFAAERKPVPKNLESQNSSQLKSIIKEVLQ  270

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+IV DDVW    W+A+K+ LP    G R M++TR  D+A +S  ++ G +Y + PL
Sbjct  271   KRRYLIVLDDVWHVNEWDAVKYALPTNNCGSRVMLTTRNADLAFTSRIESEGKVYNLEPL  330

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L CRK F  +SCP HL +I   IL++C GLPLAIVAI GVLA K+K  I+EW 
Sbjct  331   LPEESWTLFCRKTFRGNSCPHHLEDICNNILRKCEGLPLAIVAISGVLAAKDKRRIDEWE  390

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + E N++  +L+ +L LSFNDLP YLK CF+Y+SI+PEDHLIEH  LI  W 
Sbjct  391   MVRRSLGAEIEDNNKLLNLKKVLSLSFNDLPYYLKSCFLYVSIFPEDHLIEHMKLIRLWV  450

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+ K GK +E+VAE Y  EL+NRSL+   +   DG +K  R HDL REII+SKS D
Sbjct  451   AEGFVEAKYGKELEDVAEDYFNELLNRSLLQVAETASDGRVKTCRPHDLLREIIISKSRD  510

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF     ++ A WP+K R LS+H T+ N Q+ R  ++LRSL  F + +   S       
Sbjct  511   QNFAVIAKDQNAMWPDKIRRLSIHYTVRNVQLNRCVSQLRSLFMFGMVEK--SPLRTLFP  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             +  R++ VLDLQ   +++ P ++  L +LRYLSL+ TKV  +P  I KL+ LE LDLK+T
Sbjct  569   NGFRLLHVLDLQGAPIKMFPVQVINLYYLRYLSLKETKVSRVPSYIGKLQHLETLDLKHT  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
             +VTELP EILKLQ LRHL+VY +   +Y  ++   GFKA + +G+L SL+KL +VEAN G
Sbjct  629   YVTELPDEILKLQRLRHLLVYRYKFESYAHFHSKNGFKALEKIGQLQSLQKLCFVEANHG  688

Query  1618  NGTIE-EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             NG I  E+GKL +L+RL ++KLR EDGK++CSSIE L  LR+L+L S+EED +LD+ +L 
Sbjct  689   NGNIMIELGKLTKLRRLGVVKLRREDGKSLCSSIENLRNLRALSLLSVEEDEILDLEHLF  748

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPPPLLQRLYL+G +  +PHWI +L +LV+++ +WS+LK DPLE LQ LPNLVHLE L  
Sbjct  749   SPPPLLQRLYLTGRLVTLPHWIPNLESLVRVHLKWSRLKGDPLESLQVLPNLVHLELLQV  808

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y G+ + F  G F+ L+LL +DK +ELR V +  GA+P +EKL IQRC  L   P GIE 
Sbjct  809   YEGDTLCFKVGGFKKLKLLGIDKFDELRCVEVEVGALPRVEKLSIQRCKLLEKAPLGIEH  868

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ--ETSS  2328
             L  L+ LEFFDM  + I T L D++G DY +V+HI EVY TYW+DG WEV S++    SS
Sbjct  869   LTKLKVLEFFDMPQELIKTLLSDEQGGDYWRVAHIPEVYSTYWRDGGWEVYSLESFNDSS  928

Query  2329  GPETAVK  2349
              P   ++
Sbjct  929   RPSPVIR  935



>ref|XP_007158212.1| hypothetical protein PHAVU_002G133600g [Phaseolus vulgaris]
 gb|ESW30206.1| hypothetical protein PHAVU_002G133600g [Phaseolus vulgaris]
Length=945

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/774 (52%), Positives = 533/774 (69%), Gaps = 6/774 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D+R DALLL+ +++VGI+ P+K+ I  L+   P  KVISV GMGG GKTTLVK VYDD 
Sbjct  148   HDQRGDALLLDNNDLVGIDRPKKKFIGWLINGCPGRKVISVTGMGGIGKTTLVKKVYDDP  207

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF++  W+TVSQ+ K+EE+LKD+  +LF+E+++P+PEGM SM  +KLK+I+K+ L 
Sbjct  208   DVKKHFKACVWVTVSQSCKIEELLKDLALKLFSEIRRPIPEGMESMCNDKLKMIIKDLLQ  267

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             R++Y++VFDDVW    WEA+K+ LP      R MI+TR  D+A +SS ++NG +Y + PL
Sbjct  268   RKRYLVVFDDVWHMYEWEAVKYALPNNTCCSRIMITTRRSDLAFTSSIESNGKVYNLQPL  327

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              E+ +W L CR  F   SCPS+L +I K ILK+C GLPLAIVAI GVLATK+K  I+EW 
Sbjct  328   KEDEAWDLFCRNTFQGDSCPSYLIDICKYILKKCEGLPLAIVAISGVLATKDKRRIDEWD  387

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + HSLG +  GN + +S + +L LSFNDLP +LK CF+YLSI+PED+LI+   LI  W 
Sbjct  388   MICHSLGAEIHGNGKLDSFKTVLNLSFNDLPYHLKYCFLYLSIFPEDYLIQRMRLIRLWI  447

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF++ K GKT E+VA+ YL EL+NR+LI    +  DG +K  RIHDL REII+ KS D
Sbjct  448   AEGFIEAKEGKTKEDVADDYLKELLNRNLIQVAGITSDGRVKTLRIHDLLREIIILKSKD  507

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF + + E++ AWPEK R LSVHGTL   Q  R  ++LRS L F V +      +    
Sbjct  508   QNFASIVKEQSVAWPEKIRRLSVHGTLPYRQQHRSVSQLRSFLMFGVGEHVPLGKLFP--  565

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRS-IKKLRMLEILDLKY  1434
             S  +++ VLD Q   L+  P  +  L HLRYLSLR+TKVK++P   I KL  LE LDLK 
Sbjct  566   SGFKLLSVLDYQDAPLKKFPLAVIDLYHLRYLSLRNTKVKMVPGYLIGKLHNLETLDLKK  625

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T V ELPV+ILKLQ LRHL+VY      Y  ++   G KAP  +G L SL+KL +VEAN 
Sbjct  626   TSVRELPVDILKLQKLRHLLVYQFKFKGYAQFHSKHGVKAPTEIGNLKSLQKLCFVEANQ  685

Query  1615  GNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
               G  I ++ KL +L+RL ILKLR EDG A C SIE+L  L +L++ S  E  V+D+ +L
Sbjct  686   DRGMIIRQLAKLTQLRRLGILKLREEDGMAFCLSIERLTNLHALSVTSEGESKVIDLTFL  745

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
              SPPP LQRLYLSG + ++P WI+SL +L +++ +WS L  DPL +LQDLPNL HLE L 
Sbjct  746   CSPPPFLQRLYLSGRLQELPCWIQSLHSLARLFLKWSCLNYDPLVYLQDLPNLAHLELLQ  805

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G+ MHF +GKF+ L++L LDK + L+ V +G+ AM  LE+L I RC  L  VP+GIE
Sbjct  806   VYDGDTMHFRSGKFKKLKVLGLDKFDGLKEVTVGKDAMTCLERLSIGRCELLKKVPSGIE  865

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSV  2313
              L  L+ LEFFDM D+ + T  P   G+DYCKV HI +VY TYW+DG W+V ++
Sbjct  866   NLTKLKVLEFFDMPDELMKTICPHGPGKDYCKVLHIPDVYSTYWRDGGWDVYAL  919



>ref|XP_008238137.1| PREDICTED: disease resistance protein RPM1-like [Prunus mume]
Length=949

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/780 (51%), Positives = 546/780 (70%), Gaps = 9/780 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--D  180
             DRR DALLLE+ +IVGI+ P K+L+  LL      +V+SV GMGG GKTTLVK VYD  +
Sbjct  154   DRRGDALLLEKTDIVGIDEPIKQLVGWLLSGGSGREVVSVAGMGGLGKTTLVKQVYDAAE  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF+ HAWITV+Q+FK+ E+LKDM+QQL   +++P+P+G  +MN N+LK ++K+FL +
Sbjct  214   VKKHFKVHAWITVTQSFKLGELLKDMLQQLHKAIRRPLPQGTSNMNNNQLKTLIKDFLQK  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV DDVW    W+++K+ LP    G R +++TR  D+AS++S ++ G +Y M PL 
Sbjct  274   RRYLIVLDDVWHLHGWDSVKYALPNNICGSRIILTTRNADIASTTSVESGGKVYNMEPLP  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             +  SW LLC+K F  SSCP +L EI   IL++C GLPLAIVA+ GVLATK+K  I+EW  
Sbjct  334   QLESWELLCKKTFQGSSCPPYLEEISNCILRKCEGLPLAIVAVSGVLATKDKRRIDEWDM  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EGND+ + L+ +L LSFNDLP YLK CF+YLSI+PEDHLIEH  L+  W  
Sbjct  394   VGHSLGAEIEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHLIEHMRLVRLWMA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGF++ K GKT+E+VAE YL EL+NRS+I   +   DG +K  R+HDL+REII SK  D 
Sbjct  454   EGFIEAKEGKTLEDVAEDYLNELLNRSMIQAAETTSDGRVKNFRVHDLFREIITSKIRDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-  1257
             NF T   +++  WP+K R LS+H +L   Q  R  ++LRSL  F + +      ++Q L 
Sbjct  514   NFATIAKDQSMPWPDKIRRLSMHNSLQYVQKNRCASQLRSLFMFRLAEKP----LLQTLF  569

Query  1258  -SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
                 R++ VLDLQS  L + P E+F L  L+YLSL+ T+VK +P  I KL+ LE LDLK+
Sbjct  570   PGGFRLLNVLDLQSAPLSVFPIEVFNLFFLKYLSLKDTRVKTIPSFIGKLQNLETLDLKH  629

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             + VTELP EILKL+HLRHL+VY +    Y  ++   GFK    +G L SL+KL +++AN 
Sbjct  630   SLVTELPAEILKLKHLRHLLVYRYEFVPYGDFHSKYGFKVLAKIGALTSLQKLCFIKANQ  689

Query  1615  GNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
               G I +E+GKL +L+RL I+++R EDGK +CSSIEKL KL +L++ S+EED ++D+ +L
Sbjct  690   DGGAILKELGKLVQLRRLGIVQMRKEDGKVLCSSIEKLSKLCALSITSVEEDEIIDLQHL  749

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP LLQRLYL G +  +PHWI SL +LV++Y +WS+LKDDPL  LQ LPNLVHLE   
Sbjct  750   SSPPLLLQRLYLQGRLDALPHWIPSLHSLVRLYLKWSRLKDDPLLFLQYLPNLVHLELSQ  809

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              + G+ + F AG F+ L+ L +++ + LR + +  GAMP +EKL IQRC  L  VP+GIE
Sbjct  810   VFEGDTLCFGAGGFKKLKHLGINEFDALRCIQVEMGAMPCVEKLSIQRCKSLEKVPSGIE  869

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
              L  L+ LEFF+M +  I T  P + G DY KV+HI EVY+TYW++  WEV  ++  + G
Sbjct  870   HLNKLKVLEFFEMPEKLIKTLRPQEEGNDYWKVAHIPEVYFTYWRECGWEVYPLEGLNEG  929



>ref|XP_008373504.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
Length=941

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/784 (52%), Positives = 548/784 (70%), Gaps = 5/784 (1%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R+ DALLLEE ++V I  P+++LI LL+  +   + ISVVGMGG GKTTLVK VY+D  V
Sbjct  149   RQGDALLLEEADLVAIGEPKRQLIELLMAGESGRQAISVVGMGGLGKTTLVKQVYEDARV  208

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +K F+ HAWITVSQ FK++ +L+ ++Q++F  +++PVPE + SMN ++L+  +K+ L + 
Sbjct  209   QKRFKVHAWITVSQPFKIKRLLRHVVQKIFQVIRKPVPEEVDSMNTDQLRERIKKLLQQT  268

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +Y+IV DD+W   VW+AI H LP   +G R MI+TR   VAS+SS + +G +Y + PLS 
Sbjct  269   RYLIVLDDLWNNDVWDAINHALPHNGNGSRVMITTRNAAVASASSMENHGMVYHLEPLSP  328

Query  544   EVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
             E SW L CRK F  +SCP +L  I + IL++CGGLPLAIVAI  VLATK+K NI EW A+
Sbjct  329   EESWTLFCRKTFPENSCPPNLEGICQSILRKCGGLPLAIVAISAVLATKDKRNIEEWAAV  388

Query  724   YHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTME  903
               S+G   E N Q ++++ +L LSF+DLP +LK CF+YLSI+P+ + I+H  LI  W  E
Sbjct  389   SGSIGAQIEENGQLDNMKKLLYLSFSDLPYHLKSCFLYLSIFPDLYQIDHMRLIRLWMAE  448

Query  904   GFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHN  1083
             GFV ++ GKT EEVAE YL EL++RSLI   ++  DG +K  RIHDL REII+SKS + N
Sbjct  449   GFVIEREGKTPEEVAESYLKELLDRSLIQAAEIATDGRVKSCRIHDLLREIIISKSREQN  508

Query  1084  FVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-S  1260
             F     E+   WP+K R LS+  TL N   KR  + LRSLL F V DS     + ++   
Sbjct  509   FAAIEKEQGTMWPDKVRRLSIFNTLQNVIPKRTPSHLRSLLIFGVEDSLTEFSIPKLFPK  568

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
                ++ VLDLQ   L++ P E+  LL LRYLSLR TKVK +P SI+KL+ LE LDLK++ 
Sbjct  569   GLPLLTVLDLQGAPLDMFPREVVNLLLLRYLSLRDTKVKQIPSSIRKLQNLETLDLKHSL  628

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             V ELP EIL L+ LRHL+VY +   +Y  +N   G K P G+  L SL+KL ++EAN  N
Sbjct  629   VVELPPEILNLKRLRHLLVYRYEVESYARFNSRFGVKVPAGICGLQSLQKLCFIEANHDN  688

Query  1621  GTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
             G +  E+G++N+L+RL I KLRTEDG  VCSS+EKL  LRSL++ S+E+++++D+  +S 
Sbjct  689   GALMAELGRMNQLRRLGIFKLRTEDGVTVCSSVEKLTNLRSLSVSSVEKEMIIDLTQISC  748

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQRLYL+G +  +PHWI SL NLV+++ +WS+LK+DPL HLQ LPNLVHLE L  Y
Sbjct  749   PPQFLQRLYLTGRLENLPHWISSLHNLVRLFLKWSRLKEDPLVHLQGLPNLVHLELLQVY  808

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE +HF  G F SL+LL +DKLE +  ++I EGAMP LEKL+IQRCN L  VP+GIE L
Sbjct  809   DGECLHFKEGGFPSLKLLGIDKLEGVEEIIIDEGAMPCLEKLIIQRCNLLKKVPSGIEHL  868

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGPE  2337
              +L+ LEFFDM D+ I + LPD  GED+ KV+HI  VYY+YW+ G W+VNS++       
Sbjct  869   KSLKLLEFFDMPDELIQSLLPDG-GEDHGKVAHIQAVYYSYWRGGGWDVNSLEIIHPATS  927

Query  2338  TAVK  2349
             +A++
Sbjct  928   SAMR  931



>ref|XP_008348395.1| PREDICTED: LOW QUALITY PROTEIN: disease resistance protein RPM1-like 
[Malus domestica]
Length=954

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/787 (50%), Positives = 538/787 (68%), Gaps = 16/787 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--  177
              D R DALLLE+ +IVGI  P K+++  L+      +V+SV GMGG GKTTL K VYD  
Sbjct  153   GDHRGDALLLEKTDIVGIVKPIKQMVGWLVSGGSGRQVVSVAGMGGLGKTTLAKQVYDAA  212

Query  178   DVKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             +VKKHF+  AW+TV+Q+ ++ E+LKDMIQQL   +++PVP+G  +MN N+LK ++K FL 
Sbjct  213   EVKKHFKVSAWVTVTQSLRLRELLKDMIQQLHKAIRRPVPQGTNNMNNNQLKTMIKAFLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+IV DDVW    W ++K+ LP    G R +++TR  DVAS++S ++ G ++ + PL
Sbjct  273   KRRYLIVLDDVWDRDGWASLKYALPNNTCGSRVILTTRKADVASTTSKESGGRVFNLEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              +  SW LLC+K F  +SCP +L EI K IL++C GLPLAIVA+ GVLATK+K  I+EW 
Sbjct  333   PQLESWXLLCKKTFQGNSCPPYLEEIGKSILRKCEGLPLAIVAVSGVLATKDKRRIDEWD  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + HSLG + EGND+ + L+ +L LSFNDLP YLK CF+YLSI+PEDHLIEH  L+  W 
Sbjct  393   MVGHSLGAEMEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHLIEHMRLVRLWM  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF+++  GKT+E+VAE YL EL+NRS+I   +   DG +K  R+HDL REII SK  D
Sbjct  453   AEGFIEEXQGKTLEDVAEDYLNELLNRSMIQVAETTTDGRVKSFRVHDLLREIITSKIRD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF T   E+   WP+K R LS+H +L   Q  R  ++LRSL  F VT+      +    
Sbjct  513   QNFATIAKEQNMPWPDKVRRLSMHTSLQYIQKNRSASQLRSLFMFGVTEKPLLQTIFP--  570

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                R++ VLDLQS  L + P E   L  L+YLSL+ T+VK +P+ I KL+ LE LDLK++
Sbjct  571   GGFRLLSVLDLQSAPLNVFPVEAVNLFFLKYLSLKGTRVKTIPKFIGKLQNLETLDLKHS  630

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPY--------NCSPGFKAPkglgklgslekl  1593
              VTELPVEILKLQHLRHL+VY    + ++PY        +   GFK    +G L  L+KL
Sbjct  631   LVTELPVEILKLQHLRHLLVY---RYEFVPYGDFHSKYGHSKYGFKVLAKIGALTCLQKL  687

Query  1594  VYVEANPGNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDV  1770
              ++EAN   G I  E+GKL +L+RL I+ LR +DGKA+C SI+KL KL +L++ S+EED 
Sbjct  688   CFIEANQDGGAILRELGKLIQLRRLGIVHLRKQDGKALCLSIDKLTKLCALSITSVEEDE  747

Query  1771  VLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNL  1950
             ++D+ ++SSPP LLQRLYL G +  +PHWI SL +LV++Y +WS+LKD+PL  +Q LPNL
Sbjct  748   IIDLQHISSPPLLLQRLYLRGRLETLPHWIPSLHSLVRLYLKWSRLKDNPLVFIQHLPNL  807

Query  1951  VHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLA  2130
             VHLE    + G+ + F AG ++ L+ L +DK +ELR + + EGAMP +EKL IQRC  L 
Sbjct  808   VHLELSQVFEGDTLCFGAGGYKKLKHLGIDKFDELRCIEVQEGAMPFIEKLSIQRCKSLE  867

Query  2131  SVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNS  2310
              VP+GIE L  L+ LEFFDM +  I T  P ++G DY KV+HI EVY+TY ++  WEV +
Sbjct  868   KVPSGIEHLNKLKVLEFFDMPETLIKTLSPHEQGNDYWKVAHIPEVYFTYLRESGWEVYT  927

Query  2311  VQETSSG  2331
             ++  + G
Sbjct  928   LEGFNEG  934



>gb|AFP82245.1| NBS-LRR type disease resistance protein [Malus domestica]
Length=941

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/784 (52%), Positives = 547/784 (70%), Gaps = 5/784 (1%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R+ DALLLEE ++V I  P+++LI LL+  +   + ISVVGMGG GKTTLVK VY+D  V
Sbjct  149   RQGDALLLEEADLVAIGEPKRQLIELLMAGESGRQAISVVGMGGLGKTTLVKQVYEDARV  208

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +K F+ HAWITVSQ FK++ +L+ ++Q++F  +++PVPE + SMN ++L+  +K+ L + 
Sbjct  209   QKRFKVHAWITVSQPFKIKRLLRHVVQKIFQVIRKPVPEEVDSMNTDQLRERIKKLLQQT  268

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +Y+IV DD+W   VW+AI H LP   +G R MI+TR   VAS+SS + +G +Y + PLS 
Sbjct  269   RYLIVLDDLWNNDVWDAINHALPHNGNGSRVMITTRNAAVASASSMENHGMVYHLEPLSP  328

Query  544   EVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
             E SW L CRK F  +SCP +L  I + IL++CGGLPLAIVAI  VLATK+K NI EW A+
Sbjct  329   EESWTLFCRKTFPENSCPPNLEGICQSILRKCGGLPLAIVAISAVLATKDKRNIEEWAAV  388

Query  724   YHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTME  903
               S+G   E N Q ++++ +L LSF+DLP +LK CF+YLSI+P+ + I+H  LI  W  E
Sbjct  389   SGSIGAQIEENGQLDNMKKLLYLSFSDLPYHLKSCFLYLSIFPDLYQIDHMRLIRLWMAE  448

Query  904   GFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHN  1083
             GFV ++ GKT EEVAE YL EL++RSLI   ++  DG +K  RIHDL REII+SKS + N
Sbjct  449   GFVIEREGKTPEEVAESYLKELLDRSLIQAAEIATDGRVKSCRIHDLLREIIISKSREQN  508

Query  1084  FVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-S  1260
             F     E+   WP+K R LS+  TL N   KR  + LRSLL F V DS     + ++   
Sbjct  509   FAAIEKEQGTMWPDKVRRLSIFNTLRNVIPKRTPSHLRSLLIFGVEDSLTEFSIPKLFPK  568

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
                ++ VLDLQ   L++ P E+  LL LRYLSLR TKVK +P SI+KL+ LE LDLK++ 
Sbjct  569   GLPLLTVLDLQGAPLDMFPREVVNLLLLRYLSLRDTKVKQIPSSIRKLQNLETLDLKHSL  628

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             V ELP EIL L+ LRHL+VY +   +Y  +N   G K P G+  L SL+KL ++EAN  N
Sbjct  629   VVELPPEILNLKRLRHLLVYRYEVESYARFNSRFGVKVPAGICGLQSLQKLCFIEANHDN  688

Query  1621  GTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
             G +  E+G++N+L+RL I KLRTEDG  VCSS+EKL  LRSL++ S+E+ +++D+  +S 
Sbjct  689   GALMAELGRMNQLRRLGIFKLRTEDGVTVCSSVEKLTNLRSLSVSSVEKGMIIDLTQISC  748

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQRLYL+G +  +PHWI SL NLV+++ +WS+LK+DPL HLQ LPNLVHLE L  Y
Sbjct  749   PPQFLQRLYLTGRLENLPHWISSLHNLVRLFLKWSRLKEDPLVHLQGLPNLVHLELLQVY  808

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE +HF  G F SL+LL +DKLE +  ++I EGAMP LEKL+IQRCN L  VP+GIE L
Sbjct  809   DGECLHFKEGGFPSLKLLGIDKLEGVEEIIIDEGAMPCLEKLIIQRCNLLKKVPSGIEHL  868

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGPE  2337
              +L+ LEFFDM D+ I + LPD  GED+ KV+HI  VYY+YW+ G W+VNS++       
Sbjct  869   KSLKLLEFFDMPDELIQSLLPDG-GEDHGKVAHIQAVYYSYWRGGGWDVNSLEIIHPATS  927

Query  2338  TAVK  2349
             +A++
Sbjct  928   SAMR  931



>ref|XP_007040757.1| Nbs-lrr resistance protein [Theobroma cacao]
 gb|EOY25258.1| Nbs-lrr resistance protein [Theobroma cacao]
Length=947

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/778 (53%), Positives = 538/778 (69%), Gaps = 4/778 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              DRR DALLL++ ++VGI+ P+K+L+  L+      KVIS+ GMGG GKTTL K VYDD 
Sbjct  152   QDRRGDALLLDKTDVVGIDEPKKKLVGWLVNGASDFKVISLSGMGGLGKTTLAKQVYDDP  211

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF+ HAWITVSQ+FK+E +LKDM+QQL   + +PVPEG+ SM++ +LK I+K  L 
Sbjct  212   EVKKHFKVHAWITVSQSFKLEGLLKDMVQQLSRVITKPVPEGVDSMSSYQLKTIIKNLLR  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+I+ DDVW    W+AIK  LP    G R M++TR  D+A SS  ++ G +Y + PL
Sbjct  272   KRRYLIILDDVWRINEWDAIKFALPANDCGSRVMLTTRNADLAFSSRIESEGEVYNLEPL  331

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               EVSW L CRK F  + CP +L EI KQILK+C GLPLAIVAI GVLATK+K  I+EW 
Sbjct  332   PPEVSWTLFCRKTFGGNYCPPYLEEICKQILKKCEGLPLAIVAISGVLATKSKRRIDEWE  391

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + +GND+  +L+ +L LSFNDLP YLK CF+YLSI+PED  IE   LI  WT
Sbjct  392   MVGRSLGAEIDGNDKLMNLKKVLSLSFNDLPYYLKSCFLYLSIFPEDRPIELMRLIRLWT  451

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+ K GKT EEVAE +  EL+NRSLI       DG +K  RIHDL REII+ KS +
Sbjct  452   AEGFVEVKQGKTQEEVAEDFFNELLNRSLIQVAGTTSDGRVKSCRIHDLLREIIILKSRE  511

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF     E+ A WP+K R LS+H TL N    R  ++LRSL  F V ++     ++   
Sbjct  512   QNFAAIAKEQNAMWPDKVRRLSIHNTLQNVLQNRFVSRLRSLFMFGVEENPSLRRLIP--  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                R++ VLDLQ+T +   P E+  L +L+YLSLR TK+ V+PR I KL+ LE LDLK+ 
Sbjct  570   GGFRLLAVLDLQATPITKFPVEVVNLYYLKYLSLRETKITVVPRFIGKLQNLETLDLKHA  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
             + TELPVEIL+LQ LRHL+VY +   +Y  ++   GFKAP+ +G L SL+KL ++E + G
Sbjct  630   YATELPVEILQLQRLRHLLVYRYEFESYDHFHSKYGFKAPERIGSLQSLQKLCHIEVDQG  689

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
             + T+ E+GKL +L+RL I KLR EDGK +CSSI+ L  LRSL++ SIEED ++DV +L S
Sbjct  690   SVTLAELGKLTQLRRLGITKLRKEDGKKLCSSIQNLSSLRSLSIISIEEDEIIDVQHLIS  749

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PPPLLQRLYL G +  +PHWI SL +LVK+Y +WS+L +DPL  LQ LPNLVHLE +  Y
Sbjct  750   PPPLLQRLYLRGRLETLPHWIPSLHSLVKVYLKWSRLAEDPLASLQSLPNLVHLELVQVY  809

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE + F AG F+ L+ L LDK +EL+ V +  GAMP ++KL IQRC  +  VP GIE L
Sbjct  810   DGETLCFKAGGFKMLKHLGLDKFDELKWVQVQVGAMPRVQKLSIQRCKSMEKVPLGIEYL  869

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
               L  LEFFDM  +FI T   D+ GEDY +V+HI EVY TYW+DG WEV S++  S G
Sbjct  870   TKLNVLEFFDMPHEFIRTLRLDEHGEDYWRVAHIPEVYSTYWRDGAWEVYSLESFSEG  927



>ref|XP_008342592.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
Length=948

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/779 (50%), Positives = 537/779 (69%), Gaps = 5/779 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--  177
             +D R DALLLE+ +IVGI+ P K+++  L+      +V+SV GMGG GKTTL K VYD  
Sbjct  152   DDHRGDALLLEKTDIVGIDEPIKQMVGWLVNGGSGREVVSVAGMGGLGKTTLAKQVYDAA  211

Query  178   DVKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             +VKKHF+  AWITV+Q+FK+ ++L+DMIQQL   +++P P+G  +MN N+LK I+K+FL 
Sbjct  212   EVKKHFKVSAWITVTQSFKLGDLLEDMIQQLHKAIRRPAPQGTNNMNNNQLKTIIKDFLQ  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+IV DDVW   VW+++K+ LP    G R +++TR  DVAS++S ++ G ++ + PL
Sbjct  272   KRRYLIVLDDVWHLYVWDSLKYALPNNTCGGRVILTTRKADVASTTSKESGGRVFNLKPL  331

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
                 SW LLC+K F  +SCP +L +I   IL++C GLPLAIVA+ GVLATK+K  I++W 
Sbjct  332   PLLESWELLCKKTFQGNSCPPYLEDIGNSILRKCEGLPLAIVAVSGVLATKDKRRIDQWD  391

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + HSLG + EGND+ + L+ +L LSFNDLP +LK CF+YLSI+PEDHLIEH  L+  W 
Sbjct  392   MVGHSLGAEMEGNDKLKDLKKVLSLSFNDLPYHLKSCFLYLSIFPEDHLIEHMRLVRLWM  451

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF++ K GKT+E+VAE YL EL+NRS+I   +   DG +K  R+HDL REII SK  D
Sbjct  452   AEGFIEAKQGKTLEDVAEDYLNELLNRSMIQAAETTSDGRVKSFRVHDLLREIITSKIRD  511

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF T   E+   WP+K R LS+H +L   Q  R  ++LRSL  F VT+      +    
Sbjct  512   QNFATIAKEQNIPWPDKVRRLSMHNSLQYVQKNRCASQLRSLFMFGVTEKPVLHTIFP--  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                +++ VLDLQ   L   P E+  L  L+YLSL+ T+VK +PR I KL+ LE LDLK++
Sbjct  570   GGFKLLNVLDLQGAPLNAFPVEVVNLFFLKYLSLKGTRVKTIPRFIGKLQNLETLDLKHS  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              VTELPVEILKLQHLRHL+VY +    Y  ++   GFK    +G L  L+KL +++AN  
Sbjct  630   LVTELPVEILKLQHLRHLLVYRYEFVPYGDFHSKYGFKVLAKIGALTCLQKLCFIKANQD  689

Query  1618  NGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
              G I  E+GKL +L+RL I+ +R +DGK++CSS+EKL KL +L++ S+EED ++D+ ++S
Sbjct  690   GGAILRELGKLIQLRRLGIVHMRKQDGKSLCSSLEKLTKLCALSITSVEEDEIIDLQHIS  749

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPP LLQRLYL G +  +PHWI SL +LV++Y +WS+L+D+PL  +Q LPNLVHLE    
Sbjct  750   SPPLLLQRLYLRGRLETLPHWIPSLHSLVRLYLKWSRLRDNPLVFIQYLPNLVHLELSQV  809

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             + G+ + F AG F+ L+ L +D+ +ELR + +  GAMP L+KL IQRC  L  VP+GIE 
Sbjct  810   FEGDTLCFGAGGFKKLKHLGIDEFDELRCIEVQVGAMPSLQKLSIQRCISLEKVPSGIEH  869

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
             L  L+ LEFFDM +  I T  P ++G DY KV+HI EVY+TY ++  WEV  ++  + G
Sbjct  870   LKKLKVLEFFDMPEKLIKTLSPHEQGNDYGKVAHIPEVYFTYLRESGWEVYPLEGLNEG  928



>gb|KDP33396.1| hypothetical protein JCGZ_12852 [Jatropha curcas]
Length=950

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/782 (51%), Positives = 539/782 (69%), Gaps = 3/782 (0%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             R DALLLEE E+VG++  + +LI  L+KD P LKV+SVVGMGG GKTT++K VYDD  VK
Sbjct  169   RGDALLLEESELVGVDKHKSQLIGWLVKDGPRLKVVSVVGMGGLGKTTIIKRVYDDGEVK  228

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             KHF S AWI VSQ+FK++E+LKDMI QLF  + +  P+GM +MN+++LK+ +KEFL + +
Sbjct  229   KHFDSRAWINVSQSFKIDEMLKDMIYQLFDGVNKQAPQGMETMNSHRLKITIKEFLQQSR  288

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y++V DD+W    W+AIKH  P    G R +++TR  +VAS++  ++ G IY + PLS++
Sbjct  289   YLLVLDDIWGRDAWDAIKHAFPNNNQGSRVLLTTRNAEVASATCIESKGNIYVLEPLSDK  348

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L C+K F  +  P HL  + +QI++RC GLPLAIVA+ G+LATK+ + I+EW  L 
Sbjct  349   ESWTLFCKKTFRQNLSPPHLEVLSRQIVQRCSGLPLAIVAMSGILATKDWSRIDEWEKLA  408

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              +L  +  G D  +S+  ILLL +NDLP YLK CF+YLSI+PEDH IE   LI+ W  EG
Sbjct  409   SNLWAEIGGTDIQQSMAKILLLGYNDLPYYLKSCFLYLSIFPEDHSIECMRLIHLWIAEG  468

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FVK+ AGKT+EEVAE YL EL+ RSLI   +   DG +   RIH L REIIL KS D N 
Sbjct  469   FVKKVAGKTLEEVAEAYLNELLTRSLIQVAQTTSDGRIHSCRIHGLVREIILLKSRDQNL  528

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-  1263
             +T   E+   WPE+ R LS+H T+ +A++    TKLRSLL F V DS  ++ +  + S  
Sbjct  529   MTVTSEQNDMWPERIRCLSIHNTMKHAKVGNSLTKLRSLLIFGVEDSLSATSMPLLFSGD  588

Query  1264  CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
              +++ VLDL+ T LE+VP+ +F+++HLRYLSLR TKVK LP SI KLR LE LDLK T V
Sbjct  589   LKLLTVLDLRGTLLEVVPDGLFKMIHLRYLSLRDTKVKSLPSSIGKLRNLETLDLKRTGV  648

Query  1444  TELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNG  1623
              ELP EI KLQ LRHL+VY + +  Y+PY+   GFKAP  +G+L SL+KL +VE+N  NG
Sbjct  649   AELPPEISKLQQLRHLLVYRYETEPYMPYHYLNGFKAPLRIGELQSLQKLCFVESNDSNG  708

Query  1624  TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPP  1803
              + E+ +L +LKRL I KL+ EDG+A+CSSIE L  LRSLN+ S+EE+ ++D+ YLSSPP
Sbjct  709   ILGELARLQQLKRLGITKLKKEDGEALCSSIETLRNLRSLNVHSVEEEEIIDMQYLSSPP  768

Query  1804  PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTG  1983
               LQRLYL G + ++P WI SL +LVK+Y RWS L+D   E L DLPNLV L+    + G
Sbjct  769   KFLQRLYLHGRLEELPSWISSLHSLVKLYLRWSHLRDGLCESLGDLPNLVELQLRQAFKG  828

Query  1984  EHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFN  2163
             + + F AG FQ L++L LD+LEELR + + +GAMP L +L I R   L  VP+GI+ L +
Sbjct  829   QTLSFKAGTFQKLKILFLDELEELRWLEMEKGAMPILGELTISRSQFLEEVPSGIQHLKD  888

Query  2164  LRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGPETA  2343
             L+ ++FFDM D+     +  ++  D   +SH+ ++Y+  WK  CWE   +   S+  +TA
Sbjct  889   LKTIKFFDMPDELNKMIMAKRQDTDSWNLSHVPQIYFIKWKKSCWERTILSIGSASNKTA  948

Query  2344  VK  2349
              K
Sbjct  949   SK  950



>ref|XP_007210392.1| hypothetical protein PRUPE_ppa000961mg [Prunus persica]
 gb|EMJ11591.1| hypothetical protein PRUPE_ppa000961mg [Prunus persica]
Length=949

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/780 (51%), Positives = 543/780 (70%), Gaps = 9/780 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--D  180
             D R DALLLE+ +IVGI+ P K+L+  LL      +V+SV GMGG GKTTLVK VYD  +
Sbjct  154   DHRGDALLLEKTDIVGIDEPIKQLVGWLLTGGSGREVVSVAGMGGLGKTTLVKQVYDAAE  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF+ HAWITV+Q+FK+ E+LKDM+QQL   +++P+P+G  +MN N+LK ++K+FL +
Sbjct  214   VKKHFKVHAWITVTQSFKLGELLKDMLQQLHKAIRRPLPQGTNNMNNNQLKTLIKDFLQK  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV DDVW    W+++K+ LP    G R +++TR  D+AS++S ++ G +Y M PL 
Sbjct  274   RRYLIVLDDVWHLHGWDSVKYALPNNICGSRIILTTRNADIASTTSVESGGKVYNMEPLP  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             +  SW LLC+K F  SSCP +L EI   IL++C GLPLAIVA+ GVLATK+K  I+EW  
Sbjct  334   QLESWELLCKKTFQGSSCPPYLEEIGNCILRKCEGLPLAIVAVSGVLATKDKRRIDEWDM  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EGND+ + L+ +L LSFNDLP YLK CF+YLSI+PEDHLIEH  L+  W  
Sbjct  394   VGHSLGAEIEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHLIEHMRLVRLWMA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGF++ K GKT+E+VAE YL EL+NRS+I   +   DG +K  R+HDL+REII SK  D 
Sbjct  454   EGFIEAKEGKTLEDVAEDYLNELLNRSMIQAAETTSDGRVKNFRVHDLFREIITSKIRDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-  1257
             NF T   ++   WP+K R LS+H +L   Q  R  ++LRSL  F + +      ++Q L 
Sbjct  514   NFATIAKDQNMPWPDKIRRLSMHNSLPYVQKNRCASQLRSLFMFRLAEKP----LLQTLF  569

Query  1258  -SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
                 R++ VLDLQS  L + P E+  L  L+YLSL+ T+VK +P  I KL+ LE LDLK+
Sbjct  570   PGGFRLLNVLDLQSAPLSVFPIEVVNLFFLKYLSLKDTRVKTIPSFIGKLQNLETLDLKH  629

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             + VTELP EILKL+HLRHL+VY +    Y  ++   GFK    +G L SL+KL +++AN 
Sbjct  630   SLVTELPAEILKLKHLRHLLVYRYEFVPYGDFHSKYGFKVLAKIGALTSLQKLCFIKANQ  689

Query  1615  GNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
               G I +E+GKL +L+RL I+++R EDGK +CSSIEKL KL +L++ S+EED ++D+ +L
Sbjct  690   DGGAILKELGKLVQLRRLGIVQMRKEDGKVLCSSIEKLSKLCALSITSVEEDEIIDLQHL  749

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP LLQRLYL G +  +PHWI SL +LV++Y +WS+LKDDPL  LQ LPNLVHLE   
Sbjct  750   SSPPLLLQRLYLQGRLDALPHWIPSLHSLVRLYLKWSRLKDDPLLFLQYLPNLVHLELSQ  809

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              + G+ + F AG F+ L+ L +++ + LR + +  GAMP +EKL IQRC  L  VP+GIE
Sbjct  810   VFEGDTLCFGAGGFKKLKHLGINEFDALRCIQVEMGAMPCVEKLSIQRCKSLEKVPSGIE  869

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
              L  L+ LEFF+M +  I T  P + G DY KV+HI EVY+TYW++  WEV  ++  + G
Sbjct  870   HLNKLKVLEFFEMPEKLIKTLRPQEEGNDYWKVAHIPEVYFTYWRECGWEVYPLEGLNEG  929



>ref|XP_008238134.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Prunus 
mume]
Length=951

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/789 (51%), Positives = 537/789 (68%), Gaps = 8/789 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +DRR DALLL+  ++VGI+ P+++L+S L++     +V+SV GMGG GKTTLVK VYDDV
Sbjct  153   HDRRGDALLLDNTDVVGIDKPKQKLVSWLVRGGSGREVVSVTGMGGMGKTTLVKKVYDDV  212

Query  184   K--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             K  KHF+  AWITVSQ+F+ E++LKD+I +LF  +++PVPEG+   N+N+LK I+K FL 
Sbjct  213   KVKKHFKPRAWITVSQSFQAEDLLKDIIHKLFYAIRRPVPEGVDDKNSNELKAIIKNFLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +RKY+IV DDVW    WE +K+VLP    G R M++TR  DVA +S +++ G +Y + PL
Sbjct  273   KRKYLIVLDDVWHTNEWETVKYVLPTGNFGSRVMVTTRKADVAFTSCSESKGKVYHLKPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L  RKAF    CP +L E  K ILK+C GLPLAIVAI GVLATK+   I+EW 
Sbjct  333   PADESWNLFTRKAFQGKPCPPYLYEKCKCILKKCEGLPLAIVAISGVLATKDTRRIDEWD  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + HSLG +  GND+ E L+ +L LSFNDLP YLK CF+YLSI+PE HLI+H  LI  W 
Sbjct  393   FICHSLGAEIHGNDKLEDLKKVLSLSFNDLPYYLKACFLYLSIFPEGHLIQHMRLIRLWI  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+   G+T+EEVAE YL EL+NR+LIL      DG +K  RIHDL REII+SKS D
Sbjct  453   AEGFVEAIQGRTLEEVAEDYLKELLNRNLILVGYTTSDGRIKTYRIHDLLREIIISKSRD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF   + ++ A WP++ R LS+H +L   Q KR   +LRSL  F V      S      
Sbjct  513   QNFAAIVKDQNAIWPDRVRRLSIHNSLQTVQAKRSVPQLRSLFLFGVVAR--PSIQKYFP  570

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  R++KVLDL++  L++ P EI  L +L YLSLR T+VKV+PR I  L+ L  LDLK T
Sbjct  571   SGLRLLKVLDLEAAPLKMFPREILDLFYLSYLSLRKTQVKVIPRGIGNLQNLLTLDLKKT  630

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP-  1614
              VTELP+EILKL+ LRHL+VY     +Y  +    GFKA   LG L SL+KL ++EAN  
Sbjct  631   NVTELPLEILKLEKLRHLLVYRLKIESYAHFYSKFGFKALSSLGDLQSLQKLCFIEANDH  690

Query  1615  GNG-TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             G G T+ EIGKL  L+RL I+KLR +DG A+C S+E L KLR+ ++KS  E+ +LD+ +L
Sbjct  691   GCGMTMREIGKLKNLRRLGIMKLRKQDGLALCLSLEHLTKLRAFSVKSTRENEILDLQHL  750

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  L+RLYL+G + ++P+WI SL +LVK++ +WS LKDDPL  LQDLPNLVHLE L 
Sbjct  751   SSPPQFLERLYLTGRLEELPNWIPSLHSLVKLFLKWSWLKDDPLVRLQDLPNLVHLELLH  810

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
                 + + F +G F+ L++L LDK + LR V + EGAMP LEKL IQRC  +  VP+G++
Sbjct  811   ACDSDMLSFKSGGFKKLKVLGLDKFDNLRCVKVEEGAMPCLEKLTIQRCKSMKRVPSGVK  870

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
              L  L+ LEFF+M  + I    P+  GEDY +V H+ +V+   W+DG W+V S+ E+   
Sbjct  871   HLSRLKLLEFFEMPSELILKLQPNG-GEDYGEVKHVPDVHSACWRDGGWDVYSI-ESFKE  928

Query  2332  PETAVKISG  2358
              E A   +G
Sbjct  929   IENATSQAG  937



>ref|XP_008238135.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Prunus 
mume]
Length=949

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/789 (51%), Positives = 537/789 (68%), Gaps = 8/789 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +DRR DALLL+  ++VGI+ P+++L+S L++     +V+SV GMGG GKTTLVK VYDDV
Sbjct  151   HDRRGDALLLDNTDVVGIDKPKQKLVSWLVRGGSGREVVSVTGMGGMGKTTLVKKVYDDV  210

Query  184   K--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             K  KHF+  AWITVSQ+F+ E++LKD+I +LF  +++PVPEG+   N+N+LK I+K FL 
Sbjct  211   KVKKHFKPRAWITVSQSFQAEDLLKDIIHKLFYAIRRPVPEGVDDKNSNELKAIIKNFLQ  270

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +RKY+IV DDVW    WE +K+VLP    G R M++TR  DVA +S +++ G +Y + PL
Sbjct  271   KRKYLIVLDDVWHTNEWETVKYVLPTGNFGSRVMVTTRKADVAFTSCSESKGKVYHLKPL  330

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L  RKAF    CP +L E  K ILK+C GLPLAIVAI GVLATK+   I+EW 
Sbjct  331   PADESWNLFTRKAFQGKPCPPYLYEKCKCILKKCEGLPLAIVAISGVLATKDTRRIDEWD  390

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + HSLG +  GND+ E L+ +L LSFNDLP YLK CF+YLSI+PE HLI+H  LI  W 
Sbjct  391   FICHSLGAEIHGNDKLEDLKKVLSLSFNDLPYYLKACFLYLSIFPEGHLIQHMRLIRLWI  450

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+   G+T+EEVAE YL EL+NR+LIL      DG +K  RIHDL REII+SKS D
Sbjct  451   AEGFVEAIQGRTLEEVAEDYLKELLNRNLILVGYTTSDGRIKTYRIHDLLREIIISKSRD  510

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF   + ++ A WP++ R LS+H +L   Q KR   +LRSL  F V      S      
Sbjct  511   QNFAAIVKDQNAIWPDRVRRLSIHNSLQTVQAKRSVPQLRSLFLFGVVAR--PSIQKYFP  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  R++KVLDL++  L++ P EI  L +L YLSLR T+VKV+PR I  L+ L  LDLK T
Sbjct  569   SGLRLLKVLDLEAAPLKMFPREILDLFYLSYLSLRKTQVKVIPRGIGNLQNLLTLDLKKT  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP-  1614
              VTELP+EILKL+ LRHL+VY     +Y  +    GFKA   LG L SL+KL ++EAN  
Sbjct  629   NVTELPLEILKLEKLRHLLVYRLKIESYAHFYSKFGFKALSSLGDLQSLQKLCFIEANDH  688

Query  1615  GNG-TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             G G T+ EIGKL  L+RL I+KLR +DG A+C S+E L KLR+ ++KS  E+ +LD+ +L
Sbjct  689   GCGMTMREIGKLKNLRRLGIMKLRKQDGLALCLSLEHLTKLRAFSVKSTRENEILDLQHL  748

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  L+RLYL+G + ++P+WI SL +LVK++ +WS LKDDPL  LQDLPNLVHLE L 
Sbjct  749   SSPPQFLERLYLTGRLEELPNWIPSLHSLVKLFLKWSWLKDDPLVRLQDLPNLVHLELLH  808

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
                 + + F +G F+ L++L LDK + LR V + EGAMP LEKL IQRC  +  VP+G++
Sbjct  809   ACDSDMLSFKSGGFKKLKVLGLDKFDNLRCVKVEEGAMPCLEKLTIQRCKSMKRVPSGVK  868

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
              L  L+ LEFF+M  + I    P+  GEDY +V H+ +V+   W+DG W+V S+ E+   
Sbjct  869   HLSRLKLLEFFEMPSELILKLQPNG-GEDYGEVKHVPDVHSACWRDGGWDVYSI-ESFKE  926

Query  2332  PETAVKISG  2358
              E A   +G
Sbjct  927   IENATSQAG  935



>ref|XP_009346318.1| PREDICTED: disease resistance protein RPM1-like [Pyrus x bretschneideri]
Length=949

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/785 (50%), Positives = 540/785 (69%), Gaps = 8/785 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--D  180
             D RSDALLLE+ +IVGI+ P K+++  L+      +V+SV GMGG GKTTL K VYD  +
Sbjct  154   DHRSDALLLEKTDIVGIDEPIKQMVGWLVNGGSGREVVSVAGMGGLGKTTLAKQVYDAAE  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF+  AWITV+Q+FK+ E+L+DMIQQL   +++P P+G  +MN N+LK I+K+FL +
Sbjct  214   VKKHFKVSAWITVTQSFKLGELLEDMIQQLHKAIRRPAPQGTNNMNNNQLKTIIKDFLQK  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV DDVW   VW ++K+ LP    G R +++TR  DVAS++S ++ G ++ + PL 
Sbjct  274   RRYLIVLDDVWHLYVWHSLKYALPNNTCGSRVILTTRKADVASTTSKESGGRVFNLKPLP  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
                SW LLC+K F  +SCP +L +I   IL++C GLPLAIVA+ G+LATK+K  I++W  
Sbjct  334   LLESWELLCKKTFQGNSCPPYLEDIGNSILRKCEGLPLAIVAVSGILATKDKRRIDQWDM  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EGND+ + L+ +LLLSFNDLP +LK CF+YLSI+PEDHLIEH  L+  W  
Sbjct  394   VGHSLGAEMEGNDKLKDLKKVLLLSFNDLPYHLKSCFLYLSIFPEDHLIEHMRLVRLWMA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGF++ K GKT+E+VAE YL EL+NRS+I   +   DG +K  R+HDL REII SK  D 
Sbjct  454   EGFIEAKQGKTLEDVAEDYLNELLNRSMIQAAETTSDGRIKSFRVHDLLREIITSKIRDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF T   E+   WP+K R LS+H +L   Q  R  ++LRSL  F VT+      +     
Sbjct  514   NFATIAKEQNIPWPDKVRRLSMHNSLQYVQKNRCASQLRSLFMFGVTEKPVLHTIFP--G  571

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               R++ VLDLQ   L   P ++  L  L+YLSL+ T+VK +PR I KL+ LE LDLK++ 
Sbjct  572   GFRLLNVLDLQGAPLNAFPVQVVNLFFLKYLSLKGTRVKTIPRFIGKLQNLETLDLKHSL  631

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VTELP+EILKLQHLRHL+VY +    Y  ++   GFK    +G L  L+KL +++AN   
Sbjct  632   VTELPIEILKLQHLRHLLVYRYEFVPYGDFHSKYGFKVLAKIGALTCLQKLCFIKANQDG  691

Query  1621  GTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
             G I  E+GKL +L+RL I+ +R +DGK++CSS+EKL KL +L++ S+EED ++D+ ++SS
Sbjct  692   GAILRELGKLIQLRRLGIVHMRKQDGKSLCSSLEKLTKLCALSITSVEEDEIIDLQHISS  751

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP LLQRLYL G +  +PHWI SL +LV++Y +WS+L+D+PL  +Q LPNLVHLE    +
Sbjct  752   PPLLLQRLYLRGRLETLPHWIPSLHSLVRLYLKWSRLRDNPLVFIQYLPNLVHLELSQVF  811

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              G+ + F AG F+ L+ L +D+ +ELR + +  GAMP L+KL IQRC  L  VP+GIE L
Sbjct  812   EGDTLCFGAGGFKKLKHLGIDEFDELRCIEVQVGAMPSLQKLSIQRCKSLEKVPSGIEHL  871

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG--  2331
               L+ LEFFDM +  I T  P ++G DY KV+HI EVY+TY ++  WEV  ++  + G  
Sbjct  872   KKLKVLEFFDMPEKLIKTLSPHEQGNDYGKVAHIPEVYFTYLRESGWEVYPLEGLNEGEN  931

Query  2332  -PETA  2343
              P+T 
Sbjct  932   FPQTT  936



>ref|XP_007040756.1| Nbs-lrr resistance protein [Theobroma cacao]
 gb|EOY25257.1| Nbs-lrr resistance protein [Theobroma cacao]
Length=947

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/778 (53%), Positives = 538/778 (69%), Gaps = 4/778 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              DRR DALLL++ ++VGI+ P+ +L+  L+      KVIS+ GMGG GKTTL K VYDD 
Sbjct  152   QDRRGDALLLDKADVVGIDEPKMKLVGWLVDGGSDYKVISLSGMGGLGKTTLAKQVYDDP  211

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF+ HAWITVSQ+FK+E +LKDM+QQL   + +PVPEG+ SM++ +LK I+K  L 
Sbjct  212   EVKKHFKVHAWITVSQSFKLEGLLKDMVQQLSRVITKPVPEGVDSMSSYQLKTIIKNLLR  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+I+ DD+W    W+AIK  LP    G R M++TR  D+A SS  ++ G +Y + PL
Sbjct  272   KRRYLIILDDIWRINEWDAIKFALPANDCGSRVMLTTRNADLAFSSRIESEGEVYNLEPL  331

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               EVSW L C+K F  + CP +L EI KQILK+C GLPLAIVAI GVLATK+K  I+EW 
Sbjct  332   PPEVSWTLFCKKTFRGNYCPPYLEEICKQILKKCEGLPLAIVAISGVLATKSKRRIDEWE  391

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + +GND+  +L+ +L LSFNDLP YLK CF+YLSI+PED  IE   LI  WT
Sbjct  392   MVGRSLGAEIDGNDKLMNLKKVLSLSFNDLPYYLKSCFLYLSIFPEDRPIELMRLIRLWT  451

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+ K GKT EEVAE +  EL+NRSLI       DG +K  RIHDL REII+ KS +
Sbjct  452   AEGFVEVKQGKTQEEVAEDFFNELLNRSLIQVAGTTSDGRVKSCRIHDLLREIIILKSRE  511

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF     E+ A WP+K R LS+H TL N    R  ++LRSL  F V ++  S H + I 
Sbjct  512   QNFAAITKEQNAMWPDKVRRLSIHNTLQNVLQNRFVSQLRSLFMFGVEENP-SLHGL-IP  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                R++ VLDLQ+TS+   P E+  L +L+YL+LR TKV V+PR I KL+ LE LDLK+ 
Sbjct  570   GGFRLLAVLDLQATSIMKFPVEVVNLYYLKYLNLRETKVTVVPRFIGKLQNLETLDLKHA  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
             +VTELPVEIL+LQ LRHL+VY +   +Y  ++   GFKA + +G L SL+KL Y+E + G
Sbjct  630   YVTELPVEILQLQRLRHLLVYRYEFESYDHFHSKYGFKALERIGDLQSLQKLCYIEVDQG  689

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
             +  + E+GKL +L+RL I KLR EDGK +CSSI+ L  LR+L++ SIEED ++DV +L S
Sbjct  690   SVILAELGKLTQLRRLGITKLRKEDGKKLCSSIQNLSSLRALSIISIEEDEIIDVQHLIS  749

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PPPLLQRLYL G +  +PHWI  L +LVK+Y +WS+L +DPL  LQ+LPNLVHLE +  Y
Sbjct  750   PPPLLQRLYLRGRLETLPHWIPYLHSLVKVYLKWSRLAEDPLASLQNLPNLVHLELVQVY  809

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE + F AG F+ L+ L LDK +EL+ V +  GAMP ++KL IQRC  +  VP GIE L
Sbjct  810   DGETLCFKAGGFKMLKHLGLDKFDELKWVQVQVGAMPCVQKLSIQRCKSMEKVPLGIEYL  869

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
               L  LEFFDM  + I T   D+ GEDY +V+HI EVY TYW+DG WEV S++  S G
Sbjct  870   TKLNVLEFFDMPHELIRTLRLDEHGEDYWRVAHIPEVYSTYWRDGAWEVYSLESFSEG  927



>ref|XP_004301665.1| PREDICTED: disease resistance protein RPM1-like [Fragaria vesca 
subsp. vesca]
Length=920

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/794 (50%), Positives = 535/794 (67%), Gaps = 31/794 (4%)
 Frame = +1

Query  1     ANDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD-  177
             + D R DALLLE+ +IVGI+ P K+++  LL  D   +V+SV GMGG GKTTL K VYD 
Sbjct  146   SKDHRGDALLLEKTDIVGIDKPIKQMVGRLLNGDCAREVVSVAGMGGMGKTTLAKQVYDA  205

Query  178   -DVKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
              +VKKHF+  AWITV+Q+FK+ E+LKD++QQL   ++ PVP+ + SM+ N+LK I+K+FL
Sbjct  206   AEVKKHFKLRAWITVTQSFKLGELLKDIVQQLHQAIRSPVPQEINSMSTNQLKTIIKDFL  265

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
              +R+Y+IV DDVW    W A+K+ LP   +G R +++TR  D+AS++S ++ G +Y + P
Sbjct  266   QKRRYLIVLDDVWHLYGWNAMKYALPNNMYGSRVILTTRNADIASTTSMESGGEVYTLEP  325

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             L    SW LLC+K F  +SCP HL +I   +LK+C GLPLAIVAI GVLA K+K  I+EW
Sbjct  326   LPPMESWELLCKKTFQGNSCPPHLEKICNYVLKKCEGLPLAIVAISGVLAAKDKRRIDEW  385

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               + HSLG + EGND+ + L+ +L LSFNDLP YLK CF+YLSI+PEDHLI+H  LI  W
Sbjct  386   DMVGHSLGYEIEGNDKLQDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHLIKHMRLIRLW  445

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGF+++K GKT+EEVAE YL EL+NRS+I   +   DG + + RIHDL+REII SK+ 
Sbjct  446   MAEGFIEEKQGKTLEEVAEDYLNELLNRSMIQAAETTADGRVTKLRIHDLFREIITSKTR  505

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             D NF T   E     PEK R LS+H TL   Q  R            +  + F+      
Sbjct  506   DQNFATVAKEHNVTLPEKIRRLSIHNTLQYVQTNR------------LFPAGFA------  547

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
                  ++ VLDLQST L + P E+  L  L+YLSLR T+VK +PR I KL+ LE LD+K+
Sbjct  548   -----LLNVLDLQSTPLNVFPVEVVNLYFLKYLSLRDTRVKAIPRFIGKLQNLETLDMKH  602

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             + VTELPVEILKLQ LR+L+VY +    Y  ++ + GFK  + +G L SL+KL ++E N 
Sbjct  603   SRVTELPVEILKLQRLRYLLVYRYEFVPYEDFHSTYGFKVLEKIGALKSLQKLCFIEVNQ  662

Query  1615  GNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             G   +  E+GKL +L+RL I+K+R EDGKA+ SSIEKL KL +L++ S+EED ++D+ +L
Sbjct  663   GGSALMRELGKLIQLRRLGIVKMRKEDGKALSSSIEKLSKLSALSITSVEEDEIIDLEHL  722

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
              SPP LLQRLYL G +  +PHWI SL +LVK+Y +WS+LKDDPL  LQ LPNLVHLE   
Sbjct  723   YSPPMLLQRLYLRGRLEALPHWIPSLHSLVKLYLKWSRLKDDPLVSLQHLPNLVHLELCQ  782

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              + G+ + F  G F+ L+ L LDK +ELR + +  G MP LE L I+RC  L  VP+GIE
Sbjct  783   VFEGDTLCFGDGGFKKLKHLCLDKSDELRCIEVEVGTMPCLENLSIRRCKSLEKVPSGIE  842

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ-----  2316
              L  L+ L+FFDM +  I T LP ++G DY KV H+ EVY TY ++  WEV S++     
Sbjct  843   HLVKLKVLKFFDMPEKLIKTLLPHEKGNDYWKVCHVPEVYVTYLREFGWEVFSLEGLSEA  902

Query  2317  ETSSGPETAVKISG  2358
             + SS P + +K  G
Sbjct  903   QHSSQPSSVMKSLG  916



>ref|XP_009345346.1| PREDICTED: disease resistance protein RPM1-like [Pyrus x bretschneideri]
Length=949

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/785 (50%), Positives = 539/785 (69%), Gaps = 8/785 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--D  180
             D RSDALLLE+ +IVG+E P K+++  L+      +V+SV GMGG GKTTL K VYD  +
Sbjct  154   DHRSDALLLEKTDIVGMEEPIKQMVGWLVNGGSGREVVSVAGMGGLGKTTLAKQVYDAAE  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF+  AWITV+Q+FK+ E+L+DMIQQL   +++P P+G  +MN N+LK I+K+FL +
Sbjct  214   VKKHFKVSAWITVTQSFKLGELLEDMIQQLHKAIRRPAPQGTNNMNNNQLKTIIKDFLQK  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV DDVW   VWE++K+ LP    G R +++TR  DVAS++S ++ G ++ + PL 
Sbjct  274   RRYLIVLDDVWHLYVWESLKYALPNNTCGSRVILTTRKADVASTTSKESGGRVFNLKPLP  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
                SW LLC+K F   SCP +L +I   IL++C GLPLAIVA+ G+LATK+K  I++W  
Sbjct  334   LLESWELLCKKTFQGHSCPPYLEDIGNSILRKCEGLPLAIVAVSGILATKDKRRIDQWDM  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EGND+ + L+ +LLLSFNDLP +LK CF+YLSI+PEDHLIEH  L+  W  
Sbjct  394   VGHSLGAEMEGNDKLKDLKKVLLLSFNDLPYHLKSCFLYLSIFPEDHLIEHMRLVRLWMA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGF++ K GKT+E+VAE YL EL+NRS+I   +    G +K  R+HDL REII SK  D 
Sbjct  454   EGFIEAKQGKTLEDVAEDYLNELLNRSMIQAAETTSYGRIKSFRVHDLLREIITSKIRDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF T   E+   WP+K R LS+H +L   Q  R  ++LRSL  F VT+      +     
Sbjct  514   NFATIAKEQNIPWPDKVRRLSMHNSLQYVQKNRCASQLRSLFMFGVTEKPVLHTIFP--G  571

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               R++ VLDLQ   L   P ++  L  L+YLSL+ T+VK +PR I KL+ LE LDLK++ 
Sbjct  572   GFRLLNVLDLQGAPLNAFPVQVVNLFFLKYLSLKGTRVKTIPRFIGKLQNLETLDLKHSL  631

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VTELP+EILKLQHLRHL+VY +    Y  ++   GFK    +G L  L+KL +++AN   
Sbjct  632   VTELPIEILKLQHLRHLLVYRYEFVPYGDFHSKYGFKVLAKIGALTCLQKLCFIKANQDG  691

Query  1621  GTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
             G I  E+GKL +L+RL I+ +R +DGK++CSS+EKL KL +L++ S+EED ++D+ ++SS
Sbjct  692   GAILRELGKLIQLRRLGIVHMRKQDGKSLCSSLEKLTKLCALSITSVEEDEIIDLQHISS  751

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP LLQRLYL G +  +PHWI SL +LV++Y +WS+L+D+PL  +Q LPNLVHLE    +
Sbjct  752   PPLLLQRLYLRGRLETLPHWIPSLHSLVRLYLKWSRLRDNPLVFIQYLPNLVHLELSQVF  811

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              G+ + F AG F+ L+ L +D+ EELR + +  GAMP L+KL IQRC  L  VP+GIE L
Sbjct  812   EGDTLCFGAGGFKKLKHLGIDEFEELRCIEVQVGAMPSLQKLSIQRCKSLEKVPSGIEHL  871

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG--  2331
               L+ LEFFDM +  I T  P ++G DY KV+HI EVY+TY ++  WEV  ++  + G  
Sbjct  872   KKLKVLEFFDMPEKLIKTLSPHEQGNDYGKVAHIPEVYFTYLRESGWEVYPLEGLNEGEN  931

Query  2332  -PETA  2343
              P+T 
Sbjct  932   FPQTT  936



>ref|XP_010056217.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Eucalyptus 
grandis]
Length=948

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/790 (50%), Positives = 538/790 (68%), Gaps = 15/790 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R +ALLL++  +VGIE P+ ELI  LL      +VISV+GMGG GKTTLVK V++D  
Sbjct  154   DNRGNALLLDKTGLVGIEQPKNELIGQLLDGVHRREVISVLGMGGLGKTTLVKQVFEDPS  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF  +AWIT+S+  ++EE+LKDM+ Q+   +++PVP G  +MN++ LK+I+ + L R
Sbjct  214   VKKHFAVYAWITLSRPSEIEELLKDMLDQIVRVMRKPVPPGANAMNSDWLKMIINDQLQR  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV DD W    W+A+ H LP   HG R +I+TR  D+AS+S  + NG +  M PL+
Sbjct  274   RRYLIVLDDAWYRDKWDAVMHALPNNDHGSRVIITTRNADLASTSCKEFNGLVKNMEPLN  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C++ F  +SCPSHL EI + IL +C GLP AI+AI GVLA K+K  I+EW A
Sbjct  334   PEQSWKLFCQRTFQKNSCPSHLEEICEYILGKCDGLPFAIMAISGVLAAKDKQRIDEWDA  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             L  +L  + +GN++  +L+ +L LSF+DLP YLK CF++LS++PE HLIE   L   W  
Sbjct  394   LRCNLRAEIDGNNRLMNLKRVLSLSFSDLPYYLKSCFLHLSVFPEGHLIERRRLTRLWVA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV+++ GKT++EVA+ Y  EL+NRSL+   +   D  ++  RIHD  REII SKS+D 
Sbjct  454   EGFVERREGKTLDEVAKEYFSELLNRSLVQVAETTTDRRVRLCRIHDFQREIITSKSSDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             +F T   E+T  WP K R LS+H +L  AQ  R  ++LRSL  F V D  F   V+    
Sbjct  514   SFATITKEQTDMWPNKVRRLSLHNSLQAAQQNRSLSRLRSLYMFGV-DRGFIDFVLG--C  570

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               +++ VLD+Q+T L   P ++    +LRYL+LR T+VK +P SI +L+ LE LDLKYT 
Sbjct  571   DIKLLNVLDMQATPLSRFPVQVVDCYYLRYLNLRHTEVKTIPTSIGRLQNLETLDLKYTN  630

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VT LPVEI KLQ L+HL+VY + + +YL Y    GFKA   +G L SL+KL Y+EAN   
Sbjct  631   VTRLPVEIFKLQKLQHLLVYRYANISYLCYKY--GFKALTEIGALQSLQKLCYIEANDER  688

Query  1621  GTI--EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
               I   E+GKL +L RL ILKLR EDG+A+CSSIEKL  L +L++ S+E+D +LD+ +L+
Sbjct  689   NDILMRELGKLTQLSRLGILKLRKEDGRALCSSIEKLTNLCALSVASVEDDEILDLQHLT  748

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPPPLLQR+YL G +  +P+W+ +L +LVK++ RWS+LKDDPL  LQ LPNL+HLE L  
Sbjct  749   SPPPLLQRIYLKGRLKTLPNWLVTLDSLVKLHLRWSRLKDDPLALLQSLPNLIHLELLQV  808

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             + G+ + F +  F+ LR+L LD  + LR+V + EGAMP LEKL+IQRC  L  +P+GIE 
Sbjct  809   FEGKTLCFKSKGFRKLRILGLDNFDGLRSVEVEEGAMPCLEKLIIQRCKLLEKLPSGIEY  868

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVN------SVQ  2316
             L  LR LEFFDM D  +  F+  +  EDY K++HI EVYY YW+DG W+V       SV 
Sbjct  869   LTKLRVLEFFDMPDQLVKKFMRHEHDEDYQKIAHIPEVYYGYWRDGGWDVQFIDRFLSVG  928

Query  2317  ETSSGPETAV  2346
             ETSSG  T++
Sbjct  929   ETSSGQGTSM  938



>ref|XP_007211256.1| hypothetical protein PRUPE_ppa019283mg [Prunus persica]
 gb|EMJ12455.1| hypothetical protein PRUPE_ppa019283mg [Prunus persica]
Length=928

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/765 (51%), Positives = 517/765 (68%), Gaps = 5/765 (1%)
 Frame = +1

Query  16    SDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--DVKK  189
              DALLLE  +IVGI+ P K+++  L+K     +V+SV GMGG GKTTL K VYD   VKK
Sbjct  157   GDALLLERSDIVGIDEPIKQMVGWLVKGSSGREVVSVAGMGGMGKTTLAKQVYDAAQVKK  216

Query  190   HFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKY  369
             HF+  AWITV+Q+FK+ E+LK MI+QL   ++ PVP+G+ +M+ N+LK ++KE L RR+Y
Sbjct  217   HFKVRAWITVTQSFKLGEILKHMIEQLHQAIRIPVPQGINNMSTNQLKTVIKEVLQRRRY  276

Query  370   VIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEV  549
             ++V DDVW    W+A+K+ LP    G R +++TR  DVAS++  ++ G +Y + PL    
Sbjct  277   LVVLDDVWHLCGWDALKYALPNNTCGSRVILTTRNADVASTTCVESRGKVYNLEPLPLTD  336

Query  550   SWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYH  729
             +W LLC+K F  +SCP HL E+   IL++C GLPLAIVAI GVLATK+K  I+EW  +  
Sbjct  337   AWELLCKKTFQGNSCPPHLEEVCNYILRKCEGLPLAIVAISGVLATKDKRRIDEWDMVGR  396

Query  730   SLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGF  909
              LG   EGND+ + L+ +L LSFNDLP YLK CF+YLSI+PEDH I+H  LI  W  EGF
Sbjct  397   CLGGQIEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHQIKHMRLIRLWIAEGF  456

Query  910   VKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFV  1089
             ++ K  KT+E+VAE YL EL+NRS+I   +   DG +++ RIHDL REII SK+ D NF 
Sbjct  457   IETKESKTLEDVAEDYLNELLNRSMIQAAETTPDGRVQKFRIHDLLREIITSKTRDQNFA  516

Query  1090  TTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSCR  1269
             T   E    WP+K R LS+H TL N Q  R  ++LRSL  F V +           +   
Sbjct  517   TIAKEYNMPWPDKVRRLSIHNTLQNVQQYRSASQLRSLFMFRVAEKPSLQRFFP--TGFT  574

Query  1270  VIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTE  1449
             ++ VLDLQST L + P E+  L  L+YLSLR T+VK +P  I KL+ LE LDLK + VTE
Sbjct  575   LLNVLDLQSTPLNVFPAEVVNLFFLKYLSLRDTRVKTVPTWIGKLQNLETLDLKNSRVTE  634

Query  1450  LPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTI  1629
             LPVEILKLQHLRHL+VY +    +  ++   GFK    +G L SL+KL ++E N   G I
Sbjct  635   LPVEILKLQHLRHLLVYRYEFVPHENFHSKYGFKVLGKIGALTSLQKLCFIEVNQDGGAI  694

Query  1630  E-EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPP  1806
               E+GKL +L+RL I+K+R E GKA CSSIEKL K+ SL++ S+EED ++D+ YLSSPP 
Sbjct  695   LIELGKLVQLRRLGIVKMRKEYGKAFCSSIEKLTKICSLSITSVEEDEIIDLEYLSSPPL  754

Query  1807  LLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGE  1986
             LLQRLYL G + K+PHWI SL +LVK+Y +WS+LKDDPL  LQ LPNLVHLE    + G+
Sbjct  755   LLQRLYLRGRLEKLPHWIPSLHSLVKLYLKWSRLKDDPLVFLQYLPNLVHLELSEVFEGD  814

Query  1987  HMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNL  2166
              + F AG F+ L+ L LD  +ELR + +  G MP +E+L I+RC  L  VP+GIE L  L
Sbjct  815   TLCFGAGGFKKLKHLGLDTSDELRCIRVEAGTMPCIEQLSIKRCKSLEKVPSGIEHLITL  874

Query  2167  RYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWE  2301
             + L+F DM +  I T LP + G DY KV HI EVY TYW++  W+
Sbjct  875   KVLKFSDMPEKLIRTLLPHEPGNDYWKVEHIPEVYITYWREWEWK  919



>ref|XP_008238138.1| PREDICTED: disease resistance protein RPM1-like [Prunus mume]
Length=937

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/778 (50%), Positives = 524/778 (67%), Gaps = 5/778 (1%)
 Frame = +1

Query  16    SDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--DVKK  189
              DALLLE  +IVGI+ P K+++  L+K     +V+SV GMGG GKTTL K VYD   VKK
Sbjct  157   GDALLLERSDIVGIDEPIKQMVGWLVKGSSGREVVSVAGMGGMGKTTLAKQVYDAAQVKK  216

Query  190   HFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKY  369
             HF+  AWITV+Q+FK+ E+LK MI+QL   ++ PVP+G+ +M+ N LK ++KE L +R+Y
Sbjct  217   HFKVRAWITVTQSFKLGEILKHMIEQLHQAIRIPVPQGINNMSTNLLKTVIKEVLQKRRY  276

Query  370   VIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEV  549
             ++V DDVW    W+A+K+ LP    G R +++TR  DVAS++  ++ G +Y + PL    
Sbjct  277   LVVLDDVWHLCGWDALKYALPNNTCGSRVILTTRNADVASTTCVESRGKVYNLEPLPLTD  336

Query  550   SWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYH  729
             +W LLC+K F  +SCP HL E+   IL++C GLPLAIVAI GVLATK+K  I+EW  + H
Sbjct  337   AWELLCKKTFQGNSCPPHLEEVCNYILRKCEGLPLAIVAISGVLATKDKRRIDEWDMVGH  396

Query  730   SLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGF  909
              LG   EGND+ + L+ +L LSFNDLP YLK CF+YLSI+PEDH I+H  LI  W  EGF
Sbjct  397   CLGGQIEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHQIKHMRLIRLWIAEGF  456

Query  910   VKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFV  1089
             ++ K  KT+E+VAE YL EL+NRS+I   +   DG +++ RIHDL REII SK+ D NF 
Sbjct  457   IETKESKTLEDVAEDYLNELLNRSMIQAAETTPDGRVQKFRIHDLLREIITSKTRDQNFA  516

Query  1090  TTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSCR  1269
             T   E    WP+K R LS+H TL   Q  R  ++LRSL  F V +           +   
Sbjct  517   TIAKEYNMPWPDKVRRLSIHNTLQYVQQYRSASQLRSLFMFRVAEKPSLQRFFP--TGFT  574

Query  1270  VIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTE  1449
             ++ VLDLQST L + P E+  L  L+YLSLR T+VK +P  I KL+ LE LDLK + VTE
Sbjct  575   LLNVLDLQSTPLNVFPAEVVNLFFLKYLSLRDTRVKTVPTWIGKLQNLETLDLKNSRVTE  634

Query  1450  LPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTI  1629
             LPVEILKLQHLRHL+VY +    +  ++   GFK    +G L SL+KL ++E N   G I
Sbjct  635   LPVEILKLQHLRHLLVYRYEFVPHENFHSKYGFKVLGKIGALTSLQKLCFIEGNQDGGAI  694

Query  1630  E-EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPP  1806
               E+GKL +L+RL I+K+R E GKA CSSIEKL K+ SL++ S+EED ++D+ YLSSPP 
Sbjct  695   LIELGKLVQLRRLGIVKMRKEYGKAFCSSIEKLTKICSLSITSVEEDEIIDLEYLSSPPL  754

Query  1807  LLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGE  1986
             LLQRLYL G +  +PHWI SL +L+K+Y +WS+LKDDPL  LQ LPNLVHLE    + G+
Sbjct  755   LLQRLYLRGRLETLPHWIPSLHSLIKLYLKWSRLKDDPLVFLQYLPNLVHLELSEVFEGD  814

Query  1987  HMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNL  2166
              + F AG F+ L+ L LDK +ELR + +  G MP +E+L I+RC  L  VP+GIE L  L
Sbjct  815   TLCFGAGGFKKLKHLGLDKSDELRCIRVEAGTMPCIEQLSIKRCKSLEKVPSGIEHLITL  874

Query  2167  RYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGPET  2340
             + L+F DM +  I T LP ++G DY KV HI EVY TYW++  W+V S++  S   ++
Sbjct  875   KVLKFSDMPEKLIRTLLPHEQGNDYWKVEHIPEVYITYWREWEWKVYSLEGLSEAQKS  932



>ref|XP_010056220.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=947

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/795 (51%), Positives = 548/795 (69%), Gaps = 13/795 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R +ALLL++ ++VGIE P+ ELI  LLK     +VISVVGMGG GKTTLVK VY+D 
Sbjct  153   QDHRGNALLLDKTDLVGIERPKNELIGRLLKGALRREVISVVGMGGLGKTTLVKQVYEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF  +AWIT+S++ K+EE LKDM+ Q+   +++PVP G  +MN++ LK+I+K+ L 
Sbjct  213   AVKKHFTIYAWITLSRSSKIEEHLKDMLDQIMRVIRKPVPPGANTMNSHWLKMIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+IV DD W    W+AIKH LP   HG R +I+TR  D+AS+S  + +G + +M PL
Sbjct  273   RRRYLIVLDDAWHINKWDAIKHALPNNGHGSRVIITTRNADLASTSCKEFSGLLKDMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C+K F  +SCPSHL EI K IL++C GLPLAIVAI GVLA K+K  I+EW 
Sbjct  333   DPEQSWKLFCQKTFQGNSCPSHLEEICKYILRKCEGLPLAIVAISGVLAAKDKQRIDEWD  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + +GND+ ++L+ +L LSF+DLP YLK CF++LS++PE HLIE   L   W 
Sbjct  393   VVRRSLRAEIDGNDRLKNLKRVLSLSFSDLPYYLKSCFLHLSVFPERHLIERRRLTRLWV  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+++ GKT++EVA+ Y  EL+NRSLI   +   DG +K  RIHD  REII SKS D
Sbjct  453   AEGFVERQEGKTLDEVAKEYFSELLNRSLIQVAETTTDGRVKLCRIHDFQREIITSKSRD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F T   E+T  WPEK R LS+H +L  AQ  R  + L SL  F V        ++ ++
Sbjct  513   QTFATITKEQTDMWPEKVRRLSLHNSLQAAQQNRSLSHLHSLYMFGV-----DRGIIDLV  567

Query  1258  SSC--RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
               C  +++ VLD+Q+T L   P ++    +LRY+S R T++K +P SI +L+ LE LDLK
Sbjct  568   LGCDIKLLNVLDMQATPLSKFPVQVVDWYYLRYISFRHTEIKTIPSSIGRLQNLETLDLK  627

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             YT VT LPVEILKL+ LRHL+VY + + +YL YN   GFKA   +G L SLEKL Y+EA+
Sbjct  628   YTNVTRLPVEILKLRKLRHLLVYRYENISYL-YN-KYGFKALTDIGALQSLEKLCYIEAS  685

Query  1612  PGNGTI--EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
                  I   E+GKL +L R+ ILKLR EDG+A+CSSI KL  L +L++ S+E+D +LD+ 
Sbjct  686   DERNDILMRELGKLTQLSRVGILKLRKEDGRALCSSIAKLTNLCALSVASVEDDEILDLQ  745

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
             +L+SPP LLQR+YL G +  +P+W+ +L +LVK++ RWS+LKDDPL  LQ+LPNLVHLE 
Sbjct  746   HLTSPPQLLQRIYLRGRLEMLPNWLATLNSLVKLHLRWSRLKDDPLVSLQNLPNLVHLEL  805

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  Y G+ + F +  F+ LR+L LD  +ELR+V + EGAMP LEKL+IQRC  L  +P+G
Sbjct  806   LQVYEGKTLCFKSKGFRKLRILGLDNFDELRSVEVEEGAMPCLEKLIIQRCKLLEKLPSG  865

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETS  2325
             IE L  L+ LEFFDM D+ +  F+ D++ +DY KV+ I EVYY YW+DG W+V S++ +S
Sbjct  866   IEYLSKLKVLEFFDMPDELVKKFVQDEQDKDYQKVARIPEVYYGYWRDGGWDVQSIERSS  925

Query  2326  SGPETAVKISGRRNS  2370
              G  +  + +  R+S
Sbjct  926   EGNASPRQGTSMRSS  940



>gb|AES95654.2| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=951

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/777 (51%), Positives = 534/777 (69%), Gaps = 12/777 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D+R DALLL+  ++VGI+  +  LI  L+K  P  KVISV GMGG GKTTLVK VYDD 
Sbjct  149   HDQRGDALLLDNTDLVGIDRHKNWLIGWLIKGCPGRKVISVTGMGGMGKTTLVKKVYDDP  208

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V KHF++ AW+TVSQ+  +EE+L+D+ ++LF+E+++ VPEG+ +M+++KLK+I+KE L 
Sbjct  209   EVIKHFKACAWVTVSQSCGIEELLRDLAEKLFSEIRRKVPEGLENMHSDKLKMIIKELLQ  268

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y++VFDDVW    WEA+K+ LPK   G R MI+TR  D+AS SS ++ G +Y + PL
Sbjct  269   RRRYLVVFDDVWHIHEWEAVKYALPKNNCGSRIMITTRKSDIASISSIESKGKVYNLQPL  328

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              E+ +W L CRK F   SCPS+L +I   IL++C GLPLAIVA+ GVLATK+K  I+EW 
Sbjct  329   KEDEAWDLFCRKTFQGHSCPSYLIDICSYILRKCEGLPLAIVAMSGVLATKDKHRIDEWD  388

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + + N + ++L+ +L LSFNDLP YLK CF+YLS++PED+LI+   LI  W 
Sbjct  389   MICRSLGAEIQVNGKLDNLKTVLSLSFNDLPYYLKYCFLYLSMFPEDYLIQRMRLIRLWI  448

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF++ K+GKT+E+VAE YL ELINR+L+   +   DG +K  RIHDL REII+SKS D
Sbjct  449   AEGFIEAKSGKTMEDVAEDYLKELINRNLLQVAETTSDGRVKTLRIHDLLREIIISKSKD  508

Query  1078  HNFVTTIDEETAAWPEKARHLSVHG-TL--GNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
              NF T + E+    PEK R L+ HG TL   N Q  R  ++LRSLL F +T+S     + 
Sbjct  509   QNFATIVKEQNVVLPEKIRRLAQHGPTLPNPNGQQHRSVSQLRSLLMFGMTESLSLGKLF  568

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSI-KKLRMLEILD  1425
                   +++ VLD Q   L   P+ +  L HL YLSL++T+VKVLP+ +  KL+ LE LD
Sbjct  569   P--GGFKLLSVLDYQDAPLRKFPKAVVDLYHLTYLSLKNTQVKVLPKCVLGKLQNLETLD  626

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVE  1605
             LK T VTELP +I+K++ LR+L+VY      Y  ++   GFKAP  +GKL SL+KL +VE
Sbjct  627   LKNTRVTELPADIVKVKKLRNLLVYQSKVEGYAQFHSKYGFKAPLEIGKLQSLQKLCFVE  686

Query  1606  ANPGNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
             AN G G  I ++ KL++L+RL I++LR EDGK  C  IEKL  L +L++ S  ED  +D+
Sbjct  687   ANQGCGMIIRQLQKLSQLRRLGIMRLREEDGKEFCWCIEKLTSLCALSVTSEGEDKFIDL  746

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
               L  PPP LQRLYLSG + ++P WI SL NL +++ +WS LK DPL +LQDLPNL HLE
Sbjct  747   TSLCKPPPFLQRLYLSGRLQELPSWIPSLHNLARLFLKWSCLKHDPLVYLQDLPNLAHLE  806

Query  1963  FLVGYT-GEHM--HFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
              L  Y  GE+M  HF  GKF  L++L LDK E L  V++G+GAMP LE L I RC  L  
Sbjct  807   LLQVYDGGENMLLHFKCGKFTKLKVLGLDKFEGLSQVIVGKGAMPWLETLSIGRCESLKK  866

Query  2134  VPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEV  2304
             VP+GIE L  L+ LEFFDM D+ + T      GEDY KVSHI EVY TYW+DG W+V
Sbjct  867   VPSGIENLAKLQVLEFFDMPDELMLTICQHGPGEDYWKVSHIPEVYSTYWRDGGWDV  923



>ref|XP_004301648.1| PREDICTED: disease resistance protein RPM1-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/786 (49%), Positives = 535/786 (68%), Gaps = 8/786 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +DRR DALLL+  ++VGI+ P+  L+S L+  D   +V+SV GMGG GKTTLVK VYDDV
Sbjct  156   HDRREDALLLDNTDVVGIDEPKDLLVSWLVNGDSGREVVSVTGMGGMGKTTLVKKVYDDV  215

Query  184   --KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
               KK F+  AWITVSQ+F+ +++LKD+I++L++E+ + VPEG+  M+++KLKV +K  L 
Sbjct  216   EVKKRFKPRAWITVSQSFEAQDLLKDIIRKLYSEIGRQVPEGVDGMSSHKLKVRIKNLLQ  275

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+IV DDVW    WE +K+  P  K G R MI+TR  DVAS+S +++ G+++E+ PL
Sbjct  276   KRRYLIVLDDVWRINEWETVKYAFPNGKLGSRVMITTRNSDVASTSCSESGGHVHEVRPL  335

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              E+ SW+L  RKAF   SCPS+L    + ILK+C GLPLAIVAI GVLATK++  I+EW 
Sbjct  336   PEKESWSLFSRKAFQRKSCPSYLESFCEDILKKCEGLPLAIVAISGVLATKDERRIDEWD  395

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
             A+  SLG +  GND+ E L+ +L LSFNDLP  LK CF+ LS++PE HLI+   +I  W 
Sbjct  396   AICRSLGAEIHGNDKLEDLKKVLSLSFNDLPYNLKACFLCLSVFPEGHLIKSMKIIRLWI  455

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              E FV+   G+T+EEVAE YL EL+NR+L+L      DG +K  R+H L REII+SKS D
Sbjct  456   AERFVEAIEGRTLEEVAEDYLKELLNRNLMLVGSTTSDGRVKTYRVHGLLREIIVSKSRD  515

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF   + E    WP++ R LS+   L   Q  R   +LRSL  F       SS    + 
Sbjct  516   QNFAAIVKEHNTIWPDRVRRLSIQNVLQTVQQSRSFPQLRSLFMFGAVSR--SSMRKYLS  573

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             +  R++KVLD+++  ++  P EI  L +L YLSLR T+VKV+PRSI  L+ LE LDLK+T
Sbjct  574   NGFRLLKVLDIEAAPIKTFPREIMDLFYLSYLSLRKTQVKVIPRSIGNLQNLETLDLKHT  633

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
             +V+ELPVEILKLQ LRHL+VY     +Y  +    GF+    +G L SL+KL ++EAN G
Sbjct  634   YVSELPVEILKLQKLRHLLVYHLKIESYAHFYSKFGFEVLSSIGDLQSLQKLCFIEANQG  693

Query  1618  NG-TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
              G TI ++ KL +L+RL I+KLR EDG A+C S+E L KLRS ++ S  E+ ++D+ +LS
Sbjct  694   CGMTIRDLAKLKQLRRLGIIKLRKEDGLALCLSLESLTKLRSFSVNSAGENEIIDLQHLS  753

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPP  L+RLYL+G + ++P WI SL +LVK++ +WS+LKDDP+  LQDLPNLVHLE L  
Sbjct  754   SPPQFLERLYLTGRLEELPSWIPSLHSLVKLFLKWSQLKDDPMVLLQDLPNLVHLELLQT  813

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
                + + F  G F+ L++L LDK ++L  V + +GAMP LE+L IQRC  L  VP+G++ 
Sbjct  814   CDNDILSFKGGGFKKLQVLGLDKFDKLSCVKVEKGAMPCLERLTIQRCKLLKRVPSGVQN  873

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEV---NSVQETS  2325
             L  L+ L+FFDM  + IS  LPD  GEDY  V+HI EVY  YW+DG W+V   +S +E  
Sbjct  874   LAKLKSLQFFDMPYELISKLLPDGEGEDYEDVAHIPEVYSAYWRDGGWDVYPIDSFKEIK  933

Query  2326  SGPETA  2343
             + P +A
Sbjct  934   NSPSSA  939



>ref|XP_003534302.1| PREDICTED: disease resistance protein RPM1-like [Glycine max]
Length=937

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/790 (49%), Positives = 537/790 (68%), Gaps = 13/790 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D + DALLLEE ++VGI+ P+K+L  LL  ++    VI V GMGG GKTTL K VYDD  
Sbjct  142   DSQGDALLLEEADLVGIDKPKKQLSDLLFNEEAGRAVIPVYGMGGLGKTTLAKQVYDDPK  201

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+ HAWI VSQ+FK++E+LKD++QQL   + +P PE +G M +++LK ++K  L R
Sbjct  202   VKKRFRIHAWINVSQSFKLDELLKDLVQQLHTVIGKPAPEAVGQMKSDQLKEVIKNLLQR  261

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y++V DDVW  +VW+++K  LP    G R M++TR  D+A  S  +  G  +++  L 
Sbjct  262   SRYLVVLDDVWQVKVWDSVKLALPNNNRGSRVMLTTRKKDIALHSCAEL-GKDFDLEFLP  320

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             EE +W L C+K F  +SCP HL E+ ++ILK CGGLPLAIV IGG LATK + NI EW  
Sbjct  321   EEEAWYLFCKKTFQGNSCPPHLEEVCRKILKMCGGLPLAIVGIGGALATKGRANIEEWQM  380

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EGND+ E ++ +L LSFN+LP YLK C +YLSI+PE H IEH  LI  W  
Sbjct  381   VCRSLGSEIEGNDKLEDMKKVLSLSFNELPYYLKSCLLYLSIFPEFHAIEHMRLIRLWIA  440

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV  + GKT+EEVA+ YL EL++RSL+  V    DG MK  R+HDL REI+  KS D 
Sbjct  441   EGFVNGEEGKTLEEVADSYLKELLDRSLLQVVAKTSDGRMKTCRMHDLLREIVNFKSKDQ  500

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF T   ++   WP+K R LS+  TL N Q  R   +LRSLL F ++D+   +  ++ L 
Sbjct  501   NFATIAKDQDITWPDKVRRLSIINTLNNVQQNRTAFQLRSLLMFALSDNSLENFSIRALC  560

Query  1261  SC--RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
             S   ++++VLDLQ   LE+ P EI  L  L+YLSL++TKVK +P SIKKL+ LE LDLK+
Sbjct  561   STGYKLLRVLDLQDAPLEVFPAEIVSLYLLKYLSLKNTKVKSIPGSIKKLQQLETLDLKH  620

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T VT LPVEI++LQ LRHL+VY +   +Y   +   GFK    +G + SL+KL ++EA+ 
Sbjct  621   THVTVLPVEIVELQRLRHLLVYRYEIESYANLHSRHGFKVAAPIGLMQSLQKLCFIEAD-  679

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
                 + E+GKL  L+RL I K+R +DG A+CSSIEK++ LRSL++ +IEED ++D++ + 
Sbjct  680   -QALMIELGKLTRLRRLGIRKMRKQDGAALCSSIEKMINLRSLSITAIEEDEIIDIHNIF  738

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
              PP  L +LYLSG +   PHWI SL+NLV+++ +WS+LK+DPL HLQDLPNL H+EFL  
Sbjct  739   RPPQYLHQLYLSGRLDNFPHWISSLKNLVRVFLKWSRLKEDPLVHLQDLPNLRHVEFLQV  798

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y GE +HF A  F SL++L LD L+ L+++ + EGAMP L+KL+IQRC+ L  VP GIE 
Sbjct  799   YVGETLHFKAKGFPSLKVLGLDYLDGLKSMTVEEGAMPGLKKLIIQRCDSLKQVPLGIEH  858

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ-----E  2319
             L  L+ +E FDM ++FI+   P+  GEDY +V  +  VY +YW+D  W+V S++     E
Sbjct  859   LTKLKSIELFDMPEEFITALRPNG-GEDYWRVQQVPAVYISYWRDRGWDVYSLETLGERE  917

Query  2320  TSSGPETAVK  2349
             + S   TA++
Sbjct  918   SDSSGGTAIR  927



>ref|XP_003612696.1| Nbs-lrr resistance protein [Medicago truncatula]
Length=954

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/780 (51%), Positives = 534/780 (68%), Gaps = 15/780 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D+R DALLL+  ++VGI+  +  LI  L+K  P  KVISV GMGG GKTTLVK VYDD 
Sbjct  149   HDQRGDALLLDNTDLVGIDRHKNWLIGWLIKGCPGRKVISVTGMGGMGKTTLVKKVYDDP  208

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V KHF++ AW+TVSQ+  +EE+L+D+ ++LF+E+++ VPEG+ +M+++KLK+I+KE L 
Sbjct  209   EVIKHFKACAWVTVSQSCGIEELLRDLAEKLFSEIRRKVPEGLENMHSDKLKMIIKELLQ  268

Query  358   RRK---YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEM  528
             RR+   Y++VFDDVW    WEA+K+ LPK   G R MI+TR  D+AS SS ++ G +Y +
Sbjct  269   RRRFNRYLVVFDDVWHIHEWEAVKYALPKNNCGSRIMITTRKSDIASISSIESKGKVYNL  328

Query  529   TPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
              PL E+ +W L CRK F   SCPS+L +I   IL++C GLPLAIVA+ GVLATK+K  I+
Sbjct  329   QPLKEDEAWDLFCRKTFQGHSCPSYLIDICSYILRKCEGLPLAIVAMSGVLATKDKHRID  388

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  +  SLG + + N + ++L+ +L LSFNDLP YLK CF+YLS++PED+LI+   LI 
Sbjct  389   EWDMICRSLGAEIQVNGKLDNLKTVLSLSFNDLPYYLKYCFLYLSMFPEDYLIQRMRLIR  448

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGF++ K+GKT+E+VAE YL ELINR+L+   +   DG +K  RIHDL REII+SK
Sbjct  449   LWIAEGFIEAKSGKTMEDVAEDYLKELINRNLLQVAETTSDGRVKTLRIHDLLREIIISK  508

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHG-TL--GNAQMKRQGTKLRSLLTFNVTDSQFSS  1239
             S D NF T + E+    PEK R L+ HG TL   N Q  R  ++LRSLL F +T+S    
Sbjct  509   SKDQNFATIVKEQNVVLPEKIRRLAQHGPTLPNPNGQQHRSVSQLRSLLMFGMTESLSLG  568

Query  1240  HVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSI-KKLRMLE  1416
              +       +++ VLD Q   L   P+ +  L HL YLSL++T+VKVLP+ +  KL+ LE
Sbjct  569   KLFP--GGFKLLSVLDYQDAPLRKFPKAVVDLYHLTYLSLKNTQVKVLPKCVLGKLQNLE  626

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              LDLK T VTELP +I+K++ LR+L+VY      Y  ++   GFKAP  +GKL SL+KL 
Sbjct  627   TLDLKNTRVTELPADIVKVKKLRNLLVYQSKVEGYAQFHSKYGFKAPLEIGKLQSLQKLC  686

Query  1597  YVEANPGNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVV  1773
             +VEAN G G  I ++ KL++L+RL I++LR EDGK  C  IEKL  L +L++ S  ED  
Sbjct  687   FVEANQGCGMIIRQLQKLSQLRRLGIMRLREEDGKEFCWCIEKLTSLCALSVTSEGEDKF  746

Query  1774  LDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLV  1953
             +D+  L  PPP LQRLYLSG + ++P WI SL NL +++ +WS LK DPL +LQDLPNL 
Sbjct  747   IDLTSLCKPPPFLQRLYLSGRLQELPSWIPSLHNLARLFLKWSCLKHDPLVYLQDLPNLA  806

Query  1954  HLEFLVGYT-GEHM--HFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQ  2124
             HLE L  Y  GE+M  HF  GKF  L++L LDK E L  V++G+GAMP LE L I RC  
Sbjct  807   HLELLQVYDGGENMLLHFKCGKFTKLKVLGLDKFEGLSQVIVGKGAMPWLETLSIGRCES  866

Query  2125  LASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEV  2304
             L  VP+GIE L  L+ LEFFDM D+ + T      GEDY KVSHI EVY TYW+DG W+V
Sbjct  867   LKKVPSGIENLAKLQVLEFFDMPDELMLTICQHGPGEDYWKVSHIPEVYSTYWRDGGWDV  926



>ref|XP_004300176.1| PREDICTED: disease resistance protein RPM1-like [Fragaria vesca 
subsp. vesca]
Length=924

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/779 (49%), Positives = 524/779 (67%), Gaps = 33/779 (4%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--  177
             +D + DALLLE+ +IVGI+   ++L+  L+K     +V+SV G+GG GKTTL K VYD  
Sbjct  154   DDHQGDALLLEKTDIVGIDKLIQQLVGWLVKGGSGREVVSVAGIGGMGKTTLAKQVYDAA  213

Query  178   DVKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             +VKKHF+  AWITV+++FK+ E+LKDM+ QL+  +++PVP G+ +MN N LK I+K+FL 
Sbjct  214   EVKKHFKVCAWITVTRSFKLGELLKDMVHQLYNAIRRPVPAGINNMNNNHLKTIIKDFLQ  273

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+IV DDV     W+A+K+ LP    G R +++TR  +VAS++S ++ G +Y + PL
Sbjct  274   KRRYLIVLDDVSHLYGWDAVKYALPNNTSGSRVILTTRNAEVASTTSVESGGKVYNLEPL  333

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              +  SW LLC+K F   SCP HL EI    LK+C G+PLAIVA+ GVL+TK++  I+EW 
Sbjct  334   PQSESWELLCKKTFQGKSCPPHLEEICTYALKKCEGMPLAIVAVSGVLSTKDQRRIDEWD  393

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + HSLG + +GND+   L+ +L LSFNDLP YLK CF+YLSI+PED+LIEH  L+  W 
Sbjct  394   MVCHSLGAEIQGNDKLRDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDYLIEHMRLVRLWM  453

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+ K GKT+E+VAE YL EL+NR +I       DG +K  R+HDL+RE+I SK  D
Sbjct  454   AEGFVEPKDGKTLEDVAEDYLSELLNRGMIQAADTTSDGRVKNIRVHDLFREMITSKIRD  513

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF T   E+   WP+K R LS+H ++                              Q +
Sbjct  514   QNFATISKEQNVPWPDKVRRLSLHNSM------------------------------QYV  543

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                R++ VLDLQ+  L + P EI  L  L+YLSL+ TKVK +PR I KL+ LE LDLK++
Sbjct  544   QKNRLLNVLDLQNAPLNVFPVEIINLFFLKYLSLKGTKVKTIPRFIGKLQNLETLDLKHS  603

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              VTELPVEILKL+HLRHL+VY +    Y  ++   GFK    +G L SL+KL +++AN  
Sbjct  604   LVTELPVEILKLEHLRHLLVYRYEFVPYGDFHSKYGFKVLVKIGALTSLQKLCFIKANED  663

Query  1618  NGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
              G I +E+GKL +L+RL I+++R EDGK +CSSIEKL KL +L++ S+EED ++D+ +LS
Sbjct  664   GGAILKELGKLVQLRRLGIVQMRKEDGKVLCSSIEKLNKLCALSITSVEEDEIIDLQHLS  723

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPP LLQRLYL G +  +PHWI SL +LV++Y +WS+LKDDPL  LQ LPNLVHLE    
Sbjct  724   SPPLLLQRLYLRGRLETIPHWIPSLHSLVRLYLKWSRLKDDPLVFLQYLPNLVHLELSQV  783

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             + GE + F AG F+ L+ L +D+ E L+ + +  GAMP ++KL IQRC  L  VP+GIE 
Sbjct  784   FEGETLCFEAGGFKKLKHLGIDEFEGLKYIQVQLGAMPSVKKLSIQRCKLLEKVPSGIEH  843

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
             L  L+ LEFFDM +  I T  P ++  DY KV+HI EVY+TYWK+  WEV  ++  S G
Sbjct  844   LSKLKVLEFFDMPETLIKTLRPHEKDNDYWKVAHIPEVYFTYWKECGWEVYPLEGLSEG  902



>ref|XP_007211130.1| hypothetical protein PRUPE_ppa026111mg, partial [Prunus persica]
 gb|EMJ12329.1| hypothetical protein PRUPE_ppa026111mg, partial [Prunus persica]
Length=892

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/767 (51%), Positives = 523/767 (68%), Gaps = 7/767 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +DRR DALLL+  ++VGI+ P+++L+S L+K     +V+SV GMGG GKTTLVK VYDDV
Sbjct  129   HDRRGDALLLDNTDVVGIDKPKQKLVSWLVKGGSGREVVSVTGMGGIGKTTLVKKVYDDV  188

Query  184   K--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             K  KHF+ HAWITVSQ+F+ E++LKD+I +LF  +++PVPEG+   N+N+LK I+K FL 
Sbjct  189   KVKKHFKPHAWITVSQSFQAEDLLKDIIHKLFYAIRRPVPEGVDDKNSNELKAIIKNFLQ  248

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +RKY+IV DDVW    WE +K+VLP    G R M++TR  DVA +S +++   +Y + PL
Sbjct  249   KRKYLIVLDDVWHTNEWETVKYVLPTGNFGSRVMVTTRKADVAFTSCSESKCKVYHLKPL  308

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L  RKAF    CP +L E  K ILK+C GLPLAIVAI GVLATK+   I+EW 
Sbjct  309   PADKSWNLFTRKAFQGKPCPPYLYEKCKCILKKCEGLPLAIVAISGVLATKDTRRIDEWD  368

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + HSLG +  GND+ E L+ +L LSFNDLP YLK CF+YLSI+PE +LI+   LI  W 
Sbjct  369   FICHSLGAEIHGNDKLEDLKKVLSLSFNDLPYYLKACFLYLSIFPEGYLIQRMRLIRLWI  428

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+   GKT+EEVAE YL EL+NR+LIL      DG +K  RIHDL REII+SKS D
Sbjct  429   AEGFVEAIQGKTLEEVAEDYLKELLNRNLILVGNTTSDGRVKTYRIHDLLREIIISKSRD  488

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF   + E++A WP++ R LS+H +L   Q KR   +LRSL  F V      S      
Sbjct  489   QNFAAIVKEQSAIWPDRVRRLSIHNSLQTVQAKRSVPQLRSLFLFGVVAR--PSIQKYFP  546

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  R++KVLDL++  L++ P EI  L +L YLSLR T+VK +PR I  L+ L  LDLK T
Sbjct  547   SGLRLLKVLDLEAAPLKMFPREILDLFYLSYLSLRKTQVKFIPRGIGNLQNLLTLDLKKT  606

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP-  1614
              VTELP+EILKL+ L HL+VY     +Y  +    GFKA   LG L SL+KL ++EAN  
Sbjct  607   NVTELPLEILKLEKLCHLLVYRLKIESYAHFYSKSGFKALSSLGDLQSLQKLCFIEANDH  666

Query  1615  GNG-TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             G G T+ E+GKL  L+RL I+KLR +DG A+C S+E L KLR+ ++KS  E+ +LD+ +L
Sbjct  667   GCGMTMRELGKLKNLRRLGIMKLRKQDGLALCLSLEHLTKLRAFSVKSTRENEILDLQHL  726

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  L+RLYL+G + ++P+WI SL +LVK++ +WS LKDDPL  LQ LPNLVHLE L 
Sbjct  727   SSPPQFLERLYLTGRLEELPNWIPSLNSLVKLFLKWSWLKDDPLVCLQGLPNLVHLELLH  786

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
                 + + F +G F+ L++L LDK + LR V + EGAMP LEKL IQRC  +  VP+G++
Sbjct  787   ACDSDMLSFKSGGFKKLKVLGLDKFDNLRCVKVEEGAMPCLEKLTIQRCKSMKRVPSGVK  846

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDG  2292
              L  L+ LEFF+M  + I    P+  GEDY +V H+ +VY   W+DG
Sbjct  847   HLSKLKLLEFFEMPSELILKLRPNG-GEDYGEVKHVPDVYSACWRDG  892



>ref|XP_008373505.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
Length=946

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/775 (50%), Positives = 528/775 (68%), Gaps = 8/775 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +DRR DALLLE  ++VGI   +K+L+ +L++    L+V+SV GMGG GKTTLVK VYDD 
Sbjct  153   HDRREDALLLENTDVVGIHKRKKKLVRMLVEGGSGLEVVSVTGMGGMGKTTLVKKVYDDD  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF+  AWITVSQ+F+VE++LKD+I +LF  +++PVPEG+   N+N+LK I+K FL 
Sbjct  213   EVKKHFKPRAWITVSQSFRVEDLLKDIIHKLFDAIRRPVPEGVHDKNSNELKAIIKXFLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+IV DDVW A  WE +K+ LPK + G R M++TR  +   ++ +++   +Y + PL
Sbjct  273   KRRYLIVLDDVWHADKWETVKYALPKGRFGSRIMLTTR--NAVFTTCSESKSKVYHLKPL  330

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L  +KAF    CP +L E  + I+KRC GLPLAIVAI GVLATK+K  I+EW 
Sbjct  331   PADESWKLFIKKAFLGKPCPPYLVERCQGIVKRCEGLPLAIVAISGVLATKDKRRIDEWD  390

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG +  GN++ E L+ +L LSFNDLP YLK CF+YLS++PE HLI    LI  W 
Sbjct  391   FICRSLGAELHGNNKLEDLKKVLSLSFNDLPYYLKACFLYLSLFPEGHLIRRMRLIRLWI  450

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+   G+T+EEVAE YL EL+NR+LIL      DG +K  R+H L REII+SKS D
Sbjct  451   AEGFVEAIEGRTLEEVAEDYLKELLNRNLILVGDTTSDGRVKTYRLHGLLREIIISKSRD  510

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF   + ++   WP++ R LS+H  L   Q KR   +LRSL  F       SS      
Sbjct  511   QNFAAIVKDQNTIWPDRVRRLSIHNALDTVQEKRSVPQLRSLFMFGAVAR--SSMXKYFA  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             +  R++ VLDL++  L+  P EI  L +L+YLSLR T+VK +PRSI  L  LE LDLK T
Sbjct  569   TGFRLLGVLDLEAAPLKKFPREILDLFYLKYLSLRKTQVKFIPRSIGNLSNLETLDLKKT  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              VTELP+EILKLQ LRHL+VY   + +Y  +    GF A   +G+L SL+KL ++EAN  
Sbjct  629   NVTELPLEILKLQKLRHLLVYRLKNESYAHFYSKFGFSALSNIGELQSLQKLCFIEANDQ  688

Query  1618  NG--TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             +   T+ E+GKL +L+RL I+KLR +DG A+C SIE L KLR+L++ S  E  V+D++++
Sbjct  689   SCGMTMRELGKLKQLRRLGIMKLRKQDGLALCLSIESLTKLRALSVTSTGESEVIDLHHI  748

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  L+RLYL G + +MP+WI SL +L +++ +WS+L+DDPL HLQDLPNL+HLE L 
Sbjct  749   SSPPQFLERLYLIGRLEEMPNWIPSLNSLARLFLKWSQLEDDPLVHLQDLPNLIHLELLH  808

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
                 + + FN   F+ L++L LDK ++L+ V + EGAMP LEKL IQRC  +  VP+G++
Sbjct  809   ACDSDMLSFNGRGFKKLKVLGLDKFDKLQCVKVEEGAMPCLEKLTIQRCKSMKRVPSGVK  868

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ  2316
              L  L+ LEFF+M ++ I    PD  GEDY +V HI +VY  YW+DG W+V S++
Sbjct  869   HLTKLKLLEFFEMPNELILKLRPDGEGEDYEEVQHIPDVYSAYWRDGGWDVYSIE  923



>ref|XP_008238139.1| PREDICTED: disease resistance protein RPM1-like [Prunus mume]
Length=952

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/779 (51%), Positives = 533/779 (68%), Gaps = 7/779 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R DALLL++ ++VG++ P+ +L+  L       +V+S+ GMGG GKTTL K VYDD 
Sbjct  156   QDCRGDALLLDKSDLVGLDEPKNQLVGWLFNGSSGREVVSLAGMGGMGKTTLAKQVYDDP  215

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF+  AWITV+Q+FK  ++LKDM+QQLF  +++ +P+ + +MN  +LK  +KE L 
Sbjct  216   EVKKHFEVRAWITVNQSFKFGDLLKDMVQQLFKAIRRRIPQIVANMNNCQLKTTIKELLQ  275

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              R+Y++V DDVW    W+AIK+ LP    G R M++TR  DVAS++     G  Y + PL
Sbjct  276   NRRYLVVLDDVWHLYEWDAIKYALPSNGCGSRIMLTTRNADVASTTGVLCEGKAYNLKPL  335

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
                 SW L CRKAF  + CP HL EI K IL++C GLPLAIVAI GVLATK+K  I+EW 
Sbjct  336   PPPESWDLFCRKAFQWNKCPPHLEEICKYILRKCEGLPLAIVAISGVLATKDKRRIDEWD  395

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + EGND+ + L+ +L LSFNDLP YLK CF+YLSI+PEDHLIE   LI  W 
Sbjct  396   MVGRSLGAEIEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHLIERMRLIRLWV  455

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF++ K GKT+EEVA+ YL EL+NRSL+       DG +K  RIHDL REII+SKS D
Sbjct  456   AEGFIEAKEGKTLEEVADDYLHELLNRSLMQVATTTPDGRVKTCRIHDLLREIIISKSRD  515

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF T + +++  W ++AR LS+H TL   Q  R  ++LRSL  F  ++    S +    
Sbjct  516   QNFTTIVKDQSLQWFDRARRLSIHSTLQIVQPNRSVSQLRSLFMFGASEKPSISKLFP--  573

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  R++ VLDLQ++ LE  P E+  L +L+YLSLR TKVK +PRSI +L+ LE LDLK++
Sbjct  574   SGLRLLNVLDLQNSPLEKFPVEVVDLYYLKYLSLRETKVKTVPRSIGRLQSLETLDLKHS  633

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V +LPVEILKLQ LRHL+VY H   +Y  ++   GFK    +G L +L+KL ++E N  
Sbjct  634   NVNQLPVEILKLQRLRHLLVYQHEFVSYEHFHSKKGFKVMSNIGVLQALQKLCFIEVNQD  693

Query  1618  NGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
              GT I E+GKLN+L+RL +LKLR EDGKA+CSSIEKL  LR+L++ S+EED ++D+ +L 
Sbjct  694   GGTIIRELGKLNQLRRLGLLKLRKEDGKALCSSIEKLTNLRALSIASVEEDEIIDLQHLP  753

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPP LLQRLY+ G +  +PHWI SL +LV++  +WS+LKDDPL +L+ +PNLV LE    
Sbjct  754   SPPLLLQRLYMRGRLDALPHWIPSLPSLVRLSLKWSQLKDDPLIYLRYIPNLVQLELCQA  813

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             + G+ + F A  F+ L++L++DK +ELR + +  GAM  LEKL IQRC  L +VP+GIE 
Sbjct  814   FLGDRLCFRADGFRKLKILSMDKFDELRCIEVEMGAMASLEKLSIQRCKLLENVPSGIEH  873

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
             L  L+ LEF DM  D + T   D  G+D  KVSHI EVY TYW++G WEV S++  + G
Sbjct  874   LTKLKVLEFSDMPVDLMKTIRTD--GKDNWKVSHIPEVYSTYWREGGWEVYSIESMTDG  930



>ref|XP_003631469.1| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]
Length=931

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/772 (51%), Positives = 527/772 (68%), Gaps = 14/772 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDD--PTLKVISVVGMGGSGKTTLVKMVYDD  180
             +RR DALLL+E E+VGI   +  LI  L+K      LKV+SVVGMGG GKTTLVK VYDD
Sbjct  163   ERRGDALLLDEAELVGINQHKSLLIECLVKGGCGAGLKVVSVVGMGGLGKTTLVKKVYDD  222

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               V+KHF+SH WITVSQ+FK EE+LKDMI+QL+  ++QPVP  +   ++  LK  +K+FL
Sbjct  223   IEVRKHFESHMWITVSQSFKTEELLKDMIRQLYDGIRQPVPNSVDMGSSQMLKASIKDFL  282

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
              +R+Y+++ DDVW    WEA+K+ LP      R +++TR +D AS++  +++G +Y + P
Sbjct  283   QQRRYLLILDDVWDLHAWEALKYTLPNCNCDGRVLLTTRNVDTASTACKESHGNVYTLKP  342

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             LS+E SW L C+K F A SCPS+L  I K IL+RC GLPLAIVA+ GVL+TK+   I+EW
Sbjct  343   LSQEESWTLFCKKTFPAESCPSYLEGISKCILQRCEGLPLAIVAVSGVLSTKD--GIDEW  400

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
              ++Y SLG + EGN++F+SL+ ILLLS+NDLP YLK CF+Y+SI+PED+LI    LI  W
Sbjct  401   ESVYRSLGAELEGNNKFDSLKEILLLSYNDLPYYLKSCFLYMSIFPEDYLIRRMRLIRLW  460

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFV+ K  KT EEV EGYL EL+NRSL+       +G +   R+HDL REII+SKS 
Sbjct  461   MAEGFVEAKGRKTQEEVGEGYLNELVNRSLVQVATRTRNGRVSTCRVHDLLREIIVSKSR  520

Query  1075  D-HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
                N V   +EE   WPEK R L+VH TL N     +  +LRSLL F++     S   + 
Sbjct  521   GGQNLVAIANEENVRWPEKIRRLAVHKTLENVPQDMELGQLRSLLMFSLP----SGDCIP  576

Query  1252  ILSS--CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILD  1425
              LSS   R++KVLDLQ   LEI+P E++ L +LRYLSL  TKVKV+P SI KL+ LE LD
Sbjct  577   TLSSGGLRLLKVLDLQGAPLEIIPNEVWNLFNLRYLSLSRTKVKVIPSSIGKLQNLETLD  636

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVE  1605
             LK+++VTELP EIL L  LRHL++Y +      P++ + GFKAP+G+  L  L+KL +V+
Sbjct  637   LKHSYVTELPAEILMLHQLRHLLLYRYEKQTSSPFHSTYGFKAPQGMQALSFLQKLCFVD  696

Query  1606  ANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
                GNG I E+G L +L++L I+KLR EDG  +CSSIEKL  LRSL++ SI++D ++D+ 
Sbjct  697   VEEGNGVISEVGHLKQLRKLGIIKLRKEDGMNLCSSIEKLSNLRSLDVTSIQDDEMIDLQ  756

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              +SSPP  LQRL+L G + KMPHWI SL NLVK+  RWS+L+DDPL  LQ LP+LV L+ 
Sbjct  757   CMSSPPRFLQRLWLQGRLEKMPHWISSLDNLVKLRLRWSRLRDDPLVLLQALPSLVELQL  816

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
                Y GE + F +  F  L +L+  KLE LR V + +GAMP LE+L I  C  L  VP G
Sbjct  817   RHAYEGESLCFKSAGFLRLNILHFHKLERLRRVTVEDGAMPRLERLGIFYCKLLEKVPQG  876

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWE  2301
             I+ L  L+ L+  +M ++FI   L D+ GEDY  + HI +V YTYW +  W+
Sbjct  877   IQFLTQLKSLDLAEMPNEFIGK-LQDRSGEDYSVIEHIPDVRYTYWVNNQWK  927



>ref|XP_003612691.1| Disease resistance protein RPP8 [Medicago truncatula]
 gb|AES95649.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=944

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/812 (48%), Positives = 542/812 (67%), Gaps = 24/812 (3%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D + DALLLEE ++VGI+ P+K+L  LL KD+   +VIS+ GMGG GKTTL K VYDD  
Sbjct  148   DSQGDALLLEEADLVGIDQPKKQLTDLLFKDESKREVISIYGMGGLGKTTLAKQVYDDPK  207

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+ HAW+ +SQ+ K+EE+LKD++Q+L     +P P  +G+MN + LK ++K  L R
Sbjct  208   VKKRFRIHAWVNLSQSIKMEEILKDLVQKLHNVFGKPAPGSIGTMNNDDLKELIKNLLQR  267

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y+IV DDVW  +VW+ +KH LP    G R M++TR  D+  +      G  + +  L 
Sbjct  268   SRYLIVLDDVWNVKVWDDVKHSLPNNNRGSRVMLTTRKKDIVRAEL----GKDFHLAFLP  323

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             E+ +W+L CRK F  +SCP HL E+ + ILK CGGLPLAIVAI G LAT+ +TNI EW  
Sbjct  324   EQEAWSLFCRKTFQGNSCPPHLEEVCRNILKLCGGLPLAIVAISGALATRGRTNIEEWQI  383

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  S G + EGND+ E ++ +L LSFN+LP +LK C +YLSI+PE H IEH  LI     
Sbjct  384   VCRSFGSEIEGNDKLEDMKKVLSLSFNELPYHLKSCLLYLSIFPEFHAIEHMRLIRLLIA  443

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV  + GKT+EEVA+ YL EL+NRSL+  V+   DG +K  R+HDL REI+  KS D 
Sbjct  444   EGFVNSENGKTLEEVADRYLKELLNRSLLQVVEKTSDGRIKTCRMHDLLREIVNFKSRDQ  503

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGT-KLRSLLTFNVTDS--QFSSHVVQ  1251
             NF T   E+   WPE+ R LSV  +  N   + +   KLRSLL F ++DS   FS H + 
Sbjct  504   NFATVAKEQDMVWPERVRRLSVINSSHNVHKQNKTIFKLRSLLMFAISDSVNHFSIHELC  563

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
               +  +++ VLDLQ   LE  P EI  L  L++LSL++TKVK +P SIKKL+ LE LDLK
Sbjct  564   SSTGVKLLNVLDLQDAPLEDFPVEIVNLYLLKHLSLKNTKVKSIPGSIKKLKYLETLDLK  623

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             +T+VTELPVE+ +L+ LRHL+VY +   +Y  ++   GFK    +G + SL+KL ++E +
Sbjct  624   HTYVTELPVEVAELKRLRHLLVYRYEIESYAHFHSRHGFKVAAPIGNMLSLQKLCFIEVD  683

Query  1612  PGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
              G+   + E+GKL +L+RL I K+R EDG A+CSSIEK++ LRSLN+ +IE+D ++D++ 
Sbjct  684   QGSRALMVELGKLTQLRRLGIRKMRKEDGAALCSSIEKMINLRSLNITAIEDDEIIDIHN  743

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             +S PP  LQ+LYLSG + K P WI SL+NLVK++ +WS+LK+DPL +LQDLPNL HLEFL
Sbjct  744   ISKPPQYLQQLYLSGRLEKFPQWINSLKNLVKVFLKWSRLKEDPLVYLQDLPNLRHLEFL  803

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y G+ ++FNA  F SL++L LD LE L++++I EGAM  L+KLV+QRC    +VP GI
Sbjct  804   QVYVGDTLNFNAKGFPSLKVLGLDDLEGLKHMIIEEGAMQSLKKLVMQRCGSFKNVPLGI  863

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSS  2328
             E L  L+ +EFFDM D+ I    P+  G DY +V ++  VY TYW+DG W+V S++    
Sbjct  864   EHLTKLKTIEFFDMPDELIMALRPNV-GADYWRVQNVPTVYSTYWRDGGWDVYSLE----  918

Query  2329  GPETAVKISGRRNSL*FSTHGNSMKFLTLPSL  2424
                      G R S   S H ++ +   LP+L
Sbjct  919   -------TFGERES--DSNHSSAKRTRELPTL  941



>ref|XP_009373507.1| PREDICTED: disease resistance protein RPM1-like [Pyrus x bretschneideri]
Length=952

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/794 (50%), Positives = 538/794 (68%), Gaps = 14/794 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +DRR DALLLE  ++VGI   +K+L+ +L+     L+V+SV GMGG GKTTLVK VYDD 
Sbjct  153   HDRREDALLLENTDVVGIHKRKKKLVRMLVGGGSGLEVVSVTGMGGMGKTTLVKKVYDDD  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF+  AWITVSQ+F+VE++LKD+I +LF  +++PVPEG+   N+N+LK I+K FL 
Sbjct  213   EVKKHFKPRAWITVSQSFRVEDLLKDIIHKLFDAIRRPVPEGVHDKNSNELKAIIKNFLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+IV DDVW A  WE +K+ LPK K G R M++TR  +V  ++ +++   +Y + PL
Sbjct  273   KRRYLIVLDDVWHADKWETVKYALPKGKFGSRIMLTTR--NVVFTTCSESKSKVYHLKPL  330

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + S  L  +KAF    CP +L E  + I+KRC GLPLAIVAI GVLATK+K  I+EW 
Sbjct  331   PADESRKLFIKKAFLGKPCPPYLLERCECIVKRCEGLPLAIVAISGVLATKDKRRIDEWD  390

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG +  GN++ E L+ +L LSFNDLP YLK CF+YLS++PE HLI    LI  W 
Sbjct  391   FICRSLGAELHGNNKLEDLKKVLSLSFNDLPYYLKACFLYLSLFPEGHLIRRMKLIRLWI  450

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+ + G+T+EEVAEGYL EL+NR+LIL      DG +K  R+H L REII+SKS D
Sbjct  451   AEGFVEVREGRTLEEVAEGYLKELLNRNLILVGDTTSDGRVKTYRLHGLLREIIISKSRD  510

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF   I ++   WP++ R LS+H  L   Q KR   +LRSL  F   +   SS      
Sbjct  511   QNFAAIIKDQNTIWPDRVRRLSIHNALETVQEKRSVPQLRSLFIFG--EVARSSMRKCFS  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             +  R++ VLDL++  L+  P +I  L +L+YLSLR T+VK +PRSI  L  LE LDLK T
Sbjct  569   TGFRLLGVLDLEAAPLKTFPSQILDLFYLKYLSLRKTQVKSIPRSIGNLSNLETLDLKKT  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN-P  1614
              VTELP+EILKLQ LRHL+VY     +Y  +    GF A   +G+L SL+KL ++EAN  
Sbjct  629   NVTELPLEILKLQKLRHLLVYRLKIESYAHFYSKFGFSALSNIGELQSLQKLCFIEANYQ  688

Query  1615  GNG-TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             G G T+ E+GKL +L+RL I+KLR +DG A+C SIE L KLR+L++ S  E  V+D++++
Sbjct  689   GCGMTMRELGKLKQLRRLGIMKLRKQDGLALCLSIESLTKLRALSVTSTGESEVIDLHHI  748

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  L+RLYL G + +MP+WI SL +L +++ +WS+LKDDPL HLQDLPNL+HLE L 
Sbjct  749   SSPPQFLERLYLIGRLEEMPNWIPSLNSLARLFLKWSQLKDDPLVHLQDLPNLIHLELLH  808

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
                 + + FN   F+ L++L LDK ++L+ V + EGAMP LEKL IQRC  +  VP+G++
Sbjct  809   ACDSDMLSFNGRGFKKLKVLGLDKFDKLQCVKVEEGAMPCLEKLTIQRCKSMKRVPSGVK  868

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ---ET  2322
              L  L+ LEFF+M ++ I    PD  GEDY +V HI +VY  YW+DG W+V S++   E 
Sbjct  869   HLTKLKLLEFFEMPNELILKLRPDGEGEDYEEVQHIPDVYSAYWRDGGWDVYSIECFGEI  928

Query  2323  SSGPET---AVKIS  2355
              + P +    V+IS
Sbjct  929   ENSPSSVAGTVRIS  942



>gb|KCW72844.1| hypothetical protein EUGRSUZ_E01296, partial [Eucalyptus grandis]
Length=917

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/772 (51%), Positives = 535/772 (69%), Gaps = 13/772 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R +ALLL++ ++VGIE P+ ELI  LLK     +VISVVGMGG GKTTLVK VY+D 
Sbjct  153   QDHRGNALLLDKTDLVGIERPKNELIGRLLKGALRREVISVVGMGGLGKTTLVKQVYEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF  +AWIT+S++ K+EE LKDM+ Q+   +++PVP G  +MN++ LK+I+K+ L 
Sbjct  213   AVKKHFTIYAWITLSRSSKIEEHLKDMLDQIMRVIRKPVPPGANTMNSHWLKMIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+IV DD W    W+AIKH LP   HG R +I+TR  D+AS+S  + +G + +M PL
Sbjct  273   RRRYLIVLDDAWHINKWDAIKHALPNNGHGSRVIITTRNADLASTSCKEFSGLLKDMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C+K F  +SCPSHL EI K IL++C GLPLAIVAI GVLA K+K  I+EW 
Sbjct  333   DPEQSWKLFCQKTFQGNSCPSHLEEICKYILRKCEGLPLAIVAISGVLAAKDKQRIDEWD  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + +GND+ ++L+ +L LSF+DLP YLK CF++LS++PE HLIE   L   W 
Sbjct  393   VVRRSLRAEIDGNDRLKNLKRVLSLSFSDLPYYLKSCFLHLSVFPERHLIERRRLTRLWV  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+++ GKT++EVA+ Y  EL+NRSLI   +   DG +K  RIHD  REII SKS D
Sbjct  453   AEGFVERQEGKTLDEVAKEYFSELLNRSLIQVAETTTDGRVKLCRIHDFQREIITSKSRD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F T   E+T  WPEK R LS+H +L  AQ  R  + L SL  F V        ++ ++
Sbjct  513   QTFATITKEQTDMWPEKVRRLSLHNSLQAAQQNRSLSHLHSLYMFGV-----DRGIIDLV  567

Query  1258  SSC--RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
               C  +++ VLD+Q+T L   P ++    +LRY+S R T++K +P SI +L+ LE LDLK
Sbjct  568   LGCDIKLLNVLDMQATPLSKFPVQVVDWYYLRYISFRHTEIKTIPSSIGRLQNLETLDLK  627

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             YT VT LPVEILKL+ LRHL+VY + + +YL YN   GFKA   +G L SLEKL Y+EA+
Sbjct  628   YTNVTRLPVEILKLRKLRHLLVYRYENISYL-YN-KYGFKALTDIGALQSLEKLCYIEAS  685

Query  1612  PGNGTI--EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
                  I   E+GKL +L R+ ILKLR EDG+A+CSSI KL  L +L++ S+E+D +LD+ 
Sbjct  686   DERNDILMRELGKLTQLSRVGILKLRKEDGRALCSSIAKLTNLCALSVASVEDDEILDLQ  745

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
             +L+SPP LLQR+YL G +  +P+W+ +L +LVK++ RWS+LKDDPL  LQ+LPNLVHLE 
Sbjct  746   HLTSPPQLLQRIYLRGRLEMLPNWLATLNSLVKLHLRWSRLKDDPLVSLQNLPNLVHLEL  805

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  Y G+ + F +  F+ LR+L LD  +ELR+V + EGAMP LEKL+IQRC  L  +P+G
Sbjct  806   LQVYEGKTLCFKSKGFRKLRILGLDNFDELRSVEVEEGAMPCLEKLIIQRCKLLEKLPSG  865

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWE  2301
             IE L  L+ LEFFDM D+ +  F+ D++ +DY KV+ I EVYY YW+DG W+
Sbjct  866   IEYLSKLKVLEFFDMPDELVKKFVQDEQDKDYQKVARIPEVYYGYWRDGGWD  917



>ref|XP_007210391.1| hypothetical protein PRUPE_ppa000953mg [Prunus persica]
 gb|EMJ11590.1| hypothetical protein PRUPE_ppa000953mg [Prunus persica]
Length=952

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/779 (51%), Positives = 534/779 (69%), Gaps = 7/779 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R DALLL++ ++VG++ P+ +L+  L       +V+S+ GMGG GKTTL K VYDD 
Sbjct  156   QDCRGDALLLDKSDLVGLDEPKNQLVGWLFNGSSGREVVSLAGMGGMGKTTLAKQVYDDP  215

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF+  AWITV+++FK  ++LKDM+QQLF  +++ +P+ + +MN  +LK  +KE L 
Sbjct  216   EVKKHFEVRAWITVNRSFKFGDLLKDMVQQLFKAIRRRIPQIVANMNDYQLKTTIKELLQ  275

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              R+Y++V DDVW    W+AIK+ LP    G R M++TR  DVAS++     G  Y + PL
Sbjct  276   NRRYLVVLDDVWHLYEWDAIKYALPSNGCGSRIMLTTRNADVASTTGVLCEGKAYNLKPL  335

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
                 SW L CRKAF  + CPSHL EI K IL++C GLPLAIVAI GVLATK+K  I+EW 
Sbjct  336   PPPESWDLFCRKAFQWNKCPSHLEEICKYILRKCEGLPLAIVAISGVLATKDKRRIDEWD  395

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + EGND+ + L+ +L LSFNDLP YLK CF+YLSI+PEDHLIE   LI  W 
Sbjct  396   MVRRSLGAEIEGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHLIERMRLIRLWV  455

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF++ K GKT+EEVA+ YL EL+NRSL+       DG +K  RIHDL REII+ KS D
Sbjct  456   AEGFIEAKEGKTLEEVADDYLHELLNRSLMQVATTTPDGRVKTCRIHDLLREIIIPKSRD  515

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF T + +++  W E+AR LS+H TL + Q  R  ++LRSL  F  +++   S +    
Sbjct  516   QNFTTIVKDQSLQWFERARRLSIHSTLQSVQPNRSVSQLRSLFMFGASENPSISKLFP--  573

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  R++ VLDLQ++ LE  P E+  L  L+YLSLR TKVK +PRSI +L+ LE LDLK++
Sbjct  574   SGLRLLNVLDLQNSPLEKFPVEVVDLYCLKYLSLRETKVKTVPRSIGRLQSLETLDLKHS  633

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V +LPVEILKLQ LRHL+VY H   +Y  ++   GFK    +G L +L+KL ++E N  
Sbjct  634   NVNQLPVEILKLQRLRHLLVYQHEFVSYEHFHSKKGFKVMSNIGVLQALQKLCFIEVNQD  693

Query  1618  NGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
              GT I E+GKLN+L+RL +LKLR EDGKA+CSSIEKL  LR+L++ S+EED ++D+ +L 
Sbjct  694   GGTIIRELGKLNQLRRLGLLKLRKEDGKALCSSIEKLTNLRALSIASVEEDEIIDLQHLP  753

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPP LLQRLY+ G +  +PHWI SL +LV++  +WS+LKDDPL +L+ +PNLV LE    
Sbjct  754   SPPLLLQRLYMRGRLDALPHWIPSLPSLVRLSLKWSQLKDDPLIYLRYIPNLVQLELCQV  813

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             + G+ + F A  F+ L++L++DK +ELR + +  GAM  LEKL IQRC  L +VP+GIE 
Sbjct  814   FLGDRLCFRADGFRKLKILSMDKFDELRCIEVEMGAMASLEKLSIQRCKLLENVPSGIEH  873

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
             L  L+ LEF DM  D + T   D  G+D  KVSHI EVY TYW++G WEV S++  + G
Sbjct  874   LTKLKVLEFSDMPVDLMKTIRTD--GKDNWKVSHIPEVYSTYWREGGWEVYSIESMTDG  930



>ref|XP_010056219.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=947

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/794 (49%), Positives = 543/794 (68%), Gaps = 11/794 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R +ALLL++ ++VGIE P+ +L+  LL      +VISVVGMGG GKTTLV  VY+D 
Sbjct  153   QDHRGNALLLDKTDVVGIEQPKNDLVGQLLDGPQRREVISVVGMGGLGKTTLVNQVYEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF  +AWIT+S++ K+EE+LKDM+ Q+   +++PVP G  +MN++ LK+I+K+ L 
Sbjct  213   SVKKHFAVYAWITLSRSSKIEELLKDMLDQIMRVIRKPVPPGANTMNSHWLKMIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+IV DD W    W+A+KH LP    G R +++TR  ++AS++  + NG +  M PL
Sbjct  273   RRRYLIVLDDTWYINEWDAVKHALPNNGQGSRVILTTRNAELASTACKEFNGLVKNMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L CRK F  + CPSHL EI K ILK+C GLPLAIVAI GVLA K+K  I+EW 
Sbjct  333   DPEQSWKLFCRKTFQGNFCPSHLEEICKYILKKCEGLPLAIVAISGVLAAKDKRRIDEWD  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + +GN++ ++L+ +L LSF+DLP YLK CF++LS++PE HLIE   L   W 
Sbjct  393   VVRRSLRAEIDGNNRLKNLKRVLSLSFSDLPYYLKSCFLHLSVFPEGHLIERRRLTRLWV  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT++EVA+ Y  EL+NRSL+   +   DG +K  RIHD  REII SKS+D
Sbjct  453   AEGFVERKEGKTLDEVAKEYFGELLNRSLVQVAETTTDGRVKLCRIHDFQREIITSKSSD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              +F T   E+T  WP+K R LS+H +L  AQ  R  + LR+L  F V D  F   V+   
Sbjct  513   QSFATIAKEQTDMWPDKVRRLSLHNSLQAAQQNRSLSHLRALYMFGV-DGAFIDFVLG--  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                +++ VLD+Q+T L   P ++    +LRYLS R T++K +P SI +L+ LE LDLK+T
Sbjct  570   CDIKLLNVLDMQATPLSRFPVQVVDCYYLRYLSFRHTEIKTIPTSIGRLQNLETLDLKHT  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSP-GFKAPkglgklgsleklVYVEANP  1614
              VT LPV ILKL+ LRHL+VY + + +YL   C+  GFKA   +G L SLEKL Y+E + 
Sbjct  630   NVTRLPVGILKLRKLRHLLVYRYENISYL---CNKYGFKALTEIGALQSLEKLCYIEVDD  686

Query  1615  GNGTI--EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                 I   E+GKL +L RL ILKLR EDG+A+CSSI KL  L ++++ S+E+D +LD+ +
Sbjct  687   ERNDIIMRELGKLTQLSRLGILKLRKEDGRALCSSIAKLTNLCAISVASVEDDEILDLQH  746

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             L+SPP LLQR+YL G +  +P+W+ +L +LVK++ RWS+LKDDPL  LQ LPNLVHLE L
Sbjct  747   LTSPPQLLQRIYLKGRLEMLPNWLATLNSLVKLHLRWSRLKDDPLLPLQSLPNLVHLELL  806

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y G+ + F +  F+ LR+L LD  +ELR+V + EGAMP LEKL+IQRC  L  +P GI
Sbjct  807   QVYGGKTLCFKSKGFRKLRILGLDNFDELRSVEVEEGAMPCLEKLIIQRCKLLEKLPPGI  866

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSS  2328
             E L  L+ LEFFDM D+ + TF+  ++ EDY KV+HI E+YY YW+DG W+V S++ +S 
Sbjct  867   EYLTKLKVLEFFDMPDELVKTFVRGEQDEDYRKVAHIPEIYYGYWRDGGWDVQSIERSSK  926

Query  2329  GPETAVKISGRRNS  2370
             G  +  + +  R+S
Sbjct  927   GDASPRQGTSMRSS  940



>ref|XP_007158211.1| hypothetical protein PHAVU_002G133600g [Phaseolus vulgaris]
 gb|ESW30205.1| hypothetical protein PHAVU_002G133600g [Phaseolus vulgaris]
Length=755

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/731 (52%), Positives = 502/731 (69%), Gaps = 6/731 (1%)
 Frame = +1

Query  133   MGGSGKTTLVKMVYDD--VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGM  306
             MGG GKTTLVK VYDD  VKKHF++  W+TVSQ+ K+EE+LKD+  +LF+E+++P+PEGM
Sbjct  1     MGGIGKTTLVKKVYDDPDVKKHFKACVWVTVSQSCKIEELLKDLALKLFSEIRRPIPEGM  60

Query  307   GSMNANKLKVIVKEFLLRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVA  486
              SM  +KLK+I+K+ L R++Y++VFDDVW    WEA+K+ LP      R MI+TR  D+A
Sbjct  61    ESMCNDKLKMIIKDLLQRKRYLVVFDDVWHMYEWEAVKYALPNNTCCSRIMITTRRSDLA  120

Query  487   SSSSTDTNGYIYEMTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVA  666
              +SS ++NG +Y + PL E+ +W L CR  F   SCPS+L +I K ILK+C GLPLAIVA
Sbjct  121   FTSSIESNGKVYNLQPLKEDEAWDLFCRNTFQGDSCPSYLIDICKYILKKCEGLPLAIVA  180

Query  667   IGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSI  846
             I GVLATK+K  I+EW  + HSLG +  GN + +S + +L LSFNDLP +LK CF+YLSI
Sbjct  181   ISGVLATKDKRRIDEWDMICHSLGAEIHGNGKLDSFKTVLNLSFNDLPYHLKYCFLYLSI  240

Query  847   YPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQ  1026
             +PED+LI+   LI  W  EGF++ K GKT E+VA+ YL EL+NR+LI    +  DG +K 
Sbjct  241   FPEDYLIQRMRLIRLWIAEGFIEAKEGKTKEDVADDYLKELLNRNLIQVAGITSDGRVKT  300

Query  1027  GRIHDLYREIILSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLL  1206
              RIHDL REII+ KS D NF + + E++ AWPEK R LSVHGTL   Q  R  ++LRS L
Sbjct  301   LRIHDLLREIIILKSKDQNFASIVKEQSVAWPEKIRRLSVHGTLPYRQQHRSVSQLRSFL  360

Query  1207  TFNVTDSQFSSHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLP  1386
              F V +      +    S  +++ VLD Q   L+  P  +  L HLRYLSLR+TKVK++P
Sbjct  361   MFGVGEHVPLGKLFP--SGFKLLSVLDYQDAPLKKFPLAVIDLYHLRYLSLRNTKVKMVP  418

Query  1387  RS-IKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkg  1563
                I KL  LE LDLK T V ELPV+ILKLQ LRHL+VY      Y  ++   G KAP  
Sbjct  419   GYLIGKLHNLETLDLKKTSVRELPVDILKLQKLRHLLVYQFKFKGYAQFHSKHGVKAPTE  478

Query  1564  lgklgsleklVYVEANPGNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrs  1740
             +G L SL+KL +VEAN   G  I ++ KL +L+RL ILKLR EDG A C SIE+L  L +
Sbjct  479   IGNLKSLQKLCFVEANQDRGMIIRQLAKLTQLRRLGILKLREEDGMAFCLSIERLTNLHA  538

Query  1741  lnlksIEEDVVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDP  1920
             L++ S  E  V+D+ +L SPPP LQRLYLSG + ++P WI+SL +L +++ +WS L  DP
Sbjct  539   LSVTSEGESKVIDLTFLCSPPPFLQRLYLSGRLQELPCWIQSLHSLARLFLKWSCLNYDP  598

Query  1921  LEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEK  2100
             L +LQDLPNL HLE L  Y G+ MHF +GKF+ L++L LDK + L+ V +G+ AM  LE+
Sbjct  599   LVYLQDLPNLAHLELLQVYDGDTMHFRSGKFKKLKVLGLDKFDGLKEVTVGKDAMTCLER  658

Query  2101  LVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
             L I RC  L  VP+GIE L  L+ LEFFDM D+ + T  P   G+DYCKV HI +VY TY
Sbjct  659   LSIGRCELLKKVPSGIENLTKLKVLEFFDMPDELMKTICPHGPGKDYCKVLHIPDVYSTY  718

Query  2281  WKDGCWEVNSV  2313
             W+DG W+V ++
Sbjct  719   WRDGGWDVYAL  729



>ref|XP_008238133.1| PREDICTED: disease resistance protein RPM1-like [Prunus mume]
Length=950

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/786 (51%), Positives = 545/786 (69%), Gaps = 13/786 (2%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDD--PTLKVISVVGMGGSGKTTLVKMVYDD--  180
             + DALLLEE ++V I  P+++LI LL+++      + ++VVGMGG GKTTL K VY D  
Sbjct  150   QGDALLLEEADLVAIGEPKRQLIELLMQEGGHAGRQAVAVVGMGGLGKTTLAKQVYKDAR  209

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK+F+ HAWITVSQ+FK++++L+ +++++F  +++PVPE +  M+ N+L+  +K+ L  
Sbjct  210   VKKNFKVHAWITVSQSFKIKKLLRHIVEKIFKVIRKPVPEEVDRMDTNQLREKIKKLLQH  269

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTR---LMDVASSSSTDTNGYIYEMT  531
              KY+IV DD+W    W  I H LP  K G R MI+TR   +  VAS+S  + +G +Y + 
Sbjct  270   SKYLIVLDDLWHIDAWNVINHALPDNK-GSRVMITTRNAFVASVASASCMNNHGMVYHLE  328

Query  532   PLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             PLS E SW LLCRK F   SCP +L EI + IL++CGGLPLAIVAIG VLA K+K NI +
Sbjct  329   PLSPEESWTLLCRKTFQEESCPPNLEEICQCILRKCGGLPLAIVAIGAVLAMKDKKNIED  388

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W A+  S+G + E NDQ ++++ +L LSF+DLP +LK CF+YLSI+P+ +  E+  LI  
Sbjct  389   WAAVCGSIGAEIEENDQLDNMKRLLYLSFSDLPYHLKSCFLYLSIFPDLYKFEYMRLIRL  448

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EGFV +K GKT EEVAE YL EL++RSLI   ++  DG +K  RIHDL REI++SKS
Sbjct  449   WIAEGFVIEKEGKTPEEVAESYLKELLDRSLIEEEEIATDGRVKSCRIHDLLREIVVSKS  508

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              + NF     E+   WPEK R LS+  TL N Q KR  +KLRSLL F V DS     + +
Sbjct  509   REQNFAAIQKEQGTMWPEKVRRLSIVNTLQNVQQKRVPSKLRSLLIFGVEDSLTEFSIPK  568

Query  1252  IL-SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
             +      ++ VLDL+   LE  P+E+  LL LRYLSLR T+VK +P SIKKL+ LE  DL
Sbjct  569   LFPRGLPLLTVLDLEGAPLETFPKEVVNLLLLRYLSLRGTRVKQIPSSIKKLQNLETFDL  628

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K++ V ELP EI+ L+ LRHL+VY +   +Y  +N   G K P G+  L SL+KL +VEA
Sbjct  629   KHSHVVELPAEIVNLKRLRHLLVYRYEVESYARFNSRYGVKVPAGICGLQSLQKLCFVEA  688

Query  1609  NPGNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             N  NG  + E+G++N+L+RL I KLR EDG  +CSSIEK+  LRSL++ S+E+D ++D+ 
Sbjct  689   NQDNGALVAELGRMNQLRRLGIFKLRQEDGVTLCSSIEKMRNLRSLSVSSVEKDKIIDLT  748

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
             ++S PP  LQRLYL+G +  +PHWI SL+N+V+++ +WS+LK+DPL HLQ LPNLVHLE 
Sbjct  749   HISCPPQFLQRLYLTGRLESLPHWISSLQNVVRLFLKWSRLKEDPLVHLQGLPNLVHLEL  808

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  Y G+ +HF AG F SL+LL +DKL+EL+ V++ EGAMP LEKL+IQRC  L  V +G
Sbjct  809   LQVYEGDCLHFKAGGFPSLKLLGIDKLDELKLVIMDEGAMPCLEKLIIQRCRLLKKV-SG  867

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETS  2325
             IE L NL+ LEFFDM D+ I  F PD  GED+ KVSHI EVY +YW  G W+V S+ E +
Sbjct  868   IEHLQNLKLLEFFDMPDELIRPFHPDG-GEDHWKVSHIPEVYSSYWNVGGWDVYSL-EIT  925

Query  2326  SGPETA  2343
              G  T+
Sbjct  926   DGESTS  931



>ref|XP_011018452.1| PREDICTED: disease resistance protein RPM1-like [Populus euphratica]
Length=948

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/773 (50%), Positives = 518/773 (67%), Gaps = 3/773 (0%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             + DALLLEE ++VGIE P+K+LI  LL      +VISVVGMGG GK+TLVK VYDD  VK
Sbjct  154   QKDALLLEEADLVGIEKPKKQLIEWLLGSKSGREVISVVGMGGLGKSTLVKKVYDDSDVK  213

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             KHF+  AWITVSQ+FK E++LKDMIQQLF   ++P P+G+ SMN NKL+ ++ EFL ++K
Sbjct  214   KHFKFRAWITVSQSFKREDLLKDMIQQLFRVHRKPDPKGVDSMNYNKLRSVIHEFLRQKK  273

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E
Sbjct  274   YLIVLDDVWHTSAWRAFQHALPNNICGSRILVTTRNTEVASTSCVDSPDKVYPLNPLSQE  333

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L C+K F  + CP HL  + + IL RC GLPLAIVAI GVLATK+K+  +EW  ++
Sbjct  334   ESWTLFCKKIFQDNPCPPHLKNVSETILGRCEGLPLAIVAISGVLATKDKSKTDEWEMVH  393

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SLG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+   LI  W  EG
Sbjct  394   LSLGAGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMRLIRLWIAEG  453

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FVK K G TVEEVA+ YL EL+ RSL+  VK   DG +K  R+HDL REI+++K+ D +F
Sbjct  454   FVKGKEGMTVEEVAQDYLNELMKRSLVQVVKATSDGRVKTCRVHDLLREIMIAKAKDQDF  513

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-  1263
             V    EE   WPEK R +S+H  + + Q +   ++ RSLLTF   D  + S V  + S  
Sbjct  514   VAIAKEEGTIWPEKVRRVSIHNVMPSKQQRHVASRFRSLLTFWGADCSYESPVHNLFSGR  573

Query  1264  CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
              R++ VLDL+   L+  P E+  L  L+YLSLR+T V  +P SI KL+ LE LDLK+  V
Sbjct  574   LRLLHVLDLEGAPLKEFPNEVVSLFLLKYLSLRNTTVSFIPSSISKLKNLETLDLKHAQV  633

Query  1444  TELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNG  1623
             + LP EI KL+ L +L+VY +   +        GFKAP  +G L S++KL +VEA+ G  
Sbjct  634   SVLPAEIRKLRKLCYLLVYRYEIDSDDRIPTKYGFKAPAHIGGLQSIQKLCFVEAHQGRN  693

Query  1624  TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPP  1803
              + E+G+L +L+RL I+KL+ + GKA+CSSIE+L  LR+L++ SI E  ++D++YL+SPP
Sbjct  694   LMFELGRLKQLRRLGIVKLKKKHGKALCSSIERLTNLRALSVTSITESEIIDLDYLASPP  753

Query  1804  PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTG  1983
               LQRLYL+G M K P WI SL +LVK+  +WSKL +DPL  LQ LPNLVHLEF+  Y G
Sbjct  754   QFLQRLYLAGRMEKFPDWISSLDSLVKLVLKWSKLSEDPLLSLQYLPNLVHLEFVQVYNG  813

Query  1984  EHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFN  2163
             E + F A  FQ L+ L L+KLE LR +++ +GAMP LEK+++Q C  L  VP+GIE L  
Sbjct  814   EILCFQAKGFQRLKFLGLNKLERLRMIIVEQGAMPSLEKMIVQSCKSLRRVPSGIEHLST  873

Query  2164  LRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQET  2322
             L+ LEFF+M  + + T  P+    DY KV+H+ +VY TYW +G W++ S+  T
Sbjct  874   LKVLEFFNMPKELVMTLHPNGEDGDYLKVAHVPDVYSTYWNNGTWDIFSLLST  926



>ref|XP_003612692.1| Nbs-lrr resistance protein [Medicago truncatula]
 gb|AES95650.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=946

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/798 (49%), Positives = 537/798 (67%), Gaps = 11/798 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +D+R DALLL+  ++VGI+  + +LI  L+K     KVISV GMGG GKTTLVK VYDD 
Sbjct  148   HDQRGDALLLDNTDLVGIDRHKNQLIRWLIKGSRGRKVISVTGMGGMGKTTLVKKVYDDP  207

Query  184   K--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             K  KHF + AW+TVSQ+  +EE+L+D+ Q+LF+E+++ VP+G+ SM+ +KLK+I+K+ L 
Sbjct  208   KVIKHFDACAWVTVSQSCAIEELLRDLAQKLFSEIRRKVPKGLESMHRDKLKMIIKKLLQ  267

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RRKY++VFDDVW    WEA+++ LPK  +G R M++TR  ++A+ SS ++ G +Y + PL
Sbjct  268   RRKYLVVFDDVWHRHEWEAVRYALPKNNYGSRIMLTTRKSNLANISSKESKGKVYNLQPL  327

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              E+ +W L C+K F    CPS+L  I   IL++C GLPLAIVA+ GVLATK+K  I+EW 
Sbjct  328   KEDEAWDLFCKKTFQGHRCPSYLINICSYILRKCEGLPLAIVAMSGVLATKDKHRIDEWD  387

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + + N + ++L+ +L LSFNDLP YLK CF+YLS++PED+LI+   LI  W 
Sbjct  388   RICRSLGAEIQINGKLDNLKTVLSLSFNDLPHYLKYCFLYLSMFPEDYLIQRMRLIRLWI  447

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF+K   GKT+E++AE YL +LINR+L+   +   DG +K  RIHDL REII+ KS D
Sbjct  448   AEGFIKAGEGKTMEDIAEDYLKKLINRNLLQVAERTSDGRVKTLRIHDLLREIIILKSKD  507

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTL--GNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              NF T + E+T    EK R LS+ GTL   N Q     ++LRSLL F V ++     +  
Sbjct  508   QNFATIVKEQTVIRAEKIRRLSLQGTLPIPNGQQHISVSQLRSLLMFGVDENLSLGKLFP  567

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSI-KKLRMLEILDL  1428
                  +++ VLD Q + L+  P+ +  L HL YLSLR+T+VK +P  I  KL+ LE LDL
Sbjct  568   --GGFKLLNVLDYQDSPLKKFPKAVVDLYHLTYLSLRNTQVKTIPNCILGKLQNLETLDL  625

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K T VTELP +I+K++ LRHL+VY      Y  ++   GFKAP  +G L SL+KL +VEA
Sbjct  626   KNTCVTELPTDIVKVKKLRHLLVYQSKVEGYAQFHSKYGFKAPLEIGNLQSLQKLCFVEA  685

Query  1609  NPG-NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             N G    I  + +L++L+RL I++LR EDGK  C  IEKL+ L +L++ S  E+ V+D+ 
Sbjct  686   NKGCRMIIRHLKELSQLRRLGIMRLREEDGKDFCFCIEKLVSLSALSVTSEGENKVIDLT  745

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              LS+PPP LQRLYLSG + ++P WI SL NL +++ +WS LK DPL +LQDLPNL HLE 
Sbjct  746   SLSTPPPFLQRLYLSGRLKELPCWIPSLHNLARLFLKWSYLKHDPLVYLQDLPNLAHLEL  805

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  Y G+ +HF  GKF  L++L +DK EEL  V++G+GAMP LE L I RC  L  VP+G
Sbjct  806   LQVYDGDTLHFKCGKFNKLKVLGIDKFEELGQVIVGKGAMPCLETLSIGRCESLKKVPSG  865

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEV---NSVQ  2316
             IE L  ++ LEFFDM D+ + T      G+DY KVSHI EVY TYW+DG W+V   +S++
Sbjct  866   IENLTKIKVLEFFDMPDELMMTICQHGPGKDYWKVSHIPEVYSTYWRDGGWDVYALDSLR  925

Query  2317  ETSSGPETAVKISGRRNS  2370
             + S    T  +    RN 
Sbjct  926   DCSPRSGTVRRSHECRNQ  943



>ref|XP_003612695.1| Disease resistance protein RPP8 [Medicago truncatula]
 gb|AES95653.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=940

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/788 (49%), Positives = 536/788 (68%), Gaps = 13/788 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D + DALLLEE ++VGIE+P+K+L  LL KD+    VIS+ GMGG GKTT+ K VYDD  
Sbjct  145   DSQGDALLLEEADLVGIEHPKKQLCDLLFKDESNRAVISIYGMGGLGKTTIAKQVYDDPK  204

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+ HAW+ +SQ+FK+EE+LKD+++Q+   + +PVPE +  M ++KLK ++K+ L R
Sbjct  205   VKKRFRIHAWVNLSQSFKMEELLKDLVEQIHILIGKPVPEAVERMKSDKLKELIKDLLQR  264

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y+IV DDVW   VW+A+K  LP    G R M++TR  D+A  S  +  G  + +  L 
Sbjct  265   SRYLIVLDDVWHVNVWDAVKLALPNNDRGSRVMLTTRKKDIALYSCAEL-GKDFHLEFLP  323

Query  541   EEVSWALLCRKAFHAS--SCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             E+ +W+L CRK F  +  SCP HL E+ + ILK CGGLPLAIVAI G LATK ++NI EW
Sbjct  324   EQEAWSLFCRKTFQGNNNSCPPHLEEVCRNILKLCGGLPLAIVAISGALATKGRSNIEEW  383

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               +  S G + EGND+ E ++ +L LSFN+LP +LK C +YLS++PE H IEH  LI  W
Sbjct  384   QIVCRSFGSEIEGNDKLEDMKKVLSLSFNELPYHLKSCLLYLSVFPEFHAIEHMRLIRLW  443

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFV  + GKT+EEVA+ YL EL+NRSL+  V+   DG MK  R+HDL REI+  KS 
Sbjct  444   VAEGFVNGEDGKTLEEVADRYLKELLNRSLLQVVEKTSDGRMKTCRMHDLLREIVNFKSR  503

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGT--KLRSLLTFNVTDS--QFSSH  1242
             D NF T   E+   WPE+ R LSV  +  N  +K+  T  KLRSLL F ++DS   FS H
Sbjct  504   DQNFATVAKEQDMVWPERVRRLSVINSSHNV-LKQNKTIFKLRSLLMFAISDSVNHFSIH  562

Query  1243  VVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEIL  1422
              +   +  +++ VLDLQ   LE  P EI  L  L++LSL++TKVK +P SIKKL+ LE L
Sbjct  563   ELCSSTGVKLLNVLDLQDAPLEDFPLEIINLYLLKHLSLKNTKVKNIPSSIKKLQYLETL  622

Query  1423  DLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             DLK+T V ELP EI +L+ LRHL+VY +   +Y  ++   GFK    +G + SL+KL +V
Sbjct  623   DLKHTCVMELPFEIAELKRLRHLLVYRYKIESYAHFHSKNGFKVAAPIGNMQSLQKLCFV  682

Query  1603  EANPGNGTIE-EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             + + G+G +  E+G+L +L++L I K+R EDG A+CSSIEK++ LRSL++ +IEED V+D
Sbjct  683   DVDQGSGALMVELGRLTQLRKLGIRKMRKEDGAALCSSIEKMINLRSLSITAIEEDEVID  742

Query  1780  VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHL  1959
             ++ +S+PP  LQ+LYLSG + K P WI S +NLV+++ +WS+L++DPL +LQ LPNL HL
Sbjct  743   IHDISNPPRYLQQLYLSGRLEKFPQWINSCKNLVRVFLKWSRLEEDPLVYLQGLPNLRHL  802

Query  1960  EFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVP  2139
             EFL  Y GE +HFNA  F SL++L LD L  L+ ++I EGAM  L+KLV+QRC    +VP
Sbjct  803   EFLQVYVGEMLHFNAKGFPSLKVLGLDDLAGLKCMIIEEGAMKGLKKLVMQRCGSFKNVP  862

Query  2140  AGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQE  2319
              GIE L  L+ +EFFDM D+ I    P+  G DY +V ++  VY TYW+D  W+V S+ E
Sbjct  863   LGIEHLTKLKTIEFFDMPDELIMALRPNV-GADYWRVQNVPTVYSTYWRDDGWDVYSL-E  920

Query  2320  TSSGPETA  2343
             T    E+A
Sbjct  921   TFGERESA  928



>ref|NP_001235671.1| NBS-LRR type disease resistance protein [Glycine max]
 gb|ACM89637.1| NBS-LRR type disease resistance protein [Glycine max]
Length=934

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/787 (49%), Positives = 532/787 (68%), Gaps = 12/787 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D + DALLLEE ++VGI+ P+++L  LL  ++    VI + GMGG GKTTL K VYDD  
Sbjct  140   DSQGDALLLEEADLVGIDKPKRQLSDLLFNEEAGRAVIPIYGMGGLGKTTLAKQVYDDPK  199

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+ HAWI VSQ+F++E +LKD++QQL   + +P PE +G M +++LK ++K  L +
Sbjct  200   VKKRFRIHAWINVSQSFQLEVLLKDLVQQLHNVIGKPSPEAVGQMKSDQLKELIKNLLQQ  259

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y+IV DDVW  +VW+++K  LP    G R M++TR  D+A  S  +  G  + +  L 
Sbjct  260   SRYLIVLDDVWHVKVWDSVKLALPNNNRGSRVMLTTRKKDIALYSCAEL-GKDFNLEFLP  318

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             EE SW L C+K F  + CP +L  + + ILK CGGLPLAIVAIGG LATKN+ NI EW  
Sbjct  319   EEESWYLFCKKTFQGNPCPPYLEAVCRNILKMCGGLPLAIVAIGGALATKNRANIEEWQM  378

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +Y S G + EGND+ E ++ +L LSFN+LP YLK C +YLSI+PE H IEH  LI  W  
Sbjct  379   VYRSFGSEIEGNDKLEDMKKVLSLSFNELPYYLKSCLLYLSIFPEFHAIEHMRLIRLWIA  438

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV  + GKT+EEVA+ YL EL++RSL+  V    DG MK  R+HDL REI+  KS D 
Sbjct  439   EGFVNGEDGKTLEEVADSYLKELLDRSLLQVVAKTSDGRMKTCRMHDLLREIVNLKSKDQ  498

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF T   ++   WP+K R LS+  TL N Q  R   +LRSLL F  +DS     +  + S
Sbjct  499   NFATIAKDQDIIWPDKVRRLSIINTLNNVQQNRTTFQLRSLLMFASSDSLEHFSIRALCS  558

Query  1261  SC-RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  ++++VLDLQ   LE+ P EI  L  L+YLSL++TKVK +P SIKKL+ LE LDLK+T
Sbjct  559   SGYKLLRVLDLQDAPLEVFPAEIVSLYLLKYLSLKNTKVKSIPGSIKKLQQLETLDLKHT  618

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
             +VT LPVEI++LQ LRHL+VY +   +Y   +   GF     +G + SL+KL ++EAN  
Sbjct  619   YVTVLPVEIVELQRLRHLLVYRYEIESYAYLHSRHGFMVAAPIGLMQSLQKLCFIEAN--  676

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                + E+GKL +L+RL I K+R +DG A+CSSIEK++ LRSL++ +IE+D ++D++ +  
Sbjct  677   QALMIELGKLTQLRRLGIRKMRKQDGAALCSSIEKMINLRSLSITAIEDDEIIDIHNIFR  736

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQ+LYL G +   P WI SL+NLV+++ +WS+L++DPL HLQDLPNL HLEFL  Y
Sbjct  737   PPQYLQQLYLGGRLDNFPQWISSLKNLVRVFLKWSRLEEDPLVHLQDLPNLRHLEFLQVY  796

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE +HF A  F SL++L LD L+ L+++ + EGAMP L+KL+IQRC+ L  VP GIE L
Sbjct  797   VGETLHFKAKGFPSLKVLGLDDLDGLKSMTVEEGAMPGLKKLIIQRCDSLKQVPLGIEHL  856

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ-----ET  2322
               L+ +EFFDM ++ I+   P+  GEDY +V H+  VY +YW+DG W+V S++     E+
Sbjct  857   TKLKSIEFFDMPEELITALRPNG-GEDYWRVQHVPAVYISYWRDGGWDVYSLETLGERES  915

Query  2323  SSGPETA  2343
              S   TA
Sbjct  916   DSSSGTA  922



>ref|XP_006368329.1| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
 gb|ERP64898.1| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
Length=948

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/770 (50%), Positives = 518/770 (67%), Gaps = 3/770 (0%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             + DALLLEE ++VGIE P+K+LI  LL      +VISVVGMGG GK+TLVK VYDD  VK
Sbjct  154   QKDALLLEEADLVGIEKPKKQLIEWLLGSKSGREVISVVGMGGLGKSTLVKKVYDDSDVK  213

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             KHF+  AWITVSQ+FK E++LKDMIQQLF   ++P P+G+ SMN NKL+ ++ EFL ++K
Sbjct  214   KHFKFRAWITVSQSFKREDLLKDMIQQLFRVHRKPDPKGVDSMNYNKLRSVIHEFLRQKK  273

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E
Sbjct  274   YLIVLDDVWHTSAWRAFQHALPNNICGSRILVTTRNTEVASTSCMDSPDKVYPLNPLSQE  333

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L C+K F  + CP HL  + + IL RC GLPLAIVAI GVLATK+K+  +EW  ++
Sbjct  334   ESWTLFCKKIFQDNLCPPHLKNVSETILGRCEGLPLAIVAISGVLATKDKSKTDEWEMVH  393

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SLG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+   LI  W  EG
Sbjct  394   LSLGAGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMRLIRLWIAEG  453

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FVK K G TVEEVA+ YL EL+ RSL+  V+   DG +K  R+HDL REI+++K+ D +F
Sbjct  454   FVKGKEGMTVEEVAQDYLNELMKRSLVQVVRATSDGRVKTCRVHDLLREIMITKAKDQDF  513

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-  1263
             V    EE   WPEK R +S+H  + + Q +   ++ RSLLTF V D  + S V  + S  
Sbjct  514   VAIAKEEGTIWPEKVRRVSMHNVMPSKQQRHVASRFRSLLTFWVADCSYESPVHNLFSGR  573

Query  1264  CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
              R++ VLDL+   L+  P E+  L  L+YLSLR+T+V  +P SI KL+ LE LDLK+  V
Sbjct  574   LRLLHVLDLEGAPLKEFPNEVVSLFLLKYLSLRNTRVSFIPSSISKLKNLETLDLKHAQV  633

Query  1444  TELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNG  1623
             + LP EI KL+ L +L+VY +   +        GFKAP  +G L S++KL +VEA+ G  
Sbjct  634   SVLPAEIRKLRKLCYLLVYRYEIDSDDRIPTKYGFKAPAHIGGLQSIQKLCFVEAHQGRN  693

Query  1624  TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPP  1803
              + E+G+L +L+RL I+KL+ + GKA+CSSIE+L  LR+L+L SI E  ++D++YL+SPP
Sbjct  694   LMLELGRLKQLRRLGIVKLKKKHGKALCSSIERLTNLRALSLTSITESEIIDLDYLASPP  753

Query  1804  PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTG  1983
               LQRLYL+G M K P WI SL +LVK+  +WSKL +DPL  LQ LPNLVHLEF+  Y G
Sbjct  754   QFLQRLYLAGRMEKFPDWISSLDSLVKLVLKWSKLSEDPLLSLQYLPNLVHLEFVQVYNG  813

Query  1984  EHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFN  2163
             E + F A  FQ L+ L L+KL+ LR +++  GAMP LEK+++Q C  L  VP+GIE L  
Sbjct  814   EILCFQAKGFQRLKFLGLNKLDRLRIIIVERGAMPSLEKMIVQSCKSLRRVPSGIEHLST  873

Query  2164  LRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSV  2313
             L+ LEFF+M  + + T  P+    DY KV+H+ +VY TYW +G W++ S+
Sbjct  874   LKVLEFFNMPKELVMTLHPNGEDGDYLKVAHVPDVYSTYWNNGNWDIFSL  923



>gb|KHN40407.1| Disease resistance protein RPM1 [Glycine soja]
Length=934

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/787 (49%), Positives = 531/787 (67%), Gaps = 12/787 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D + DALLLEE ++VGI+ P+++L  LL  ++    VI + GMGG GKTTL K VYDD  
Sbjct  140   DSQGDALLLEEADLVGIDKPKRQLSDLLFNEEAGRAVIPIYGMGGLGKTTLAKQVYDDPK  199

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+ HAWI VSQ+F++E +LKD++QQL   + +P PE +G M +++LK ++K  L +
Sbjct  200   VKKRFRIHAWINVSQSFQLEVLLKDLVQQLHNVIGKPSPEAVGQMKSDQLKELIKNLLQQ  259

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y+IV DDVW  +VW+++K  LP    G R M++TR  D+A  S  +  G  + +  L 
Sbjct  260   SRYLIVLDDVWHVKVWDSVKLALPNNNRGSRVMLTTRKKDIALYSCAEL-GKDFNLEFLP  318

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             EE SW L C+K F  + CP +L  + + ILK CGGLPLAIVAIGG LATKN+ NI EW  
Sbjct  319   EEESWYLFCKKTFQGNPCPPYLEAVCRNILKMCGGLPLAIVAIGGALATKNRANIEEWQM  378

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +Y S G + EGND+ E ++ +L LSFN+LP YLK C +YLSI+PE H IEH  LI  W  
Sbjct  379   VYRSFGSEIEGNDKLEDMKKVLSLSFNELPYYLKSCLLYLSIFPEFHAIEHMRLIRLWIA  438

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV  + GKT+EEVA+ YL EL++RSL+  V    DG MK  R+HDL REI+  KS D 
Sbjct  439   EGFVNGEDGKTLEEVADSYLKELLDRSLLQVVAKTSDGRMKTCRMHDLLREIVNLKSKDQ  498

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF T   ++   WP+K R LS+  TL N Q  R   +LRSLL F  +DS     +  + S
Sbjct  499   NFATIAKDQDIIWPDKVRRLSIINTLNNVQQNRTTFQLRSLLMFASSDSLEHFSIRALCS  558

Query  1261  SC-RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  ++++VLDLQ   LE+ P EI  L  L+YLSL++TKVK +P SIKKL+ LE LDLK+T
Sbjct  559   SGYKLLRVLDLQDAPLEVFPAEIVSLYLLKYLSLKNTKVKSIPGSIKKLQQLETLDLKHT  618

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
             +VT LPVEI++LQ LRHL+VY +   +Y   +   GF     +G + SL+KL ++EAN  
Sbjct  619   YVTVLPVEIVELQRLRHLLVYRYEIESYAYLHSRHGFMVAAPIGLMQSLQKLCFIEAN--  676

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                + E+GKL  L+RL I K+R +DG A+CSSIEK++ LRSL++ +IE+D ++D++ +  
Sbjct  677   QALMIELGKLTRLRRLGIRKMRKQDGAALCSSIEKMINLRSLSITAIEDDEIIDIHNIFR  736

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQ+LYL G +   P WI SL+NLV+++ +WS+L++DPL HLQDLPNL HLEFL  Y
Sbjct  737   PPQYLQQLYLGGRLDNFPQWISSLKNLVRVFLKWSRLEEDPLVHLQDLPNLRHLEFLQVY  796

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE +HF A  F SL++L LD L+ L+++ + EGAMP L+KL+IQRC+ L  VP GIE L
Sbjct  797   VGETLHFKAKGFPSLKVLGLDDLDGLKSMTVEEGAMPGLKKLIIQRCDSLKQVPLGIEHL  856

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ-----ET  2322
               L+ +EFFDM ++ I+   P+  GEDY +V H+  VY +YW+DG W+V S++     E+
Sbjct  857   TKLKSIEFFDMPEELITALRPNG-GEDYWRVQHVPAVYISYWRDGGWDVYSLETLGERES  915

Query  2323  SSGPETA  2343
              S   TA
Sbjct  916   DSSSGTA  922



>ref|XP_011018457.1| PREDICTED: disease resistance protein RPM1-like [Populus euphratica]
Length=948

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/770 (50%), Positives = 517/770 (67%), Gaps = 3/770 (0%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             + DALLLEE ++VGIE P+K+LI  LL      +VISVVGMGG GK+TLVK VYDD  VK
Sbjct  154   QKDALLLEEADLVGIEKPKKQLIEWLLGSKSGREVISVVGMGGLGKSTLVKKVYDDSDVK  213

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             KHF+  AWITVSQ+FK E++LKDMIQQLF   ++P P+G+ SMN NKL+ ++ EFL ++K
Sbjct  214   KHFKFRAWITVSQSFKREDLLKDMIQQLFRVHRKPDPKGVDSMNYNKLRSVIHEFLRQKK  273

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E
Sbjct  274   YLIVLDDVWHTSAWRAFQHALPNNICGSRILVTTRNTEVASTSCVDSPDKVYPLNPLSQE  333

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L C+K F  + CP HL  + + IL RC GLPLAIVAI GVLATK+K+  +EW  ++
Sbjct  334   ESWTLFCKKIFQDNPCPPHLKNVSETILGRCEGLPLAIVAISGVLATKDKSKTDEWEIVH  393

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SLG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+   LI  W  EG
Sbjct  394   LSLGAGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMRLIRLWIAEG  453

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FVK K G TVEEVA+ YL EL+ RSL+  VK   DG +K  R+HDL REI+++K+ D +F
Sbjct  454   FVKGKEGMTVEEVAQDYLNELMKRSLVQVVKATSDGRVKTCRVHDLLREIMITKAKDQDF  513

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-  1263
             V    EE   WPEK R +S+H  + + Q +   ++ RSLLTF   D  + S V  + S  
Sbjct  514   VAIAKEEGTIWPEKVRRVSMHNVMPSKQQRHVASRFRSLLTFWGADCSYESPVHNLFSGR  573

Query  1264  CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
              R++ VLDL+   L+  P E+  L  L+YLSLR+T V  +P SI KL+ LE LDLK+  V
Sbjct  574   LRLLHVLDLEGAPLKEFPNEVVSLFLLKYLSLRNTIVSFIPSSISKLKNLETLDLKHAQV  633

Query  1444  TELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNG  1623
             + LP EI KL+ L +L+VY +   +        GFKAP  +G L S++KL +VEA+ G  
Sbjct  634   SVLPAEIRKLRKLCYLLVYRYEIDSDDRIPTKYGFKAPAHIGGLQSIQKLCFVEAHQGRN  693

Query  1624  TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPP  1803
              + E+G+L +L+RL I+KL+ + GKA+CSSIE+L  LR+L++ SI E  ++D++YL+SPP
Sbjct  694   LMLELGRLKQLRRLGIVKLKKKHGKALCSSIERLANLRALSVTSITESEIIDLDYLASPP  753

Query  1804  PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTG  1983
               LQRLYL+G M K P WI SL +LVK+  +WSKL +DPL  LQ LPNLVHLEF+  Y G
Sbjct  754   QFLQRLYLAGRMEKFPDWISSLDSLVKVVLKWSKLSEDPLLSLQYLPNLVHLEFVQVYNG  813

Query  1984  EHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFN  2163
             E + F A  FQ L+ L L+KLE LR +++ +GAMP LEK+++Q C  L  VP+GIE L  
Sbjct  814   EILCFQAKGFQRLKFLGLNKLERLRMIIVEQGAMPSLEKMIVQSCKSLRRVPSGIEHLST  873

Query  2164  LRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSV  2313
             L+ LEFF+M  + + T  P+    DY KV+H+ +VY TYW +G W++ S+
Sbjct  874   LKVLEFFNMPKELVMTLHPNGEDGDYLKVAHVPDVYSTYWNNGTWDIFSL  923



>emb|CAN74463.1| hypothetical protein VITISV_032893 [Vitis vinifera]
Length=931

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/772 (51%), Positives = 523/772 (68%), Gaps = 14/772 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDD--PTLKVISVVGMGGSGKTTLVKMVYDD  180
             +RR DALLL+E E+VGI   +  LI  L+K      LKV+SVVGMGG GKTTLVK VYDD
Sbjct  163   ERRGDALLLDEAELVGINQHKSLLIECLVKGGCGAGLKVVSVVGMGGLGKTTLVKKVYDD  222

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               V+KHF+SH WITVSQ+FK EE+LKDMI+QL+  ++QPVP  +   ++  LK  +K+FL
Sbjct  223   IEVRKHFESHMWITVSQSFKTEELLKDMIRQLYDGIRQPVPNSVDMGSSQMLKASIKDFL  282

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
              +R+Y+++ DDVW    WEA+K+ LP      R +++TR +D AS++  +++G +Y + P
Sbjct  283   QQRRYLLILDDVWDLHAWEALKYTLPNSNCDSRVLLTTRNVDTASTACKESHGNVYTLKP  342

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             LS+E SW L C+K F A SCPS+L  I K IL+RC GLPLAIVA+ GVL+TK+   I+EW
Sbjct  343   LSQEESWTLFCKKTFPAESCPSYLEGISKCILQRCEGLPLAIVAVSGVLSTKD--GIDEW  400

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
              ++Y SLG + EGN++F+SL+ ILLLS+NDLP YLK CF+Y+SI+PED+LI    LI  W
Sbjct  401   ESVYRSLGAELEGNNKFDSLKEILLLSYNDLPYYLKSCFLYMSIFPEDYLIRRMRLIRLW  460

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFV+ K  KT EEV EGYL EL+NRSL+       +G +   R+HDL REI +S S 
Sbjct  461   MAEGFVEAKGRKTQEEVGEGYLNELVNRSLVQVATRTRNGRVSTCRVHDLLREIXVSXSR  520

Query  1075  D-HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
                N V   +EE   WPEK R L+VH TL N        +LRSLL F++     S   + 
Sbjct  521   GGQNLVAIANEENVRWPEKIRRLAVHKTLENVPQDMVLGQLRSLLMFSLP----SGDCIP  576

Query  1252  ILSS--CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILD  1425
              LSS   R++KVLDLQ   LEI+P E++ L +LRYLSL  TKVKV+P SI KL+ LE LD
Sbjct  577   TLSSGGLRLLKVLDLQGAPLEIIPNEVWNLFNLRYLSLSRTKVKVIPSSIGKLQNLETLD  636

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVE  1605
             LK+++VTELP EIL L  LRHL++Y +      P++ + GFKAP+G+  L  L+KL +V+
Sbjct  637   LKHSYVTELPAEILMLHQLRHLLLYRYEKQTSSPFHSTYGFKAPQGMQALSFLQKLCFVD  696

Query  1606  ANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
                GNG I E+G L +L++L I+KLR EDG  +CSSIEKL  LRSL++ SI++D ++D+ 
Sbjct  697   VEEGNGVISEVGHLKQLRKLGIIKLRKEDGMNLCSSIEKLSNLRSLDVTSIQDDEMIDLQ  756

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              +SSPP  LQRL+L G + KMPHWI SL NLVK+  RWS+L+DDPL  LQ LP+LV L+ 
Sbjct  757   CMSSPPRFLQRLWLQGRLEKMPHWISSLDNLVKLRLRWSRLRDDPLVLLQALPSLVELQL  816

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
                Y GE + F +  F  L +++  KLE LR V + +GAMP LE+L I  C  L  VP G
Sbjct  817   RHAYEGESLCFKSAGFLRLNIVHFHKLERLRRVTVEDGAMPRLERLGIFYCKLLEKVPQG  876

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWE  2301
             I+ L  L+ L+  +M ++FI   L D+ GEDY  + HI +V YTY  +  W+
Sbjct  877   IQFLTQLKSLDLAEMPNEFIGK-LQDRSGEDYSVIGHIPDVRYTYCVNNEWK  927



>gb|ABF81442.1| NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=948

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/770 (50%), Positives = 519/770 (67%), Gaps = 3/770 (0%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             + DALLLEE ++VGIE P+K+LI  LL      +VISVVGMGG GK+TLVK VYDD  VK
Sbjct  154   QKDALLLEEADLVGIEKPKKQLIEWLLGSKSGREVISVVGMGGLGKSTLVKKVYDDSDVK  213

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             KHF+  AWITVSQ+FK E++LKDMIQQLF   ++P P+G+ +MN NKL+ ++ EFL ++K
Sbjct  214   KHFKFRAWITVSQSFKREDLLKDMIQQLFRVHRKPDPKGVDNMNYNKLRSVIHEFLRQKK  273

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E
Sbjct  274   YLIVLDDVWHTSAWRAFQHALPNNICGSRILVTTRNTEVASTSCMDSPDKVYPLNPLSQE  333

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L C+K F  ++CP HL  + + IL RC GLPLAIVAI GVLATK+K+  +EW  ++
Sbjct  334   ESWTLFCKKIFQDNTCPPHLKNVSETILGRCEGLPLAIVAISGVLATKDKSKTDEWEMVH  393

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SLG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+   LI  W  EG
Sbjct  394   LSLGAGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMRLIRLWIAEG  453

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FVK K G TVEEVA+ YL EL+ RSL+  V+   DG +K  R+HDL REI+++K+ D +F
Sbjct  454   FVKGKEGMTVEEVAQDYLNELMKRSLVQVVRATSDGRVKTCRVHDLLREIMITKAKDQDF  513

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-  1263
             V    EE   WPEK R +S+H  + + Q +   ++ RSLLTF   D  + S V  + S  
Sbjct  514   VAIAKEEGTIWPEKVRRVSMHNVMPSKQQRHVASRFRSLLTFWGADCSYESPVHNLFSGR  573

Query  1264  CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
              R++ VLDL+   L+  P E+  L  L+YLSLR+T+V  +P SI KL+ LE LDLK+  V
Sbjct  574   LRLLHVLDLEGAPLKEFPNEVVSLFLLKYLSLRNTRVSFIPSSISKLKNLETLDLKHAQV  633

Query  1444  TELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNG  1623
             + LP EI KL+ L +L+VY +   +        GFKAP  +G L S++KL +VEA+ G  
Sbjct  634   SVLPAEIRKLRKLCYLLVYRYEIDSDDRIPAKYGFKAPAHIGGLQSIQKLCFVEAHQGRN  693

Query  1624  TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPP  1803
              + E+G+L +L+RL I+KL+ + GKA+CSSIE+L  LR+L+L SI E  ++D++YL+SPP
Sbjct  694   LMLELGRLKQLRRLGIVKLKKKHGKALCSSIERLTNLRALSLTSITESEIIDLDYLASPP  753

Query  1804  PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTG  1983
               LQRLYL+G M K P WI SL +LVK+  +WSKL +DPL  LQ LPNLVHLEF+  Y G
Sbjct  754   QFLQRLYLAGRMEKFPDWISSLDSLVKLVLKWSKLSEDPLLSLQYLPNLVHLEFVQVYNG  813

Query  1984  EHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFN  2163
             E + F A  FQ L+ L L+KL+ LR +++ +GAMP LEK+++Q C  L  VP+GIE L  
Sbjct  814   EILCFQAKGFQRLKFLGLNKLDRLRMIIVEQGAMPSLEKMIVQSCKSLRRVPSGIEHLST  873

Query  2164  LRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSV  2313
             L+ LEFF+M  + + T  P+    DY KV+H+ +VY TYW +G W++ S+
Sbjct  874   LKVLEFFNMPKELVMTLHPNGEDGDYLKVAHVPDVYSTYWNNGNWDIFSL  923



>ref|XP_004301647.1| PREDICTED: disease resistance protein RPM1-like [Fragaria vesca 
subsp. vesca]
Length=945

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/779 (49%), Positives = 535/779 (69%), Gaps = 8/779 (1%)
 Frame = +1

Query  16    SDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKK  189
              DA LLEE E+V I  P+++L  LL+K++ T +V+ +VGMGG GKTTLVK +Y+D  V+K
Sbjct  149   GDATLLEEAELVAIGEPKRKLFELLMKEESTRQVVPIVGMGGLGKTTLVKQLYEDAKVQK  208

Query  190   HFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVP--EGMGSMNANKLKVIVKEFLLRR  363
             HF+ HAWITVS++  + ++L+ MI ++F  +++PVP  E + SM+ NKL+  +++ L   
Sbjct  209   HFKIHAWITVSRSCHMNKLLRRMIHEIFNVIRKPVPQDEEIESMDDNKLRERIRKLLQHS  268

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNG-YIYEMTPLS  540
             +Y+IV DD+W    W AI H +P   HG R M++TR + VAS+S  +     IY + PLS
Sbjct  269   RYLIVLDDLWNTADWNAINHAMPNNNHGSRVMLTTRNVKVASASCLENPADMIYRLQPLS  328

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L CRK F  S CP +L EI   IL +C GLPLAIVA+G VLA K++TN++EW  
Sbjct  329   LEDSWTLFCRKTFRGSPCPPNLEEICPSILTKCEGLPLAIVALGAVLALKDQTNVDEWTD  388

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  S+G + + N+Q +++  +L LSF+DLP +LK CF+YLS++P+ + I+H  LI  W  
Sbjct  389   VCGSIGAEIQENEQLDNMTKVLYLSFSDLPYHLKSCFLYLSMFPDIYKIDHMKLIRLWLA  448

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGF+ +  G+T EEVA+ Y+ EL +RSLI   +   DG +K  RIHDL REII+SKS + 
Sbjct  449   EGFIIETGGRTPEEVAQSYIKELWDRSLIQATETATDGRVKSYRIHDLLREIIISKSREQ  508

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-  1257
             NF     EE+  W +K R LS+  TL N Q K+  +KLRSLL F V DS     + ++  
Sbjct  509   NFAAVEREESTTWSDKVRRLSIVNTLQNVQKKKTRSKLRSLLIFGVEDSLNDFSITKLFP  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             +  +++ VLDL+   L+  P+E+ +L+ L+YLSLR++KVK +P SIKKLR LE LDLK++
Sbjct  569   TGLQLLTVLDLEGAHLQEFPKEVVKLVFLKYLSLRNSKVKQIPSSIKKLRYLETLDLKHS  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP-  1614
              V ELPVEIL L+ LRHL+VY +   +Y  +N   G K P G+  L SL+KL ++EAN  
Sbjct  629   HVVELPVEILYLKQLRHLLVYRYEVESYARFNAKYGVKLPAGICSLQSLQKLCFIEANQC  688

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
               G + E+G +N+L+RL ILKLR EDG+ +CSSI+K+  LRSL++ S E D ++D++Y+ 
Sbjct  689   SGGFMAELGGMNQLRRLGILKLRQEDGEILCSSIQKMKNLRSLSVSSGEFDGLIDLSYMP  748

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             S P  L+RLYL+G +  +PHW+ +L+NLV+++ +WS+L +DPL HLQ LPNLVHLE L  
Sbjct  749   SAPKFLRRLYLTGRLANLPHWLPALQNLVRLFLKWSRLTEDPLVHLQGLPNLVHLELLQV  808

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             + GE +HF AG F  L+LL +DKL+EL+++ I EGAMP LEKL+IQRC  L  VP GIE 
Sbjct  809   FDGESLHFKAGGFPRLKLLGIDKLDELQSITIDEGAMPCLEKLIIQRCESLKKVPHGIEH  868

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
             L +L+ LEFFDM D FI+   PD  GED+ +V+H+  VYY+YWK G W+V S+     G
Sbjct  869   LNSLKLLEFFDMPDKFITALNPDC-GEDHWRVAHVPAVYYSYWKVGGWDVFSLVNDGEG  926



>ref|XP_004300177.1| PREDICTED: disease resistance protein RPM1-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=955

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/781 (51%), Positives = 529/781 (68%), Gaps = 9/781 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DALLL++ ++VG++ PR +L+  L K  P  KV+S+ GMGG GK+TL K VYDD 
Sbjct  157   HDCRGDALLLDKSDLVGLDEPRNQLVGWLFKSSPGRKVVSLAGMGGMGKSTLAKQVYDDP  216

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKK+F+  AWITV+++FK  E+LKDM QQLF  +++ VP+ + SM+ N+LK  +KE L 
Sbjct  217   EVKKYFEVCAWITVNRSFKSGELLKDMAQQLFKAIRRRVPQVVTSMDNNQLKTTIKELLQ  276

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+IV DDVW    W AI++ LP    G R M++TR  DVA+++   ++G +YE+ PL
Sbjct  277   QRRYLIVLDDVWDLCEWHAIQNALPNNSCGSRIMLTTRNADVAATTRVLSDGKVYELKPL  336

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
                 SW L CRKAF  + CP HL +I K ILK+C GLPLAIVAI GVLATK+   I+EW 
Sbjct  337   PPPESWDLFCRKAFRQNKCPPHLEDICKDILKKCEGLPLAIVAISGVLATKDIRRIDEWD  396

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + EGND+ + LR +L LSF+DLP +LK CF+YLSI+PE HLIE   LI  W 
Sbjct  397   MVGRSLGAEIEGNDKLKYLRKVLSLSFSDLPYFLKSCFLYLSIFPEGHLIERMRLIRLWV  456

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF++ K G+T+EEVA+ YL EL+NRSL+       DG +K+ RIHDL REII+SKS D
Sbjct  457   AEGFIEAKEGRTLEEVADDYLHELLNRSLMQVATTTPDGRVKKCRIHDLLREIIISKSRD  516

Query  1078  HNFVTTIDEET--AAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              NF T + E++  A W +K R LS+H TL   Q  R  ++LRSL  F V  S+  S    
Sbjct  517   QNFTTIVKEKSVPAQWSDKMRRLSIHNTLQTVQPNRSVSQLRSLFIFGV--SRKPSIAAL  574

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
               +  R++ VLDL S  L+  P  +  L  L+YLSLR TKVK +P+ I KL+ LE LDLK
Sbjct  575   FPNGFRLLNVLDLHSLPLKRFPVVVVDLYFLKYLSLRETKVKTVPKFIGKLQNLETLDLK  634

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             ++ V+ELP EILKLQ LRHL+VY H   +Y  +    GFK    +G L +L+KL  +E N
Sbjct  635   HSNVSELPDEILKLQRLRHLLVYKHEFVSYEQFGSKNGFKVTPKIGVLRALQKLCLIEVN  694

Query  1612  PGNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                GT I E+GKL +L+RL +LKLR  DGKA+CSSIEKL  LR+L++ S+EED ++D+ +
Sbjct  695   QDGGTIIRELGKLTQLRRLGLLKLRKADGKALCSSIEKLSNLRALSIASVEEDEIIDLQH  754

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             LSSPP LLQRLY+ G +  +PHWI SL +LV++  +WS+LKDDPL  L+ +PNLV LE  
Sbjct  755   LSSPPSLLQRLYMRGRLDALPHWIPSLPSLVRLSLKWSRLKDDPLISLRHIPNLVQLELC  814

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               + G+ + F A  F+ L++L+LDK +ELR + I  GAM  LEKL IQRC  L  VP+GI
Sbjct  815   QVFVGDKLCFKADGFRKLKILSLDKCDELRRIDIEMGAMDCLEKLSIQRCKLLEKVPSGI  874

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSS  2328
             E L  L+ LEF +M  D + T  PD  G+D  +VSHI EVY TYW++G WEV S+   + 
Sbjct  875   EHLLKLKVLEFSEMPVDLMKTIRPD--GKDNWRVSHIPEVYSTYWREGGWEVYSIDSMTD  932

Query  2329  G  2331
             G
Sbjct  933   G  933



>gb|KCW72841.1| hypothetical protein EUGRSUZ_E01293, partial [Eucalyptus grandis]
Length=905

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/757 (50%), Positives = 517/757 (68%), Gaps = 9/757 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R +ALLL++  +VGIE P+ ELI  LL      +VISV+GMGG GKTTLVK V++D  
Sbjct  154   DNRGNALLLDKTGLVGIEQPKNELIGQLLDGVHRREVISVLGMGGLGKTTLVKQVFEDPS  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF  +AWIT+S+  ++EE+LKDM+ Q+   +++PVP G  +MN++ LK+I+ + L R
Sbjct  214   VKKHFAVYAWITLSRPSEIEELLKDMLDQIVRVMRKPVPPGANAMNSDWLKMIINDQLQR  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV DD W    W+A+ H LP   HG R +I+TR  D+AS+S  + NG +  M PL+
Sbjct  274   RRYLIVLDDAWYRDKWDAVMHALPNNDHGSRVIITTRNADLASTSCKEFNGLVKNMEPLN  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C++ F  +SCPSHL EI + IL +C GLP AI+AI GVLA K+K  I+EW A
Sbjct  334   PEQSWKLFCQRTFQKNSCPSHLEEICEYILGKCDGLPFAIMAISGVLAAKDKQRIDEWDA  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             L  +L  + +GN++  +L+ +L LSF+DLP YLK CF++LS++PE HLIE   L   W  
Sbjct  394   LRCNLRAEIDGNNRLMNLKRVLSLSFSDLPYYLKSCFLHLSVFPEGHLIERRRLTRLWVA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV+++ GKT++EVA+ Y  EL+NRSL+   +   D  ++  RIHD  REII SKS+D 
Sbjct  454   EGFVERREGKTLDEVAKEYFSELLNRSLVQVAETTTDRRVRLCRIHDFQREIITSKSSDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             +F T   E+T  WP K R LS+H +L  AQ  R  ++LRSL  F V D  F   V+    
Sbjct  514   SFATITKEQTDMWPNKVRRLSLHNSLQAAQQNRSLSRLRSLYMFGV-DRGFIDFVLG--C  570

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               +++ VLD+Q+T L   P ++    +LRYL+LR T+VK +P SI +L+ LE LDLKYT 
Sbjct  571   DIKLLNVLDMQATPLSRFPVQVVDCYYLRYLNLRHTEVKTIPTSIGRLQNLETLDLKYTN  630

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VT LPVEI KLQ L+HL+VY + + +YL Y    GFKA   +G L SL+KL Y+EAN   
Sbjct  631   VTRLPVEIFKLQKLQHLLVYRYANISYLCYKY--GFKALTEIGALQSLQKLCYIEANDER  688

Query  1621  GTI--EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
               I   E+GKL +L RL ILKLR EDG+A+CSSIEKL  L +L++ S+E+D +LD+ +L+
Sbjct  689   NDILMRELGKLTQLSRLGILKLRKEDGRALCSSIEKLTNLCALSVASVEDDEILDLQHLT  748

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPPPLLQR+YL G +  +P+W+ +L +LVK++ RWS+LKDDPL  LQ LPNL+HLE L  
Sbjct  749   SPPPLLQRIYLKGRLKTLPNWLVTLDSLVKLHLRWSRLKDDPLALLQSLPNLIHLELLQV  808

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             + G+ + F +  F+ LR+L LD  + LR+V + EGAMP LEKL+IQRC  L  +P+GIE 
Sbjct  809   FEGKTLCFKSKGFRKLRILGLDNFDGLRSVEVEEGAMPCLEKLIIQRCKLLEKLPSGIEY  868

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISE  2265
             L  LR LEFFDM D  +  F+  +  EDY K++HI E
Sbjct  869   LTKLRVLEFFDMPDQLVKKFMRHEHDEDYQKIAHIPE  905



>ref|XP_009373504.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009373505.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009373506.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Pyrus 
x bretschneideri]
Length=949

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/780 (51%), Positives = 531/780 (68%), Gaps = 8/780 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              DRR DALLL++ ++VG++ P+ +L+  L K     +V+SV GMGG GKTTL K VYDD 
Sbjct  152   QDRRGDALLLDKYDLVGLDEPKSQLVGWLFKGSSGREVVSVAGMGGMGKTTLAKQVYDDP  211

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF+  AWITV+++FK  ++L+DM+QQLF  +++ VP+ + +M+ N+LK  +KE L 
Sbjct  212   EVKKHFKVRAWITVNRSFKFGDLLRDMVQQLFKAIRRKVPQMVTNMSNNQLKTTIKELLQ  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSS-STDTNGYIYEMTP  534
             +R+Y+IV DDVW    W AIK+ LP    G R M++TR  DVA+++ S  + G  Y++ P
Sbjct  272   KRRYLIVLDDVWNLSEWNAIKYALPNNDCGSRIMLTTRKSDVATTAASVLSEGKAYDLKP  331

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             L    SW L CRKAF  + CP HL EI   +L++C GLPLAIVAIGGVLATK+   ++EW
Sbjct  332   LPPSESWDLFCRKAFQHNKCPPHLEEICNYVLRKCEGLPLAIVAIGGVLATKDTRRLDEW  391

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               +  SLG + EGND+   L+ +L LSFNDLP +LK C +YLSI+PEDHLIE   LI  W
Sbjct  392   DVVARSLGAEIEGNDKLNDLKKVLSLSFNDLPYFLKSCLLYLSIFPEDHLIERMRLIRLW  451

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGF++ K GKT+EEV E YL EL+NRSL+       DG +K  RIHDL REII+SKS 
Sbjct  452   VAEGFIEAKEGKTLEEVGEDYLQELLNRSLMQVATTTPDGRVKTCRIHDLLREIIISKSR  511

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             D NF T + E++  W E+ R LS+HGTL N Q  R  ++LRSL  F VT+    S     
Sbjct  512   DQNFTTILKEQSLQWSERVRRLSIHGTLQNVQPNRSVSQLRSLFMFGVTEQ--PSIPTLF  569

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              S  R++ VLD Q++ LE  P E+  L HL+YLSLR TKV+ +P+SI  L+ LE LDLK+
Sbjct  570   PSGFRLLNVLDFQNSPLEKFPVEVVDLYHLKYLSLRETKVETVPKSIGMLKNLETLDLKH  629

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             + V ELPVEILKL  LRHL+VY H   +Y  ++   GFK    +G L +L+KL +VE N 
Sbjct  630   SKVKELPVEILKLHRLRHLLVYLHEFESYEHFHSKKGFKVMPNIGVLQALQKLCFVEVNQ  689

Query  1615  -GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              G   I E+GKLN+L+RL +LKLR EDGKA+CSSIEKL  L +L++ S++ED ++D+ +L
Sbjct  690   DGRTIIRELGKLNQLRRLGLLKLRKEDGKALCSSIEKLTNLCALSIASVKEDEIIDLEHL  749

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  LQRLY+ G +  +PHWI  L +LV++  +WS+LKDDPL HL+ +PNLV LE + 
Sbjct  750   SSPPLFLQRLYMRGRLDALPHWIPMLPSLVRLSLKWSRLKDDPLIHLRHIPNLVQLELIQ  809

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              + G+ + F A  F  L++L LDKL+ELR + + +GAM  LEKL IQRC  L +VP+GIE
Sbjct  810   AFVGDRLCFRADGFGKLKILCLDKLDELRCIEVEKGAMACLEKLTIQRCKLLENVPSGIE  869

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
              L  L+ LEF DM  D I T   D  G+D  K+SHI E+Y TYW++G WEV S++  + G
Sbjct  870   HLTELKVLEFSDMPVDLIKTIRTD--GKDNSKISHIPELYSTYWREGGWEVYSIESMTDG  927



>ref|XP_007040755.1| Nbs-lrr resistance protein, putative [Theobroma cacao]
 gb|EOY25256.1| Nbs-lrr resistance protein, putative [Theobroma cacao]
Length=947

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/776 (50%), Positives = 532/776 (69%), Gaps = 8/776 (1%)
 Frame = +1

Query  16    SDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKK  189
             SDAL+L+  ++VGI+  ++ L+  L++ +P  KV+SVVGMGG GKTTLVK VYDD  VKK
Sbjct  157   SDALILDSADLVGIDESKELLVRWLVERNPGRKVLSVVGMGGLGKTTLVKQVYDDERVKK  216

Query  190   HFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKY  369
             HF  H WI +S  FK+E+ L++++QQLF+ +++PVPEG+  MN++ LKV++K FL + +Y
Sbjct  217   HFDVHVWIALSHPFKMEDFLRNIVQQLFSAIRKPVPEGIDDMNSDWLKVVIKPFLRQWRY  276

Query  370   VIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEV  549
             +IV D+VW    W A+ H   K     R MI+TR  DVA +S  +++  ++ + PLS + 
Sbjct  277   LIVLDNVWHINQWHAVNHAFAKNDSN-RVMITTRNTDVAIASCLESDDMVFNIEPLSSDY  335

Query  550   SWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYH  729
             SW L CR++F  ++CP +L E+ ++IL++C GLPLAIVAI G+L+TK  T   EW  +Y 
Sbjct  336   SWDLFCRRSFRGNTCPPYLVEVSRRILEKCEGLPLAIVAISGLLSTKTGTPA-EWETIYR  394

Query  730   SLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGF  909
             SLG   + ND+  +L  +L LSF  LP +LK CF+YLSI+P+++LIE   LI  W  EGF
Sbjct  395   SLGAIIKDNDKLMNLTEVLSLSFKYLPYHLKSCFLYLSIFPDNYLIERMRLIRLWIAEGF  454

Query  910   VKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFV  1089
             V+ K GKT EEVAE YL EL++RSL+       DG +K  RIHDL REII+SKS D NF 
Sbjct  455   VEVKEGKTQEEVAEDYLNELLSRSLVQVFGRTSDGRVKTCRIHDLLREIIISKSRDQNFA  514

Query  1090  TTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-SSC  1266
                 ++  AWP+K R LS+H +L N Q  R  + LRS   F V D   S+ +  +     
Sbjct  515   AIAKDKNGAWPDKVRRLSLHNSLQNVQHNRNVSHLRSFFMFEVEDPLLSAPLHSLYPDGF  574

Query  1267  RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVT  1446
             R++KVLDL++  L+  P EI  L  LRYLSLR TKV  +P SI KL+ L+ LDLK+T VT
Sbjct  575   RLLKVLDLRAARLQTFPGEIINLFLLRYLSLRETKVNSIPSSIGKLQNLQTLDLKHTNVT  634

Query  1447  ELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGT  1626
             ELPVEILKLQ LRHL+VY +    Y  ++   GFKA  G+G L SL+KL ++EA+  N +
Sbjct  635   ELPVEILKLQQLRHLLVYRYEFKYYSRFHSKYGFKALAGIGALQSLQKLCFIEADHRNAS  694

Query  1627  I-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPP  1803
             I EE+GKL +L+RL I+ LR EDG A+CSSI+KL  L++L++ S  +D V+D+++L+SPP
Sbjct  695   ILEEVGKLTQLRRLGIMNLRKEDGMALCSSIQKLTNLQALSVVSSVKDEVIDLHHLASPP  754

Query  1804  PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTG  1983
              LL+RLYL+G + ++P WI  L++LV +Y +WS+L+DDPL  LQ L NLVHLE L    G
Sbjct  755   QLLERLYLTGRLEQLPDWIPRLQSLVIVYLKWSRLEDDPLLSLQHLSNLVHLELLQVSIG  814

Query  1984  EHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFN  2163
             + + F AG FQ L++L +DK +ELR + + EGAMP +EKL I RC  L +VP GIE L  
Sbjct  815   DTLSFKAGGFQKLKVLGIDKFDELRCIEMEEGAMPVIEKLSILRCKSLETVPFGIEHLTT  874

Query  2164  LRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
             L+ LEFFDM ++ I T  P+ +G DY KV+ I EVYYTY +DG WEV S++  SSG
Sbjct  875   LKVLEFFDMPEELIKTLSPNAKGGDYRKVARIPEVYYTYCRDGEWEVYSLE--SSG  928



>ref|XP_010110397.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXC26229.1| Disease resistance protein RPM1 [Morus notabilis]
Length=949

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/789 (49%), Positives = 536/789 (68%), Gaps = 10/789 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R DALLL++ ++VGI+  +K+L+  L++     +V+S+ G GG GKTTL K VYDD  
Sbjct  154   DHRDDALLLDKSDLVGIDGRKKQLVGWLIEGGLGREVVSLAGQGGMGKTTLAKQVYDDAE  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK+F+  AWITVSQ+F++E++LKDM++QL+  +K+ VP  +G+MN N+LK  +K+ L R
Sbjct  214   VKKNFKVRAWITVSQSFEIEDLLKDMVEQLYKAIKRRVPPEVGNMNNNRLKTTIKKLLQR  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             ++Y+IV DDVW    W A+++ LP    G R +++TR  DVA+++  ++ G  Y + PL 
Sbjct  274   QRYLIVLDDVWHLHAWRAVQYALPNNSFGSRVVLTTRNTDVATTACIESEGKTYNLEPLP  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
                SW LLCRK F  + CP HL EI K ILKRC GLPLAIVAI GVLATK+   I+EW  
Sbjct  334   PSDSWDLLCRKTFQGNPCPPHLEEICKYILKRCEGLPLAIVAISGVLATKDTRRIDEWDM  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + +GND+ + L+ +L LSFNDLP YLK CF+YLSI+PEDHLIEH  LI  W  
Sbjct  394   VARSLGAEIDGNDKLKDLKKVLSLSFNDLPYYLKSCFLYLSIFPEDHLIEHMRLIRLWIA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGF++ K GK VEEVA+ YL +L+NRSL+       DG +K  RIHDL REII+SKS D 
Sbjct  454   EGFIEAKEGKVVEEVADDYLNDLLNRSLMQVATTTSDGRVKTFRIHDLLREIIISKSRDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             N V  +  +   W ++AR LSVH TL +    R  ++LRSL  F VT+ +   H      
Sbjct  514   NLVMVVKGQNVQWSDRARRLSVHYTLQHLLPNRSVSQLRSLFMFEVTE-KLRLH-TSFPG  571

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               R++ VLDLQ++ L+  P E+  L +L+YLSLR TKVK++PR I KL+ LE LDLK++ 
Sbjct  572   GFRLLSVLDLQNSHLKKFPVEVVNLYYLKYLSLRDTKVKIVPRFIGKLQNLETLDLKHSL  631

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VTELPVEILKL+ LRHL++Y     +Y  ++   GF+    +G L SL+KL ++E N G+
Sbjct  632   VTELPVEILKLKRLRHLLLYRSKFVSYELFDSRSGFRVMANIGVLQSLQKLCFIEVNQGS  691

Query  1621  GT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
             G  ++E+G LN+L+RL I+KLR EDGK +CSSI K+  LR+L++ S EE+ ++D+ +LS+
Sbjct  692   GNMVKELGNLNQLRRLGIVKLRREDGKVLCSSIGKMTNLRALSIASFEENEIIDLQHLST  751

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP LLQRLY+ G +  +PHWI SL +LVK+ F+WS+LKDDPL +LQ LPNL+HL     +
Sbjct  752   PPVLLQRLYMRGRLEMLPHWIPSLHSLVKLSFKWSRLKDDPLVYLQYLPNLLHLVLCQVF  811

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              G  + F AG F+ L++L LD+ +EL+ + +  GAM  LE L I+RC  L  VP+GIE L
Sbjct  812   NGHRLCFRAGGFKKLKILGLDEFDELKCIQVEPGAMTLLEDLSIRRCRFLEKVPSGIEHL  871

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG--  2331
               L+ LE  ++  +  +T  P+ +  +Y +V+HI EVY TYW++G W+V S++  S G  
Sbjct  872   TKLKLLELSNIPAELFNTLRPNVKDSEYWRVAHIPEVYSTYWREGEWKVYSLESLSDGEN  931

Query  2332  ---PETAVK  2349
                P T +K
Sbjct  932   CPLPSTVIK  940



>ref|XP_011028248.1| PREDICTED: uncharacterized protein LOC105128333 [Populus euphratica]
Length=1930

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/767 (50%), Positives = 522/767 (68%), Gaps = 3/767 (0%)
 Frame = +1

Query  19    DALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKH  192
             DALL+EE ++VGIE P+K+LI  LL   P  +VISVVGMGG GK+TLVK VYDD  +KKH
Sbjct  1138  DALLIEEADLVGIEKPKKQLIEWLLGSKPGREVISVVGMGGLGKSTLVKKVYDDSNMKKH  1197

Query  193   FQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYV  372
             F+  AW+TVSQ+FK E++LKDMIQQLF   ++P P+G+ SM+ NKL+ ++ EFL ++KY+
Sbjct  1198  FKFRAWVTVSQSFKREDLLKDMIQQLFRAHRKPDPKGVNSMDYNKLRSVIHEFLQQKKYL  1257

Query  373   IVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVS  552
             IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E S
Sbjct  1258  IVLDDVWHPSAWHAFQHALPHNNCGSRILVTTRNTEVASTSCMDSPDKVYPLNPLSQEES  1317

Query  553   WALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHS  732
             W L C+K F  + CP HL  + + IL RC GLPLAIVAI GVLATK+K+ I+EW  ++ S
Sbjct  1318  WTLFCKKIFQNNICPPHLKSVSETILDRCEGLPLAIVAISGVLATKDKSRIDEWEMVHRS  1377

Query  733   LGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFV  912
             LG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+  +LI  W  EGFV
Sbjct  1378  LGAGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMTLIRLWIAEGFV  1437

Query  913   KQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVT  1092
             K K G TVEEVA+ YL EL+ RSL+  VK   DG +K  RIHDL REI+++ + D  FV 
Sbjct  1438  KCKEGMTVEEVAQDYLNELMKRSLVQVVKTTTDGRVKTCRIHDLLREIMIAMAKDQGFVA  1497

Query  1093  TIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-CR  1269
                EE   WPEK R +S+H  + N Q ++  ++LRSLL F V D  + S V ++ SS  R
Sbjct  1498  IAREEGITWPEKVRRVSIHNAMPNKQRRQVASRLRSLLAFWVADCNYESPVRKLFSSRLR  1557

Query  1270  VIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTE  1449
             ++ VLDL+   L+  P+EI  L  L+YLSLR+TKV  +P +I +L+ LE LD+K+  V+E
Sbjct  1558  LLHVLDLEGAPLKEFPKEIVSLFLLKYLSLRNTKVNFIPSTISQLKNLETLDMKHALVSE  1617

Query  1450  LPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTI  1629
             LP EI KLQ L +L+VY     +        GFKAP  +G+L SL+KL +VEAN G   +
Sbjct  1618  LPAEIRKLQKLCYLLVYRFEIDSGDRIPTKYGFKAPAQIGRLLSLQKLCFVEANQGRNLM  1677

Query  1630  EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPL  1809
              E+G+L +L++L I+KL+ + GKA+CSS+E+L  LR+L+  SI E+ ++D++Y++SPP  
Sbjct  1678  FELGRLKQLRKLGIVKLKKKHGKALCSSVERLTNLRALSATSITENEIIDLDYVASPPQY  1737

Query  1810  LQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEH  1989
             LQRLYL G M K+P WI SL +LV++  +WS+L DDPL  LQ LPNLVHLE +  Y GE 
Sbjct  1738  LQRLYLGGRMKKLPDWISSLDSLVRLVLKWSQLNDDPLLSLQHLPNLVHLELVQVYNGEL  1797

Query  1990  MHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLR  2169
             + F A  FQ L+ L L+KLE LR + + +GAMP LEKL++Q C  L  VP+GIE L  L+
Sbjct  1798  LCFQAKGFQRLKFLGLNKLERLRMINVEQGAMPCLEKLIVQSCKSLRRVPSGIEHLSTLK  1857

Query  2170  YLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNS  2310
              LEFFDM  + + +  P+    DY KV+H+S+VY TYW +G W++ S
Sbjct  1858  VLEFFDMPKELVMSLHPNGEDGDYLKVAHVSDVYSTYWNNGNWDIFS  1904


 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/820 (47%), Positives = 526/820 (64%), Gaps = 4/820 (0%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             + + D LLLEE ++VGIE P+++LI  LL      +V+SVVGMGG GK+TLVK VYDD  
Sbjct  152   ESQGDGLLLEEADLVGIEKPKRQLIEWLLGKKSGREVVSVVGMGGLGKSTLVKKVYDDPD  211

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+  AWITVSQ+FK EE+LKD+IQQLF   ++P P+G+  M+ +KL+  + +FL +
Sbjct  212   VKKQFKFRAWITVSQSFKKEELLKDIIQQLFRVHRKPGPKGVDKMDYDKLRTEINKFLQQ  271

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             RKY+IV DDVW    W A +H LP    G R M++TR  +VAS++  D    ++ + PLS
Sbjct  272   RKYLIVLDDVWHTSAWGAFQHALPNNNCGSRIMVTTRNTEVASTACMDFPDRVFPLDPLS  331

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             +E SW L C+K F  ++CP HL  + + IL RC GLPLAIV+I GVLATK+K  I+EW  
Sbjct  332   QEESWILFCKKIFQNNTCPPHLKNVSETILGRCEGLPLAIVSISGVLATKDKNKIDEWEM  391

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             ++ SLG  FE ND   S R IL LS+NDLP YLK C +Y SI+P  + I    LI  W  
Sbjct  392   VHRSLGAGFENNDTLMSTRKILSLSYNDLPYYLKSCLLYFSIFPVGNPIGRMKLIRLWIA  451

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV+ K G T+EEVAE YL ELI RSL   V+   DG +K  RIHDL REI+++K+ D 
Sbjct  452   EGFVEGKEGMTLEEVAEDYLNELIKRSLARVVEATSDGRVKTCRIHDLLREIMITKAKDQ  511

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI-L  1257
             +FV    EE   W EKAR +S+H  + + Q +   ++LRS+L F   DS   S    +  
Sbjct  512   DFVAIAKEEGMMWSEKARRVSIHKAVPSIQRRHVASRLRSVLIFWGADSCPDSPAPNLSF  571

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                R++ VLDL+   L+  P ++  L  L+YLSLR+T V  +P SI KL  LE LDLK+T
Sbjct  572   GHLRLLNVLDLEGAPLKEFPSKVSSLFLLKYLSLRNTNVNSIPSSISKLLNLETLDLKHT  631

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              ++ELPVEILKL+ LRHL+VY +   +    +   GF+ P  +G L SL+KL +VEAN G
Sbjct  632   QISELPVEILKLRKLRHLLVYRYEIDSDDRIHTKYGFQPPPQIGSLQSLQKLCFVEANQG  691

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                + E+G+L++L+RL I++ R E GKA+CSS+ KL  LR+L++ +I +   +D+ YLSS
Sbjct  692   GDLLLELGRLSQLRRLGIVRFRKEHGKALCSSVTKLADLRALSITAITDSEFIDLEYLSS  751

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQRLYL+G    +P W+ SL +LVK+  +WS+L DDPL  LQ LPNL+HLE +  Y
Sbjct  752   PPRFLQRLYLTGRFRSLPEWLHSLDSLVKLVLKWSRLSDDPLLSLQHLPNLLHLELVQVY  811

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE + F A  FQ L+ L ++KLE LR + + +GAMP LEKL++Q C +L  VP+GIE L
Sbjct  812   DGEMLCFQAKGFQRLKFLGINKLESLRVITVQQGAMPCLEKLIVQSCKELKRVPSGIEHL  871

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGPE  2337
               L+ LEFF+M  + I T  P +   DY KV+H+ +VY TYW +G  +  ++     G  
Sbjct  872   TTLKVLEFFNMPKELIMTLQPSEENGDYLKVAHVPDVYSTYWNNGILDYFTLLTKEDGNC  931

Query  2338  TAVKISGRRNSL*FSTHGNSMKFLTLPSLNSLVKIHFRFT  2457
                  SG R    +    NS K    P+LN+ +K+  R +
Sbjct  932   ALSSPSGSRRDYIWK-RVNSQKHKPTPTLNTSIKLLPRVS  970



>ref|XP_004512454.1| PREDICTED: disease resistance protein RPM1-like [Cicer arietinum]
 gb|AHB79186.1| CC-NBS-LRR disease resistance protein [Cicer arietinum]
Length=954

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/798 (48%), Positives = 539/798 (68%), Gaps = 18/798 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D + DALLLEE ++VGIE P+K+L  +L KD+    VIS+ GMGG GKTTL K VYDD  
Sbjct  151   DSQGDALLLEEADLVGIEQPKKQLNDMLFKDESGRAVISIYGMGGLGKTTLAKQVYDDPK  210

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             V+K F+ HAW+ +SQ+ K+EE+LKD++QQL   + +P PE +G M + KLK ++K  L R
Sbjct  211   VQKRFRIHAWVNLSQSSKLEELLKDLVQQLHNVIGKPAPEAVGQMKSEKLKEVIKNLLQR  270

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y+IV DDVW A +W+A+K  LP    G R M++TR  D+A  S  +  G  + +  L 
Sbjct  271   SRYLIVLDDVWHANIWDAVKLALPNNDRGSRVMLTTRKKDIALYSCAEL-GKDFHLEFLP  329

Query  541   EEVSWALLCRKAFHA--SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             E+ +W+L CRK F    +SCP HL E+ K ILK CGGLPLAIVAI GVL+T+ +TNI +W
Sbjct  330   EQEAWSLFCRKTFQGDNNSCPPHLEEVCKNILKLCGGLPLAIVAISGVLSTRGRTNIEDW  389

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               +  S G + +GND+ E ++ ++ LSFN+LP YLK C +YLSI+PE H IE   LI  W
Sbjct  390   QMVCRSFGSEIQGNDKLEDMKKVISLSFNELPYYLKSCLLYLSIFPEFHAIEPMRLIRLW  449

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGF+  + GKT+EEVA+ Y+ EL+NRSL+  V    DG MK  R+HDL REI+  KS 
Sbjct  450   IAEGFINGEDGKTLEEVADSYIKELLNRSLLQVVGKTSDGRMKTCRMHDLLREIVSLKSR  509

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGT---KLRSLLTFNVTDS--QFSS  1239
             D NF T   ++   WPE+ R LSV  +  N  +++  T   +LRSLL F ++DS   FS 
Sbjct  510   DQNFATIAKDQDMVWPERVRRLSVINSSHNVLLQQNMTTLFQLRSLLMFALSDSLNSFSL  569

Query  1240  HVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEI  1419
             H +   +  + ++VLDLQ   LE  P EI  L  L+YLSL++TKVK +P SIKKL+ LE 
Sbjct  570   HELGS-NGLKWLRVLDLQDAPLEAFPVEIVNLYLLKYLSLKNTKVKNIPGSIKKLQYLET  628

Query  1420  LDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             L+LK T+VTELP EI +L+ LRHL+VY +   +Y  ++   GFK    +G + SL+KL +
Sbjct  629   LNLKQTYVTELPAEIAELKRLRHLLVYRYEIESYAYFHSRHGFKVAAPIGNMLSLQKLCF  688

Query  1600  VEANPGNGTIE-EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             +E + G+G +  E+GKL +L+RL I K+R +DG A+CSSIEK++ LRSL++ +I+ED ++
Sbjct  689   IEVDQGSGALMVELGKLTQLRRLGIRKMRQKDGAALCSSIEKMINLRSLSITAIDEDEII  748

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             D++ +S PP  LQ+LYLSG + K P WI SL+NLV+++ +WS+LK+DPL  LQDLPNL H
Sbjct  749   DIHDISKPPQYLQQLYLSGRLEKFPCWISSLKNLVRVFLKWSRLKEDPLVFLQDLPNLRH  808

Query  1957  LEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
             +EFL  Y GE MHFNA  F SL++L LD LE L++++I EGAM  L+KL+IQ+C    +V
Sbjct  809   VEFLQVYVGETMHFNAKGFPSLKVLGLDDLEGLKSMIIEEGAMQGLKKLIIQQCGSFKNV  868

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSV-  2313
             P GIE L  L+ +EFFDM  + I    P+  G+DY  V ++  +Y +YW+DG W+V S+ 
Sbjct  869   PLGIEHLTKLKNIEFFDMPKELIMALRPNV-GKDYWSVQNVPSIYSSYWRDGGWDVYSLE  927

Query  2314  ----QETSSGPETAVKIS  2355
                 QE+ S   +A++ S
Sbjct  928   TFGEQESDSNHSSAMRRS  945



>ref|XP_010650011.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Vitis 
vinifera]
 ref|XP_010650012.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Vitis 
vinifera]
Length=924

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/768 (51%), Positives = 529/768 (69%), Gaps = 7/768 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDVK  186
             D R DALL+EE E+VGI+ P+++LI +LL D    KV+SVVGMGG GKTTLVK VYDDVK
Sbjct  155   DSRGDALLVEESELVGIDKPKQKLIGMLLDDVSRTKVVSVVGMGGLGKTTLVKKVYDDVK  214

Query  187   --KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
               K FQ HAWITVS + K+E++L+D+IQQLF E  +PVP+G+G++NA++LK ++  FL +
Sbjct  215   VEKSFQHHAWITVSSS-KIEDLLRDLIQQLFEEGGKPVPQGIGTLNADRLKALLNYFLRQ  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             +KY+I+ D+VW   +WE++K+  P  + G R +++TR  D+A  S  +++G ++ + PL 
Sbjct  274   KKYIIILDNVWRIFMWESVKYAFPNSRRGSRILVTTRNSDIAGGSCVESDGDVFPLNPLP  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
                SW L CRKAF  ++CP HL ++ + ILKRC GL LAIVAIGGVLATK++  ++EW  
Sbjct  334   PTESWTLFCRKAFRRNACPPHLNKLSQGILKRCEGLSLAIVAIGGVLATKDQNRMDEWDI  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SL  + E ND+ E +  IL L +NDLP YLK CF+YLSI+PEDHLIEH  LI  W  
Sbjct  394   VDRSLSSELESNDKLERVNKILSLGYNDLPYYLKHCFLYLSIFPEDHLIEHKRLIRLWIA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV  + GK  EEVAE YL +L NR LI   + + DG +K  RIHDL R+II+SKS D 
Sbjct  454   EGFVVPQEGKMPEEVAESYLRDLTNRCLIQVAQRDVDGRIKTYRIHDLIRQIIISKSRDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             +FVT I E   A P KARHLS  GTL     +++   +RSLL F V DS   S +  + S
Sbjct  514   DFVTIIRENNTATPNKARHLSARGTLETC-TRQEFPGVRSLLIFGV-DSVSKSCMSALFS  571

Query  1261  SCR--VIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
               R  +++VLDL+   LE  PE +  L HLRYLSLR TKV +LP SI KL  LE LDLK 
Sbjct  572   GDRFGLLRVLDLRGLPLEKFPEGVVNLFHLRYLSLRGTKVDILPSSIGKLPYLETLDLKQ  631

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T V++LP EI KLQ+LRHL++Y  V  +Y+ ++   GF  P+ +G L  L+KL +VE   
Sbjct  632   TKVSKLPAEIQKLQNLRHLLLYRCVIVSYVTFHSKEGFLMPERIGDLQFLQKLCFVEPEQ  691

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             G  T+ E+GKL++L++L I+KLR EDG+++CSSIEK+  L SL++ S++E+ ++D+N+LS
Sbjct  692   GGHTLTELGKLSQLRKLGIIKLRKEDGRSLCSSIEKMKNLGSLDVTSLKEEEIIDLNHLS  751

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPP LL+ LYL G +  +P WI +L NL KI  RWS+LK++PLE LQ LPNLV L+ L  
Sbjct  752   SPPLLLKGLYLKGRLEDLPGWIPTLDNLSKISLRWSRLKNNPLEALQALPNLVQLQLLHA  811

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y GE + F AG FQ L+ L LD+LEELR V +  GA+  L++L I RC  L  +P GI+ 
Sbjct  812   YEGEALCFKAGGFQKLKSLKLDRLEELRKVSVEWGALTCLQELSILRCQALKQLPFGIQY  871

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCW  2298
             L  L+ L F+DM D+F  T L  ++G DY K+ HI +V++ Y ++G W
Sbjct  872   LSQLQQLCFYDMPDEFARTLLRAEQGYDYWKIKHIPKVFFIYSENGRW  919



>ref|XP_007040754.1| Nbs-lrr resistance protein, putative [Theobroma cacao]
 gb|EOY25255.1| Nbs-lrr resistance protein, putative [Theobroma cacao]
Length=946

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/779 (50%), Positives = 529/779 (68%), Gaps = 7/779 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R DALLL+  ++VGI+  + +LI+ L++ +   KVISVVGMGGSGKTTLVK VYD+  
Sbjct  153   DGRGDALLLDSVDLVGIDGSKVQLINWLVERNSGRKVISVVGMGGSGKTTLVKQVYDNAN  212

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNA-NKLKVIVKEFLL  357
             VKKHF  H W+T+S+ FK+EE+L++M++QLF  +++PVP+ +  MN+ + LK +VK+FL 
Sbjct  213   VKKHFDVHVWVTISRPFKIEELLRNMVRQLFDAIRKPVPKRVNDMNSVHDLKKVVKDFLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+IV DDVW    W+ + + L     G R +++TR   VAS+S  ++   ++ + PL
Sbjct  273   RRRYLIVLDDVWHMNEWDVVNYALANNDRGSRVLLTTRNSGVASTSCIESEDKVFNLEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L C+K F    CP  L +  ++IL++C GLPLAIVAIGGVLATK +T I EW 
Sbjct  333   PPDESWILFCKKCFRQEPCPPELEKHSRRILEKCEGLPLAIVAIGGVLATKRRT-IAEWE  391

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +Y SLG + E N +  + + +LLLSFNDLP +LK CF+YLSI+PE+HLIE   LI  W 
Sbjct  392   TVYLSLGAEIEDNSRLMNFKEVLLLSFNDLPYHLKSCFLYLSIFPENHLIESMRLIRLWI  451

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+ K GKT EEVAE YL EL+NRS+I      +DG +K  RIHDL REII+S + D
Sbjct  452   AEGFVEVKEGKTQEEVAEDYLNELLNRSMIQIAGTTNDGRVKTCRIHDLLREIIISNARD  511

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NFV    E  A WP+K R L++H    NAQ  R  + LRSLL F + D    S    + 
Sbjct  512   QNFVAVSKEHNATWPDKVRRLAIHNAFPNAQENRNVSHLRSLLMFGMGDPLSCSPTKTLF  571

Query  1258  -SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
                CR++KVLDL++  L+  P+E+  L  L YLSLR T +K +P SI KL+ LE LDLK+
Sbjct  572   PDGCRLLKVLDLRAAPLQTFPQEVINLKLLSYLSLRDTNIKTIPSSIVKLQALETLDLKH  631

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             + V+ LPVEIL+L+ LRHL+VY +   AY  ++   GF+A  G+G L SL+KL ++E N 
Sbjct  632   SQVSNLPVEILQLRRLRHLLVYRYEFTAYSRFHSKYGFQALSGIGALQSLQKLSFMEVNH  691

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
              +  I E+GKL +L+RL I  LR EDGK +CSSI+KL KLR+L++ S  ++  +D+ +LS
Sbjct  692   DDALIIELGKLVQLRRLGITNLRKEDGKLLCSSIQKLTKLRALSIVSSVKEEFVDLQHLS  751

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPP LLQRLYL G + K+P WI SL +LV +Y +WS+L DD LE LQ+LPNL+HLE L  
Sbjct  752   SPPQLLQRLYLYGRLEKIPDWIPSLHSLVVLYLKWSRLPDDALESLQNLPNLIHLELLQA  811

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
               G+ + F AG F  L++L +DK E L+ + + +GAMP LE L IQRC  L  VP GIE 
Sbjct  812   TQGDTLRFKAGGFTKLKILGIDKFEGLKCIEMEKGAMPCLENLSIQRCKLLERVPLGIEY  871

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
             L  L+ LEFFDM ++ I T LPD +  DY KV++I EV+YTYW++G WEV  ++  SSG
Sbjct  872   LAKLKVLEFFDMPEELIMTLLPDAQRGDYSKVANIPEVHYTYWRNGEWEVYFIE--SSG  928



>ref|XP_008373506.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
 ref|XP_008346479.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
Length=949

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/780 (50%), Positives = 530/780 (68%), Gaps = 8/780 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              DRR DALLL++ ++VG++ P+ +L+  L K     +V+SV GMGG GKTTL K VYDD 
Sbjct  152   QDRRGDALLLDKYDLVGLDEPKSQLVGWLFKGSSGREVVSVAGMGGMGKTTLAKQVYDDP  211

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF+  AWITV+++FK  ++L+DM+QQLF  +++ VP+ + +MN N+LK  +KE L 
Sbjct  212   EVKKHFKVRAWITVNRSFKFGDLLRDMVQQLFKAIRRQVPQMVANMNNNQLKTTIKELLQ  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSS-TDTNGYIYEMTP  534
             +R+Y+IV DDVW    W AIK+ LP    G R M++TR  DVA++++   + G  Y++ P
Sbjct  272   KRRYLIVLDDVWNLSEWNAIKYALPNNDCGSRIMLTTRKSDVATTAAGVLSEGKAYDLKP  331

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             L    SW L CR+AF  + CP HL EI   IL++C GLPLAIVAI GVLATK+   ++EW
Sbjct  332   LPXSESWDLFCRRAFQHNKCPPHLEEICNYILRKCEGLPLAIVAISGVLATKDTRRLDEW  391

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               +  SLG + EGND+   L+ +L LSFNDLP +LK CF+YLSI+PEDHLIE   LI  W
Sbjct  392   DVVARSLGAEIEGNDKLNDLKKVLSLSFNDLPYFLKSCFLYLSIFPEDHLIERMRLIRLW  451

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGF++ K GKT+EEV E YL EL+NRSL+       DG +K  RIHDL REII+SKS 
Sbjct  452   VAEGFIEAKEGKTLEEVGEDYLQELLNRSLMQVATTTPDGRVKTCRIHDLLREIIISKSR  511

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             D NF T + E++  W E+ R LS+HGTL N Q  R  ++LRSL  F VT+      +   
Sbjct  512   DQNFTTILKEQSLQWSERVRRLSIHGTLQNVQPNRSVSQLRSLFMFGVTEQPSIPRLFP-  570

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              S  R++ VLD Q++ LE  P E+  L +L+YLSLR TKV+ +PRSI KL+ LE LDLK+
Sbjct  571   -SGFRLLNVLDFQNSPLEKFPVEVVDLYYLKYLSLRETKVETVPRSIGKLKNLETLDLKH  629

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             + V +LPVEILKL  LRHL+VY H   +Y  ++   GFK    +G L +L+KL +VE N 
Sbjct  630   SKVKQLPVEILKLHRLRHLLVYLHEFESYEHFHSKNGFKVMPNIGVLQALQKLCFVEVNQ  689

Query  1615  -GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              G   I E+GKLN+L+RL +LKLR EDG+A+CSSIEKL  L +L++ S++ED ++D+ +L
Sbjct  690   DGRTIIRELGKLNQLRRLGLLKLRKEDGEALCSSIEKLTNLCALSIASVKEDEIIDLQHL  749

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  LQRLY+ G +  +P+WI  L +LV++  +WS+LKDDPL +LQ +PNLV LE + 
Sbjct  750   SSPPLFLQRLYMRGRLDALPYWIPMLPSLVRLSLKWSRLKDDPLIYLQHIPNLVQLELIQ  809

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              + G+ + F A  F  L++L LDKL+ELR + + +GAM  LEKL IQRC  L +VP+GIE
Sbjct  810   AFVGDRLCFRAYGFGKLKILTLDKLDELRCIEVEKGAMACLEKLTIQRCKLLENVPSGIE  869

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
              L  L+ LEF +M  D + T   D  G+D  KV HI E+Y TYW++G WEV S++    G
Sbjct  870   HLTELKVLEFSNMPVDLMKTICTD--GKDNSKVLHIPELYSTYWREGGWEVYSIESMMDG  927



>ref|XP_003612687.1| Disease resistance protein RPM1 [Medicago truncatula]
 gb|AES95645.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=949

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/813 (48%), Positives = 537/813 (66%), Gaps = 22/813 (3%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D + DALLL+E ++VGI+ P+K+L  LL  D+P  +VIS+ GMGG GKTTL K VYDD  
Sbjct  149   DSQGDALLLDEADLVGIDQPKKQLCDLLFNDEPKREVISIYGMGGLGKTTLAKQVYDDPK  208

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF+ HAW+ +SQ+ K+EE+LKD++Q+L     +P PE +G+MN + LK  ++ FL R
Sbjct  209   VKKHFRIHAWVNLSQSIKMEEILKDLVQKLHNVFGKPAPESIGTMNNDDLKKFIQNFLQR  268

Query  361   -RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              +KY+IV DDVW  +VW+ + H  P    G R M++TR  D+A  S     G  + +  L
Sbjct  269   SQKYLIVLDDVWHVKVWDGLNHAFPNNNRGSRVMLTTRKRDIALYSCAGL-GKDFHLEFL  327

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              E+ +W+L CRK F  +SCP HL E+ + ILK CGGLPLAIVAI G LATK ++NI EW 
Sbjct  328   PEKEAWSLFCRKTFQDNSCPPHLEEVCRNILKLCGGLPLAIVAISGALATKERSNIEEWQ  387

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  S G + EGND+ E +  ++ LS N+LP YLK C MYL+I+PE H +E   LI  W 
Sbjct  388   IVCRSFGSEIEGNDKLEDMNKVISLSLNELPSYLKSCLMYLTIFPEFHAMETWRLIRLWI  447

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV  + GKT+EEVA+ YL EL++RSLI  V+   DG MK  R+H L REI+ SKS D
Sbjct  448   AEGFVNGEDGKTLEEVADSYLKELLDRSLIQVVEKTSDGRMKTCRMHGLLREIVNSKSRD  507

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGT-KLRSLLTFNVTD--SQFSSHVV  1248
              NF T + E+   WPE+ R LSV     N   +   T  LRSLL F ++D  +QFS H +
Sbjct  508   QNFATIVKEQDMVWPERVRRLSVINPSHNVLQQNTTTFHLRSLLMFGLSDLLNQFSLHEL  567

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
                +  + + VLDLQ   L+  P EI  L  L+YLSL++TKVK +P SIK+L+ LE LDL
Sbjct  568   CSSNGVQFLNVLDLQDAPLDDFPAEIVNLYLLKYLSLKNTKVKNIPGSIKRLQNLETLDL  627

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K+T VTELPVEI +L+ LRHL+VY +   +Y  ++   GFK    +G + SL+KL ++E 
Sbjct  628   KHTSVTELPVEIAELKRLRHLLVYRYEIESYAKFHSRHGFKVAAPIGNMLSLQKLCFIEV  687

Query  1609  NPGNGTIE-EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             + G+  +  E+GKL +L+RL I K+R EDG A+CSSIEK++ LRSL++ +IEED V+D++
Sbjct  688   DQGSAALMVELGKLTQLRRLGIRKMRKEDGAALCSSIEKMIHLRSLSIFAIEEDEVIDIH  747

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              +S+PP  LQ+LYLSG + K P WI S +NL +++ +WSKL++DPL +LQ LPNL HLE 
Sbjct  748   DISNPPRYLQQLYLSGRLEKFPQWINSCKNLARVFLKWSKLEEDPLVYLQGLPNLRHLEL  807

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  Y GE +HFNA  F SL++L LD LE L+ + I EGAM  L+KLV+QRC+   +VP G
Sbjct  808   LQVYVGEMLHFNAKGFPSLKVLGLDYLEGLKYMTIEEGAMQGLKKLVMQRCSSFKNVPVG  867

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETS  2325
             IE L  L+ +EFFDM D+ I    P+  G+D+ +V ++  VY TYW++  W+V S+ ET 
Sbjct  868   IEHLAKLKAIEFFDMPDELIMDLRPNG-GKDFWRVQNVPTVYSTYWRNDGWDVYSL-ETF  925

Query  2326  SGPETAVKISGRRNSL*FSTHGNSMKFLTLPSL  2424
                E+ V             H  +M+ L LP+L
Sbjct  926   GDIESDV------------DHRIAMRTLQLPTL  946



>ref|XP_007158209.1| hypothetical protein PHAVU_002G133400g [Phaseolus vulgaris]
 gb|ESW30203.1| hypothetical protein PHAVU_002G133400g [Phaseolus vulgaris]
Length=941

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/789 (49%), Positives = 531/789 (67%), Gaps = 13/789 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D + DALLLEE ++VGI+ P++++  LL  ++    VI + GMGG GKTTL K VYDD  
Sbjct  148   DSQGDALLLEEADLVGIDKPKRQICDLLFNEELGRAVIPIYGMGGLGKTTLAKQVYDDPK  207

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+ HAWI VSQ+FK++E+LKD++QQL   + +P PE +G M +  LK ++K  L  
Sbjct  208   VKKRFRIHAWINVSQSFKLQELLKDLVQQLHNVIGKPAPEAVGQMKSEGLKEMIKNLLQS  267

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y+IV DDVW  RVW+++K  LP    G R M++TR  D+A  S  +  G  + +  L 
Sbjct  268   SRYLIVLDDVWHVRVWDSVKLALPNSNRGSRVMVTTRKKDIALYSCAEL-GKDFNLDFLP  326

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             EE +W L C+K F  +SCP HL E+ ++ILK CGGLPLAIVAIGG LATK + NI EW  
Sbjct  327   EEEAWYLFCKKTFQGNSCPPHLEEVCRKILKMCGGLPLAIVAIGGALATKGRANIEEWQM  386

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  S G + EGND+   +  +L LSFN+LP YLK C +YL+I+PE H IEH  LI  W  
Sbjct  387   VCRSFGSEIEGNDKLGDMNKVLSLSFNELPYYLKSCLLYLNIFPEFHAIEHMRLIRLWIA  446

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV  + GKT EEVA+ YL EL++RSL+  V    DG MK  R+HDL REI+  K+ D 
Sbjct  447   EGFVNGEDGKTREEVADSYLKELLDRSLLQVVAKTSDGRMKTCRMHDLLREIVNLKAKDQ  506

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF T   ++   WP+K R LS+  TL N Q  R   +LRSLL F+++DS  +  +  + S
Sbjct  507   NFATIAKDQDIIWPDKVRRLSIINTLHNVQKNRASFQLRSLLLFDLSDSLDNFSIRALCS  566

Query  1261  SC-RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             +  ++I+VLDLQ T LE+ P EIF L  L+YLSL++TKVK +P +IKKL+ LE LDLK T
Sbjct  567   TGYKLIRVLDLQDTPLEVFPAEIFSLYLLKYLSLKNTKVKSIPGTIKKLQQLETLDLKQT  626

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              VT LPVEI++LQ LRHL+VY +   +Y  ++   GFK    +G + SL+KL ++EA+  
Sbjct  627   LVTVLPVEIVELQQLRHLLVYRYEIESYAYFHSRHGFKVAAPIGLMKSLQKLCFIEAD--  684

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                + E+GKL +L+RL I K+R +DG A+CSSIEK++ LRSL++ +IE+  ++D++ +  
Sbjct  685   QALMVELGKLTQLRRLGIRKMRQQDGAALCSSIEKMINLRSLSITAIEDYEIIDIHNIFR  744

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PPP LQ+LYLSG +   PHWI SL+NLV+++ +WS+L++DPL HLQDLPNL HLEFL  Y
Sbjct  745   PPPYLQQLYLSGRLDTFPHWISSLKNLVRVFLKWSRLREDPLVHLQDLPNLRHLEFLQVY  804

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE ++F A  F SL++L LD L+EL+ + + EGAMP L+KL+IQRC  L  VP GIE L
Sbjct  805   VGETLNFKAKGFPSLKVLGLDDLDELKCMTVEEGAMPGLKKLIIQRCGSLKQVPLGIEHL  864

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ-----ET  2322
               L+ +EFFDM  + I+       GEDY +  H+  +Y +YW+DG W+V S++     ET
Sbjct  865   TKLKSIEFFDMPGELITRL--SSGGEDYLRAQHVPALYSSYWRDGGWDVYSLETLGERET  922

Query  2323  SSGPETAVK  2349
                  TA++
Sbjct  923   DFSRSTAMR  931



>ref|XP_007211004.1| hypothetical protein PRUPE_ppa020740mg, partial [Prunus persica]
 gb|EMJ12203.1| hypothetical protein PRUPE_ppa020740mg, partial [Prunus persica]
Length=903

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/757 (51%), Positives = 525/757 (69%), Gaps = 9/757 (1%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKD--DPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             + DALLLEE ++V I  P+++LI LL+++  D   + ++VVGMGG GKTTL K VY D  
Sbjct  150   QGDALLLEEADLVAIGEPKRQLIELLMQEGGDAGRQAVAVVGMGGLGKTTLAKQVYKDAR  209

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK+F+ HAWITVSQ+FK++E+L+ +++++F  +++PVPE   SM+ NKL+  +K+ L  
Sbjct  210   VKKNFKVHAWITVSQSFKIKELLRHIVEKIFKVIRKPVPEEFDSMDTNKLRERIKKLLQH  269

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y+IV DD+W    W+ I H LP   +G R MI+TR   VAS+S    +  +Y + PLS
Sbjct  270   SRYLIVLDDLWHIDAWDVINHALPN-NNGSRVMITTRNASVASASCMHNHVMVYHLEPLS  328

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW LLCRK F   SCP +L EI + IL +CGGLPLAIVAIG VLA K+K NI +W A
Sbjct  329   PEESWTLLCRKTFQEESCPPNLEEICRCILSKCGGLPLAIVAIGAVLAMKDKKNIEDWAA  388

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  S+G + E NDQ ++++ +L LSF+DLP +LK CF+YLSI+P+ +  E+  LI  W  
Sbjct  389   VCGSIGAEIEENDQLDNMKRLLYLSFSDLPYHLKSCFLYLSIFPDLYKFEYMRLIRLWIA  448

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV +K GKT EEVAE YL EL++RSLI   ++  DG +K  RIHDL REI++ KS + 
Sbjct  449   EGFVIEKEGKTPEEVAESYLKELLDRSLIEAEEIATDGRVKSCRIHDLLREIVVLKSREQ  508

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-  1257
             NF     E+   WPEK R LS+  TL N Q KR  +KLRSLL F V DS     + ++  
Sbjct  509   NFAAIEKEQGTMWPEKVRRLSIFNTLQNVQQKRIPSKLRSLLIFGVEDSLTEFSISKLFP  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                 ++ VLDL+   LE  P+E+  LL LRYLSLR TKVK +P SIKKL+ LE  DLK++
Sbjct  569   RGLPLLTVLDLEGAPLETFPKEVVNLLLLRYLSLRGTKVKQIPSSIKKLQNLETFDLKHS  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V ELP EIL L+ LRHL+VY +   +Y  +N   G K P G+  L SL+KL +VEAN  
Sbjct  629   HVVELPAEILNLKRLRHLLVYRYEVESYARFNSRYGVKVPAGICGLQSLQKLCFVEANQD  688

Query  1618  NGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             NG  + E+G++N+L++L I KLR EDG  +CSSIEK+  LRSL++ S+E+D ++D+ ++S
Sbjct  689   NGALVAELGRMNQLRKLGIFKLRQEDGVTLCSSIEKMRNLRSLSVSSVEKDKIIDLTHIS  748

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
              PP  LQRLYL+G +  +PHWI SL+N+V+++ +WS+LK+DPL HLQ LPNLVHLE L  
Sbjct  749   CPPQFLQRLYLTGRLENLPHWISSLQNVVRLFLKWSRLKEDPLVHLQGLPNLVHLELLQV  808

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y G+ +HF AG F SL+LL +DKL+EL+ V + +GAMP LEKL+IQRC  L  V +GIE 
Sbjct  809   YEGDCLHFKAGGFPSLKLLGIDKLDELKLVSMDKGAMPCLEKLIIQRCRLLKKV-SGIEH  867

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISE  2265
             L +L+ LEFFDM ++ I  F PD  GED+ KV+HI E
Sbjct  868   LQDLKLLEFFDMPNELIRPFHPDG-GEDHWKVAHIPE  903



>ref|XP_007210591.1| hypothetical protein PRUPE_ppa016482mg, partial [Prunus persica]
 gb|EMJ11790.1| hypothetical protein PRUPE_ppa016482mg, partial [Prunus persica]
Length=903

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/757 (51%), Positives = 526/757 (69%), Gaps = 9/757 (1%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKD--DPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             + DALLLEE ++V I  P+++LI LL+++  D   + ++VVGM G GKTTL K VY D  
Sbjct  150   QGDALLLEEADLVAIGEPKRQLIELLMQEGGDVGRQAVAVVGMAGLGKTTLAKQVYKDER  209

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK+F+ HAWITVSQ+FK++++L+ +++++F  +++PVPE   SM+ NKL+  +K+ L  
Sbjct  210   VKKNFKVHAWITVSQSFKIKKLLRHIVEKIFKVIRKPVPEEFDSMDTNKLRERIKKLLQH  269

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y+IV DD+W    W+ I H LP   +G R MI+TR   VAS+S  + +G +Y + PLS
Sbjct  270   SRYLIVLDDLWHIDDWDVINHALPN-NNGSRVMITTRNASVASASCMNNHGMVYHLEPLS  328

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW LLCRK F   SCP +L EI + IL +CGGLPLAIVAIG VLA K+K NI +W A
Sbjct  329   PEESWTLLCRKTFQEESCPPNLEEICRCILSKCGGLPLAIVAIGAVLAMKDKKNIEDWAA  388

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  S+G + E NDQ ++++ +L LSF+DLP +LK CF+YLSI+P+ +  E+  LI  W  
Sbjct  389   VCGSIGAEIEENDQLDNMKRLLYLSFSDLPYHLKSCFLYLSIFPDLYKFEYMRLIRLWIA  448

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV +K GKT EEVAE YL EL++RSLI   ++  DG +K  RIHDL REI++ KS + 
Sbjct  449   EGFVIEKEGKTPEEVAESYLKELLDRSLIEAEEIATDGRVKSCRIHDLLREIVVLKSREQ  508

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-  1257
             NF     E+   WPEK R LS+  T  N Q KR  +KLRSLL F V DS     + ++  
Sbjct  509   NFAAIEKEQGTMWPEKVRRLSIFNTFQNVQQKRIPSKLRSLLIFGVEDSLTEFSIPKLFP  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                 ++ VLDL+   LE  P+E+  LL LRYLSLR TKVK +P SIKKL+ LE  DLK++
Sbjct  569   RGLPLLTVLDLEGAPLETFPKEVVNLLLLRYLSLRGTKVKQIPSSIKKLQNLETFDLKHS  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V ELP EIL L+ LRHL+VY +   +Y  +N   G K P G+  L SL+KL +VEAN  
Sbjct  629   HVVELPAEILNLKRLRHLLVYRYEVESYARFNSRYGVKVPAGICGLQSLQKLCFVEANQD  688

Query  1618  NGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             NG  + E+G++N+L++L I KLR EDG  +CSSIEK+  LRSL++ S+E+D ++D+ ++S
Sbjct  689   NGALVAELGRMNQLRKLGIFKLRQEDGVTLCSSIEKMRNLRSLSVSSVEKDKIIDLTHIS  748

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
              PP  LQRLYL+G +  +PHWI SL+N+V+++ +WS+LK+DPL HLQ LPNLVHLE L  
Sbjct  749   CPPQFLQRLYLTGRLENLPHWISSLQNVVRLFLKWSRLKEDPLVHLQGLPNLVHLELLQV  808

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y G+ +HF AG F SL+LL +DKL+EL+ V++ +GAMP LEKL+IQRC  L  V +GIE 
Sbjct  809   YEGDCLHFKAGGFPSLKLLGIDKLDELKLVIMDKGAMPCLEKLIIQRCRLLKKV-SGIEH  867

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISE  2265
             L +L+ LEFFDM ++ I  F PD  GED+ KV+HI E
Sbjct  868   LQDLKLLEFFDMPNELIRPFHPDG-GEDHWKVAHIPE  903



>ref|XP_007210578.1| hypothetical protein PRUPE_ppa015762mg, partial [Prunus persica]
 gb|EMJ11777.1| hypothetical protein PRUPE_ppa015762mg, partial [Prunus persica]
Length=903

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/757 (51%), Positives = 524/757 (69%), Gaps = 9/757 (1%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKD--DPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             + DALLLEE ++V I  P+++LI LL+++  D   + ++VVGMGG GKTTL K VY D  
Sbjct  150   QGDALLLEEADLVAIGEPKRQLIKLLMQEGGDARRQAVAVVGMGGLGKTTLAKQVYKDAR  209

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK+F+ HAWITVSQ+FK++++L+ +++++F  +++PVPE +  M+ N+L+  +K+ L  
Sbjct  210   VKKNFKVHAWITVSQSFKIKKLLRHIVEKIFKVIRKPVPEEVDRMDTNQLRERIKKLLQH  269

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              KY+IV DD+W   VW+ I H LP  K G R MI+TR   VAS+S  + +  +Y   PLS
Sbjct  270   SKYLIVLDDLWHIDVWDVINHALPNNK-GSRVMITTRNASVASASCMNNHSMVYHKEPLS  328

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW LLCRK F   SCP +L +I + IL +CGGLPLAIVAIG VLA K+K NI +W A
Sbjct  329   PEDSWTLLCRKTFQEESCPPNLEDICRCILSKCGGLPLAIVAIGAVLAMKDKKNIEDWAA  388

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  S+G + E NDQ ++++ +L LSF+DLP +LK CF+YLSI+P+ +  E+  LI  W  
Sbjct  389   VCGSIGAEIEENDQLDNMKRLLYLSFSDLPYHLKSCFLYLSIFPDLYKFEYMRLIRLWIA  448

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV +K GKT EEVAE YL EL++RSLI   ++  DG +K  RIHDL REI++ KS + 
Sbjct  449   EGFVIEKEGKTPEEVAESYLKELLDRSLIEAAEIATDGRVKSCRIHDLLREIVVLKSREQ  508

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-  1257
             NF      +   WPEK R LS+  TL N Q KR  +KLRSLL F V DS     + ++  
Sbjct  509   NFAAIQKAQGTMWPEKVRRLSIFNTLQNVQQKRTPSKLRSLLIFGVEDSLTEFSIPKLFP  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                 ++ VLDL+   LE  P+E+  LL LRYLSLR TKVK +P SIKKL+ LE  DLK++
Sbjct  569   RGLPLLTVLDLEGAPLETFPKEVVNLLLLRYLSLRGTKVKQIPSSIKKLQNLETFDLKHS  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V ELP EIL L+ LRHL+VY +   +Y  +N   G K P G+  L SL+KL +VEAN  
Sbjct  629   HVVELPAEILNLKRLRHLLVYRYEVESYARFNSRYGVKVPAGICGLQSLQKLCFVEANQD  688

Query  1618  NGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             NG  + E+G++N+L++L I KLR EDG  +CSSIEK+  LRSL++ S+E+D ++D+ ++S
Sbjct  689   NGALVAELGRMNQLRKLGIFKLRQEDGVTLCSSIEKMRNLRSLSVSSVEKDKIIDLTHIS  748

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
              PP  LQRLYL+G +  +PHWI SL N+V+++ +WS+LK+DPL HLQ LPNLVHLE L  
Sbjct  749   CPPQFLQRLYLTGRLENLPHWISSLPNVVRLFLKWSRLKEDPLVHLQGLPNLVHLELLQV  808

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y G+ +HF AG F SL+LL +DKL+EL+ V + +GAMP LEKL+IQRC  L  V +GIE 
Sbjct  809   YEGDCLHFKAGGFPSLKLLGIDKLDELKLVSMDKGAMPCLEKLIIQRCRLLKKV-SGIEH  867

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISE  2265
             L +L+ LEFFDM ++ I  F PD  GED+ KV+HI E
Sbjct  868   LQDLKLLEFFDMPNELIKRFRPDG-GEDHWKVAHIPE  903



>ref|XP_008380435.1| PREDICTED: LOW QUALITY PROTEIN: disease resistance protein RPM1-like 
[Malus domestica]
Length=949

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/781 (48%), Positives = 522/781 (67%), Gaps = 11/781 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--D  180
             D RSDALLLE+ +IVGI+ P K+++  L+      +V+SV GMGG GKTT  K VYD  +
Sbjct  154   DHRSDALLLEKTDIVGIDEPIKQVVGWLVTGGSGREVVSVAGMGGLGKTTFAKQVYDAAE  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK+F+  AWITV+Q+FK+ E+L DMIQQL   +++PVPEG  +MN N+LK ++K FL +
Sbjct  214   VKKYFKVRAWITVTQSFKLGELLXDMIQQLHKAIRRPVPEGTNNMNNNQLKTMIKAFLQK  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV D+VW    W  +K+ +P    G R +++TR  DVAS++S ++ G ++ + PL 
Sbjct  274   RRYLIVLDNVWDMCGWXPLKYAMPNNTCGSRVILTTRKADVASTTSKESGGRVFNLEPLP  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             +  SW LLC+K F  +SCP  L E  K IL++C GLPLAIVA+ GVLATK+K  I+EW  
Sbjct  334   QLESWXLLCKKTFQGNSCPPXLEEXXKSILRKCEGLPLAIVAVSGVLATKDKXRIDEWDM  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EGN + + L+ +L LSFNDLP YLK CF+YLS++PEDH IE   L+  W  
Sbjct  394   VGHSLGAEMEGNXKLKDLKKVLSLSFNDLPXYLKSCFLYLSVFPEDHQIERMRLVRLWMA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGF++ K GKT+E+VAE YL EL+NRS+I   +   +G +K  R+H L+REII SK  D 
Sbjct  454   EGFIEAKQGKTLEDVAEDYLNELLNRSMIQAAETTIEGRVKSFRVHYLFREIITSKIRDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF T   E+   WP+K R LS+H +L   Q     ++LRSL  F VT++     +     
Sbjct  514   NFXTXAKEQNXPWPBKVRRLSMHTSLQYIQKNMSASQLRSLFMFGVTENPLLQTIFP--G  571

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               R++ VLDLQS+ L + P ++  L  L+YLSL+ T+VK +PR I KL+ LE LDLK++ 
Sbjct  572   GFRLLNVLDLQSSPLNVFPVDVVNLFFLKYLSLKGTRVKTIPRFIGKLQNLETLDLKHSL  631

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLP---YNCSPGFKAPkglgklgsleklVYVEAN  1611
             VTELPVEILKLQHLRHL+VY    + ++P    +   GFK    +G L  L+KL +++AN
Sbjct  632   VTELPVEILKLQHLRHLLVY---RYEFIPNGFLHSKYGFKVLPNIGALTCLQKLCFIKAN  688

Query  1612  PGNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                G I  E+GKL +L+RL I+ +R +DGKA+CSSIEKL KL +L++ S+EED ++D+ +
Sbjct  689   QDGGAILRELGKLIQLRRLGIVHMRKQDGKALCSSIEKLTKLHALSITSVEEDEIIDLQH  748

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             +SSPP LLQRLYL G +  +PHWI SL +LV+++ +WS+LKD+PL  LQ LP L+HLE  
Sbjct  749   ISSPPLLLQRLYLRGRLDTLPHWIPSLHSLVRLHLKWSRLKDNPLVFLQYLPILLHLELS  808

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               + G+ + F AG F+ L+ L + + +ELR + +  GAM  +EKL I  C  L  VP+GI
Sbjct  809   QVFEGDTLCFGAGGFKKLKHLGIGEFDELRCIEVQVGAMLSVEKLSITHCKSLEKVPSGI  868

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSS  2328
             E L  L+ LE F+M      T  P + G DY KV+H+ EVY+T  ++   EV  ++  + 
Sbjct  869   EHLNKLKVLELFNMPAKLFKTLSPHELGNDYWKVAHVPEVYFTNLRESRXEVYPLEGLNE  928

Query  2329  G  2331
             G
Sbjct  929   G  929



>ref|XP_004300178.1| PREDICTED: disease resistance protein RPM1-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=927

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/781 (50%), Positives = 517/781 (66%), Gaps = 37/781 (5%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DALLL++ ++VG++ PR +L+  L K  P  KV+S+ GMGG GK+TL K VYDD 
Sbjct  157   HDCRGDALLLDKSDLVGLDEPRNQLVGWLFKSSPGRKVVSLAGMGGMGKSTLAKQVYDDP  216

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKK+F+  AWITV+++FK  E+LKDM QQLF  +++ VP+ + SM+ N+LK  +KE L 
Sbjct  217   EVKKYFEVCAWITVNRSFKSGELLKDMAQQLFKAIRRRVPQVVTSMDNNQLKTTIKELLQ  276

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+Y+IV DDVW    W AI++ LP    G R M++TR  DVA+++   ++G +YE+ PL
Sbjct  277   QRRYLIVLDDVWDLCEWHAIQNALPNNSCGSRIMLTTRNADVAATTRVLSDGKVYELKPL  336

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
                 SW L CRKAF  + CP HL +I K ILK+C GLPLAIVAI GVLATK+   I+EW 
Sbjct  337   PPPESWDLFCRKAFRQNKCPPHLEDICKDILKKCEGLPLAIVAISGVLATKDIRRIDEWD  396

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + EGND+ + LR +L LSF+DLP +LK CF+YLSI+PE HLIE   LI  W 
Sbjct  397   MVGRSLGAEIEGNDKLKYLRKVLSLSFSDLPYFLKSCFLYLSIFPEGHLIERMRLIRLWV  456

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF++ K G+T+EEVA+ YL EL+NRSL+       DG +K+ RIHDL REII+SKS D
Sbjct  457   AEGFIEAKEGRTLEEVADDYLHELLNRSLMQVATTTPDGRVKKCRIHDLLREIIISKSRD  516

Query  1078  HNFVTTIDEET--AAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              NF T + E++  A W +K R LS+H TL                              Q
Sbjct  517   QNFTTIVKEKSVPAQWSDKMRRLSIHNTL------------------------------Q  546

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
              +   R++ VLDL S  L+  P  +  L  L+YLSLR TKVK +P+ I KL+ LE LDLK
Sbjct  547   TVQPNRLLNVLDLHSLPLKRFPVVVVDLYFLKYLSLRETKVKTVPKFIGKLQNLETLDLK  606

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             ++ V+ELP EILKLQ LRHL+VY H   +Y  +    GFK    +G L +L+KL  +E N
Sbjct  607   HSNVSELPDEILKLQRLRHLLVYKHEFVSYEQFGSKNGFKVTPKIGVLRALQKLCLIEVN  666

Query  1612  PGNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                GT I E+GKL +L+RL +LKLR  DGKA+CSSIEKL  LR+L++ S+EED ++D+ +
Sbjct  667   QDGGTIIRELGKLTQLRRLGLLKLRKADGKALCSSIEKLSNLRALSIASVEEDEIIDLQH  726

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             LSSPP LLQRLY+ G +  +PHWI SL +LV++  +WS+LKDDPL  L+ +PNLV LE  
Sbjct  727   LSSPPSLLQRLYMRGRLDALPHWIPSLPSLVRLSLKWSRLKDDPLISLRHIPNLVQLELC  786

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               + G+ + F A  F+ L++L+LDK +ELR + I  GAM  LEKL IQRC  L  VP+GI
Sbjct  787   QVFVGDKLCFKADGFRKLKILSLDKCDELRRIDIEMGAMDCLEKLSIQRCKLLEKVPSGI  846

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSS  2328
             E L  L+ LEF +M  D + T  PD  G+D  +VSHI EVY TYW++G WEV S+   + 
Sbjct  847   EHLLKLKVLEFSEMPVDLMKTIRPD--GKDNWRVSHIPEVYSTYWREGGWEVYSIDSMTD  904

Query  2329  G  2331
             G
Sbjct  905   G  905



>ref|XP_010056215.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=953

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/777 (47%), Positives = 516/777 (66%), Gaps = 9/777 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R +ALL++E ++VGIE P+ EL+  LL+     +VIS+VGMGG GKTTLVK VY+D 
Sbjct  153   QDHRGNALLVDETDLVGIEQPKNELVGRLLEGALGREVISIVGMGGLGKTTLVKQVYEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF ++AWIT+S + K+EE+L DM+ Q+   ++ PVP G  +MN++ LK I+K+ L 
Sbjct  213   AVKKHFMAYAWITLSGSSKIEELLTDMLDQIMKVIRTPVPPGAYTMNSHWLKTIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+I+ DD W    W+A+KH LP    G R +I+TR  D+AS++  + NG +  M PL
Sbjct  273   RRRYLIILDDAWCINEWDAVKHALPNNCQGSRVIITTRNADLASTTCKEFNGLVKNMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
                 SW L CRK F  +SCPS L EI + ILK+C GLPLAIVAI GVLA K+K  I EW 
Sbjct  333   DPAQSWELFCRKTFQGNSCPSPLEEICEYILKKCEGLPLAIVAISGVLAGKDKRRIYEWE  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + + ND+ ++L+ +L LSFNDLP YLK CF++LS++P+ H I+   LI  W 
Sbjct  393   LVRRSLRTEIDCNDKLKNLKRVLSLSFNDLPYYLKSCFLHLSLFPKGHRIKCQRLIRLWI  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT+EEVA+ Y  EL+NRSLI       DG +K  RIHDL ++II S+STD
Sbjct  453   AEGFVEKKEGKTLEEVAKDYFMELLNRSLIEVAAKQSDGRVKTCRIHDLLQDIITSRSTD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     EE   WP+K R LS+  TL         ++LRSL  F V  S  +S +    
Sbjct  513   QGFAEIAKEENHEWPDKIRRLSIQNTLQTLPRNWSLSQLRSLYLFGVEKSLMNSVLA---  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                +++ VLD+Q+  L   P ++     LRYLS RST+V  +PRSI KL+ LE LDLK+T
Sbjct  570   CDVKLLNVLDMQAAPLTRFPAQVADWCCLRYLSFRSTEVSTIPRSIGKLQNLETLDLKHT  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN--  1611
              VTELPVEILKLQ LRHL+VY + + +Y  +    GFKA +G+G L SL+KL Y+EA+  
Sbjct  630   NVTELPVEILKLQRLRHLLVYCYKNVSYSSFKF--GFKALRGIGALQSLQKLCYLEADDE  687

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
               +  I E+G L +L RL ILKLR EDG+ +C SI KL +LR++++ S+++D V+D+  +
Sbjct  688   SSSSVIRELGMLTQLDRLAILKLRKEDGRDLCLSISKLTRLRAISVASVDDDEVIDLQNV  747

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
              SPPP L+R+YL G +G +PHW+ SL +L+K+  R S+LK+DPL  L++LPNLVHLE L 
Sbjct  748   LSPPPFLERIYLRGRLGALPHWLPSLSSLMKLNLRCSRLKNDPLVPLENLPNLVHLELLQ  807

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + F A  F+ L+ L LD+ +EL +V + +GAMP+LE  +IQRC  L  +P+GIE
Sbjct  808   VYEGSSLCFKAESFKKLKTLALDQFDELMSVEVEKGAMPYLEMFIIQRCKLLEKLPSGIE  867

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQET  2322
              L  L  L+ FDM D+ +   +   + +DY KV+H+ ++YY +WKD  W+V  ++ +
Sbjct  868   YLKKLEVLKIFDMPDELVKKLVLGAQNDDYQKVAHVPQLYYGHWKDEGWDVQLIERS  924



>ref|XP_010054113.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW78489.1| hypothetical protein EUGRSUZ_D02632 [Eucalyptus grandis]
Length=947

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/796 (47%), Positives = 519/796 (65%), Gaps = 16/796 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R+DA+ +E+  +VGIE P+  L   L+   P  +VISV GMGG GKTTL K V+DD 
Sbjct  151   QDHRADAVFVEKSGLVGIEEPKTRLTQWLVGGIPEREVISVSGMGGLGKTTLAKQVFDDP  210

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL-  354
              V+KHF   AW+T+S + K EE+L DM+QQ+ + + +PVP G  +++ + LK+++K  L 
Sbjct  211   VVRKHFPVRAWVTLSPSSKTEELLMDMLQQIASRIMKPVPSGADTLDIDWLKMMIKRLLQ  270

Query  355   -LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMT  531
               R +Y+IV DDVW    W+A+K+ LP   HG R MI+TR  ++A +S T+  G +YEM 
Sbjct  271   GRRSRYLIVLDDVWHMDKWDAVKYALPNNNHGSRIMITTRNAELAQASCTEFVGKVYEMQ  330

Query  532   PLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             PL  E S  L CRK F  ++CPSHL EI   ILK+C GLPLAIVAI GVLATK+K  I+E
Sbjct  331   PLPVEQSQKLFCRKTFKKNACPSHLEEICTDILKKCEGLPLAIVAISGVLATKDKRRIDE  390

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W  +  SL  + +GND+ ++++ +L LSFNDLP YLK C + +S++PE + IE   L   
Sbjct  391   WDLVRRSLQSEIDGNDKLKNMKKVLSLSFNDLPYYLKSCLLQISVFPEAYAIERMRLTRH  450

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EGFV+ K  KT+EEVA+ YL EL+NRSLI  V+ + DG +K  RIH L R II SKS
Sbjct  451   WVAEGFVEMKDAKTMEEVADDYLNELVNRSLIHVVERDSDGRIKSCRIHGLLRRIITSKS  510

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              D NF   +DE+++ WP++ R  SVH  L   Q     + LRSL  F V   +FS + + 
Sbjct  511   RDQNFAAIVDEQSSVWPDRIRRCSVHNELQIGQQNLSLSHLRSLYIFGV--DKFSLYRI-  567

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             +    +++ VLDLQ+  L   P +I  +  +++LSLR T+++ LP S+ +L+ LE LDLK
Sbjct  568   LAGDLKLLSVLDLQNAPLRRFPVQIVDMRSVKFLSLRHTQIQTLPTSMGRLQNLETLDLK  627

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             +T V  LP+EI+KLQ L HL+VY + + +Y  Y    GF  P  +G L SL+KL Y++A+
Sbjct  628   HTHVISLPIEIMKLQRLCHLLVYRYQTVSYTHYKY--GFSTPAQIGALQSLQKLCYIDAD  685

Query  1612  PG--NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
                 N  I E+GKLN+L+RLCILKL+ EDG+ +C SI KL  L+SL + S+ +D  +D+ 
Sbjct  686   DDRTNNVISELGKLNQLRRLCILKLKKEDGRKLCWSIAKLTNLQSLAVYSLGDDEEIDLQ  745

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              LSSPPPLLQR+YL G M  +PHWI S+  L K++  W  LK+DPL  LQDLPNLVHLE 
Sbjct  746   NLSSPPPLLQRIYLRGRMRALPHWIASMHGLAKLHLSWCLLKEDPLPSLQDLPNLVHLEL  805

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  +  + + F A  FQ L++L LD  EEL  V I E AM +LEKL+IQRC QL S+P+G
Sbjct  806   LQVHDWQTLCFKAKGFQKLKILGLDYYEELTFVQIEEEAMSNLEKLMIQRCKQLKSMPSG  865

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ---  2316
             IE L  L+ LEFFDM ++       +++  DY KV+  +E+ Y YW+DG W+V SV+   
Sbjct  866   IEHLTKLKVLEFFDMPEELTEKLKLEEKDGDYQKVARAAELRYGYWRDGAWDVTSVERSG  925

Query  2317  -ETSSGPE-TAVKISG  2358
              E SS P+ T +K S 
Sbjct  926   KEQSSRPQDTTMKRSN  941



>ref|XP_004301646.1| PREDICTED: disease resistance protein RPM1-like [Fragaria vesca 
subsp. vesca]
Length=948

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/778 (48%), Positives = 517/778 (66%), Gaps = 6/778 (1%)
 Frame = +1

Query  13    RSDALLLEEDEIVGI-ENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             + D LLLE  +++ I E P+ +LI LL+K +P L+V+SVVGMGG GKTTLVK VY+D  V
Sbjct  153   QGDDLLLEAADLMAIREQPKNQLIELLMKHEPGLQVVSVVGMGGLGKTTLVKQVYEDPEV  212

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +K F+ HAWITVSQ+  + ++L+ MI  +F  +++P  E + SMN N+L+  +++ L + 
Sbjct  213   RKRFKVHAWITVSQSVSMNQLLRSMIHNIFQVIQKPPEEEVDSMNNNQLRERIQKLLQQS  272

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +Y+IV DD+W    W+ I  V+P  K G R M++TR+  VA +S   T G +Y + PLS 
Sbjct  273   RYLIVLDDLWQTDAWDVINKVIPNNKLGSRVMLTTRIHAVAQASCLGTQGMVYILEPLSV  332

Query  544   EVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
             E S  LL +  F A SCP  L  I   IL +CGGLPLAIVAIG VLA K+K NI+EW A+
Sbjct  333   EESRTLLYKMTFQADSCPQTLKGICDCILNKCGGLPLAIVAIGAVLAAKDKKNIDEWTAI  392

Query  724   YHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTME  903
               S+  + + NDQ E+++ +L LSF+DLP  LK CF+YLSI+P+ + IE   LI  W  E
Sbjct  393   CGSISAEIQQNDQLENMKELLYLSFSDLPYQLKSCFLYLSIFPDLYNIERMRLIRLWLAE  452

Query  904   GFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHN  1083
             GF+    GKT EEVAE YL EL++R LI   +   DG +K  RIH+  REI +SKS + N
Sbjct  453   GFLITMEGKTPEEVAESYLKELLDRCLIQAAETATDGRVKSYRIHNFLREIFISKSKEQN  512

Query  1084  FVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL-S  1260
             F   + E    WPEK R LS+  ++ N Q KR  + LRSLL F    S  +  + ++   
Sbjct  513   FAAVVKEGDTMWPEKVRRLSIVNSVQNVQKKRPPSTLRSLLIFGAEGSLTNLSIPKLFPK  572

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               +++ VLDLQ   +E+ P+E+F+L+ L++LSLR +KVK +P SIK LR L+ LDLK++ 
Sbjct  573   GLQLLTVLDLQGAHIEVFPKEVFKLVLLKFLSLRGSKVKQVPTSIKNLRYLQTLDLKHSH  632

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             V ELP EILKL+ LRHL+VY +   +Y  +N   G K P G+  L  L+KL  +EAN  N
Sbjct  633   VVELPSEILKLKQLRHLLVYRYEVESYAHFNSKYGVKVPAGICGLEKLQKLCKIEANQDN  692

Query  1621  -GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                +  +G L +L+RL ILKLR E+G A+C SI+K+  LR+L++ S++++ ++D+++LS 
Sbjct  693   YALMANLGSLTQLRRLGILKLRQENGTALCLSIQKMKNLRALSVSSVKKEGIIDLSHLSC  752

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
              P  LQRLYL+G +  +PHWI SL+NL +++ +WS+LK+DPL  LQ LPNLVHLE L  Y
Sbjct  753   APEFLQRLYLTGRLESLPHWISSLQNLARLFLKWSRLKEDPLVQLQGLPNLVHLELLQVY  812

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              G  +HF A  F SL+LL +DKLEEL++V I + AMP LEKL+IQRC  L  VP+GIE L
Sbjct  813   DGNSLHFEAKGFPSLKLLGIDKLEELQSVTIDKRAMPCLEKLIIQRCKLLKKVPSGIELL  872

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
              +L+ LE FDM D+FI    PD  GED+ KV+ I  VYY+YWK G W+V S+     G
Sbjct  873   TSLKLLECFDMPDEFIMALHPDG-GEDHQKVARIPAVYYSYWKGGGWDVYSLVNDGEG  929



>gb|KCW72843.1| hypothetical protein EUGRSUZ_E01295, partial [Eucalyptus grandis]
Length=899

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/753 (50%), Positives = 515/753 (68%), Gaps = 11/753 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R +ALLL++ ++VGIE P+ +L+  LL      +VISVVGMGG GKTTLV  VY+D 
Sbjct  153   QDHRGNALLLDKTDVVGIEQPKNDLVGQLLDGPQRREVISVVGMGGLGKTTLVNQVYEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF  +AWIT+S++ K+EE+LKDM+ Q+   +++PVP G  +MN++ LK+I+K+ L 
Sbjct  213   SVKKHFAVYAWITLSRSSKIEELLKDMLDQIMRVIRKPVPPGANTMNSHWLKMIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+IV DD W    W+A+KH LP    G R +++TR  ++AS++  + NG +  M PL
Sbjct  273   RRRYLIVLDDTWYINEWDAVKHALPNNGQGSRVILTTRNAELASTACKEFNGLVKNMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L CRK F  + CPSHL EI K ILK+C GLPLAIVAI GVLA K+K  I+EW 
Sbjct  333   DPEQSWKLFCRKTFQGNFCPSHLEEICKYILKKCEGLPLAIVAISGVLAAKDKRRIDEWD  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + +GN++ ++L+ +L LSF+DLP YLK CF++LS++PE HLIE   L   W 
Sbjct  393   VVRRSLRAEIDGNNRLKNLKRVLSLSFSDLPYYLKSCFLHLSVFPEGHLIERRRLTRLWV  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT++EVA+ Y  EL+NRSL+   +   DG +K  RIHD  REII SKS+D
Sbjct  453   AEGFVERKEGKTLDEVAKEYFGELLNRSLVQVAETTTDGRVKLCRIHDFQREIITSKSSD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              +F T   E+T  WP+K R LS+H +L  AQ  R  + LR+L  F V D  F   V+   
Sbjct  513   QSFATIAKEQTDMWPDKVRRLSLHNSLQAAQQNRSLSHLRALYMFGV-DGAFIDFVLG--  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                +++ VLD+Q+T L   P ++    +LRYLS R T++K +P SI +L+ LE LDLK+T
Sbjct  570   CDIKLLNVLDMQATPLSRFPVQVVDCYYLRYLSFRHTEIKTIPTSIGRLQNLETLDLKHT  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSP-GFKAPkglgklgsleklVYVEANP  1614
              VT LPV ILKL+ LRHL+VY + + +YL   C+  GFKA   +G L SLEKL Y+E + 
Sbjct  630   NVTRLPVGILKLRKLRHLLVYRYENISYL---CNKYGFKALTEIGALQSLEKLCYIEVDD  686

Query  1615  GNGTI--EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                 I   E+GKL +L RL ILKLR EDG+A+CSSI KL  L ++++ S+E+D +LD+ +
Sbjct  687   ERNDIIMRELGKLTQLSRLGILKLRKEDGRALCSSIAKLTNLCAISVASVEDDEILDLQH  746

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             L+SPP LLQR+YL G +  +P+W+ +L +LVK++ RWS+LKDDPL  LQ LPNLVHLE L
Sbjct  747   LTSPPQLLQRIYLKGRLEMLPNWLATLNSLVKLHLRWSRLKDDPLLPLQSLPNLVHLELL  806

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y G+ + F +  F+ LR+L LD  +ELR+V + EGAMP LEKL+IQRC  L  +P GI
Sbjct  807   QVYGGKTLCFKSKGFRKLRILGLDNFDELRSVEVEEGAMPCLEKLIIQRCKLLEKLPPGI  866

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCK  2247
             E L  L+ LEFFDM D+ + TF+  ++ EDY K
Sbjct  867   EYLTKLKVLEFFDMPDELVKTFVRGEQDEDYRK  899



>ref|XP_002303452.1| hypothetical protein POPTR_0003s09790g [Populus trichocarpa]
 gb|EEE78431.1| hypothetical protein POPTR_0003s09790g [Populus trichocarpa]
Length=1006

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/826 (46%), Positives = 507/826 (61%), Gaps = 63/826 (8%)
 Frame = +1

Query  19    DALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKH  192
             DALL+EE ++VGIE P+K+LI  LL      +VISVVGMGG GK+TLVK VYDD  VKKH
Sbjct  156   DALLIEEADLVGIEKPKKQLIEWLLGSKTGREVISVVGMGGLGKSTLVKRVYDDSNVKKH  215

Query  193   FQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYV  372
             F+  AW+TVSQ+FK E++LKDMIQQLF   ++P P+G+ SM+ NKL+ ++ EFL ++KY+
Sbjct  216   FKFRAWVTVSQSFKREDLLKDMIQQLFRVHRKPDPKGVNSMDYNKLRSVIHEFLQQKKYL  275

Query  373   IVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVS  552
             IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E S
Sbjct  276   IVLDDVWHPSAWHAFQHALPNNICGSRILVTTRNTEVASTSCMDSPDKVYPLNPLSQEES  335

Query  553   WALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHS  732
             W L C+K F  + CP HL  + + IL RC GLPLAIVAI GVLATK+K+ I+EW  ++ S
Sbjct  336   WTLFCKKIFQNNICPPHLKSVSETILDRCEGLPLAIVAISGVLATKDKSRIDEWEMVHRS  395

Query  733   LGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFV  912
             LG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+  +LI  W  EGFV
Sbjct  396   LGAGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMTLIRLWIAEGFV  455

Query  913   KQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVT  1092
             K K G TVEEVA+ YL EL+ RSL+  VK   DG +K  RIHDL REI+++ + D +FV 
Sbjct  456   KGKEGMTVEEVAQDYLNELMKRSLVQVVKTTTDGRVKTCRIHDLLREIMIAMAKDQDFVA  515

Query  1093  TIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-CR  1269
                EE   WPEK R +S+H  + N Q ++  ++LRSLLTF V D  + S V ++ S   R
Sbjct  516   IAREEGITWPEKVRRVSIHNAMPNKQRRQVASRLRSLLTFWVADCNYESPVRKLFSGRLR  575

Query  1270  VIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTE  1449
             ++ VLDL+   L+  P+EI  L  L+YLSLR+TKV  +P +I +L+ LE LD+K   V+E
Sbjct  576   LLHVLDLEGAPLKEFPKEIVSLFLLKYLSLRNTKVNFIPSTISQLKNLETLDMKRALVSE  635

Query  1450  LPVEILKLQHLRHLIVY----------------------------SHVSFAYLPYNCSPG  1545
             LP EI KLQ L +L+VY                            S  SF      C   
Sbjct  636   LPAEIRKLQKLCYLLVYRFEIDSDDRIVGDSGSPMRGPGVHPWCCSTCSFVN-KGGCQLQ  694

Query  1546  FKAPkglgklgsleklVYVEANP-------GNGTIEEIGKLNELKRLC------------  1668
                               +  NP       G    ++IG+L  L++LC            
Sbjct  695   LFFNNAAAAAIVNGCCTLMATNPTRIPTKYGFKAPDQIGRLQSLQKLCFVEANQGRNLMF  754

Query  1669  ------------ILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLL  1812
                         I+KL+ + GKA+CSS+E+L  LR+L+  SI E+ ++D++Y++SPP  L
Sbjct  755   ELGRLKQLRKLGIVKLKKKHGKALCSSVERLTNLRALSATSITENEIIDLDYVASPPQYL  814

Query  1813  QRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHM  1992
             QRLYL G M K+P WI SL +LV++  +WS+L DDPL  LQ LPNLVHLE +  Y GE +
Sbjct  815   QRLYLGGRMEKLPDWISSLDSLVRLVLKWSQLNDDPLVSLQHLPNLVHLELVQVYNGELL  874

Query  1993  HFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRY  2172
              F A  FQ L+ L L+KLE LR + + +GAMP LEKL++Q C  L  VP+GIE L  L+ 
Sbjct  875   CFQAKGFQRLKFLGLNKLERLRMITVEQGAMPCLEKLIVQSCKSLRRVPSGIEHLSTLKV  934

Query  2173  LEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNS  2310
             LEFFDM  + + T  P+    DY KV+H+ +VY TYW +G W++ S
Sbjct  935   LEFFDMPKELVMTLHPNGEDGDYLKVAHVPDVYSTYWNNGNWDIFS  980



>ref|XP_004300174.1| PREDICTED: disease resistance protein RPM1-like [Fragaria vesca 
subsp. vesca]
Length=951

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/792 (48%), Positives = 532/792 (67%), Gaps = 13/792 (2%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             + +ALLLEE ++V I   +K+LI LL+K D   +V+ VVGM G GKTTLVK VY+D  V+
Sbjct  153   QGEALLLEEADLVAIGEHKKQLIELLMKGDTGRQVVPVVGMAGLGKTTLVKQVYEDPKVQ  212

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEG--MGSMNANKLKVIVKEFLLR  360
             K F+ HAWITVS++ K+ ++L+ MI ++F  + +P PE   + +M+ N+L+  +K+ L  
Sbjct  213   KRFKVHAWITVSRSVKINQLLRRMINKIFRVITKPDPEDEEVETMDDNQLRERIKKLLQN  272

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSS-TDTNGYIYEMTPL  537
              +Y+IV DD+W  + W AI HV+P    G R M++TR ++VAS+S   +    IY + PL
Sbjct  273   SRYLIVLDDIWHIQDWVAINHVMPNNDRGSRVMLTTRNVNVASASCLGNPADMIYRLQPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S E SW L C+K FH  SCP +L    + IL +C GLPLAIVAIG VLA K+K  ++EW 
Sbjct  333   SPEDSWTLFCKKTFHGESCPPNLEGFCQCILMKCRGLPLAIVAIGAVLALKDKRIVDEWA  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
             A+  S+G +  GNDQ +S++ +L LS+ DLP +LK CF+YLSI+P+ + IEH  LI  W 
Sbjct  393   AVCGSIGAEIAGNDQLDSMKKLLYLSYRDLPYHLKSCFLYLSIFPDFYKIEHMKLIRLWL  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV  K G+T EEVAE YL EL+NRSLI   + + DG +K  RIHDL  EII+  S +
Sbjct  453   AEGFVIGKEGRTPEEVAESYLRELLNRSLIQAAETSTDGRVKSYRIHDLLLEIIILMSRE  512

Query  1078  HNF--VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              NF  +     +    P+K R LS+  TL N    R  ++LRSLL F V DS     + +
Sbjct  513   QNFAAIEKGQGQGTICPDKVRRLSIVNTLQNVCQTRTPSRLRSLLVFGVEDSLADFPIPK  572

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             +L + +++ VLDL+   L++ P E+ +LL LRYLSLR TKVK +P SIKKL+ LE LDLK
Sbjct  573   LLPNLQLLTVLDLEGARLDMFPSEVVKLLLLRYLSLRHTKVKQIPSSIKKLQNLETLDLK  632

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             ++ V ELP EIL L+ LRHL+VY +   +Y  +N   G K P G+  L SL+KL ++EAN
Sbjct  633   HSHVVELPAEILNLKRLRHLLVYRYEVESYARFNARKGVKIPAGICGLQSLQKLCFIEAN  692

Query  1612  PGNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
               +G +  E+G++N+L+RL I KLR E G  +CSS++K+  LRSL++ S E+D ++++++
Sbjct  693   QYSGALMAELGRMNQLRRLGIYKLRAEHGVTLCSSVQKMTNLRSLSVSSTEKDKIIELSH  752

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             +S  PP LQRLYL+G +  +P WI  L+NLV+++ +WS LK+DPL HLQ LPNLVHLE L
Sbjct  753   ISHTPPFLQRLYLTGRLENLPRWISRLQNLVRLFLKWSHLKEDPLVHLQGLPNLVHLELL  812

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y GE +HF+AG F SL+LL +DKL+EL+ V I EGAMP LEKL+IQRC  L  VP GI
Sbjct  813   QVYDGESLHFDAGGFPSLKLLGIDKLDELQLVTIEEGAMPQLEKLIIQRCESLKKVPHGI  872

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWE----VNSVQ  2316
             E L +L+ LEFFDM D+FI+   PD  G D+ KV+H+  VYY+YW+ G W+    VN V+
Sbjct  873   EHLNSLKLLEFFDMPDEFITALNPDD-GGDHWKVAHVPAVYYSYWRGGGWDVYSLVNDVE  931

Query  2317  ETSSGPETAVKI  2352
               + G     ++
Sbjct  932   SINPGTSAVRRL  943



>ref|XP_010054114.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Eucalyptus 
grandis]
Length=928

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/783 (47%), Positives = 509/783 (65%), Gaps = 15/783 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R+DA+ +E+  +VGIE P+  L   L+   P  +VISV GMGG GKTTL K V+DD 
Sbjct  151   QDHRADAVFVEKSGLVGIEEPKTRLTQWLVGGIPEREVISVSGMGGLGKTTLAKQVFDDP  210

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL-  354
              V+KHF   AW+T+S + K EE+L DM+QQ+ + + +PVP G  +++ + LK+++K  L 
Sbjct  211   VVRKHFPVRAWVTLSPSSKTEELLMDMLQQIASRIMKPVPSGADTLDIDWLKMMIKRLLQ  270

Query  355   -LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMT  531
               R +Y+IV DDVW    W+A+K+ LP   HG R MI+TR  ++A +S T+  G +YEM 
Sbjct  271   GRRSRYLIVLDDVWHMDKWDAVKYALPNNNHGSRIMITTRNAELAQASCTEFVGKVYEMQ  330

Query  532   PLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             PL  E S  L CRK F  ++CPSHL EI   ILK+C GLPLAIVAI GVLATK+K  I+E
Sbjct  331   PLPVEQSQKLFCRKTFKKNACPSHLEEICTDILKKCEGLPLAIVAISGVLATKDKRRIDE  390

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W  +  SL  + +GND+ ++++ +L LSFNDLP YLK C + +S++PE + IE   L   
Sbjct  391   WDLVRRSLQSEIDGNDKLKNMKKVLSLSFNDLPYYLKSCLLQISVFPEAYAIERMRLTRH  450

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EGFV+ K  KT+EEVA+ YL EL+NRSLI  V+ + DG +K  RIH L R II SKS
Sbjct  451   WVAEGFVEMKDAKTMEEVADDYLNELVNRSLIHVVERDSDGRIKSCRIHGLLRRIITSKS  510

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              D NF   +DE+++ WP++ R  SVH  L   Q     + LRSL  F V   +FS + + 
Sbjct  511   RDQNFAAIVDEQSSVWPDRIRRCSVHNELQIGQQNLSLSHLRSLYIFGV--DKFSLYRI-  567

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             +    +++ VLDLQ+  L   P +I  +  +++LSLR T+++ LP S+ +L+ LE LDLK
Sbjct  568   LAGDLKLLSVLDLQNAPLRRFPVQIVDMRSVKFLSLRHTQIQTLPTSMGRLQNLETLDLK  627

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslekl--VYVE  1605
             +T V  LP+EI+KLQ L HL+VY + + +Y  Y    GF  P  +G L SL+KL  +YV+
Sbjct  628   HTHVISLPIEIMKLQRLCHLLVYRYQTVSYTHYKY--GFSTPAQIGALQSLQKLCCIYVD  685

Query  1606  ANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
              +  N  I E+G+LN+L+RLCILKL+ EDGK +C SI  L  L++L++     D  +D+ 
Sbjct  686   DDRTNNVISELGQLNQLRRLCILKLKKEDGKRLCWSIANLTNLQALSVHPSGNDEDIDLQ  745

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              LS PPPLLQR+YL G M  +PHWI ++ +LVK++ RW  LK+DPL  LQDLPNLVHLE 
Sbjct  746   DLSCPPPLLQRIYLKGRMRALPHWIANMHSLVKLHLRWCLLKEDPLPSLQDLPNLVHLEL  805

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  +  + + F A  FQ L++L LD  EEL  V I E AM +LEKL+IQRC +L S+P+G
Sbjct  806   LQVHDWQTLCFKAKGFQKLKILGLDYYEELTFVQIEEEAMSNLEKLIIQRCKRLKSMPSG  865

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETS  2325
             IE L  L+ L+FFD   +       D+R EDY KV+H+ E+ Y YW+DG W+V   + + 
Sbjct  866   IEHLTKLKVLQFFDTPKE----LQLDERDEDYQKVAHVPELRYGYWRDGAWDVTVTKRSD  921

Query  2326  SGP  2334
               P
Sbjct  922   LPP  924



>ref|XP_010058435.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=941

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/777 (48%), Positives = 519/777 (67%), Gaps = 9/777 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R +A+LL++ ++VGIE P+ EL+  LL      +VIS+VGMGG GKTTLV+ V++D 
Sbjct  153   QDHRGNAVLLDKTDLVGIEQPKNELVGQLLDWGLRREVISIVGMGGLGKTTLVRQVFEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK+HF  HAWIT+ ++ K+EEVL+DM+ Q+   +++PVP G  +M ++ LK+I+K+ L 
Sbjct  213   AVKEHFTVHAWITLCRSSKIEEVLQDMLDQIIRVIRKPVPHGANTMTSHWLKMIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+IV DD+W    W+AIKH  P   HG R +I+TR  D+AS+S  + NG   +M PL
Sbjct  273   RRRYLIVLDDIWHINEWDAIKHAFPTNGHGSRVIITTRNADLASTSCKEFNGQEKKMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L CRK F  +SCPSHL EI K IL++C GLPLAIVAI GVLA+K++  I EW 
Sbjct  333   DPEQSWELFCRKTFQGNSCPSHLEEICKYILRKCEGLPLAIVAISGVLASKDRWRIYEWE  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + + ND+ ++L+ +L LSFNDLP YLK CF++LS++PE   I    LI  W 
Sbjct  393   LVRRSLHIEIDCNDKLKNLKRVLSLSFNDLPYYLKSCFLHLSLFPEGCPINRRRLIRLWV  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT+EEVA+ Y  EL+NRSLI       DG +K  RIHD  R+II  KS D
Sbjct  453   AEGFVEKKEGKTLEEVAKDYFVELLNRSLIEVASKRSDGRVKYCRIHDFLRDIITLKSID  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     EE   WP+K RHLS+  T    Q     ++LRSL TF +  S F + V  + 
Sbjct  513   QGFAEISKEENHEWPDKVRHLSIQNTPQALQKNLSWSRLRSLYTFGIERS-FMNEV--LA  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  +++ VLDLQ+  L   P ++    +L+YLS R T+V  +P SI KL+ LE LDLK+T
Sbjct  570   SDMKLLNVLDLQAAPLTRFPAQVADWCYLKYLSFRFTEVSTIPSSIGKLQNLETLDLKHT  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN--  1611
              VTELP EILKL+ LRHL+VY + + +Y  +    GF+  +G+G L SL+KL Y+EA+  
Sbjct  630   KVTELPFEILKLRRLRHLLVYRYKNISYSSFEF--GFRVFRGIGALQSLQKLCYIEADDE  687

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
               N  I E+G L +L RL ILKLR EDG+ +C SI KL +LR++++ S+++D ++D+ +L
Sbjct  688   SRNSVIRELGMLTQLDRLAILKLRKEDGRDLCLSISKLTRLRAISVASVDDDEIIDLQHL  747

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPPP LQR+YL G +G +PHW+ SL +L K++ R S LKDDPL  L++LPNL+HLE L 
Sbjct  748   SSPPPFLQRIYLRGRLGALPHWLPSLISLTKLHLRHSHLKDDPLISLKNLPNLMHLELLQ  807

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + F A  F+ LR+L LD  +ELR + + +GAMP+LEK +IQRC  L  +P+GIE
Sbjct  808   VYEGSSLCFEAKAFKKLRILGLDHFDELRCIDVEKGAMPYLEKFIIQRCKLLEKLPSGIE  867

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQET  2322
              L  L+ LE FDM D+ I   +   + ++Y KV+H+  VY+ YW+DG W+V  ++ +
Sbjct  868   HLTKLKVLEIFDMPDELIKKLVQGGQDDEYQKVAHVPHVYFGYWRDGGWDVQLMERS  924



>ref|XP_010056221.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=947

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/809 (46%), Positives = 518/809 (64%), Gaps = 22/809 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             ++ +++A  L++ E+VGIE P+K+LI  L++     +VISVVGMGG GKTTLV  VY+D 
Sbjct  153   HEHQNNAFFLDKTELVGIEEPKKQLIGWLVEGTSKRQVISVVGMGGLGKTTLVNQVYEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF     ITVS +  + E+L DM+QQ+   +++P+P G  + N   LK+I+K+ L 
Sbjct  213   EVKKHFTICTRITVSGSPNIGELLHDMLQQIMRVIRKPIPSGAETTNLYWLKMIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             R  Y++V DD W    W+A+KH LP    G R +I+TR  D+A +S  +  G  Y+M PL
Sbjct  273   RMSYLVVLDDTWRIDEWDAVKHALPNNTCGSRIIITTRNADLAYTSCREFKGRFYKMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C+K F  +SCPSHL E  + IL++C GLPLAIVAI GVLATK++  I+EW 
Sbjct  333   PVEHSWKLFCKKTFQVNSCPSHLKESCEFILRKCEGLPLAIVAISGVLATKDRHRIDEWE  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + + ND+ ++L+ +L LSFNDLP YLK CF++LS++PE H I+   LI  W 
Sbjct  393   LVCRSLRSEIDCNDKLKNLKRVLSLSFNDLPYYLKACFLHLSLFPEGHPIKRRRLIRLWV  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT E+VA+ Y  EL+NRSLI       DG +K  RIHD  R+II S+STD
Sbjct  453   AEGFVEKKEGKTHEQVAKDYFMELLNRSLIEVASKRSDGRVKTCRIHDFLRDIITSRSTD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     EE   WP++ R LS+   L         ++LRSL  F V  S  +S +    
Sbjct  513   QGFAEIAKEENREWPDRVRRLSIQNNLQTLPRNWSLSQLRSLYIFGVDKSLMNSVLA---  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  +++ VLD+Q+  L   P ++    +LRYLS R T+V  +P SI KL+ LE LDLK+T
Sbjct  570   SDMKLLTVLDMQAAPLTRFPAQVADWCYLRYLSFRFTEVSTIPSSIGKLQNLETLDLKHT  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              VTELPVEILKLQ LRHL+VY + + +Y   +   GFKA +G+G L SL+KL Y+EAN  
Sbjct  630   NVTELPVEILKLQRLRHLLVYRYKNVSY--SSSKFGFKALRGIGALQSLQKLCYLEANDE  687

Query  1618  NGT--IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             N +  I E+G L +L RL ILK R EDG+ +C SI KL +LR++++ S+++D ++D+ +L
Sbjct  688   NSSSVIRELGMLTQLDRLAILKFRKEDGRDLCLSISKLTRLRAISIASLDDDEIIDLQHL  747

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  LQR+YL G +G +PHW+ SL +L+K++ R S+LKDDPL  LQ+LPNLVHLE L 
Sbjct  748   SSPPSFLQRIYLRGRLGALPHWLPSLSSLMKLHLRCSRLKDDPLVSLQNLPNLVHLELLQ  807

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + F A  F+ LR L LD  +ELR V + +GAMP LEKL+IQRC  L  +P+GIE
Sbjct  808   VYEGSSLCFKAKTFRKLRTLGLDYFDELRCVEVEKGAMPFLEKLIIQRCKLLKKLPSGIE  867

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
              L  L+ LE FDM D+ +   +   + +D+ KV+ + E+YY YW+D  W+V  + E S  
Sbjct  868   HLTRLKVLEIFDMPDELVKKLVQGGQDDDFQKVARVPEIYYGYWRDEGWDVQLI-ERSVQ  926

Query  2332  PETAVKISGRRNSL*FSTHGNSMKFLTLP  2418
              + A            ST G SM+    P
Sbjct  927   KDVA------------STQGTSMRSDEFP  943



>ref|XP_010271941.1| PREDICTED: disease resistance protein RPM1-like [Nelumbo nucifera]
Length=1434

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/786 (49%), Positives = 536/786 (68%), Gaps = 22/786 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DALLLEE ++VGIE P++++I  LLK+   L+V++VVGMGGSGKTTLVK VYDD 
Sbjct  658   HDLRGDALLLEEADLVGIEKPKEKIIGWLLKNSLMLRVVAVVGMGGSGKTTLVKRVYDDQ  717

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK HF+SH WITVSQ+FK +EVL+DMI+QLF E  Q +P G+ +M   +LK+I+KEFL 
Sbjct  718   RVKTHFESHVWITVSQSFKTDEVLRDMIEQLFEECNQSIPGGVEAMKETRLKLILKEFLK  777

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +R+YV+VFDD+W+ + WE++K+  P  KHG R +I+TR  D+ASS      G++Y + PL
Sbjct  778   QRRYVLVFDDIWSNQAWESVKYACPDGKHGSRIIITTRSDDIASSC-IKPYGHLYHLKPL  836

Query  538   SEEVSWALLCRKAFHASSCPS---HLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
             S E SW L C KAF + + P     L  + + I++RC GLPLAIVAIGG+L+TK K N+ 
Sbjct  837   SPEESWTLFCEKAFGSKNEPDLTHQLQGLSRSIMRRCEGLPLAIVAIGGLLSTKLK-NVI  895

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  +Y +LG + E ND+  S++ IL LS++DLP +LK C +YL ++PED LIE   LI 
Sbjct  896   EWQMVYRNLGIELESNDKLRSMKKILSLSYDDLPYHLKSCILYLGVFPEDELIEPMRLIR  955

Query  889   QWTMEGFVK-QKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILS  1065
              W  EGF++  + G+T+EE+ E Y ++LINR+LI  +  + DG ++  RIH + +EI+LS
Sbjct  956   LWMAEGFIQGDEQGRTMEEIGEVYFYDLINRNLIQILNRHTDGRVRTCRIHSVMKEIVLS  1015

Query  1066  KSTDHNF--VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTF--NVTDSQF  1233
             K+ + NF  +  +DE      +K R LS+H        K+   +L SL  F  N+    F
Sbjct  1016  KAREENFGEIVVVDELNTQLYDKVRRLSIHNGCEKILEKKSFARLHSLFMFQANIPSISF  1075

Query  1234  S-SHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRM  1410
             S +H     S  R++KVL+L+   LE+ P E+  L HLRYLSLR TKVK +P SI  L  
Sbjct  1076  SCAH----FSGFRLLKVLELRDAPLEVFPAEVVNLFHLRYLSLRGTKVKRIPVSIGNLEN  1131

Query  1411  LEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslek  1590
             L+ LDL+Y  V++LP+ ILKLQ LRHL+V+ + S AY+ ++  PGF+AP+G+  L +L+ 
Sbjct  1132  LQTLDLRYAPVSKLPIGILKLQKLRHLLVHQYNSKAYIKFH-HPGFRAPRGIENLETLQS  1190

Query  1591  lVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDV  1770
             L ++EAN G+  I+E+G+L +L+RL ILK+R E+G  +CSS+EK+  LRSL L + EED 
Sbjct  1191  LCFIEANQGSHMIKELGRLRQLRRLGILKIRRENGIDLCSSLEKITNLRSLFLTAAEEDE  1250

Query  1771  VLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNL  1950
             +L++++LSSPPP LQRLY+ G + K P WI SL NLVK+Y  WS+++DDPLE L+ LPNL
Sbjct  1251  MLELHFLSSPPPFLQRLYIKGRLEKPPDWIPSLHNLVKLYLSWSRMRDDPLEALEALPNL  1310

Query  1951  VHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLA  2130
             + L  L  Y GE + F+AG FQ L+ L LD+LEELR V + EGAMP L++L I  C  L 
Sbjct  1311  MKLWLLHAYEGEELCFHAGGFQKLQFLMLDQLEELRLVRVEEGAMPRLQRLCIWSCRLLK  1370

Query  2131  SVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNS  2310
              VP GIECL NL+ L   DM+++F    L     EDY +V+ I  VY+ +W++G W+ + 
Sbjct  1371  VVPLGIECLTNLKELHLSDMSNEFKIMLL----SEDYWRVAKIQLVYFYFWENGGWKRDR  1426

Query  2311  VQETSS  2328
             V   SS
Sbjct  1427  VHTVSS  1432


 Score =   117 bits (292),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 97/145 (67%), Gaps = 0/145 (0%)
 Frame = +1

Query  1774  LDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLV  1953
             L +  +S+PP  LQRL L G++  MP WI  L +LV+I  +WSKL+D+P+E LQDLP+L+
Sbjct  262   LHLQTMSNPPIHLQRLDLKGHLQSMPRWISELHDLVRIRLKWSKLEDNPIEALQDLPSLM  321

Query  1954  HLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
              L+ L  Y G+ + F   KF+ L++L  ++L +LR V + +G +P+L+KLVI+ C  L +
Sbjct  322   ELQLLDAYIGDQLDFMQKKFKKLKILEFEQLCQLRTVRMYKGTLPNLQKLVIRCCPLLRA  381

Query  2134  VPAGIECLFNLRYLEFFDMTDDFIS  2208
             VP GI  L  L+ LE  DM + FI+
Sbjct  382   VPRGIAYLTQLKELELQDMDETFIN  406


 Score = 82.0 bits (201),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 0/110 (0%)
 Frame = +1

Query  652  LAIVAIGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCF  831
            +AI  IG ++ +     + +WG L  +LG +   N+   S+  +L LSF +L      CF
Sbjct  136  IAIDQIGKLVRSNKSKTMFDWGKLDDTLGFELASNEHLSSITELLSLSFINLSYQFTYCF  195

Query  832  MYLSIYPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRS  981
            +YL I+P  + +    LI  W  EGF++Q +G+T EEVAE YL  LI R+
Sbjct  196  LYLGIFPRGYSVSCRRLIRLWIAEGFIQQTSGRTFEEVAEDYLNYLIERN  245



>gb|KCW72839.1| hypothetical protein EUGRSUZ_E01291, partial [Eucalyptus grandis]
Length=902

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/755 (48%), Positives = 501/755 (66%), Gaps = 9/755 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R +ALL++E ++VGIE P+ EL+  LL+     +VIS+VGMGG GKTTLVK VY+D 
Sbjct  153   QDHRGNALLVDETDLVGIEQPKNELVGRLLEGALGREVISIVGMGGLGKTTLVKQVYEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF ++AWIT+S + K+EE+L DM+ Q+   ++ PVP G  +MN++ LK I+K+ L 
Sbjct  213   AVKKHFMAYAWITLSGSSKIEELLTDMLDQIMKVIRTPVPPGAYTMNSHWLKTIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+I+ DD W    W+A+KH LP    G R +I+TR  D+AS++  + NG +  M PL
Sbjct  273   RRRYLIILDDAWCINEWDAVKHALPNNCQGSRVIITTRNADLASTTCKEFNGLVKNMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
                 SW L CRK F  +SCPS L EI + ILK+C GLPLAIVAI GVLA K+K  I EW 
Sbjct  333   DPAQSWELFCRKTFQGNSCPSPLEEICEYILKKCEGLPLAIVAISGVLAGKDKRRIYEWE  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + + ND+ ++L+ +L LSFNDLP YLK CF++LS++P+ H I+   LI  W 
Sbjct  393   LVRRSLRTEIDCNDKLKNLKRVLSLSFNDLPYYLKSCFLHLSLFPKGHRIKCQRLIRLWI  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT+EEVA+ Y  EL+NRSLI       DG +K  RIHDL ++II S+STD
Sbjct  453   AEGFVEKKEGKTLEEVAKDYFMELLNRSLIEVAAKQSDGRVKTCRIHDLLQDIITSRSTD  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     EE   WP+K R LS+  TL         ++LRSL  F V  S  +S +    
Sbjct  513   QGFAEIAKEENHEWPDKIRRLSIQNTLQTLPRNWSLSQLRSLYLFGVEKSLMNSVLA---  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                +++ VLD+Q+  L   P ++     LRYLS RST+V  +PRSI KL+ LE LDLK+T
Sbjct  570   CDVKLLNVLDMQAAPLTRFPAQVADWCCLRYLSFRSTEVSTIPRSIGKLQNLETLDLKHT  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN--  1611
              VTELPVEILKLQ LRHL+VY + + +Y  +    GFKA +G+G L SL+KL Y+EA+  
Sbjct  630   NVTELPVEILKLQRLRHLLVYCYKNVSYSSFKF--GFKALRGIGALQSLQKLCYLEADDE  687

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
               +  I E+G L +L RL ILKLR EDG+ +C SI KL +LR++++ S+++D V+D+  +
Sbjct  688   SSSSVIRELGMLTQLDRLAILKLRKEDGRDLCLSISKLTRLRAISVASVDDDEVIDLQNV  747

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
              SPPP L+R+YL G +G +PHW+ SL +L+K+  R S+LK+DPL  L++LPNLVHLE L 
Sbjct  748   LSPPPFLERIYLRGRLGALPHWLPSLSSLMKLNLRCSRLKNDPLVPLENLPNLVHLELLQ  807

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + F A  F+ L+ L LD+ +EL +V + +GAMP+LE  +IQRC  L  +P+GIE
Sbjct  808   VYEGSSLCFKAESFKKLKTLALDQFDELMSVEVEKGAMPYLEMFIIQRCKLLEKLPSGIE  867

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSH  2256
              L  L  L+ FDM D+ +   +   + +DY KV+H
Sbjct  868   YLKKLEVLKIFDMPDELVKKLVLGAQNDDYQKVAH  902



>ref|XP_010054112.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
 gb|KCW78488.1| hypothetical protein EUGRSUZ_D02631 [Eucalyptus grandis]
Length=949

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/796 (46%), Positives = 522/796 (66%), Gaps = 14/796 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R DALL+E+ ++VGIE P+KEL+  L++     +VISVVGMGG GKTTLVK VYDD 
Sbjct  153   QDHRGDALLVEKSDLVGIEEPKKELVEWLVQGASQCQVISVVGMGGLGKTTLVKQVYDDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKK F + AW+T+S + + +E+L DM+QQ+ + + + +P    +  ++ +++++K+FL 
Sbjct  213   AVKKRFTARAWVTLSPSSRTDELLSDMLQQIASSITKTLPSEAETSKSSCVRMVIKDFLQ  272

Query  358   RR--KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMT  531
              R  KY+IV DDVW    W+A+K  +P   +G R M++TR  D+AS+S T  +G +Y M 
Sbjct  273   ERRLKYLIVLDDVWDMNKWDAVKCAIPNNNNGSRIMVTTRKSDLASASGTGCSGKVYNMK  332

Query  532   PLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             PLS E S  L CRK F   +CPSHL EI +QILK+C GLPLAIVAI GVLATK+   I+E
Sbjct  333   PLSSEQSHELFCRKTFKEKACPSHLEEICRQILKKCEGLPLAIVAISGVLATKDIRRIDE  392

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W  +  SL  + +GN++ ++L+ +L LSFNDLP YLK CF++LSI+PE  ++E   +I  
Sbjct  393   WELVLRSLRSEIDGNEKLKNLKQVLSLSFNDLPYYLKSCFLHLSIFPEALVVERMRIIRL  452

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EGFV++K GKT+EEVAE YL EL+NRSLI   +   DG +K+ R+HDL  EII+ K+
Sbjct  453   WVAEGFVERKEGKTLEEVAEDYLDELLNRSLIQVAETTSDGRVKKCRVHDLLLEIIIPKA  512

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              D N+     E    WPE+ R LS+H     A+  R  + LRSL  F V +    S VV 
Sbjct  513   RDQNYAIIDHEHRGPWPERVRRLSIHKAFQIARENRSLSCLRSLFMFCVDE----SCVVD  568

Query  1252  ILSS-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              LSS   ++ VL+L+   +   P ++  +  LR+LSLRS+ ++ LP SI  L+ LE LDL
Sbjct  569   ALSSELNLLSVLNLEHAPVSRFPGQVLNMKCLRFLSLRSSCIRTLPSSIGNLQNLETLDL  628

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K T V  LPVEI KLQ LRHL+VY + + +Y  +N   GFK P  +G L SL+KL Y+E 
Sbjct  629   KGTHVVALPVEIAKLQRLRHLLVYRYETISY-THN-KYGFKTPADIGALRSLQKLCYIEV  686

Query  1609  -NPGNG-TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
              +  NG  I  +GKLN+L+RLC+LKLR EDG+ +CSSI KL  L SL + ++ +D  +++
Sbjct  687   DDERNGRNITGLGKLNQLRRLCVLKLRREDGRNLCSSIAKLTNLSSLAVYAL-DDQEIEL  745

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
              +LSSPP LLQR++L G++  +P WI +  +LV +Y + S L+DDPLE L++LP+LVHLE
Sbjct  746   RHLSSPPRLLQRIFLRGHLETLPSWIANHHSLVILYLKMSCLRDDPLESLRNLPSLVHLE  805

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
              L  Y  + + F A  F  L++L LD  EEL  + + + AMP LEKL + RC     +P 
Sbjct  806   LLHAYNWQTLCFKAKGFMKLKILGLDLFEELEFIQVEKEAMPCLEKLTVLRCKLFKDLPL  865

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQET  2322
             GIE L  L+ LEFFD+ D+ +    PDK+ EDY KV+H+ E++Y YW++  W+V S++ T
Sbjct  866   GIEHLNMLKVLEFFDLPDELVQKLKPDKQNEDYQKVAHVPEIHYGYWREQGWDVTSIETT  925

Query  2323  SSGPETAVKISGRRNS  2370
                  + ++ S +R +
Sbjct  926   VEEEGSRLQSSSKRGN  941



>ref|XP_002303451.2| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
 gb|EEE78430.2| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
Length=946

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/765 (48%), Positives = 505/765 (66%), Gaps = 3/765 (0%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             + + D LLLEE ++VGIE P+++LI  LL+     +V+SVVGMGG GK+TLVK VYDD  
Sbjct  152   ESQGDGLLLEEADLVGIEKPKRQLIEWLLERKSGREVVSVVGMGGLGKSTLVKKVYDDPD  211

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+  AWITVSQ+FK EE+LKD+IQQLF   ++P P+G+ SM+ +KL+ ++ +FL +
Sbjct  212   VKKQFKFRAWITVSQSFKKEELLKDIIQQLFRVHRKPGPKGVDSMDYDKLRTVINKFLQQ  271

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             +KY+IV DDVW    W A +H LP    G R M++TR  +VAS++  D    +  + PLS
Sbjct  272   KKYLIVLDDVWHTSTWGAFQHALPNNNCGSRIMVTTRNTEVASTACMDFPDRVLPLDPLS  331

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             +E SW L C+K F  ++CP HL  + + IL RC GLPLAIV+I GVLA K+K  I+EW  
Sbjct  332   QEESWILFCKKIFQNNTCPPHLKNVSETILGRCEGLPLAIVSISGVLAAKDKNKIDEWEM  391

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             ++ SLG  FE ND   S R IL LS+NDLP YLK C +Y SI+P  + IE   LI  W  
Sbjct  392   VHRSLGAGFENNDTLMSTRKILSLSYNDLPYYLKSCLLYFSIFPAGNPIERMKLIRLWIA  451

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV+ K   T+EEVAE YL ELI RSL+  V+   DG +K  RIHDL REI+++K+ D 
Sbjct  452   EGFVEGKEVMTLEEVAEDYLNELIKRSLVRVVEATSDGRVKTCRIHDLLREIMITKAKDQ  511

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI-L  1257
             +FV    EE   W EK R +S+H  + + Q +   ++LRS+L F   DS   S    +  
Sbjct  512   DFVAIAKEEGMVWSEKVRRVSIHKAVPSIQRRHVPSRLRSVLIFWGADSCPDSPAPNLSF  571

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                R++ VLDL+   L+  P ++  L  L+YLSLR+T V  +P SI KL  LE LDLK+T
Sbjct  572   GHLRLLNVLDLEGAPLKEFPSKVSSLFLLKYLSLRNTNVNSIPSSISKLLNLETLDLKHT  631

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              ++ELPV ILKL+ LRHL+VY +   +    +   GF+ P  +G L SL+KL +VEAN G
Sbjct  632   QISELPVGILKLRKLRHLLVYRYEIDSDDRIHTKYGFQPPPQIGSLQSLQKLCFVEANQG  691

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                + E+G+LN+L+RL I++ R E GKA+CSS+ KL  LR+L++ SI +   +D+ YLS+
Sbjct  692   GDLLLELGRLNQLRRLGIVRFRKEHGKALCSSVTKLTDLRALSITSITDSEFIDLEYLSN  751

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQRLYL+G +  +P W+ S  +LVK+  +WS+L DDPL  LQ LPNLVHLE +  Y
Sbjct  752   PPRFLQRLYLTGRLQSLPEWLHSSDSLVKLVLKWSRLSDDPLLSLQHLPNLVHLELVQVY  811

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE + F A  FQ L+ L ++KLE LR + + +GAMP LEKL++Q C +L  VP+GIE L
Sbjct  812   DGEMLCFQAKGFQRLKFLGINKLESLRVITVQQGAMPCLEKLIVQSCKELKRVPSGIEHL  871

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDG  2292
               L+ LEFF+M  + I T  P +   DY KV+H+ +VY TYW +G
Sbjct  872   TTLKVLEFFNMPKELIMTLQPSEENGDYLKVAHVPDVYSTYWNNG  916



>gb|ABF81450.1| NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=946

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/765 (48%), Positives = 505/765 (66%), Gaps = 3/765 (0%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             + + D LLLEE ++VGIE P+++LI  LL+     +V+SVVGMGG GK+TLVK VYDD  
Sbjct  152   ESQGDGLLLEEADLVGIEKPKRQLIEWLLERKSGREVVSVVGMGGLGKSTLVKKVYDDPD  211

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+  AWITVSQ+FK EE+LKD+IQQLF   ++P P+G+ SM+ +KL+ ++ +FL +
Sbjct  212   VKKQFKFRAWITVSQSFKKEELLKDIIQQLFRVHRKPGPKGVDSMDYDKLRTVINKFLQQ  271

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             +KY+IV DDVW    W A +H LP    G R M++TR  +VAS++  D    +  + PLS
Sbjct  272   KKYLIVLDDVWHTSTWGAFQHALPNNNCGSRIMVTTRNTEVASTACMDFPDRVLPLDPLS  331

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             +E SW L C+K F  ++CP HL  + + IL RC GLPLAIV+I GVLA K+K  I+EW  
Sbjct  332   QEESWILFCKKIFQNNTCPPHLKNVSETILGRCEGLPLAIVSISGVLAAKDKNKIDEWEM  391

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             ++ SLG  FE ND   S R IL LS+NDLP YLK C +Y SI+P  + IE   LI  W  
Sbjct  392   VHRSLGAGFENNDTLMSTRKILSLSYNDLPYYLKSCLLYFSIFPAGNPIERMKLIRLWIA  451

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV+ K   T+EEVAE YL ELI RSL+  V+   DG +K  RIHDL REI+++K+ D 
Sbjct  452   EGFVEGKEVMTLEEVAEDYLNELIKRSLVRVVEATSDGRVKTCRIHDLLREIMITKAKDQ  511

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI-L  1257
             +FV    EE   W EK R +S+H  + + Q +   ++LRS+L F   DS   S    +  
Sbjct  512   DFVAIAKEEGMVWSEKVRRVSIHKAVPSIQRRHVPSRLRSVLIFWGADSCPDSPAPNLSF  571

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                R++ VLDL+   L+  P ++  L  L+YLSLR+T V  +P SI KL  LE LDLK+T
Sbjct  572   GHLRLLNVLDLEGAPLKEFPSKVSSLFLLKYLSLRNTNVNSIPSSISKLLNLETLDLKHT  631

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              ++ELPV ILKL+ LRHL+VY +   +    +   GF+ P  +G L SL+KL +VEAN G
Sbjct  632   QISELPVGILKLRKLRHLLVYRYEIDSDDRIHTKYGFQPPPQIGSLQSLQKLCFVEANQG  691

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                + E+G+LN+L+RL I++ R E GKA+CSS+ KL  LR+L++ SI +   +D+ YLS+
Sbjct  692   GDLLLELGRLNQLRRLGIVRFRKEHGKALCSSVTKLTDLRALSITSITDSEFIDLEYLSN  751

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQRLYL+G +  +P W+ S  +LVK+  +WS+L DDPL  LQ LPNLVHL+ +  Y
Sbjct  752   PPRFLQRLYLTGRLQSLPEWLHSSDSLVKLVLKWSRLSDDPLLSLQHLPNLVHLKLVQVY  811

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE + F A  FQ L+ L ++KLE LR + + +GAMP LEKL++Q C +L  VP+GIE L
Sbjct  812   DGEMLCFQAKGFQRLKFLGINKLESLRVITVQQGAMPCLEKLIVQSCKELKRVPSGIEHL  871

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDG  2292
               L+ LEFF+M  + I T  P +   DY KV+H+ +VY TYW +G
Sbjct  872   TTLKVLEFFNMPKELIMTLQPSEENGDYLKVAHVPDVYSTYWNNG  916



>ref|XP_002521805.1| leucine-rich repeat-containing protein 2, lrrc2, putative [Ricinus 
communis]
 gb|EEF40615.1| leucine-rich repeat-containing protein 2, lrrc2, putative [Ricinus 
communis]
Length=943

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/788 (49%), Positives = 513/788 (65%), Gaps = 21/788 (3%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             RR D L LEE   VGIE P+ +LI  L +D    +V+SVVGM G GKTTLV  VY++  V
Sbjct  153   RRRDDLQLEEANPVGIERPKTKLIEWLFEDKSDREVVSVVGMAGLGKTTLVTKVYNNKEV  212

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             KK F+  AWIT+SQ+F  E++L D+I QLF  L+   P+G+ +M+ +KL+ ++ EFL  R
Sbjct  213   KKRFEFRAWITLSQSFTTEDLLIDIILQLFHVLRLSEPQGVDNMDNHKLRTVINEFLQER  272

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +Y+IV D+V   R W   + VLP    G R +++TR  DVA +SS +     Y + PLS+
Sbjct  273   RYLIVLDNVSDTRAWNDFERVLPNNSCGSRILLTTRNHDVALASSPEK---AYNLCPLSQ  329

Query  544   EVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
             E SW L CRK F  S CP HL  +L++IL RC GLPLAIVAIGGVLATK+++ I+EW  +
Sbjct  330   EESWTLFCRKIFQNSICPPHLNSVLQKILVRCQGLPLAIVAIGGVLATKDRSRIDEWELV  389

Query  724   YHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTME  903
             +  LG   E ND+   LR I+ LS+NDLP YLK C MY SI+P    IEH  L+  W  E
Sbjct  390   HRGLGAALEDNDR---LRSIVSLSYNDLPYYLKHCLMYFSIFPVGDSIEHTRLVRLWIAE  446

Query  904   GFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHN  1083
             GFVK+K G T+EEVAEGYL ELI RSL+  V+   DG +K  R+HD+  E+I+ KS D +
Sbjct  447   GFVKKKEGMTLEEVAEGYLNELIKRSLVQVVETTTDGRVKTCRVHDILLEMIILKSRDQD  506

Query  1084  FVTTIDEETAA--WPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             F     E++++  WPEK R LS+H  + + Q     ++ RSLL F   DS   S V+ + 
Sbjct  507   FAAIATEQSSSMMWPEKVRRLSMHNVMPSIQEVLNNSRPRSLLMFWWFDSLPESFVLNLS  566

Query  1258  SS-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
             S   R++ VLDL+ T L+  P E+  L  L+YLSLR+TKV  +P SI KL+ LE LDLK+
Sbjct  567   SRRLRLLNVLDLEGTPLKKFPNEVVNLYLLKYLSLRNTKVTSIPSSISKLQYLETLDLKH  626

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T VTELP EILKLQ LRHL+ Y + S +    +   G KAP  +G L SL+KL ++EAN 
Sbjct  627   THVTELPAEILKLQKLRHLLAYRYESESDDQIHTKYGCKAPALIGSLQSLQKLCFLEANQ  686

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
              N  + E+GKL++L+RL I+KLR EDG+ +C+SIE+L  LR+L++ S+EE  V+D+  LS
Sbjct  687   VN-LLTELGKLDKLRRLGIVKLRREDGRILCASIERLRNLRALSICSVEEREVIDIENLS  745

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             SPP  LQRLYL+G   K+P WI SL  LVK+  +W  L DDPL  LQ LPNLVHLEF+  
Sbjct  746   SPPRFLQRLYLTGRFEKLPEWISSLDGLVKVVLKWCGLSDDPLLLLQHLPNLVHLEFVQV  805

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y GE + F A  FQ L+ L L++L+ L  ++I + AMP+LEKL++Q C  L  VP GIE 
Sbjct  806   YDGEILCFQAKGFQRLKFLGLNRLDRLNTIIIEQEAMPNLEKLIVQSCRSLQRVPLGIEY  865

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGE--DYCKVSHISEVYYTYWKDGCWEVNSVQ----  2316
             L  L+ LEF++M  + I    P+  GE  DY KV  + EVY+TYW DG W++ S++    
Sbjct  866   LNELKILEFYNMPLELIMALHPNG-GENGDYWKVERVPEVYFTYWYDGNWDIISLESFKG  924

Query  2317  --ETSSGP  2334
                  SGP
Sbjct  925   RNSAQSGP  932



>ref|XP_010054922.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=949

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/777 (46%), Positives = 505/777 (65%), Gaps = 12/777 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D+R +ALL+E+ ++VGIE P ++L+  L+K  P  ++  VVGMGGSGKTTL+K V+DD 
Sbjct  154   QDQRGNALLVEKADLVGIEEPLEQLVKRLVKGPPEKEITPVVGMGGSGKTTLIKQVFDDP  213

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AW+T+S   + EEVL+DM+QQ+ + + +  P G  +++ + LK+++K  L 
Sbjct  214   AVKKHFTIRAWVTLSPYSRTEEVLRDMLQQIASSIMKSAPGGTDNLSTDLLKMMIKSLLQ  273

Query  358   RRK--YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMT  531
             RR+  Y+I+ DDVW    W+AIK+  P  ++G R MI+TR   +A SS  +  G ++ M 
Sbjct  274   RRRSRYLIILDDVWQVGEWDAIKYAFPNNQNGSRIMITTRDAMIALSSCKEFAGEVHNMK  333

Query  532   PLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             PL  E SW L C K F  S CP +L EI + IL++C GLPLAIVAI G+LATK+  NI+E
Sbjct  334   PLHAEQSWKLFCMKTFKGSRCPPNLEEICEYILRKCEGLPLAIVAISGILATKDNNNIDE  393

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W  +  S+  + +GND+  +L+ +L LSFN LP +LK CF++LS++P D  IEH  LI  
Sbjct  394   WHLVRQSIRSELDGNDRLMNLKKVLSLSFNALPYHLKSCFLHLSVFPRDQPIEHMRLIRI  453

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EG V+   GKT E VAE YL +L++RSLI   +L  DG +K  R+HDL  EI  +KS
Sbjct  454   WVAEGLVETTEGKTPEAVAEEYLKDLLSRSLIQVAELTSDGKVKMYRVHDLLWEISSTKS  513

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              + NF   +DE+ AAW ++ R LSVH TL  A       +LRSL  F V+ S  +   + 
Sbjct  514   KERNFAAVVDEQHAAWTDRVRRLSVHKTLQTAGQNEPLWQLRSLFMFGVSKSSIN---IV  570

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             + S  ++++VLDLQ   L   P ++     L YL+LR TK++ +P SI  L+ LE LDLK
Sbjct  571   LSSGPKLLRVLDLQGAPLRRFPTQVIDFHLLSYLNLRCTKIQKIPSSIGMLQNLESLDLK  630

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             +TF++ LPVEI KLQ LRHL+VY + + AY   +   GFK    +G L  L+KL Y+EA+
Sbjct  631   HTFISVLPVEITKLQRLRHLLVYRYENIAY--SHRKFGFKTLGEIGALQCLQKLCYIEAD  688

Query  1612  PGNGT--IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
                    I +I KL +L+RLCILKL+ EDG  +C SI KL  LR+L++ S+ +D  +D+ 
Sbjct  689   GETSRILIRQIRKLVQLRRLCILKLKKEDGGKLCVSITKLTNLRALSVSSL-KDAEIDLQ  747

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              L SPP LLQR+YL G +  +PHWI  L +L K++ +WS L++DP+  LQ +PNLVHLE 
Sbjct  748   NLDSPPQLLQRVYLRGKLQTLPHWIAKLPSLAKLHLKWSHLEEDPMSALQSMPNLVHLEL  807

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  Y+ + + F A  F+ L++L LD  EEL  + + EGAMP LEK  IQRC  L +VP+G
Sbjct  808   LQVYSWQKLCFKAKGFKKLKILGLDCFEELTLIQVEEGAMPCLEKWSIQRCKCLKNVPSG  867

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ  2316
             IE L  L+ LE FDM D+ I    P+++ E+Y KV+H+ E+ Y YW+DG W+V SV+
Sbjct  868   IEYLSKLKVLELFDMPDELIEKLKPEEQDEEYGKVAHVPELSYGYWRDGAWDVTSVE  924



>ref|XP_004301649.1| PREDICTED: disease resistance protein RPM1-like [Fragaria vesca 
subsp. vesca]
Length=911

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/772 (47%), Positives = 502/772 (65%), Gaps = 36/772 (5%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R DALLL+  ++VGI  P+ +L+  L KD     V+S+ GMGG GKTTL K VYDD 
Sbjct  157   QDHRGDALLLDNSDLVGIHKPKNQLVGWLCKDTSGRIVVSLAGMGGIGKTTLAKQVYDDP  216

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V+KHF+  AW+TV+++ K  E+LKDM+QQL   +++ VP  + +M+ ++LK  +KE L 
Sbjct  217   EVEKHFEVRAWVTVNRSIKSGELLKDMVQQLSKVIRRRVPGVVANMDNSQLKATIKELLQ  276

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              R+Y+IV DD+W    W+ I+  LP    G R M++TR  +VAS +   ++G  + + P+
Sbjct  277   ERRYLIVLDDIWHLYEWDTIQLALPNNGCGSRIMLTTRNAEVASITRILSDGKTFVIKPV  336

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             +   SW L CRK F  + CP HL +I K IL RC GLPLAIV IG VLATK++  I+EW 
Sbjct  337   TPAESWDLFCRKVFQLNKCPPHLQDICKDILSRCEGLPLAIVTIGRVLATKDERRIDEWE  396

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + EGND+ + L+++LLLSFNDLP +LK CF+YLSI+PE HLIE   LI  W 
Sbjct  397   MVARSLGAEIEGNDKLKYLKMVLLLSFNDLPYFLKSCFLYLSIFPEGHLIERMRLIRLWV  456

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EG V+ K G+T+EEVA+ YL EL+NRSLI   + + DG +K  RIH    EII+SKS D
Sbjct  457   AEGLVEAKEGRTLEEVADDYLHELLNRSLIQVAETSSDGRIKTCRIHGFLHEIIISKSRD  516

Query  1078  HNFVTTIDEET--AAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              NF T + E++    W +K R LS+H +                              VQ
Sbjct  517   QNFTTVVKEKSVPVQWSDKIRRLSMHNS------------------------------VQ  546

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
              +   R++ VLDLQ+ SL + P ++F L  L+YLSL+ TKVK +PR I KL+ L+ L+LK
Sbjct  547   YVQKNRLLNVLDLQNASLNVFPVDVFNLFFLKYLSLKGTKVKTIPRFIGKLQNLQTLNLK  606

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             ++ VTELP EILKL+HLRHL+VY + S  Y+ ++   GFK    +G L SL+KL +++AN
Sbjct  607   HSLVTELPFEILKLKHLRHLLVYRYKSGPYMDFHTKYGFKVLAKIGALTSLQKLCFIKAN  666

Query  1612  PGNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                G I  E+G L +L+RL I+++R EDGK +CSSIEKL KL +L++ S+EED ++D+ +
Sbjct  667   EDGGAILRELGNLVQLRRLGIVQMRKEDGKVLCSSIEKLNKLCALSITSVEEDEIIDLQH  726

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             L S PPLLQRLYL G +  +P WI SL +LV++Y +WS+LKDDPL  LQ LPNL+HLE  
Sbjct  727   LCS-PPLLQRLYLLGRLETIPRWIPSLHSLVRLYLKWSRLKDDPLVFLQYLPNLLHLELS  785

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               + G+ + F AG F+ L+ L + + E L+ + +  GAMP ++KL+I+RC  L  VP+GI
Sbjct  786   RAFEGDTLCFEAGGFKKLKHLGIAEFEGLKCIQVQLGAMPSVKKLIIKRCKLLQKVPSGI  845

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEV  2304
             E L  L+ LEF DM +  I T  P ++  DY KV+HI+ V +TYW +  W V
Sbjct  846   EHLSKLKVLEFVDMPETLIETLRPHEKDNDYWKVAHITVVCFTYWTECGWVV  897



>ref|XP_002521806.1| Disease resistance protein RPM1, putative [Ricinus communis]
 gb|EEF40616.1| Disease resistance protein RPM1, putative [Ricinus communis]
Length=943

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/777 (50%), Positives = 513/777 (66%), Gaps = 17/777 (2%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             RR DAL LEE   VGIE P+ +LI  L++D    +V+SVVGMGG GKTTLV  VY D  V
Sbjct  153   RRRDALQLEEANPVGIERPKMKLIEWLVEDKSEREVVSVVGMGGLGKTTLVTKVYYDKEV  212

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             KK F+  AWIT+SQ+F +E++LKD+I QL   L    P+G+ +M+  KL+ +++EFL  R
Sbjct  213   KKRFEFRAWITLSQSFTIEDLLKDIILQLSHVLPLSDPQGVDNMDNAKLRTVIEEFLQER  272

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +Y+IV D+V   R W   + VLP    G R +++TR  DVA +SS D     Y ++PLS+
Sbjct  273   RYLIVLDNVSDTRAWYDFELVLPNNSCGSRILLTTRNHDVAFASSADK---AYNLSPLSQ  329

Query  544   EVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
             E SW L CRK F  + CP  L  IL++IL RC GLPLAIVAIGGVLA K+++ I+EW  +
Sbjct  330   EESWTLFCRKIFQNNPCPPLLNGILQKILVRCQGLPLAIVAIGGVLAMKDRSRIDEWELV  389

Query  724   YHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTME  903
             +  LG   E +D+ +S   IL LS+NDLP YLK C MY SI+P   LIE   L+  W  E
Sbjct  390   HQGLGAALEDHDRLKS---ILSLSYNDLPYYLKYCLMYFSIFPVGDLIERAKLVRLWIAE  446

Query  904   GFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHN  1083
             GFVK+K G T+EEVAEGYL EL+ RSL+  V+   DG +K  R+HD+  E+I+ KS D +
Sbjct  447   GFVKEKEGMTLEEVAEGYLNELVKRSLVQVVETTSDGRVKTCRVHDILLEMIIWKSRDQD  506

Query  1084  FVTTIDEETAA--WPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             F    +E+  +  WPEK R LS+H  + + Q     ++ RSLL F   DS   S V+ IL
Sbjct  507   FAAIANEQNTSMMWPEKIRRLSIHNVMPSIQEILIASRPRSLLMFWWFDSLPKSFVL-IL  565

Query  1258  SS--CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             SS   R++ VLDL  T L+  P E+  L  L+YLSLR+TKV  +P SI KL+ LE LDLK
Sbjct  566   SSHRLRLLNVLDLGGTPLKKFPNEVVSLYLLKYLSLRNTKVTSIPSSIGKLQNLETLDLK  625

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
              T VTELP EILKLQ L HL+VY +   +    +   G KAP  +G L SL+KL ++EAN
Sbjct  626   QTHVTELPAEILKLQKLCHLLVYRYEIESDDQIHTKYGCKAPAQIGSLQSLQKLCFLEAN  685

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              GN  + E+GKLN+L+RL I+K+RTEDG+ +C+SIE+L  LR+L++  +EE  V+D+NYL
Sbjct  686   QGNTLLAELGKLNQLRRLGIVKIRTEDGRTLCASIERLRNLRALSIS-VEESEVIDINYL  744

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  LQRLYL+G +  +P WI SL +LVK+  +WS L DDPL  LQ LPNLVHLEF+ 
Sbjct  745   SSPPRFLQRLYLTGRLENLPEWISSLDSLVKVVLKWSGLSDDPLLLLQHLPNLVHLEFVQ  804

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y GE + F A  FQ L++L L+KL  L  + I +GAMP+LEKL++Q C  L  VP GIE
Sbjct  805   VYDGEILCFQARGFQRLKVLGLNKLHRLNTITIEQGAMPNLEKLIVQSCRSLQRVPLGIE  864

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGE--DYCKVSHISEVYYTYWKDGCWEVNSVQ  2316
              L  L+ LEF++M  + I    P   GE  DY KV  + EVY+TYW DG W++ S++
Sbjct  865   YLNELKVLEFYNMPLELIMALHPSG-GENGDYWKVERVPEVYFTYWYDGNWDIISME  920



>gb|KDP33397.1| hypothetical protein JCGZ_12853 [Jatropha curcas]
Length=948

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/784 (48%), Positives = 525/784 (67%), Gaps = 10/784 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R  ALLL+E E+VGIE PRK+LI  L+  D  LKVI++ GMGG GKTT+ K VYDD  
Sbjct  153   DYREQALLLDEHELVGIEEPRKQLIDWLVDGDSKLKVIAIGGMGGLGKTTVAKKVYDDPR  212

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHFQ H WITVS+ FK++++LKD++QQL+AE+KQ VP  + +M  N+LK IVK+FL +
Sbjct  213   VKKHFQFHVWITVSELFKIDDLLKDILQQLYAEIKQLVPREVETMKTNQLKEIVKKFLWQ  272

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
               Y++V DDVWT   W +IK VLP+  +G R M++TR   VASSSS + NG+ + + PLS
Sbjct  273   SLYILVLDDVWTVGAWNSIKSVLPR-GNGGRVMLTTRNAAVASSSSKEFNGHNFNLKPLS  331

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              + S  L  R+ F    CP HL ++ + IL +C GLPLAI+AI G+L TKNK   +EW  
Sbjct  332   WKESEELFFRRTFKEDICPPHLQKVSQSILGKCEGLPLAIIAISGLLITKNKNLTDEWEM  391

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG +   N++ E ++ IL LS+  LP  +K CF+YLSI+PE+H IE   LI  W  
Sbjct  392   VNRSLGAELRDNNEIEFMKEILSLSYEKLPYNVKSCFLYLSIFPENHPIECVRLIRLWVA  451

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E F +   G+T EEVAEGYL  L  R+LI   +   DG +K+ R+HD+   I + KS   
Sbjct  452   ERFAEAVEGRTAEEVAEGYLKLLWERNLIQVAEKRSDGRVKKCRVHDILHRISILKSRGQ  511

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF     ++   W E  R LSVH TL N Q      ++RSL  F +T+   SS    +  
Sbjct  512   NFAAIAKQQDDIWSETIRRLSVHNTLQNMQQIENVRQIRSLFMFGLTNP-LSSVSTSVPE  570

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
             S +++ VLDLQ   LE  P EI +L  LRYLSLR+TKV+++P SI KLR L+ LDLK ++
Sbjct  571   SFKMLNVLDLQGAPLEKFPSEIVKLSFLRYLSLRNTKVEIIPPSIGKLRNLQTLDLKQSY  630

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             V++LP  ILKL+ LRHL+VY ++   Y  +N   GF+AP  +G L SL+KL ++EA   +
Sbjct  631   VSKLPSTILKLKKLRHLLVYRYIIEPYAHFNYKYGFEAPLTIGDLQSLQKLCFIEAKKES  690

Query  1621  G-TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
               T+ E+G+L EL+RL I+KLR EDGK +C SIEKL KLR+L++ +++E+ V+D+    S
Sbjct  691   PITMTELGRLKELRRLGIIKLRREDGKDLCFSIEKLDKLRALSITAVKEEEVIDLQCKIS  750

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PPP L+RLYL+G + K+P WI    +LVK++ + S+LK DP EHLQ+L NL+HLE L  +
Sbjct  751   PPPHLKRLYLTGRLEKLPEWILLAHSLVKLFIKGSRLKQDPFEHLQNLLNLIHLELLQVF  810

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE + F +G FQ L++L LDK  +L+++ + +GAMP LEKL+IQRCN L  VP+GIE L
Sbjct  811   DGEVVTFASGGFQKLQILGLDKFNDLKSIDVEKGAMPRLEKLIIQRCNSLRKVPSGIEYL  870

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKD-GCWEVNSVQ----ET  2322
               L+ LEFF+M ++ I T  P+++GEDY +V+HI +VY TYW +   W+++  +    E+
Sbjct  871   TKLKVLEFFEMPEELIGTLRPNEQGEDYFRVAHIPQVYSTYWSERRVWDIHLGRYCEGES  930

Query  2323  SSGP  2334
             SS P
Sbjct  931   SSNP  934



>ref|XP_010054111.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=948

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/782 (46%), Positives = 513/782 (66%), Gaps = 17/782 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R DALL+E+ ++VGI  P+KEL+  L++     +VISVVGMGG GKTTLVK VYDD 
Sbjct  153   QDHRGDALLVEKSDLVGIGEPKKELVEWLVQGASQCQVISVVGMGGLGKTTLVKQVYDDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKK F   AW+T+S + + +E+L DM++Q+ + + + +P G  +  ++ +++++K+FL 
Sbjct  213   AVKKRFTVRAWVTLSPSSRTDELLSDMLRQVASSITKTLPSGAETSKSSCVRMMIKDFLR  272

Query  358   RR--KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMT  531
              R  KY+IV DDVW    W+A+K  +P   +G R M++TR  D+AS+S T   G +Y M 
Sbjct  273   ERRLKYLIVLDDVWDMNKWDAVKCAIPNNNNGSRIMVTTRKSDLASASGTGCAGKVYNMK  332

Query  532   PLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             PLS E S  L CRK F   +CPSHL EI +QILK+C GLPLAIV I GVLATK+   I+E
Sbjct  333   PLSSEQSHELFCRKTFKEKACPSHLEEICRQILKKCEGLPLAIVVISGVLATKDIRRIDE  392

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W  +  SL  + +GN++ ++L+ +L LSF+DLP YLK CF++LSI+PE  ++E   +I  
Sbjct  393   WELVLRSLRSEIDGNEKLKNLKQVLSLSFSDLPYYLKSCFLHLSIFPEALVVERMRIIRL  452

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EGFV++K GKT+EEVAE YL EL+NRSLI   +   DG +K+ R+HDL  EII+ K+
Sbjct  453   WVAEGFVERKEGKTLEEVAEDYLDELLNRSLIQVAETTSDGRVKKCRVHDLLLEIIIPKA  512

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              D N+   + E    WPE+ R LS+H     A+  R  + LRSL TF V +S     VV 
Sbjct  513   RDQNYAIIVHEHRGPWPERVRRLSIHKAFQIARENRSLSCLRSLFTFGVDESS----VVD  568

Query  1252  ILSS-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              LSS   ++ VLDL+   +   P ++  +  LR+LSLRS++++ +P SI  L+ LE LDL
Sbjct  569   ALSSELNLLSVLDLEHAPVSRFPGQVLNMKCLRFLSLRSSRIRTIPSSIGNLQNLETLDL  628

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSH--VSFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             K T V  LPVEI KLQ LRHL+VY +  +S+ +  Y    GFK P  +G L SL+KL ++
Sbjct  629   KDTHVIALPVEIAKLQQLRHLLVYRYENISYTHNKY----GFKTPADIGALRSLQKLCHI  684

Query  1603  EANP--GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             E +       I  +GKLN+L+RL +L+LR EDG+ +CSSI KL  L SL + +  +D  +
Sbjct  685   EVDDERDGRNITGLGKLNQLRRLGVLRLRREDGRNLCSSIAKLTNLSSLAVFAFTDDEEI  744

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             D+++LSSPP LLQR++L G++  +P WI +L NLVK+  R S L+DDPLE LQ+LP+LVH
Sbjct  745   DLHHLSSPPQLLQRIFLRGHLRTLPSWIANLHNLVKLCLRMSCLRDDPLESLQNLPSLVH  804

Query  1957  LEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
             L  L  Y  + + F A  F  L++L LD  EEL  + + +GAMP LEKL++ RC  L  +
Sbjct  805   LVLLHAYNWQTLCFKAKGFMKLKILGLDLFEELEFIQVEKGAMPCLEKLMVLRCKLLKDL  864

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQ  2316
             P GIE L  L+ LEFF++  + +    PD++ +DY KV+H+ E+ Y YW++  W+V SV+
Sbjct  865   PLGIEHLNMLKVLEFFELPCELVQKLKPDEQNKDYQKVAHVPEIRYAYWREQGWDVTSVE  924

Query  2317  ET  2322
              +
Sbjct  925   TS  926



>gb|KCW72845.1| hypothetical protein EUGRSUZ_E01297, partial [Eucalyptus grandis]
Length=860

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/738 (48%), Positives = 486/738 (66%), Gaps = 9/738 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             ++ +++A  L++ E+VGIE P+K+LI  L++     +VISVVGMGG GKTTLV  VY+D 
Sbjct  123   HEHQNNAFFLDKTELVGIEEPKKQLIGWLVEGTSKRQVISVVGMGGLGKTTLVNQVYEDP  182

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF     ITVS +  + E+L DM+QQ+   +++P+P G  + N   LK+I+K+ L 
Sbjct  183   EVKKHFTICTRITVSGSPNIGELLHDMLQQIMRVIRKPIPSGAETTNLYWLKMIIKDLLQ  242

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             R  Y++V DD W    W+A+KH LP    G R +I+TR  D+A +S  +  G  Y+M PL
Sbjct  243   RMSYLVVLDDTWRIDEWDAVKHALPNNTCGSRIIITTRNADLAYTSCREFKGRFYKMEPL  302

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C+K F  +SCPSHL E  + IL++C GLPLAIVAI GVLATK++  I+EW 
Sbjct  303   PVEHSWKLFCKKTFQVNSCPSHLKESCEFILRKCEGLPLAIVAISGVLATKDRHRIDEWE  362

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + + ND+ ++L+ +L LSFNDLP YLK CF++LS++PE H I+   LI  W 
Sbjct  363   LVCRSLRSEIDCNDKLKNLKRVLSLSFNDLPYYLKACFLHLSLFPEGHPIKRRRLIRLWV  422

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT E+VA+ Y  EL+NRSLI       DG +K  RIHD  R+II S+STD
Sbjct  423   AEGFVEKKEGKTHEQVAKDYFMELLNRSLIEVASKRSDGRVKTCRIHDFLRDIITSRSTD  482

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     EE   WP++ R LS+   L         ++LRSL  F V  S  +S +    
Sbjct  483   QGFAEIAKEENREWPDRVRRLSIQNNLQTLPRNWSLSQLRSLYIFGVDKSLMNSVLA---  539

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  +++ VLD+Q+  L   P ++    +LRYLS R T+V  +P SI KL+ LE LDLK+T
Sbjct  540   SDMKLLTVLDMQAAPLTRFPAQVADWCYLRYLSFRFTEVSTIPSSIGKLQNLETLDLKHT  599

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              VTELPVEILKLQ LRHL+VY + + +Y   +   GFKA +G+G L SL+KL Y+EAN  
Sbjct  600   NVTELPVEILKLQRLRHLLVYRYKNVSY--SSSKFGFKALRGIGALQSLQKLCYLEANDE  657

Query  1618  NGT--IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             N +  I E+G L +L RL ILK R EDG+ +C SI KL +LR++++ S+++D ++D+ +L
Sbjct  658   NSSSVIRELGMLTQLDRLAILKFRKEDGRDLCLSISKLTRLRAISIASLDDDEIIDLQHL  717

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  LQR+YL G +G +PHW+ SL +L+K++ R S+LKDDPL  LQ+LPNLVHLE L 
Sbjct  718   SSPPSFLQRIYLRGRLGALPHWLPSLSSLMKLHLRCSRLKDDPLVSLQNLPNLVHLELLQ  777

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + F A  F+ LR L LD  +ELR V + +GAMP LEKL+IQRC  L  +P+GIE
Sbjct  778   VYEGSSLCFKAKTFRKLRTLGLDYFDELRCVEVEKGAMPFLEKLIIQRCKLLKKLPSGIE  837

Query  2152  CLFNLRYLEFFDMTDDFI  2205
              L  L+ LE FDM D+ +
Sbjct  838   HLTRLKVLEIFDMPDELV  855



>gb|ABF81444.1| NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=974

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/804 (45%), Positives = 507/804 (63%), Gaps = 50/804 (6%)
 Frame = +1

Query  28    LLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKHFQS  201
             ++EE  IVGIE P+K LI  L++     +VISVVGMGG GKTTLV+ VY D  VKKHFQ 
Sbjct  157   IVEEANIVGIEKPKKLLIGWLVRGRSEREVISVVGMGGLGKTTLVRKVYHDADVKKHFQF  216

Query  202   HAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVIVF  381
               WIT+S +FK E++LKD+IQQLF  L++ VP+GM   + ++LK  +  FL +++Y+IV 
Sbjct  217   RVWITLSPSFKEEDLLKDIIQQLFRVLQKNVPQGM---DNDRLKTAINRFLQKKRYLIVL  273

Query  382   DDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSWAL  561
             DDVW A  W+A + V P    G   +++TR  +VA ++  +    +Y + PLS E SW L
Sbjct  274   DDVWHADAWDAFEPVFPNNSRGSHILLTTRKTEVALTACIEFPDKVYNLDPLSPEESWTL  333

Query  562   LCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSLGP  741
              C+  F  S CP HL  + ++IL RC GLPLAI A+ GVLAT++++ I+EW  +  SLG 
Sbjct  334   FCKMVFQNSHCPEHLKNVSERILGRCEGLPLAIEAMSGVLATRDRSKIDEWEKVCLSLGA  393

Query  742   DFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVKQK  921
              FE N++  +   IL LS+ DLP YLK C +Y S++PE   I+   LI  W  EGFVK +
Sbjct  394   GFEDNNRMRNALKILSLSYYDLPYYLKSCLLYFSMFPEGIPIQRMRLIRLWIAEGFVKGR  453

Query  922   AGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTTID  1101
              G T EEVAE +L ELI RSL+  V+    G +K  RIHDL REI+++K+ + +FV    
Sbjct  454   EGMTSEEVAEDFLNELIKRSLVQVVEATSYGQVKTCRIHDLLREILITKAKEQDFVAIAK  513

Query  1102  EETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSCRVIKV  1281
             E+   W EK R +S+H  + + +     ++LRSLL F   DS          S  R++ V
Sbjct  514   EQNMIWSEKVRRVSIHNDMPSMRQIHVASRLRSLLVFWGKDSFPGPPKFISPSRSRLLTV  573

Query  1282  LDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTELPVE  1461
             LD++ T L+  P E+  L+ L+YLSLR+TKV  +P SI KL+ LE LDLK+  VTELPV+
Sbjct  574   LDMEGTPLKEFPNEVVSLIFLKYLSLRNTKVNSVPSSISKLQNLESLDLKHAQVTELPVD  633

Query  1462  ILKLQHLRHLIVY---SHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIE  1632
             ILKLQ LRHL+VY   +H S   +      GFKAP  +G L S++KL ++EA+ G   + 
Sbjct  634   ILKLQKLRHLLVYRYETHESDDQI--RNKHGFKAPAQIGNLLSVQKLCFLEADQGQKLMS  691

Query  1633  EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLL  1812
             E+G+L  L+RL ILK R EDGK +CSSI+ L  LR+L++ SI E  V+D+ YLSSPP  L
Sbjct  692   ELGRLIHLRRLGILKFRKEDGKDLCSSIDMLTNLRALSVTSITESEVIDLEYLSSPPQFL  751

Query  1813  QRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHM  1992
             QRLYL+G + ++P WI SL +LVK+  +WS+L++DPL  LQ+LPNLVHLEF+  Y+GE +
Sbjct  752   QRLYLTGRLERLPDWILSLDSLVKLVLKWSRLREDPLLFLQNLPNLVHLEFIQVYSGEAL  811

Query  1993  HFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRY  2172
             HF+   F+ L++L L+KLE L ++ + +GA+P L+KLV+Q C  L  VP+GI+ L  L+ 
Sbjct  812   HFSNEGFEKLKVLGLNKLERLESITVQKGALPSLQKLVVQGCKLLQKVPSGIKHLAKLKT  871

Query  2173  LEFFDMTDDFIS-------------TFL---------------------------PDKRG  2232
             L+FFDM  DF+              TFL                           PD  G
Sbjct  872   LDFFDMPYDFVKRLRPDGTAQRAGRTFLQKSVVQFIKIVQILPFDAPNDFIRRLHPDGDG  931

Query  2233  EDYCKVSHISEVYYTYWKDGCWEV  2304
             EDY +V ++ E+Y TY K+G WE+
Sbjct  932   EDYHEVRNVPEIYCTYQKNGNWEI  955



>gb|KCW72846.1| hypothetical protein EUGRSUZ_E01298, partial [Eucalyptus grandis]
Length=904

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/742 (49%), Positives = 496/742 (67%), Gaps = 9/742 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R +A+LL++ ++VGIE P+ EL+  LL      +VIS+VGMGG GKTTLV+ V++D 
Sbjct  153   QDHRGNAVLLDKTDLVGIEQPKNELVGQLLDWGLRREVISIVGMGGLGKTTLVRQVFEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK+HF  HAWIT+ ++ K+EEVL+DM+ Q+   +++PVP G  +M ++ LK+I+K+ L 
Sbjct  213   AVKEHFTVHAWITLCRSSKIEEVLQDMLDQIIRVIRKPVPHGANTMTSHWLKMIIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+Y+IV DD+W    W+AIKH  P   HG R +I+TR  D+AS+S  + NG   +M PL
Sbjct  273   RRRYLIVLDDIWHINEWDAIKHAFPTNGHGSRVIITTRNADLASTSCKEFNGQEKKMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L CRK F  +SCPSHL EI K IL++C GLPLAIVAI GVLA+K++  I EW 
Sbjct  333   DPEQSWELFCRKTFQGNSCPSHLEEICKYILRKCEGLPLAIVAISGVLASKDRWRIYEWE  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + + ND+ ++L+ +L LSFNDLP YLK CF++LS++PE   I    LI  W 
Sbjct  393   LVRRSLHIEIDCNDKLKNLKRVLSLSFNDLPYYLKSCFLHLSLFPEGCPINRRRLIRLWV  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT+EEVA+ Y  EL+NRSLI       DG +K  RIHD  R+II  KS D
Sbjct  453   AEGFVEKKEGKTLEEVAKDYFVELLNRSLIEVASKRSDGRVKYCRIHDFLRDIITLKSID  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     EE   WP+K RHLS+  T    Q     ++LRSL TF +  S F + V+   
Sbjct  513   QGFAEISKEENHEWPDKVRHLSIQNTPQALQKNLSWSRLRSLYTFGIERS-FMNEVLA--  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  +++ VLDLQ+  L   P ++    +L+YLS R T+V  +P SI KL+ LE LDLK+T
Sbjct  570   SDMKLLNVLDLQAAPLTRFPAQVADWCYLKYLSFRFTEVSTIPSSIGKLQNLETLDLKHT  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN--  1611
              VTELP EILKL+ LRHL+VY + + +Y  +    GF+  +G+G L SL+KL Y+EA+  
Sbjct  630   KVTELPFEILKLRRLRHLLVYRYKNISYSSFEF--GFRVFRGIGALQSLQKLCYIEADDE  687

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
               N  I E+G L +L RL ILKLR EDG+ +C SI KL +LR++++ S+++D ++D+ +L
Sbjct  688   SRNSVIRELGMLTQLDRLAILKLRKEDGRDLCLSISKLTRLRAISVASVDDDEIIDLQHL  747

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPPP LQR+YL G +G +PHW+ SL +L K++ R S LKDDPL  L++LPNL+HLE L 
Sbjct  748   SSPPPFLQRIYLRGRLGALPHWLPSLISLTKLHLRHSHLKDDPLISLKNLPNLMHLELLQ  807

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + F A  F+ LR+L LD  +ELR + + +GAMP+LEK +IQRC  L  +P+GIE
Sbjct  808   VYEGSSLCFEAKAFKKLRILGLDHFDELRCIDVEKGAMPYLEKFIIQRCKLLEKLPSGIE  867

Query  2152  CLFNLRYLEFFDMTDDFISTFL  2217
              L  L+ LE FDM D+ I   +
Sbjct  868   HLTKLKVLEIFDMPDELIKKLV  889



>dbj|BAJ53254.1| JHL25P11.3 [Jatropha curcas]
Length=943

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/783 (49%), Positives = 520/783 (66%), Gaps = 12/783 (2%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             RR  ALLLEE   VGIE P+ +LI  LL+D   L +ISVVGMGGSGKTTLVK VY++  V
Sbjct  153   RRRSALLLEEANPVGIERPKTKLIEWLLEDKSELDLISVVGMGGSGKTTLVKKVYNNKEV  212

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             KK F+  AWIT+S +F  E++L+D+IQQL   L+ P  +G+ +M+ +KL++++ EFL  R
Sbjct  213   KKRFEFRAWITLSLSFTTEDLLRDIIQQLSHVLRGPDLQGVDNMDNDKLRIVINEFLKER  272

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +Y+IV D+V   + W+  + VLP  +   R +++TR   VA ++S    G +YE++PLSE
Sbjct  273   RYLIVLDNVSNVKTWDDFEVVLPNNRCSSRILLTTRNQGVAFAASP---GRVYELSPLSE  329

Query  544   EVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
             E SW L CRK F  +  P +L ++L++IL RC GLPLAIVAIGGVLATK++  I++W  +
Sbjct  330   EESWTLFCRKIFQNNPYPPYLKDVLEKILMRCQGLPLAIVAIGGVLATKDRNRIDQWEMV  389

Query  724   YHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTME  903
               SLG   E N + +S   IL LS+NDLP YLK C +Y SI+P    IE+  L+  W  E
Sbjct  390   GCSLGAALEDNGRLKS---ILSLSYNDLPYYLKHCLLYFSIFPVGSPIEYMRLVRLWIAE  446

Query  904   GFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHN  1083
             GFVK K G T+EEVAE YL ELI RSL+  V+   DG +K  R+HD+  EII+ KS D +
Sbjct  447   GFVKAKEGMTLEEVAEDYLNELIKRSLVQVVETTTDGRVKTCRVHDILLEIIILKSRDQD  506

Query  1084  FVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS  1263
             F    +E+   WP K R LS+H  + + Q     + LRSLL F   DS   S V+ + S 
Sbjct  507   FSAIANEQNNMWPTKVRRLSIHNVIPSIQHILVASGLRSLLMFWRLDSLPESLVLNLSSR  566

Query  1264  -CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               R + VLDL+ T L+  P EI  L  L+YLSLR+TKV  +P SI KL+ LE LDLK+T+
Sbjct  567   RLRFLNVLDLEGTPLKKFPNEIVSLYLLKYLSLRNTKVNSIPSSIGKLKNLETLDLKHTY  626

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VTELP EILKL+ L HL+VY +   +    +   GF  P  +G L  L+KL ++EAN GN
Sbjct  627   VTELPAEILKLRKLHHLLVYRYEIESDDQIHTKYGFNVPAQIGNLQFLQKLCFLEANQGN  686

Query  1621  GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSP  1800
               I E+GKL +L+RL I+KL+ EDGKA+C SIE L  LR+L++ S+E+  V+D+  LSSP
Sbjct  687   NLIVELGKLKQLRRLGIVKLKREDGKALCLSIEMLRNLRALSITSVEDCEVIDMENLSSP  746

Query  1801  PPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYT  1980
             P  LQRLYL+G + K+P WI SL +LVK+  +WSKL DDPL  LQ LPNLVHLEF+  + 
Sbjct  747   PRFLQRLYLNGRLEKLPEWISSLDSLVKVVLKWSKLSDDPLLLLQHLPNLVHLEFVQVFD  806

Query  1981  GEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLF  2160
             GE + F A  F+ L+ L L+KL++L  ++I +GAMP LEKL++Q C  L  VP+GIE L 
Sbjct  807   GEFLCFEAKGFKKLKFLGLNKLDKLNRIIIEQGAMPCLEKLIVQSCRSLQKVPSGIEHLT  866

Query  2161  NLRYLEFFDMTDDFISTFLP--DKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGP  2334
              L+ LEFF+M  +FI    P  +K+G DY KV  + EVY+TYW DG W++ S++   +G 
Sbjct  867   ELKVLEFFNMPLEFIMALHPAEEKKG-DYWKVERVPEVYFTYWYDGNWDIISLESFKAGK  925

Query  2335  ETA  2343
              +A
Sbjct  926   NSA  928



>dbj|BAJ53255.1| JHL25P11.7 [Jatropha curcas]
Length=851

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/783 (49%), Positives = 521/783 (67%), Gaps = 12/783 (2%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             RR  ALLLEE   VGIE P+ +LI  LL+D     +ISVVGMGGSGKTTLVK VY++  V
Sbjct  61    RRRSALLLEEANPVGIERPKTKLIEWLLEDKSERDLISVVGMGGSGKTTLVKKVYNNKEV  120

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             KK F+  AWIT+S +F  E++L+D+IQQL   L+ P  +G+ +M+ +KL++++ EFL  R
Sbjct  121   KKRFEFLAWITLSLSFTTEDLLRDIIQQLSHVLRGPDLQGVDNMDNDKLRIVINEFLKER  180

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +Y+IV D+V  A+ W+  + VLP  +   R +++TR   VA ++S    G +YE++PLSE
Sbjct  181   RYLIVLDNVSNAKTWDDFEVVLPNNRCSSRILLTTRNQGVAFAASP---GRVYELSPLSE  237

Query  544   EVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
             E SW L CRK F  +  P +L ++L++IL RC GLPLAIVAIGGVLATK++  I++W  +
Sbjct  238   EESWTLFCRKIFQNNPYPPYLKDVLEKILMRCQGLPLAIVAIGGVLATKDRNRIDQWEMV  297

Query  724   YHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTME  903
               SLG   E N + +S   IL LS+NDLP YLK C +Y SI+P    IE+  L+  W  E
Sbjct  298   GCSLGAALEDNGRLKS---ILSLSYNDLPYYLKHCLLYFSIFPVGSPIEYMRLVRLWIAE  354

Query  904   GFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHN  1083
             GFVK K G T+EEVAE YL ELI RSL+  V+   DG +K  R+HD+  EII+ KS D +
Sbjct  355   GFVKAKEGMTLEEVAEDYLNELIKRSLVQVVETTTDGRLKTCRVHDILLEIIILKSRDQD  414

Query  1084  FVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS  1263
             F    +E+   WP+K R LS+H  + + +     + LRSLL F   DS   S V+ + S 
Sbjct  415   FSAIANEQNNMWPKKVRRLSIHNVIPSIKHILVASGLRSLLMFWRLDSLPESLVLNLSSR  474

Query  1264  -CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               R++ VLDL+ T L+  P EI  L  L+YLSLR+TKV  +P SI KL+ LE LDLK T+
Sbjct  475   RLRLLNVLDLEGTPLKKFPNEIVSLYLLKYLSLRNTKVNSIPSSIGKLKNLETLDLKRTY  534

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VTELP EILKL+ L HL+VY +   +    +   GF  P  +G L  L+KL ++EAN GN
Sbjct  535   VTELPAEILKLRKLHHLLVYRYEIESDDQIHTKYGFNVPAQIGNLQFLQKLCFLEANQGN  594

Query  1621  GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSP  1800
               I E+GKL +L+RL I+KL+ EDGKA+C SIE L  LR+L++ S+E+  V+D+  LSSP
Sbjct  595   NLIVELGKLKQLRRLGIVKLKREDGKALCLSIEMLRNLRALSITSVEDCEVIDMENLSSP  654

Query  1801  PPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYT  1980
             P  LQRLYL+G + K+P WI SL +LVK+  +WSKL DDPL  LQ LPNLVHLEF+  + 
Sbjct  655   PRFLQRLYLNGRLEKLPEWISSLDSLVKVVLKWSKLSDDPLLLLQHLPNLVHLEFVQVFD  714

Query  1981  GEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLF  2160
             GE + F A  F+ L+ L L+KL++L  ++I +GAMP LEKL++Q C  L  VP+GIE L 
Sbjct  715   GEILCFEAKGFKKLKFLGLNKLDKLNRIIIDQGAMPCLEKLIVQSCRSLQKVPSGIEHLT  774

Query  2161  NLRYLEFFDMTDDFISTFLP--DKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGP  2334
              L+ LEFF+M  +FI    P  +K+G DY KV  + EVY+TYW DG W++ S++   +G 
Sbjct  775   ELKVLEFFNMPLEFIMALHPAEEKKG-DYWKVERVPEVYFTYWYDGNWDIISLESFKAGK  833

Query  2335  ETA  2343
              +A
Sbjct  834   NSA  836



>gb|KDP27335.1| hypothetical protein JCGZ_20267 [Jatropha curcas]
Length=805

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/783 (49%), Positives = 520/783 (66%), Gaps = 12/783 (2%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             RR  ALLLEE   VGIE P+ +LI  LL+D     +ISVVGMGGSGKTTLVK VY++  V
Sbjct  15    RRRSALLLEEANPVGIERPKTKLIEWLLEDKSERDLISVVGMGGSGKTTLVKKVYNNKEV  74

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             KK F+  AWIT+S +F  E++L+D+IQQL   L+ P  +G+ +M+ +KL++++ EFL  R
Sbjct  75    KKRFEFLAWITLSLSFTTEDLLRDIIQQLSHVLRGPDLQGVDNMDNDKLRIVINEFLKER  134

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +Y+IV D+V   + W+  + VLP  +   R +++TR   VA ++S    G +YE++PLSE
Sbjct  135   RYLIVLDNVSNVKTWDDFEVVLPNNRCSSRILLTTRNQGVAFAASP---GRVYELSPLSE  191

Query  544   EVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
             E SW L CRK F  +  P +L ++L++IL RC GLPLAIVAIGGVLATK++  I++W  +
Sbjct  192   EESWTLFCRKIFQNNPYPPYLKDVLEKILMRCQGLPLAIVAIGGVLATKDRNRIDQWEMV  251

Query  724   YHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTME  903
               SLG   E N + +S   IL LS+NDLP YLK C +Y SI+P    IE+  L+  W  E
Sbjct  252   GCSLGAALEDNGRLKS---ILSLSYNDLPYYLKHCLLYFSIFPVGSPIEYMRLVRLWIAE  308

Query  904   GFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHN  1083
             GFVK K G T+EEVAE YL ELI RSL+  V+   DG +K  R+HD+  EII+ KS D +
Sbjct  309   GFVKAKEGMTLEEVAEDYLNELIKRSLVQVVETTTDGRLKTCRVHDILLEIIILKSRDQD  368

Query  1084  FVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS  1263
             F    +E+   WP+K R LS+H  + + +     + LRSLL F   DS   S V+ + S 
Sbjct  369   FSAIANEQNNMWPKKVRRLSIHNVIPSIKHILVASGLRSLLMFWRLDSLPESLVLNLSSR  428

Query  1264  -CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               R++ VLDL+ T L+  P EI  L  L+YLSLR+TKV  +P SI KL+ LE LDLK T+
Sbjct  429   RLRLLNVLDLEGTPLKKFPNEIVSLYLLKYLSLRNTKVNSIPSSIGKLKNLETLDLKRTY  488

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VTELP EILKL+ L HL+VY +   +    +   GF  P  +G L  L+KL ++EAN GN
Sbjct  489   VTELPAEILKLRKLHHLLVYRYEIESDDQIHTKYGFNVPAQIGNLQFLQKLCFLEANQGN  548

Query  1621  GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSP  1800
               I E+GKL +L+RL I+KL+ EDGKA+C SIE L  LR+L++ S+E+  V+D+  LSSP
Sbjct  549   NLIVELGKLKQLRRLGIVKLKREDGKALCLSIEMLRNLRALSITSVEDCEVIDMENLSSP  608

Query  1801  PPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYT  1980
             P  LQRLYL+G + K+P WI SL +LVK+  +WSKL DDPL  LQ LPNLVHLEF+  + 
Sbjct  609   PRFLQRLYLNGRLEKLPEWISSLDSLVKVVLKWSKLSDDPLLLLQHLPNLVHLEFVQVFD  668

Query  1981  GEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLF  2160
             GE + F A  F+ L+ L L+KL++L  ++I +GAMP LEKL++Q C  L  VP+GIE L 
Sbjct  669   GEILCFEAKGFKKLKFLGLNKLDKLNRIIIDQGAMPCLEKLIVQSCRSLQKVPSGIEHLT  728

Query  2161  NLRYLEFFDMTDDFISTFLP--DKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGP  2334
              L+ LEFF+M  +FI    P  +K+G DY KV  + EVY+TYW DG W++ S++   +G 
Sbjct  729   ELKVLEFFNMPLEFIMALHPAEEKKG-DYWKVERVPEVYFTYWYDGNWDIISLESFKAGK  787

Query  2335  ETA  2343
              +A
Sbjct  788   NSA  790



>ref|XP_002303450.2| hypothetical protein POPTR_0003s09770g, partial [Populus trichocarpa]
 gb|EEE78429.2| hypothetical protein POPTR_0003s09770g, partial [Populus trichocarpa]
Length=901

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/750 (48%), Positives = 492/750 (66%), Gaps = 3/750 (0%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             + + D LLLEE ++VGIE P+++LI  LL+     +V+SVVGMGG GK+TLVK VYDD  
Sbjct  152   ESQGDGLLLEEADLVGIEKPKRQLIEWLLERKSGREVVSVVGMGGMGKSTLVKKVYDDPD  211

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK F+  AWITVSQ+FK EE+LKD++QQLF   ++P P+G+ SM+ +KL+ ++ +FL +
Sbjct  212   VKKQFKFRAWITVSQSFKKEELLKDIVQQLFRVHRKPGPKGVDSMDYDKLRTVINKFLQQ  271

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             +KY+IV DDVW    W A +H LP    G R M++TR  +VAS++  D    ++ + PLS
Sbjct  272   KKYLIVLDDVWHTSAWGAFQHALPNNNCGSRIMVTTRNTEVASTACMDFPDRVFPLDPLS  331

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             +E SW L C+K F  ++CP HL  + + IL RC GLPLAIV+I GVLA K+K  I+EW  
Sbjct  332   QEESWILFCKKIFQNNTCPPHLKNVSETILGRCEGLPLAIVSISGVLAAKDKNKIDEWEM  391

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             ++ SLG  FE ND   + R IL LS+NDLP YLK C +Y SI+P  + I+   LI  W  
Sbjct  392   VHRSLGAGFENNDTLMNTRKILSLSYNDLPYYLKSCLLYFSIFPAGNPIKRMKLIRLWIA  451

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV+ K G T+EEVAE YL ELI RSL+  VK   DG +K  RIHDL REI+++K+ D 
Sbjct  452   EGFVEGKEGMTLEEVAEDYLNELIKRSLVRVVKAASDGRVKTCRIHDLLREIMITKAKDQ  511

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI-L  1257
             +FV    EE     EK R +S+H  + + Q +   ++LRS+L F   DS   S    +  
Sbjct  512   DFVAIAKEEGMVLSEKVRRVSLHKAVPSIQRRHVASRLRSVLIFWGADSCPDSPAPNLSF  571

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                R++ VLDL+   L+  P ++  L  L+YLSLR+T V  +P SI KL  LE LDLK+T
Sbjct  572   GHLRLLNVLDLEGAPLKEFPSKVSSLFLLKYLSLRNTNVNSIPSSISKLLNLETLDLKHT  631

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              ++ELPV ILKL+ LRHL+VY +        +   GF+ P  +G L SL+KL +VEAN G
Sbjct  632   QISELPVGILKLRKLRHLLVYRYEIDCDDRIHIKYGFQPPPQIGSLQSLQKLCFVEANQG  691

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                + E+G+LN+L+RL I++ R E GKA+CSS+ KL  LR+L++ SI +   +D+ YLSS
Sbjct  692   GDLLLELGRLNQLRRLGIVRFRKEHGKALCSSVTKLTDLRALSISSITDSEFIDLEYLSS  751

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQR+YL+G +  +P W+    +LVK+  +WS+L DDPL  LQ LPNLVHL+ +  Y
Sbjct  752   PPRFLQRVYLTGRLQSLPEWLHYSDSLVKLVLKWSRLSDDPLLSLQHLPNLVHLKLIQAY  811

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE + F A  FQ LR L+++KLE LR + + +GAMP LEKL++Q C +L  VP+GIE L
Sbjct  812   NGEMLCFQAKGFQRLRFLSINKLESLRVITVQQGAMPCLEKLIVQSCKELKMVPSGIEHL  871

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCK  2247
               L+ LEFF+M  + I T  P +   D  K
Sbjct  872   TTLKVLEFFNMPKELIMTLQPSEENGDDLK  901



>gb|KDP27334.1| hypothetical protein JCGZ_20266 [Jatropha curcas]
Length=943

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/783 (49%), Positives = 521/783 (67%), Gaps = 12/783 (2%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             RR  ALLLEE   VGIE P+ +LI  LL+D     +ISVVGMGGSGKTTLVK VY++  V
Sbjct  153   RRRSALLLEEANPVGIERPKTKLIEWLLEDKSERDLISVVGMGGSGKTTLVKKVYNNKEV  212

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             KK F+  AWIT+S +F  E++L+D+IQQL   L+ P  +G+ +M+ +KL++++ EFL  R
Sbjct  213   KKRFEFLAWITLSLSFTTEDLLRDIIQQLSHVLRGPDLQGVDNMDNDKLRIVINEFLKER  272

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +Y+IV D+V  A+ W+  + VLP  +   R +++TR   VA ++S    G +YE++PLSE
Sbjct  273   RYLIVLDNVSNAKTWDDFEVVLPNNRCSSRILLTTRNQGVAFAASP---GRVYELSPLSE  329

Query  544   EVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
             E SW L CRK F  +  P +L ++L++IL RC GLPLAIVAIGGVLATK++  I++W  +
Sbjct  330   EESWTLFCRKIFQNNPYPPYLKDVLEKILMRCQGLPLAIVAIGGVLATKDRNRIDQWEMV  389

Query  724   YHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTME  903
               SLG   E N + +S   IL LS+NDLP YLK C +Y SI+P    IE+  L+  W  E
Sbjct  390   GCSLGAALEDNGRLKS---ILSLSYNDLPYYLKHCLLYFSIFPVGSPIEYMRLVRLWIAE  446

Query  904   GFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHN  1083
             GFVK K G T+EEVAE YL ELI RSL+  V+   DG +K  R+HD+  EII+ KS D +
Sbjct  447   GFVKAKEGMTLEEVAEDYLNELIKRSLVQVVETTTDGRLKTCRVHDILLEIIILKSRDQD  506

Query  1084  FVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS  1263
             F    +E+   WP+K R LS+H  + + +     + LRSLL F   DS   S V+ + S 
Sbjct  507   FSAIANEQNNMWPKKVRRLSIHNVIPSIKHILVASGLRSLLMFWRLDSLPESLVLNLSSR  566

Query  1264  -CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               R + VLDL+ T L+  P EI  L  L+YLSLR+TKV  +P SI KL+ LE LDLK+T+
Sbjct  567   RLRFLNVLDLEGTPLKKFPNEIVSLYLLKYLSLRNTKVNSIPSSIGKLKNLETLDLKHTY  626

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VTELP EILKL+ L HL+VY +   +    +   GF  P  +G L  L+KL ++EAN GN
Sbjct  627   VTELPAEILKLRKLHHLLVYRYEIESDDQIHTKYGFNVPAQIGNLQFLQKLCFLEANQGN  686

Query  1621  GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSP  1800
               I E+GKL +L+RL I+KL+ EDGKA+C SIE L  LR+L++ S+E+  V+D+  LSSP
Sbjct  687   NLIVELGKLKQLRRLGIVKLKREDGKALCLSIEMLRNLRALSITSVEDCEVIDMENLSSP  746

Query  1801  PPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYT  1980
             P  LQRLYL+G + K+P WI SL +LVK+  +WSKL DDPL  LQ LPNLVHLEF+  + 
Sbjct  747   PRFLQRLYLNGRLEKLPEWISSLDSLVKVVLKWSKLSDDPLLLLQHLPNLVHLEFVQVFD  806

Query  1981  GEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLF  2160
             GE + F A  F+ L+ L L+KL++L  ++I +GAMP LEKL++Q C  L  VP+GIE L 
Sbjct  807   GEILCFEAKGFKKLKFLGLNKLDKLNRIIIEQGAMPCLEKLIVQSCRSLQKVPSGIEHLT  866

Query  2161  NLRYLEFFDMTDDFISTFLP--DKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETSSGP  2334
              L+ LEFF+M  +FI    P  +K+G DY KV  + EVY+TYW DG W++ S++   +G 
Sbjct  867   ELKVLEFFNMPLEFIMALHPAEEKKG-DYWKVERVPEVYFTYWYDGNWDIISLESFKAGK  925

Query  2335  ETA  2343
              +A
Sbjct  926   NSA  928



>ref|XP_006368518.1| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
 gb|ERP65087.1| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
Length=974

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/804 (45%), Positives = 507/804 (63%), Gaps = 50/804 (6%)
 Frame = +1

Query  28    LLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKHFQS  201
             ++EE  IVGIE P+K LI  L++     +VISVVGMGG GKTTLV+ VY D  VKKHFQ 
Sbjct  157   IVEEANIVGIEKPKKLLIGWLVRGRSEREVISVVGMGGLGKTTLVRKVYHDADVKKHFQF  216

Query  202   HAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVIVF  381
               WIT+S +FK E++LKD+IQQLF  L++ VP+GM   + ++LK  +  FL +++Y+IV 
Sbjct  217   RVWITLSPSFKEEDLLKDIIQQLFRVLQKNVPQGM---DNDRLKTAINRFLQKKRYLIVL  273

Query  382   DDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSWAL  561
             DDVW A  W+A + V P    G   +++TR  +VA ++  +    +Y + PLS E SW L
Sbjct  274   DDVWHADAWDAFEPVFPNNSRGSHILLTTRKTEVALTACIEFPDKVYNLDPLSPEESWTL  333

Query  562   LCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSLGP  741
              C+  F  S CP HL  + ++IL RC GLPLAI A+ GVLAT++++ I+EW  +  SLG 
Sbjct  334   FCKMVFQNSHCPEHLKNVSERILGRCEGLPLAIEAMSGVLATRDRSKIDEWEKVCLSLGA  393

Query  742   DFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVKQK  921
              FE N++  +   IL LS+ DLP YLK C +Y S++PE   I+   LI  W  EGFVK +
Sbjct  394   GFEDNNRMRNALKILSLSYYDLPYYLKSCLLYFSMFPEGIPIQRMRLIRLWIAEGFVKGR  453

Query  922   AGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTTID  1101
              G T EEVAE +L ELI RSL+  V+    G +K  RIHDL REI+++K+ + +FV    
Sbjct  454   EGMTSEEVAEDFLNELIKRSLVQVVEATSYGQVKTCRIHDLLREILITKAKEQDFVAIAK  513

Query  1102  EETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSCRVIKV  1281
             E+   W EK R +S+H  + + +     ++LRSLL F   D           S  R++ V
Sbjct  514   EQNMIWSEKVRRVSIHNDMPSMRQIHVASRLRSLLVFWGKDYFPGPPKFISPSRSRLLTV  573

Query  1282  LDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTELPVE  1461
             LD++ T L+  P E+  L+ L+YLSLR+TKV  +P SI KL+ LE LDLK+  VTELPV+
Sbjct  574   LDMEGTPLKEFPNEVVSLIFLKYLSLRNTKVNSVPSSISKLQNLESLDLKHAQVTELPVD  633

Query  1462  ILKLQHLRHLIVY---SHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIE  1632
             ILKLQ LRHL+VY   +H S   +      GFKAP  +G L S++KL ++EA+ G   + 
Sbjct  634   ILKLQKLRHLLVYRYETHESDDQI--RNKHGFKAPAQIGNLLSVQKLCFLEADQGQKLMS  691

Query  1633  EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLL  1812
             E+G+L  L+RL ILK R EDGK +CSSI+KL  LR+L++ SI E  V+D+ YLSSPP  L
Sbjct  692   ELGRLIHLRRLGILKFRKEDGKDLCSSIDKLTNLRALSVTSITESEVIDLEYLSSPPQFL  751

Query  1813  QRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHM  1992
             QRLYL+G + ++P WI SL +LVK+  +WS+L++DPL  LQ+LPNLVHLE +  Y+GE +
Sbjct  752   QRLYLTGRLERLPDWILSLDSLVKLVLKWSRLREDPLLFLQNLPNLVHLELIQVYSGEAL  811

Query  1993  HFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRY  2172
             HF+   F+ L++L L+KLE L+++ + +GA+P L+KLV+Q C  L  VP+GI+ L  L+ 
Sbjct  812   HFSNEGFEKLKVLGLNKLERLKSITVQKGALPSLQKLVVQGCKLLQKVPSGIKHLAKLKT  871

Query  2173  LEFFDMTDDFIS-------------TFL---------------------------PDKRG  2232
             L+FFDM  DF+              TFL                           PD  G
Sbjct  872   LDFFDMPYDFVKRLRPDGTAQRAGRTFLQKSVVQFIKIVQILPFDAPNDFIRRLHPDGDG  931

Query  2233  EDYCKVSHISEVYYTYWKDGCWEV  2304
             EDY +V ++ E+Y TY K+G WE+
Sbjct  932   EDYHEVRNVPEIYCTYQKNGNWEI  955



>gb|KCW78487.1| hypothetical protein EUGRSUZ_D02629, partial [Eucalyptus grandis]
Length=914

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/770 (46%), Positives = 505/770 (66%), Gaps = 17/770 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R DALL+E+ ++VGI  P+KEL+  L++     +VISVVGMGG GKTTLVK VYDD 
Sbjct  153   QDHRGDALLVEKSDLVGIGEPKKELVEWLVQGASQCQVISVVGMGGLGKTTLVKQVYDDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKK F   AW+T+S + + +E+L DM++Q+ + + + +P G  +  ++ +++++K+FL 
Sbjct  213   AVKKRFTVRAWVTLSPSSRTDELLSDMLRQVASSITKTLPSGAETSKSSCVRMMIKDFLR  272

Query  358   RR--KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMT  531
              R  KY+IV DDVW    W+A+K  +P   +G R M++TR  D+AS+S T   G +Y M 
Sbjct  273   ERRLKYLIVLDDVWDMNKWDAVKCAIPNNNNGSRIMVTTRKSDLASASGTGCAGKVYNMK  332

Query  532   PLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             PLS E S  L CRK F   +CPSHL EI +QILK+C GLPLAIV I GVLATK+   I+E
Sbjct  333   PLSSEQSHELFCRKTFKEKACPSHLEEICRQILKKCEGLPLAIVVISGVLATKDIRRIDE  392

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W  +  SL  + +GN++ ++L+ +L LSF+DLP YLK CF++LSI+PE  ++E   +I  
Sbjct  393   WELVLRSLRSEIDGNEKLKNLKQVLSLSFSDLPYYLKSCFLHLSIFPEALVVERMRIIRL  452

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EGFV++K GKT+EEVAE YL EL+NRSLI   +   DG +K+ R+HDL  EII+ K+
Sbjct  453   WVAEGFVERKEGKTLEEVAEDYLDELLNRSLIQVAETTSDGRVKKCRVHDLLLEIIIPKA  512

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              D N+   + E    WPE+ R LS+H     A+  R  + LRSL TF V +S     VV 
Sbjct  513   RDQNYAIIVHEHRGPWPERVRRLSIHKAFQIARENRSLSCLRSLFTFGVDESS----VVD  568

Query  1252  ILSS-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              LSS   ++ VLDL+   +   P ++  +  LR+LSLRS++++ +P SI  L+ LE LDL
Sbjct  569   ALSSELNLLSVLDLEHAPVSRFPGQVLNMKCLRFLSLRSSRIRTIPSSIGNLQNLETLDL  628

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSH--VSFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             K T V  LPVEI KLQ LRHL+VY +  +S+ +  Y    GFK P  +G L SL+KL ++
Sbjct  629   KDTHVIALPVEIAKLQQLRHLLVYRYENISYTHNKY----GFKTPADIGALRSLQKLCHI  684

Query  1603  EANP--GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             E +       I  +GKLN+L+RL +L+LR EDG+ +CSSI KL  L SL + +  +D  +
Sbjct  685   EVDDERDGRNITGLGKLNQLRRLGVLRLRREDGRNLCSSIAKLTNLSSLAVFAFTDDEEI  744

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             D+++LSSPP LLQR++L G++  +P WI +L NLVK+  R S L+DDPLE LQ+LP+LVH
Sbjct  745   DLHHLSSPPQLLQRIFLRGHLRTLPSWIANLHNLVKLCLRMSCLRDDPLESLQNLPSLVH  804

Query  1957  LEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
             L  L  Y  + + F A  F  L++L LD  EEL  + + +GAMP LEKL++ RC  L  +
Sbjct  805   LVLLHAYNWQTLCFKAKGFMKLKILGLDLFEELEFIQVEKGAMPCLEKLMVLRCKLLKDL  864

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWK  2286
             P GIE L  L+ LEFF++  + +    PD++ +DY KV+H+ E+ Y YW+
Sbjct  865   PLGIEHLNMLKVLEFFELPCELVQKLKPDEQNKDYQKVAHVPEIRYAYWR  914



>ref|XP_010054887.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=924

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/779 (46%), Positives = 509/779 (65%), Gaps = 11/779 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D+  DALLLE+ ++VGIE P+++L+  L+K     ++I VVGMGGSGKTTL+K V+DD 
Sbjct  141   HDQCGDALLLEKADLVGIEEPQEQLVKRLVKGPSEKEIIPVVGMGGSGKTTLIKQVFDDP  200

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AW+T+S + + EEVL+DM+QQ+ + + + VP G  +++++ LK++++  L 
Sbjct  201   AVKKHFTICAWVTLSPSSRTEEVLRDMLQQIASSIMESVPSGTDTLSSDLLKMMIRSLLQ  260

Query  358   -RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
              R +Y+I+ DDVW    W+A+K+V P  K+G R M++TR + +ASSS  +  G +Y M P
Sbjct  261   GRSRYLIILDDVWRVDDWDAVKYVFPNNKNGSRIMMTTRDVKIASSSCKEYAGEVYFMKP  320

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             L  E SW L C K F   SCPS+L EI + IL++C GLPLAIVAI G+LATK+   I+EW
Sbjct  321   LRAEQSWKLFCMKTFKGDSCPSNLKEICESILRKCEGLPLAIVAISGILATKDSDKIDEW  380

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               ++ S+  + + ND+ ++L+ +L LSFN LP +LK CF++LS++P D  IEH  LI  W
Sbjct  381   HLVHRSIRSEIDSNDRLKNLKKVLSLSFNALPYHLKPCFLHLSVFPTDKQIEHMRLIRLW  440

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EG V+ K  KT EEVAE YL ++++RSLI   +L  DG +K  R+HDL  EI   KS 
Sbjct  441   VAEGLVETKEVKTPEEVAEEYLKDVLSRSLIQAAELTSDGRVKMYRVHDLLWEISSMKSK  500

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             D NF T +DE+ A W ++ R LSVH  L +AQ      +LRSL  F V+ S  +     +
Sbjct  501   DRNFATVVDEQHAGWTDRVRRLSVHKILQSAQQNEPLWQLRSLFMFGVSKSSLNRVFSSV  560

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
             L   +++++LDLQ   L+  P ++     LRYL+LR TK+  LP SI  L+ LE LDLK+
Sbjct  561   L---KLLRILDLQGAPLKRFPTQVIDSHLLRYLNLRCTKLHTLPSSIGMLQNLETLDLKH  617

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             TF+T LP EI KL  LRHL+VY + + AY   +   GF+    +G L  L+KL YVE + 
Sbjct  618   TFITVLPAEITKLHRLRHLLVYRYENIAY--SHSKYGFETLGEIGVLQCLQKLCYVEVDD  675

Query  1615  GNGT--IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                   I EIGKL +L+RLCILKL+ EDG+ +C SI KL  LR+L++ S  +D  +D+  
Sbjct  676   KKSRILIREIGKLIQLRRLCILKLKKEDGRKLCLSIAKLTNLRALSVSSF-KDAEIDLQS  734

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             +SSPP  LQR++++G + K+P WI  L NL K+  +WS L  DP+  LQ LP+L+HLE L
Sbjct  735   ISSPPQFLQRVFITGKLQKLPLWIAKLHNLAKLKLKWSHLDKDPMLILQSLPSLIHLELL  794

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y    + F A  F+ L++L LD  EELR + + +GAMP LEK  IQRC  L ++P+GI
Sbjct  795   QAYDWYKLCFKAEGFKKLKILGLDFFEELRFIQVEKGAMPCLEKWSIQRCKCLKNIPSGI  854

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQETS  2325
             E L  L+ LE FDM D+ I    P+++ E+Y KV+HI E+ Y YW++G W+V SV+  +
Sbjct  855   EYLSKLKVLELFDMPDELIKKLKPEEQDEEYGKVTHIPELSYGYWRNGAWDVKSVETAA  913



>emb|CAN75824.1| hypothetical protein VITISV_004157 [Vitis vinifera]
Length=1512

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/755 (50%), Positives = 499/755 (66%), Gaps = 31/755 (4%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDVK  186
             D R DALL+E  E+VGI+ P+++LI +LL D    KV+SVVGMGG GKTTLVK VYDDVK
Sbjct  134   DSRGDALLVEXSELVGIDKPKQKLIGMLLDDVSRTKVVSVVGMGGLGKTTLVKKVYDDVK  193

Query  187   --KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
               K FQ HAW+TVS + K+E++L+D+IQQLF E  +P                       
Sbjct  194   VEKSFQHHAWVTVSSS-KIEDLLRDLIQQLFEEGGKP-----------------------  229

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              KY+IV DDVW   +WE++K+  P  + G R +++TR  DVA  S  +++G ++ + PL 
Sbjct  230   -KYIIVLDDVWRIFMWESVKYAFPNSRRGSRILVTTRNSDVAGCSCVESDGDVFPLNPLP  288

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
                SW L CRKAF  ++CP HL ++ + ILKRC GLPLAIVAIGGVLATK++  ++EW  
Sbjct  289   PTESWTLFCRKAFRRNACPPHLNKLSQGILKRCEGLPLAIVAIGGVLATKDQNRMDEWDI  348

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SL  + E ND+ E +  IL L +NDLP YLK CF+YLSI+PEDHLIEH  LI  W  
Sbjct  349   VDRSLSSELESNDKLERVNKILSLGYNDLPYYLKHCFLYLSIFPEDHLIEHKRLIRLWIA  408

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV  + GK  EEVAE YL +L NR LI   + + DG +K  RIHDL R+II+SKS D 
Sbjct  409   EGFVVPQEGKIPEEVAESYLRDLTNRCLIQVAQRDVDGRIKTYRIHDLMRQIIISKSRDQ  468

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             +FVT I E   A P KARHLS  GTL     +++   +RSLL F V DS   S +  + S
Sbjct  469   DFVTIIRENNTATPNKARHLSARGTLETC-TRQEFPGVRSLLIFGV-DSVSKSCMSALFS  526

Query  1261  SCR--VIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
               R  +++VLDL+   LE  PE +  L HLRYLSLR TKV +LP SI KL  LE LDLK 
Sbjct  527   GDRFGLLRVLDLRGLPLEKFPEGVVNLFHLRYLSLRGTKVDILPSSIGKLPYLETLDLKQ  586

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T V++LP EI KLQ+LRHL++Y  V  +Y+ ++   GF  P+ +G L  L+KL +VE + 
Sbjct  587   TKVSKLPAEIQKLQNLRHLLLYRCVIVSYVTFHSKEGFLMPERIGDLQFLQKLCFVEPDQ  646

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             G  T+ E+GKL++L++L I+KLR EDG+++CSSIEK+  L SL++ S++E+ ++D+N+LS
Sbjct  647   GGHTLSELGKLSQLRKLGIVKLRKEDGRSLCSSIEKMKNLCSLDVTSLQEEEIIDLNHLS  706

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             S P LL+ LYL G +  +P WI +L NL KI  RWS+LK++PLE LQ LPNLV L+ L  
Sbjct  707   SLPLLLKGLYLKGRLEDLPGWIPTLDNLSKISLRWSRLKNNPLEALQALPNLVQLQLLHA  766

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y GE + F AG FQ L+ L LD LEELR V +  GA+  L++L I RC  L  +P GI+ 
Sbjct  767   YEGEALCFKAGGFQKLKSLKLDGLEELRKVSVEWGALTCLQELSILRCLALKQLPFGIQY  826

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHI  2259
             L  L+ L F+DM D+F  T L  ++G DY K+ HI
Sbjct  827   LSQLQQLCFYDMPDEFARTLLRAEQGYDYWKIKHI  861



>ref|XP_010054923.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=951

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/804 (44%), Positives = 510/804 (63%), Gaps = 29/804 (4%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R DALL  + ++VGIE P+K+LI  +++  P  +++SVVGMGG GKTTLVK  Y+D 
Sbjct  153   QDHRGDALLFAQKDLVGIEKPKKKLIEWMIEGRPGRQIVSVVGMGGLGKTTLVKQAYEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSM------NANKLKVI  339
              VKK F + AW+T+S + + E VL+DM+QQ+    ++PVPEG+ ++      N + LK +
Sbjct  213   LVKKLFATRAWVTLSPSSETEGVLRDMLQQITGGRRKPVPEGIPALDGLDVSNRDLLKTL  272

Query  340   VKEFLLRR--KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNG  513
             +K  L     +Y+IV DDVW    W+ +K+VLP ++   R +++TR  D+A ++ T+  G
Sbjct  273   IKNMLQESGTRYLIVLDDVWQLDRWDDVKYVLPNDEQDSRIILTTRKTDLALNACTEFTG  332

Query  514   YIYEMTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKN  693
              ++ M PLS+E SW L C + F  +SCP +L +I + IL+ C GLPLAIVA+ G+LATK+
Sbjct  333   EVHNMEPLSDEQSWELFCMRTFRDNSCPLYLEKICRSILRNCEGLPLAIVAVSGILATKD  392

Query  694   KTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEH  873
             +  I+EW  +  SL     GN     L+ +L LSFNDLP YLK CF++LS++PEDH IE 
Sbjct  393   QGRIDEWAKVCRSL----HGNVGLNKLKKVLSLSFNDLPHYLKSCFLHLSVFPEDHKIER  448

Query  874   NSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYRE  1053
               LI  W  EGFV+ K G+T EEVAE YL +L+NRSL+   +   DG ++  RIH   ++
Sbjct  449   MRLIRLWMAEGFVEPKEGETPEEVAEDYLNDLLNRSLLQVAETTTDGRVQMCRIHHHLQK  508

Query  1054  IILSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQF  1233
             I ++KS + N+    D++     +  R+LS+H  L  ++     ++LRS   F + +S  
Sbjct  509   ICITKSKERNYTIVRDKQCPERLDGTRYLSIHKLLEISRQNMNHSELRSPFIFKLDESS-  567

Query  1234  SSHVVQILSSC--RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLR  1407
                 + ++ SC  +++ VLD Q   L+  P ++  +  LRYL+LR+T+VK +PRSI  L+
Sbjct  568   ----INMVLSCDFKLVWVLDFQGAPLKRFPMQVLDMHFLRYLNLRNTEVKTIPRSIGWLQ  623

Query  1408  MLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsle  1587
              LE LDLK++ VTELPVEI+KLQ LRHL+VY +   +Y  Y+   GFK    +G L +L+
Sbjct  624   HLETLDLKHSKVTELPVEIIKLQKLRHLLVYRYEQDSY--YHTKHGFKTLAEIGTLQNLQ  681

Query  1588  klVY--VEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIE  1761
             KL Y  V+ +  +  I E+GKL++LKRLCILKL+ EDGK +CSSI +L  L SL++ S  
Sbjct  682   KLCYIVVDDDGSSTIITELGKLHQLKRLCILKLKKEDGKNLCSSIAELTNLLSLSVSSFT  741

Query  1762  EDVVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDL  1941
             +D  +D+ +LSSPPPLLQR+YL G +  +PHWI +L++LV ++ RW +L+DDPL  L  L
Sbjct  742   DDEEIDLGHLSSPPPLLQRIYLRGRLHTLPHWIANLQSLVILHLRWCQLRDDPLIPLTSL  801

Query  1942  PNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCN  2121
             PNLVHLE L  +  E +      F+ L++L LD  E L  +    GAMP LEKL+I RC 
Sbjct  802   PNLVHLELLQAHNWETLTLTKEGFKKLKILALDHFENLTFIGFENGAMPCLEKLMISRCE  861

Query  2122  QLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWE  2301
              L +VP+GIE L  L+ LEFF M D  I      ++ EDY +VSHI E+ Y YW DG W+
Sbjct  862   LLKNVPSGIEYLTKLKLLEFFVMPDTLIKKLKLGQQDEDYKRVSHIPELRYGYWTDGGWD  921

Query  2302  VNSVQET----SSGPETAVKISGR  2361
             V  ++ T    SS P      S +
Sbjct  922   VKWIERTGEEKSSHPRRTDATSSK  945



>ref|XP_010271768.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Nelumbo 
nucifera]
Length=931

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/778 (48%), Positives = 507/778 (65%), Gaps = 18/778 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DALLL+E E+VGI  P++E+I  +++D+  L VISVVGMGG GKTTLVK VYDD 
Sbjct  156   HDIREDALLLDEAELVGIGKPKEEIIGWIVEDESKLGVISVVGMGGLGKTTLVKKVYDDQ  215

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQL-FAELKQPVPEGMGSMNANKLKVIVKEFL  354
              VK+HFQ+ AW+T S++  + E+L +MI+QL +AE KQP+P+ +  M   +LK +++EFL
Sbjct  216   RVKRHFQTQAWVTFSESPGIHELLIEMIKQLVYAEQKQPIPQDVAEMKDAQLKQLLQEFL  275

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
              +++YV+V DD+W+   W+++K+V P    G R +I+TR  DVASS    +   +Y + P
Sbjct  276   KQKRYVVVLDDIWSIPAWDSVKNVFPNNNFGSRIIITTRSNDVASSC-IKSCFRVYNLQP  334

Query  535   LSEEVSWALLCRKAFHASS---CPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNI  705
             LS+E SW L C+K F  S    CP  L    + I+K+CGGLPLAIV +GGVL+TK K   
Sbjct  335   LSQEESWTLFCKKTFSFSPEQICPPELEVPSQSIVKKCGGLPLAIVTVGGVLSTKPKIT-  393

Query  706   NEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLI  885
              EW     SLG +   +D+ + +  IL LS+NDLP +LK CF+ LS++PED LI+   LI
Sbjct  394   TEWEMFNRSLGAELNLDDRLKGMMKILSLSYNDLPYHLKSCFLCLSMFPEDELIDRMRLI  453

Query  886   YQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLI-LPVKLNDDGSMKQGRIHDLYREIIL  1062
               W  EGF+++  GKT+EE  E Y  EL+NRSLI +  K +DDG +   RIHDL RE IL
Sbjct  454   RIWMAEGFIQRIQGKTLEEAGESYFSELVNRSLIQVANKADDDGRVIDCRIHDLIREFIL  513

Query  1063  SKSTDHNF--VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQF-  1233
             SK+ D +F  ++  D +      K RHLS+HG+        + T LRSL  F   D+ F 
Sbjct  514   SKARDQSFGAISNADGQDVMVDGKIRHLSIHGSCQWGVENEKFTHLRSLFMFR-QDATFN  572

Query  1234  -SSHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRM  1410
              S       S  +++KVLDL+   L++  EE   L HLRYL LR+TKVK++P SIKKL+ 
Sbjct  573   ISRCSTAFFSRLKLLKVLDLRHAPLDVFLEEFTDLFHLRYLCLRNTKVKMVPNSIKKLQN  632

Query  1411  LEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNC-SPGFKAPkglgklgsle  1587
             LE L+LKYT+V+ELPV IL L  LRHLIVY + ++  L Y    PGFKAP G+G + SL+
Sbjct  633   LETLNLKYTYVSELPVGILNLHKLRHLIVYRY-NYGPLYYTFHQPGFKAPSGIGDMISLQ  691

Query  1588  klVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED  1767
             KL  VEAN G+  I E+GKL +LKRL I KL+TEDG+ +CSSIEK+  L SL + ++ E+
Sbjct  692   KLCCVEANTGSDLITELGKLVQLKRLEIRKLKTEDGRHLCSSIEKMSCLHSLTIAALHEE  751

Query  1768  VVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPN  1947
              +LD+ +L SPPP L+RL L+G + K+P WI SL NL  I  RW K KDDPL  LQ LPN
Sbjct  752   EILDLQHLFSPPPFLRRLLLTGRLEKLPDWIGSLHNLTTIDLRWCKFKDDPLGDLQALPN  811

Query  1948  LVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL  2127
             L  +  +  Y G+ + F  G FQ L  LNL+ L+ LR V + EGA+P+LE L IQ C  L
Sbjct  812   LTTMLLIDTYDGKKLCFRRGGFQRLNYLNLNNLQGLRRVSVEEGALPNLENLHIQHCRVL  871

Query  2128  ASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWE  2301
               VP GIE L  LRY+ F +++++F+       +GED  +V+HI  V + Y + G WE
Sbjct  872   EKVPLGIEHLSKLRYVLFDNLSEEFMMKI--GTQGEDSWRVAHIPVVDFWYQEYGRWE  927



>gb|KCW78491.1| hypothetical protein EUGRSUZ_D02634, partial [Eucalyptus grandis]
Length=880

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/754 (46%), Positives = 487/754 (65%), Gaps = 12/754 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D+R +ALL+E+ ++VGIE P ++L+  L+K  P  ++  VVGMGGSGKTTL+K V+DD 
Sbjct  133   QDQRGNALLVEKADLVGIEEPLEQLVKRLVKGPPEKEITPVVGMGGSGKTTLIKQVFDDP  192

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AW+T+S   + EEVL+DM+QQ+ + + +  P G  +++ + LK+++K  L 
Sbjct  193   AVKKHFTIRAWVTLSPYSRTEEVLRDMLQQIASSIMKSAPGGTDNLSTDLLKMMIKSLLQ  252

Query  358   RRK--YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMT  531
             RR+  Y+I+ DDVW    W+AIK+  P  ++G R MI+TR   +A SS  +  G ++ M 
Sbjct  253   RRRSRYLIILDDVWQVGEWDAIKYAFPNNQNGSRIMITTRDAMIALSSCKEFAGEVHNMK  312

Query  532   PLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             PL  E SW L C K F  S CP +L EI + IL++C GLPLAIVAI G+LATK+  NI+E
Sbjct  313   PLHAEQSWKLFCMKTFKGSRCPPNLEEICEYILRKCEGLPLAIVAISGILATKDNNNIDE  372

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W  +  S+  + +GND+  +L+ +L LSFN LP +LK CF++LS++P D  IEH  LI  
Sbjct  373   WHLVRQSIRSELDGNDRLMNLKKVLSLSFNALPYHLKSCFLHLSVFPRDQPIEHMRLIRI  432

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EG V+   GKT E VAE YL +L++RSLI   +L  DG +K  R+HDL  EI  +KS
Sbjct  433   WVAEGLVETTEGKTPEAVAEEYLKDLLSRSLIQVAELTSDGKVKMYRVHDLLWEISSTKS  492

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              + NF   +DE+ AAW ++ R LSVH TL  A       +LRSL  F V+ S  +   + 
Sbjct  493   KERNFAAVVDEQHAAWTDRVRRLSVHKTLQTAGQNEPLWQLRSLFMFGVSKSSIN---IV  549

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             + S  ++++VLDLQ   L   P ++     L YL+LR TK++ +P SI  L+ LE LDLK
Sbjct  550   LSSGPKLLRVLDLQGAPLRRFPTQVIDFHLLSYLNLRCTKIQKIPSSIGMLQNLESLDLK  609

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             +TF++ LPVEI KLQ LRHL+VY + + AY   +   GFK    +G L  L+KL Y+EA+
Sbjct  610   HTFISVLPVEITKLQRLRHLLVYRYENIAY--SHRKFGFKTLGEIGALQCLQKLCYIEAD  667

Query  1612  PGNGT--IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
                    I +I KL +L+RLCILKL+ EDG  +C SI KL  LR+L++ S+ +D  +D+ 
Sbjct  668   GETSRILIRQIRKLVQLRRLCILKLKKEDGGKLCVSITKLTNLRALSVSSL-KDAEIDLQ  726

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              L SPP LLQR+YL G +  +PHWI  L +L K++ +WS L++DP+  LQ +PNLVHLE 
Sbjct  727   NLDSPPQLLQRVYLRGKLQTLPHWIAKLPSLAKLHLKWSHLEEDPMSALQSMPNLVHLEL  786

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             L  Y+ + + F A  F+ L++L LD  EEL  + + EGAMP LEK  IQRC  L +VP+G
Sbjct  787   LQVYSWQKLCFKAKGFKKLKILGLDCFEELTLIQVEEGAMPCLEKWSIQRCKCLKNVPSG  846

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCK  2247
             IE L  L+ LE FDM D+ I    P+++ E+Y K
Sbjct  847   IEYLSKLKVLELFDMPDELIEKLKPEEQDEEYGK  880



>ref|XP_009591994.1| PREDICTED: disease resistance protein RPM1-like [Nicotiana tomentosiformis]
Length=596

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/411 (69%), Positives = 340/411 (83%), Gaps = 2/411 (0%)
 Frame = +1

Query  1     ANDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD  180
             A+DRR DALLLEE EIVGIENPR++LIS L++DDPTLKV+SVVGMGGSGKTTL K VY+D
Sbjct  175   AHDRRGDALLLEEGEIVGIENPRQQLISWLVEDDPTLKVVSVVGMGGSGKTTLAKKVYED  234

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               VKK+F S AWITVSQ+FK EEVL DMIQQL+ E+KQPVP+G+ +M++N+LK + K FL
Sbjct  235   AAVKKYFNSVAWITVSQSFKAEEVLIDMIQQLYDEVKQPVPKGLSTMSSNRLKALAKVFL  294

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
               R+YV+VFDDVWT + WEAI++VLP   +G R +++TRL DVAS  S + NGY+YE+ P
Sbjct  295   QSRRYVLVFDDVWTIQAWEAIRYVLPDVNNGSRVIVTTRLFDVASFCSIECNGYVYELKP  354

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             LS E +W+L C+KAFH + CPSHL  I ++ILK+CGGLP AIVAIGGVLATK+ TNI EW
Sbjct  355   LSAEETWSLFCQKAFHGNLCPSHLESICRKILKKCGGLPRAIVAIGGVLATKSWTNIREW  414

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
             G L HSLGP+ + ND+F S+RI+LLLSFNDLP YLK CF+YLSIYPEDHLIE N+LIY+W
Sbjct  415   GMLNHSLGPELDSNDKFGSMRIVLLLSFNDLPYYLKPCFLYLSIYPEDHLIERNTLIYRW  474

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFVKQK G+TVE+VAEGYL ELINRSL+ PV+ NDDGSMK GRIHDLYRE+ILSKS 
Sbjct  475   ITEGFVKQKEGRTVEDVAEGYLNELINRSLLHPVQYNDDGSMKLGRIHDLYRELILSKSR  534

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDS  1227
             D NF  T++E+T  WPEK R LS+HGTLGN Q+KR  TKLRS LTF V+ S
Sbjct  535   DDNFTATVNEQTTLWPEKTRRLSIHGTLGNLQVKRSATKLRSFLTFGVSRS  585



>gb|KCW78242.1| hypothetical protein EUGRSUZ_D02431, partial [Eucalyptus grandis]
Length=914

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/767 (46%), Positives = 501/767 (65%), Gaps = 11/767 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D+  DALLLE+ ++VGIE P+++L+  L+K     ++I VVGMGGSGKTTL+K V+DD 
Sbjct  154   HDQCGDALLLEKADLVGIEEPQEQLVKRLVKGPSEKEIIPVVGMGGSGKTTLIKQVFDDP  213

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AW+T+S + + EEVL+DM+QQ+ + + + VP G  +++++ LK++++  L 
Sbjct  214   AVKKHFTICAWVTLSPSSRTEEVLRDMLQQIASSIMESVPSGTDTLSSDLLKMMIRSLLQ  273

Query  358   -RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
              R +Y+I+ DDVW    W+A+K+V P  K+G R M++TR + +ASSS  +  G +Y M P
Sbjct  274   GRSRYLIILDDVWRVDDWDAVKYVFPNNKNGSRIMMTTRDVKIASSSCKEYAGEVYFMKP  333

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             L  E SW L C K F   SCPS+L EI + IL++C GLPLAIVAI G+LATK+   I+EW
Sbjct  334   LRAEQSWKLFCMKTFKGDSCPSNLKEICESILRKCEGLPLAIVAISGILATKDSDKIDEW  393

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               ++ S+  + + ND+ ++L+ +L LSFN LP +LK CF++LS++P D  IEH  LI  W
Sbjct  394   HLVHRSIRSEIDSNDRLKNLKKVLSLSFNALPYHLKPCFLHLSVFPTDKQIEHMRLIRLW  453

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EG V+ K  KT EEVAE YL ++++RSLI   +L  DG +K  R+HDL  EI   KS 
Sbjct  454   VAEGLVETKEVKTPEEVAEEYLKDVLSRSLIQAAELTSDGRVKMYRVHDLLWEISSMKSK  513

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             D NF T +DE+ A W ++ R LSVH  L +AQ      +LRSL  F V+ S  +     +
Sbjct  514   DRNFATVVDEQHAGWTDRVRRLSVHKILQSAQQNEPLWQLRSLFMFGVSKSSLNRVFSSV  573

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
             L   +++++LDLQ   L+  P ++     LRYL+LR TK+  LP SI  L+ LE LDLK+
Sbjct  574   L---KLLRILDLQGAPLKRFPTQVIDSHLLRYLNLRCTKLHTLPSSIGMLQNLETLDLKH  630

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             TF+T LP EI KL  LRHL+VY + + AY   +   GF+    +G L  L+KL YVE + 
Sbjct  631   TFITVLPAEITKLHRLRHLLVYRYENIAY--SHSKYGFETLGEIGVLQCLQKLCYVEVDD  688

Query  1615  GNGT--IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
                   I EIGKL +L+RLCILKL+ EDG+ +C SI KL  LR+L++ S  +D  +D+  
Sbjct  689   KKSRILIREIGKLIQLRRLCILKLKKEDGRKLCLSIAKLTNLRALSVSSF-KDAEIDLQS  747

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             +SSPP  LQR++++G + K+P WI  L NL K+  +WS L  DP+  LQ LP+L+HLE L
Sbjct  748   ISSPPQFLQRVFITGKLQKLPLWIAKLHNLAKLKLKWSHLDKDPMLILQSLPSLIHLELL  807

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y    + F A  F+ L++L LD  EELR + + +GAMP LEK  IQRC  L ++P+GI
Sbjct  808   QAYDWYKLCFKAEGFKKLKILGLDFFEELRFIQVEKGAMPCLEKWSIQRCKCLKNIPSGI  867

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKD  2289
             E L  L+ LE FDM D+ I    P+++ E+Y KV+HI E+ Y YW++
Sbjct  868   EYLSKLKVLELFDMPDELIKKLKPEEQDEEYGKVTHIPELSYGYWRN  914



>gb|KCW72847.1| hypothetical protein EUGRSUZ_E01301 [Eucalyptus grandis]
Length=950

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/766 (45%), Positives = 495/766 (65%), Gaps = 10/766 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D+R +ALLL++ E+VGI  P K+L+  L++   T +VISVVGMGG GKTTLVK VY+D 
Sbjct  152   QDQRGNALLLDKAELVGISEPTKKLVGWLIEGASTRQVISVVGMGGLGKTTLVKQVYEDP  211

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AW T+SQ+  +EE+L+ M++Q+    +QPVP    +++    K+I+K+ L 
Sbjct  212   EVKKHFMVRAWTTLSQSPNIEEILQGMVRQIMRHTQQPVPPIEDNVDRLYQKMIIKDLLQ  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
               +Y+I+ DD W    W+AIKH LP    G R +I++R  D+A +S  +  G +Y+M PL
Sbjct  272   NARYLIIIDDAWRMNDWDAIKHALPNNNCGSRIIITSRNSDLAHTSCGEFGGMVYKMEPL  331

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C K F  +SCP HL E  + IL++C GLPLAIVAI GVL +K+    +EW 
Sbjct  332   PAEESWKLFCAKTFQGNSCPHHLEETCRLILRKCKGLPLAIVAISGVLVSKDTRKKDEWD  391

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  +   ND+F + + +L LSF+DLP YLK CF++LS++P  +LI    LI QW 
Sbjct  392   LVRQSLHTEVNCNDKFRTFKRVLSLSFDDLPYYLKSCFLHLSVFPRGYLISCGKLIRQWI  451

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV +K G TVEEVA  YL+ELINRSLI       DG +    +HD   +II SKS++
Sbjct  452   AEGFVDKKEGMTVEEVARDYLYELINRSLIEVAAQRGDGRIMYCSVHDFLLDIITSKSSN  511

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             H F  T  ++   WP+K R LS+       Q +R  ++LRSL  F V   + SS    + 
Sbjct  512   HGFAETAIDKHHKWPDKVRRLSIQNGQQAMQQRRSLSRLRSLYMFGV---ERSSTDAVLG  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  R++ VLDLQ+  L  +P ++ +  H+RYLS R +KV+ +P SI KL+ LE LDLK T
Sbjct  569   SEMRLLTVLDLQTAPLTRIPAQVAEWCHMRYLSFRYSKVRTVPNSIAKLQNLETLDLKQT  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPY-NCSPGFKAPkglgklgsleklVYVE-AN  1611
             +VTELPVEILKLQ LRHL++Y +  ++   Y NC  GFK P+ +G L SL+K+ ++   N
Sbjct  629   YVTELPVEILKLQQLRHLLIYRYRWYSNGWYSNC--GFKCPEEIGALQSLQKISFIRVGN  686

Query  1612  PGNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
               N + I E+GKL +L RL I+KLR E  + +CSSIEKL KL++L++ S++E+ ++D+  
Sbjct  687   ERNSSLIRELGKLKQLNRLGIVKLRKESARELCSSIEKLTKLQALSISSVDENEIIDLQP  746

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             LS+PP  LQRLYL+G +G +P WI SL +L+ +  + S+LKD PL  L +LPNLV+L+ +
Sbjct  747   LSTPPSFLQRLYLTGRLGALPRWISSLDSLMVLKLKHSQLKDSPLSSLGNLPNLVNLQLI  806

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y G  + FNA  F  L++L+L   ++L+ V + +G+MP LE L+I+ C  +  +P+GI
Sbjct  807   QAYEGTKLRFNANSFLKLQVLSLGCFDKLKCVEVEKGSMPCLESLLIRSCKLMEELPSGI  866

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWK  2286
             E L  L  L F +M D+F+     D + + Y K++H+ EVYY YW+
Sbjct  867   EQLEKLTRLRFINMPDEFVKKLTQDGQDDYYLKLAHVPEVYYGYWR  912



>ref|XP_010056222.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=923

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/771 (45%), Positives = 491/771 (64%), Gaps = 9/771 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D+R +ALLL++ E+VG+  P K L+  L++   T +VISVVGMGG GKTTLVK VY+D 
Sbjct  151   QDQRGNALLLDKAELVGVSEPTKNLVGWLIEGASTRQVISVVGMGGLGKTTLVKQVYEDP  210

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AW+T+SQ+  +EE+L+ M++Q+    ++PVP    +M+    K+I+K+ L 
Sbjct  211   EVKKHFMIRAWMTLSQSPNIEELLQGMVRQIMRHTQEPVPPLEYNMDRLCQKMIIKDLLQ  270

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
               +Y+I+ DD W    W+AIKH LP    G R +I++R  D+A +S  +  G +Y+M PL
Sbjct  271   NARYLIIVDDAWHINDWDAIKHALPNNNCGSRIIITSRNSDLAYTSCGEFTGMVYKMGPL  330

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C K F  +SCP HL E  + IL++C GLPLAIVAI GVL +K+    NEW 
Sbjct  331   PAEQSWKLFCAKTFQGNSCPPHLEETCRLILRKCEGLPLAIVAISGVLVSKDTRKKNEWD  390

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              ++ SL  + + ND+F++L+ +L LSF+DLP YLK CF++LS++P  +LI+   L+  W 
Sbjct  391   LVHRSLRTEIDCNDKFKALKRVLSLSFDDLPYYLKSCFLHLSVFPRGYLIKRGRLLRLWI  450

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV +K G T EEVA  YL EL++RSL+       DG ++  R+HD   +II SKS+ 
Sbjct  451   AEGFVDKKEGMTEEEVAHSYLNELMSRSLVEMAIKTIDGRIEYCRVHDFLLDIITSKSSI  510

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     E+   WP+K R LS+  +L + Q KR  ++LRSL  F V  S ++  V+   
Sbjct  511   QGFAEIAIEKHHKWPDKVRRLSIQNSLQSIQQKRSLSQLRSLYIFGVERS-YTDAVLG--  567

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  R++ VLDLQ+ SL   P +  +   LRYLS R +KV+ +P SI KL+ LE LDLK T
Sbjct  568   SEMRLLTVLDLQTPSLTRFPAQFAEWCFLRYLSFRGSKVRAVPNSIGKLQNLETLDLKNT  627

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN-P  1614
              VTELPV ILKLQ LRHLI+  H   A  P+    GFK  + +  L  L+KL Y+EA   
Sbjct  628   HVTELPVFILKLQRLRHLIIL-HRRKAPYPW-FRYGFKFLEEMVALQFLQKLYYIEAGEE  685

Query  1615  GNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              NG++  E+GKL +L +L ILKLR E G+ +CSSIEKL KL+S++L S+ E+ ++D+  L
Sbjct  686   RNGSLMRELGKLKQLSKLAILKLRKEHGRELCSSIEKLTKLQSISLTSVNENEIIDLQPL  745

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPPP L+R+ L+G +  +PHWI SL +L+ +  R+S+LKD+PL  L +LPNLV LE + 
Sbjct  746   SSPPPFLRRINLAGCLDALPHWISSLDSLMVLELRYSRLKDNPLSSLGNLPNLVCLELVQ  805

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + FN   F  LR+L L   E    V + +G+MP LE L ++ C  +  +P+GI+
Sbjct  806   AYEGTKLRFNTNNFMKLRILVLGPFERPERVEVEKGSMPCLEDLTMESCKLMEKLPSGID  865

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEV  2304
              L  L  L+F DM D+ +     D + +DY KV+H+ EVYY Y +DG W V
Sbjct  866   HLEKLEVLKFIDMPDELVKKLRRDGQDDDYLKVAHVPEVYYGYRRDGGWHV  916



>ref|XP_010058436.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=1074

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/766 (45%), Positives = 495/766 (65%), Gaps = 10/766 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D+R +ALLL++ E+VGI  P K+L+  L++   T +VISVVGMGG GKTTLVK VY+D 
Sbjct  152   QDQRGNALLLDKAELVGISEPTKKLVGWLIEGASTRQVISVVGMGGLGKTTLVKQVYEDP  211

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AW T+SQ+  +EE+L+ M++Q+    +QPVP    +++    K+I+K+ L 
Sbjct  212   EVKKHFMVRAWTTLSQSPNIEEILQGMVRQIMRHTQQPVPPIEDNVDRLYQKMIIKDLLQ  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
               +Y+I+ DD W    W+AIKH LP    G R +I++R  D+A +S  +  G +Y+M PL
Sbjct  272   NARYLIIIDDAWRMNDWDAIKHALPNNNCGSRIIITSRNSDLAHTSCGEFGGMVYKMEPL  331

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C K F  +SCP HL E  + IL++C GLPLAIVAI GVL +K+    +EW 
Sbjct  332   PAEESWKLFCAKTFQGNSCPHHLEETCRLILRKCKGLPLAIVAISGVLVSKDTRKKDEWD  391

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  +   ND+F + + +L LSF+DLP YLK CF++LS++P  +LI    LI QW 
Sbjct  392   LVRQSLHTEVNCNDKFRTFKRVLSLSFDDLPYYLKSCFLHLSVFPRGYLISCGKLIRQWI  451

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV +K G TVEEVA  YL+ELINRSLI       DG +    +HD   +II SKS++
Sbjct  452   AEGFVDKKEGMTVEEVARDYLYELINRSLIEVAAQRGDGRIMYCSVHDFLLDIITSKSSN  511

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             H F  T  ++   WP+K R LS+       Q +R  ++LRSL  F V   + SS    + 
Sbjct  512   HGFAETAIDKHHKWPDKVRRLSIQNGQQAMQQRRSLSRLRSLYMFGV---ERSSTDAVLG  568

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  R++ VLDLQ+  L  +P ++ +  H+RYLS R +KV+ +P SI KL+ LE LDLK T
Sbjct  569   SEMRLLTVLDLQTAPLTRIPAQVAEWCHMRYLSFRYSKVRTVPNSIAKLQNLETLDLKQT  628

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPY-NCSPGFKAPkglgklgsleklVYVE-AN  1611
             +VTELPVEILKLQ LRHL++Y +  ++   Y NC  GFK P+ +G L SL+K+ ++   N
Sbjct  629   YVTELPVEILKLQQLRHLLIYRYRWYSNGWYSNC--GFKCPEEIGALQSLQKISFIRVGN  686

Query  1612  PGNGT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
               N + I E+GKL +L RL I+KLR E  + +CSSIEKL KL++L++ S++E+ ++D+  
Sbjct  687   ERNSSLIRELGKLKQLNRLGIVKLRKESARELCSSIEKLTKLQALSISSVDENEIIDLQP  746

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             LS+PP  LQRLYL+G +G +P WI SL +L+ +  + S+LKD PL  L +LPNLV+L+ +
Sbjct  747   LSTPPSFLQRLYLTGRLGALPRWISSLDSLMVLKLKHSQLKDSPLSSLGNLPNLVNLQLI  806

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y G  + FNA  F  L++L+L   ++L+ V + +G+MP LE L+I+ C  +  +P+GI
Sbjct  807   QAYEGTKLRFNANSFLKLQVLSLGCFDKLKCVEVEKGSMPCLESLLIRSCKLMEELPSGI  866

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWK  2286
             E L  L  L F +M D+F+     D + + Y K++H+ EVYY YW+
Sbjct  867   EQLEKLTRLRFINMPDEFVKKLTQDGQDDYYLKLAHVPEVYYGYWR  912



>gb|KDP40943.1| hypothetical protein JCGZ_24942 [Jatropha curcas]
Length=1001

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/775 (46%), Positives = 504/775 (65%), Gaps = 15/775 (2%)
 Frame = +1

Query  31    LEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKHFQSH  204
             LE+  ++GI+  + +LI  L+      +V+SVVGM G GKTTL K V+ D  VKKHF+  
Sbjct  166   LEDFNLLGIKEHKGKLIGWLVASKSGREVVSVVGMEGLGKTTLAKRVFGDARVKKHFKFC  225

Query  205   AWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVIVFD  384
              WIT++Q F    +LK++++QLF  L++P P G+  M A +L++++ EFL +R+Y+IV D
Sbjct  226   VWITLTQHFSTRRLLKEIVRQLFLFLRKPSPSGVDGMTAQELRILINEFLEQRRYLIVLD  285

Query  385   DVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSWALL  564
             DVW+   W+A K   P    G R +++T+   +A +   ++   +Y ++ LS E SW+L 
Sbjct  286   DVWSHDAWDAFKFAFPNNNQGSRILLTTQDNAIAYNCCMESPDKVYNLSSLSPEESWSLF  345

Query  565   CRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSLGPD  744
             C+K F   SCP  L  + +QI+ RC GLPLAIVAI GVLA ++KT  +EW  +Y SLG +
Sbjct  346   CKKTFGNDSCPQDLENVSQQIVGRCEGLPLAIVAISGVLAKRDKTR-DEWDMVYRSLGAE  404

Query  745   FEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVKQKA  924
               GND   S+R IL LS+N LP YLK C +Y SI+PE + IEH  LI  W  EGFV +  
Sbjct  405   ILGNDSLASMRKILSLSYNYLPYYLKSCLLYFSIFPEGYPIEHMRLIRLWIAEGFVIETE  464

Query  925   GKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTTIDE  1104
             GKT+EEVAEGYL ELI RSLI  V+   DG +K+ RI    REII+SK+ D +F   + +
Sbjct  465   GKTLEEVAEGYLDELIRRSLIRVVETTSDGRIKRCRIQGFLREIIISKAKDQDFTAIVKQ  524

Query  1105  ETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTF-NVTDSQFSSHVVQILSSC---RV  1272
             E+  WPEKAR LS+H  +   +     ++L SLL F  ++     S ++    SC   R+
Sbjct  525   ESIMWPEKARRLSIHNPMARIESSHFTSRLCSLLLFWGLSSLPEESPLLNF--SCTHLRM  582

Query  1273  IKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTEL  1452
             + VLDL  T +E  P ++  LL L+YLSLR+TKV  +P SI +L+ LE LDLK + VTEL
Sbjct  583   LNVLDLGGTPMEEFPNQVTNLLLLKYLSLRNTKVNSIPSSIGRLQNLETLDLKNSRVTEL  642

Query  1453  PVEILKLQHLRHLIVYS-HVSFA-YLPYNCSPGFKAPkg--lgklgsleklVYVEANPGN  1620
             P+ +LKLQ LRHL+VY     F   L  N + GFK P    L  L SL+KL Y+EAN  +
Sbjct  643   PITVLKLQKLRHLLVYRFETKFDDQLQTNYTIGFKLPTNCYLRSLKSLQKLCYLEANDQD  702

Query  1621  GT-IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                I+E+G L++L+RL I+ LR EDGK +CSSIEKL  LR+L++ S+ E+ V+D++ LSS
Sbjct  703   SDLIKELGTLDQLRRLGIVNLRKEDGKDLCSSIEKLTNLRALSVASVTENEVIDLDSLSS  762

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQRLYL+G +  +P WI SL +L K+  +WS+L  +PL  LQ LPNL+H+EF+  Y
Sbjct  763   PPQFLQRLYLTGRLESLPEWITSLDSLKKVVLKWSRLNTNPLLSLQHLPNLLHVEFIQVY  822

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECL  2157
              GE + F A  F+ ++ L+L+KL+ L  ++I +GA+P LEKL++Q C  L ++P+GIE L
Sbjct  823   DGEALVFEANGFKKMKFLSLNKLDRLNEIIIRQGALPCLEKLIVQSCQVLRTLPSGIEHL  882

Query  2158  FNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVY-YTYWKDGCWEVNSVQE  2319
               L+ LEF +M  + I T  PD+   DY KV+ I EVY +TYW +G WEV S+++
Sbjct  883   MKLQVLEFVNMPIELIMTLHPDRNLGDYTKVARIPEVYFFTYWNNGSWEVFSLEK  937



>ref|XP_010271761.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Nelumbo 
nucifera]
Length=940

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/764 (46%), Positives = 489/764 (64%), Gaps = 21/764 (3%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R D+LLLEE ++VGI+ P+KE+I  L+K  P L V+ VVGMGG GKT+LVK  +DD  
Sbjct  179   DLRGDSLLLEEADLVGIDKPKKEIIEFLVKGSPRLGVLLVVGMGGVGKTSLVKQAFDDRR  238

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VK +F  H WI+VSQ+FK++E+LKDM++QL  E K+PVP+ +  M   +LK+ +KEFL +
Sbjct  239   VKVYFNIHIWISVSQSFKLDELLKDMMRQLCEESKEPVPQRLDGMKETELKLALKEFLKQ  298

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYI---YEMT  531
             ++YVIV DD+W+   W++I+H+        R +++TR  D+A+S     N Y    Y + 
Sbjct  299   KRYVIVLDDMWSKFDWDSIRHIFIDCNCKSRIIVTTRSDDIAAS----CNNYFVQTYRLQ  354

Query  532   PLSEEVSWALLCRKAFHA---SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTN  702
             PL E+ SW L C+K F +   ++CP  L ++ + I+++CGGLPLAIV +GGVL+TK +T 
Sbjct  355   PLCEKESWTLFCKKTFWSVDENNCPPQLEKLSRSIVRKCGGLPLAIVTVGGVLSTKQRT-  413

Query  703   INEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSL  882
             + EW     SLG + + +D+  S+  IL LS+NDLP +LK  F+ LSI+PED  IE   L
Sbjct  414   LTEWEMFDRSLGGELQNDDRLRSVMKILSLSYNDLPYHLKSGFLCLSIFPEDESIETMRL  473

Query  883   IYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIIL  1062
             I  W  EGF++++ GKT+EEV E YL+EL+NRSLI   +   DG +K  R+HDL R+IIL
Sbjct  474   IRIWMAEGFIQRRQGKTLEEVGESYLYELVNRSLIQVTETTYDGRIKTCRVHDLIRKIIL  533

Query  1063  SKSTDHNFVTTID-----EETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDS  1227
              K+ D NF T ID     ++     +  R LS+H +      ++  T LRSL  F V   
Sbjct  534   LKAKDQNFGTIIDGDDDEQDIIMVGKITRRLSIHNSCQEVAPEQNFTHLRSLFMFRVDTL  593

Query  1228  QFSSHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLR  1407
                       SS +++KVLDL+   LE  PEE     HLRYLSLR T VK +P SIKKL+
Sbjct  594   SNIYRNGAFFSSLKLLKVLDLRVAPLEEFPEEFTNFFHLRYLSLRKTMVKEIPNSIKKLQ  653

Query  1408  MLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsle  1587
              LE LDLK T+V+ELP+ IL L  LRHL+VY +    ++ ++   GFKAP G+G L SL+
Sbjct  654   NLETLDLKQTYVSELPIGILDLHKLRHLLVYRYNFGPHVVFH-HQGFKAPSGIGNLESLQ  712

Query  1588  klVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED  1767
             KL Y++ + G+  I  +G+L +L+RL I KL+ EDG  +CSS+E +  L+SL++ +IEE 
Sbjct  713   KLCYIDVSTGSDLITTLGRLVQLRRLGIHKLKREDGVNLCSSMENMNCLQSLSISAIEEG  772

Query  1768  VVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPN  1947
              +LD+ +LSSPPP L+ L L G + K+PHWI SL NL  +  RWSK+KDDPLE L+ LP 
Sbjct  773   EILDLQFLSSPPPFLRTLLLKGRLEKLPHWIPSLHNLCLMDLRWSKMKDDPLEALKCLPQ  832

Query  1948  LVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL  2127
             L  L  +  Y GE + F +G FQ L  L L++LE LR V I E A+P LE L I  C  L
Sbjct  833   LKRLNLMHAYDGEQLCFQSGGFQKLENLGLERLERLRMVTIEEAALPQLENLYISGCEML  892

Query  2128  ASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHI  2259
              + P GIE L  L+ L F +M ++F     P  RG D+ ++ HI
Sbjct  893   ENAPLGIEHLNELKMLLFLEMPNEFKGRLRP--RGNDHHRIEHI  934



>ref|XP_010056223.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=924

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/774 (45%), Positives = 496/774 (64%), Gaps = 15/774 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D+R +ALLL++ E+VGI  P K+L+  L++   T +VISVVGMGG GKTTLVK VY+D 
Sbjct  152   QDQRGNALLLDKAELVGISEPTKKLVGWLIEGASTRQVISVVGMGGLGKTTLVKQVYEDP  211

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AWIT+SQ+  +EE+L+ M++Q+  E ++PVP    + +    K+I+K+ L 
Sbjct  212   EVKKHFMVRAWITLSQSPNIEEILQGMVRQIMRETEEPVPPPEDNKDRLCQKMIIKDLLQ  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             + +Y+I+ DD W    W+AIKHV P    G R +I++R  D+A +S  +  G +Y+M PL
Sbjct  272   KARYLIIVDDAWRLNEWDAIKHVFPNNTCGSRIIITSRNSDLAYTSCGEFRGMVYKMEPL  331

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C K F  +SCP HL E  + IL +C GLPLAIVAI GVL +K+     EW 
Sbjct  332   PPEQSWKLFCAKTFQGNSCPPHLEETCRLILGKCEGLPLAIVAISGVLVSKDMRKKEEWD  391

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +   L  +   N++F++L+ +L LS +DLP YLK CF++LS++P+  +I+   LI  W 
Sbjct  392   RVRRGLRTEINCNNKFKTLKRVLSLSLDDLPYYLKSCFLHLSVFPKGCIIDCGKLIRLWI  451

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLI-LPVKLNDDGSMKQGRIHDLYREIILSKST  1074
              EGFV +K G   EEV + YL EL+NRSLI + VK N DG MK  RIHD   +II S+S+
Sbjct  452   AEGFVDKKEGMKEEEVGQDYLNELLNRSLIEVAVKAN-DGRMKYCRIHDFLLDIITSQSS  510

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             +  F     E     P+K R LS+  +L   Q KR  ++LRSL  F V  S   +    +
Sbjct  511   NQGFAEIATERHHKLPDKVRRLSIQTSLPAMQKKRSLSQLRSLYMFGVERSSIDA---VL  567

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              S  R++ VLDLQ+  L   P ++ +   LRYL  R +KV+ +P SI  L+ LE LDLKY
Sbjct  568   GSEMRLLTVLDLQAAPLTRFPAQVAEWCCLRYLCFRYSKVRTVPNSIGNLQNLETLDLKY  627

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFA--YLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             T+V ELP+ ILKLQ LRHL++Y + + A  +  Y    GFK+P+ +G L SL+KL Y+EA
Sbjct  628   TYVRELPIAILKLQQLRHLLIYRYENTADSWFKY----GFKSPEDIGALQSLQKLCYIEA  683

Query  1609  NP--GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
             +    +G + E+GKL +L RL I+KLR ED + +CSSIEKL KL+S+++ S++E+ ++ +
Sbjct  684   DDRRNSGLMRELGKLTQLVRLGIVKLRKEDARELCSSIEKLTKLQSISVSSVDENEIIVL  743

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
               LSSPPP LQR+YL G +  +PHWI SL +L  +  R S+LKD PL  L +LPNLVHL 
Sbjct  744   QPLSSPPPFLQRIYLIGRLEALPHWISSLDSLTVLQLRCSQLKDSPLLSLGNLPNLVHLR  803

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
              +  Y G  ++F A  F  LR L L   ++L+ V + +G+MP LE+L+I+ C QL  +P+
Sbjct  804   LIQVYEGTKLYFKANSFMKLRFLALGPFDKLKCVEVEKGSMPCLEELIIESCKQLEKLPS  863

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEV  2304
             GIE L  L+ L+F DM D+F+   + D + + Y KV+H+ EVYY Y + G W+V
Sbjct  864   GIEHLEKLKVLKFIDMLDEFVKKLMRDGQDDCYQKVAHVPEVYYGYRRGGGWDV  917



>ref|XP_010271767.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Nelumbo 
nucifera]
Length=936

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/776 (49%), Positives = 502/776 (65%), Gaps = 22/776 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DALLL+E E+VGI  P++E+I  +++D+  L VISVVGMGG GKTTLVK VYDD 
Sbjct  156   HDIREDALLLDEAELVGIGKPKEEIIGWIVEDESRLGVISVVGMGGLGKTTLVKKVYDDQ  215

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQL-FAELKQPVPEGMGSMNANKLKVIVKEFL  354
              VK+HFQ+ AW+T S++ ++ E+L +MI+QL +AE KQP+P+ +  M   +LK  ++EFL
Sbjct  216   RVKRHFQTQAWVTFSESPEIHELLIEMIKQLVYAEQKQPIPQDVAEMKDVQLKQRLQEFL  275

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
              +++YV+V DD+WT   W+++K+V P    G R +ISTR  DVASS    +   +Y + P
Sbjct  276   KKKRYVVVLDDIWTIPAWDSVKNVFPNNNFGSRIIISTRSNDVASSC-IKSYFRVYNLKP  334

Query  535   LSEEVSWALLCRKAFHASS---CPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNI  705
             LS+E SW L C+K F  S    CP  L    + I+K+CGGLPLAIV +GGVL+TK KT  
Sbjct  335   LSQEESWTLFCKKTFSFSPEQICPPELEVPSQSIVKKCGGLPLAIVTVGGVLSTKQKTT-  393

Query  706   NEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLI  885
              EW    HSLG D   +D+ + +  IL LS+NDLP +LK CF+ L ++PED LIE   LI
Sbjct  394   TEWEMFNHSLGTDLFDDDRLKGMMKILTLSYNDLPYHLKFCFLSLFMFPEDELIEKMRLI  453

Query  886   YQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDD-GSMKQGRIHDLYREIIL  1062
               W  EGF+++K GKT+EEV E Y  ELINRSL+   K +DD G ++  R+HDL REIIL
Sbjct  454   RIWMAEGFIRRKEGKTLEEVGESYFHELINRSLLQIAKTDDDDGRVEACRVHDLIREIIL  513

Query  1063  SKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNA-QMKRQGTKLRSLLTFNVTDSQFSS  1239
             SK+ D NF   I ++     EK R LS H       Q ++  T LRSL TFNV     + 
Sbjct  514   SKARDQNFGAIIKQDVMLENEKIRRLSFHHFCEMVPQQEKSTTHLRSLFTFNVNTLSNTF  573

Query  1240  HVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEI  1419
                +I S  +++KVLDL+   L    EE   L HLRYLSLR+T +K +P SIKKL+ LE 
Sbjct  574   TGGEIFSKLKLLKVLDLRDAPLSEFLEEFTNLFHLRYLSLRNTDIKEIPDSIKKLQNLET  633

Query  1420  LDLKYTFVTELPVEILKLQHLRHLIVY-SHVSFA-YLPYNCSPGFKAPkglgklgslekl  1593
             LDLK T+VTELP  IL L  LRHL+VY   + F+ +LP     GFKAP G+G L SL+KL
Sbjct  634   LDLKQTYVTELPTGILNLDKLRHLLVYRKELDFSSHLPQYS--GFKAPSGIGGLVSLQKL  691

Query  1594  VYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVV  1773
              Y+EAN G+  I  + +L +L+RL I+KLR EDG  +CSSI K+  L SL +  IEE+ +
Sbjct  692   DYIEANTGSELIRGLERLVQLRRLGIVKLRREDGIHLCSSINKMRHLESLGVHVIEEEEI  751

Query  1774  LDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLV  1953
             LD+  LS+PPPLL+R+ L G + K+P WI SL NL  I    +KLKDDPLE L+ L NL+
Sbjct  752   LDLESLSTPPPLLRRIMLKGRLEKLPRWIPSLHNLFCICLWGTKLKDDPLEALEGLSNLM  811

Query  1954  HLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
              L  +  Y GE +HF +G+FQ L++L L  L  LR + + E ++PHLEKL I  C  L  
Sbjct  812   TLYLIEAYRGEQLHFQSGRFQKLKVLYLHSLGGLRVITMEERSLPHLEKLYIVNCRILEE  871

Query  2134  VPAGIECLFNLRYLEFFDMTDDF---ISTFLPDKRGEDYCKVSHISEVYYTYWKDG  2292
             VP+GIE L  L  L F +M D+F   IS       GED+ KV+H+  V +  W DG
Sbjct  872   VPSGIERLTELEELSFHNMPDEFHLKISC-----NGEDHHKVAHVPCVLFLNWIDG  922



>emb|CDP07913.1| unnamed protein product [Coffea canephora]
Length=926

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/775 (45%), Positives = 494/775 (64%), Gaps = 16/775 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R+ +L +EE  +VGI+ P+ ELIS +L D   LKV+SV GMGG GKTTLVK VYDD  
Sbjct  154   DIRAQSLFIEEARLVGIDKPKAELISKILDDHSQLKVVSVKGMGGLGKTTLVKKVYDDAA  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK FQSHAWITVSQ F+  +++K++IQQL+ E++QPVP  + SM+       VK+FL  
Sbjct  214   VKKQFQSHAWITVSQNFQFSDIIKNLIQQLYNEIRQPVPPEVESMDDIMQSEFVKDFLRE  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y++V DDVW+   WEAIK VLP      R  ++TR+ DVAS+S   +  ++Y+M PLS
Sbjct  274   RRYILVLDDVWSIDAWEAIKCVLPDCNTASRVALTTRIADVASASCLGSLNFVYKMEPLS  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             ++ SW L C + F ++ CP +L E+ K+ILK+C GLPLAIVAIGGVLA K+K N +EW  
Sbjct  334   DKESWTLFCNRTFQSNDCPPNLEEVAKKILKKCEGLPLAIVAIGGVLALKDKENTDEWEM  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + H  G + +G+ + + ++ +LLLS+NDLP YLK C +YLSIYPED+LIE + ++ +W  
Sbjct  394   ILHGFGGEADGSGKLDRIKRVLLLSYNDLPHYLKSCLLYLSIYPEDYLIEVDDILLKWIA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLI-LPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              GFV++K G T  ++A   + ELINRS+I +  KLN DG +    +HD  REII+SKS +
Sbjct  454   LGFVEEKEGITSTDIAVRCMKELINRSIIQVKSKLN-DGRLDACSLHDFVREIIVSKSKE  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              +F T      A WPEK RHL++H    N Q       LRS+  F   D   ++ + + L
Sbjct  513   QSFTTVATRYYARWPEKFRHLAIHNFTDNPQEFSGLKCLRSVAIFGYEDPLTTTFLSEFL  572

Query  1258  -SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
                 +++KVLDL    L+ +P+++F+L HLRYL+LR T VK++P+SI KL+ LE++DL+ 
Sbjct  573   HGDPKLLKVLDLHGAELDNIPKQVFKLFHLRYLNLRGTGVKIIPKSIGKLQNLEVIDLRG  632

Query  1435  TFVTELPVEILKLQHLRHLIV--YSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             T VTELP EIL L+ LR L++  Y   S  Y  + C    K P G+GKL  LE L+ +EA
Sbjct  633   TNVTELPAEILNLRKLRSLLLGGYGDYSNEYAIWGC----KCPLGIGKLICLEDLLRIEA  688

Query  1609  NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
             +  +  + EIGKL +L+RL I KLR EDGK + SS+ +L  LR L++  IEED  LD+ +
Sbjct  689   D-SDKIVREIGKLMQLRRLAITKLRREDGKELLSSLLRLTNLRQLSISCIEEDETLDLQH  747

Query  1789  LSSPP-PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDP--LEHLQDLPNLVHL  1959
               SP    L  L L G + ++P W+ SL++L  +    S+L++D   +  L  LPNL+ L
Sbjct  748   SISPKLEFLTFLRLKGRLERVPQWVTSLQSLRILRLVNSRLREDENVIGSLGHLPNLISL  807

Query  1960  EFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVP  2139
                  Y GE + F  G FQ L+ L L +L  L+ V + E +MP L  L +  C  +  +P
Sbjct  808   SLYGAYEGETICFKVGGFQKLQRLQLGQLTRLKWVRVEEESMPSLRNLRLGNCKLMQELP  867

Query  2140  AGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWKDGCWE  2301
             +GI+ L  L  L F++M+++ +      DKR EDY  +SHI EV+  +W DG WE
Sbjct  868   SGIQNLTRLESLAFYEMSNELMHKVQNLDKRSEDYQTISHIPEVFIGHWIDGQWE  922



>ref|XP_010271762.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Nelumbo 
nucifera]
Length=929

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/754 (46%), Positives = 482/754 (64%), Gaps = 19/754 (3%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R D+LLLEE ++VGI+ P+KE+I  L+K  P L V+ VVGMGG GKT+LVK  +DD  
Sbjct  179   DLRGDSLLLEEADLVGIDKPKKEIIEFLVKGSPRLGVLLVVGMGGVGKTSLVKQAFDDRR  238

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VK +F  H WI+VSQ+FK++E+LKDM++QL  E K+PVP+ +  M   +LK+ +KEFL +
Sbjct  239   VKVYFNIHIWISVSQSFKLDELLKDMMRQLCEESKEPVPQRLDGMKETELKLALKEFLKQ  298

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYI---YEMT  531
             ++YVIV DD+W+   W++I+H+        R +++TR  D+A+S     N Y    Y + 
Sbjct  299   KRYVIVLDDMWSKFDWDSIRHIFIDCNCKSRIIVTTRSDDIAAS----CNNYFVQTYRLQ  354

Query  532   PLSEEVSWALLCRKAFHA---SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTN  702
             PL E+ SW L C+K F +   ++CP  L ++ + I+++CGGLPLAIV +GGVL+TK +T 
Sbjct  355   PLCEKESWTLFCKKTFWSVDENNCPPQLEKLSRSIVRKCGGLPLAIVTVGGVLSTKQRT-  413

Query  703   INEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSL  882
             + EW     SLG + + +D+  S+  IL LS+NDLP +LK  F+ LSI+PED  IE   L
Sbjct  414   LTEWEMFDRSLGGELQNDDRLRSVMKILSLSYNDLPYHLKSGFLCLSIFPEDESIETMRL  473

Query  883   IYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIIL  1062
             I  W  EGF++++ GKT+EEV E YL+EL+NRSLI   +   DG +K  R+HDL R+IIL
Sbjct  474   IRIWMAEGFIQRRQGKTLEEVGESYLYELVNRSLIQVTETTYDGRIKTCRVHDLIRKIIL  533

Query  1063  SKSTDHNFVTTID-----EETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDS  1227
              K+ D NF T ID     ++     +  R LS+H +      ++  T LRSL  F V   
Sbjct  534   LKAKDQNFGTIIDGDDDEQDIIMVGKITRRLSIHNSCQEVAPEQNFTHLRSLFMFRVDTL  593

Query  1228  QFSSHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLR  1407
                       SS +++KVLDL+   LE  PEE     HLRYLSLR T VK +P SIKKL+
Sbjct  594   SNIYRNGAFFSSLKLLKVLDLRVAPLEEFPEEFTNFFHLRYLSLRKTMVKEIPNSIKKLQ  653

Query  1408  MLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsle  1587
              LE LDLK T+V+ELP+ IL L  LRHL+VY +    ++ ++   GFKAP G+G L SL+
Sbjct  654   NLETLDLKQTYVSELPIGILDLHKLRHLLVYRYNFGPHVVFH-HQGFKAPSGIGNLESLQ  712

Query  1588  klVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED  1767
             KL Y++ + G+  I  +G+L +L+RL I KL+ EDG  +CSS+E +  L+SL++ +IEE 
Sbjct  713   KLCYIDVSTGSDLITTLGRLVQLRRLGIHKLKREDGVNLCSSMENMNCLQSLSISAIEEG  772

Query  1768  VVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPN  1947
              +LD+ +LSSPPP L+ L L G + K+PHWI SL NL  +  RWSK+KDDPLE L+ LP 
Sbjct  773   EILDLQFLSSPPPFLRTLLLKGRLEKLPHWIPSLHNLCLMDLRWSKMKDDPLEALKCLPQ  832

Query  1948  LVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL  2127
             L  L  +  Y GE + F +G FQ L  L L++LE LR V I E A+P LE L I  C  L
Sbjct  833   LKRLNLMHAYDGEQLCFQSGGFQKLENLGLERLERLRMVTIEEAALPQLENLYISGCEML  892

Query  2128  ASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKR  2229
              + P GIE L  L+ L F +M ++F     P  R
Sbjct  893   ENAPLGIEHLNELKMLLFLEMPNEFKGRLRPRDR  926



>gb|KCW90007.1| hypothetical protein EUGRSUZ_A02202, partial [Eucalyptus grandis]
Length=890

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/759 (45%), Positives = 492/759 (65%), Gaps = 14/759 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R +ALLLEE E+VGIE PR +L+  L+  D  L+V S+VGMGG GKT L K V+D   
Sbjct  135   DPRGNALLLEESELVGIEKPRNQLVEWLVGGDSKLEVTSIVGMGGLGKTALTKKVFDSAV  194

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VK HF SHAWIT+S++F V+++L+DMI+QLF E+K PVP G+ +MN ++LK  +  FL +
Sbjct  195   VKSHFASHAWITISRSFDVKDLLRDMIEQLFEEIKLPVPPGVSAMNGDRLKAFIHAFLQQ  254

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV DD+W+++ WE ++  LP+  HG R MI+TR  DVA     ++   +Y + PL 
Sbjct  255   RQYLIVLDDLWSSQAWELMQFALPRNFHGSRIMITTRAADVALGCCIESPDRVYNLQPLP  314

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              + SW L C+KAF  + CP HL +I + IL +C GLPLAIVAI GVLAT+  + + EW  
Sbjct  315   PQDSWLLFCKKAFQGNLCPPHLEDISRCILAKCRGLPLAIVAISGVLATRGTSRVGEWEM  374

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  +LG + EGND+  +LR IL L ++DLP YLK C +YLS++PEDH+I HN L++ W  
Sbjct  375   IRRNLGDELEGNDRLFNLRKILSLGYSDLPYYLKSCLLYLSVFPEDHIIGHNRLVHLWIT  434

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV++K GKT EEVAE YL EL NRSLI   K+  DG +    +HD+ REI+L+KS D 
Sbjct  435   EGFVEEKEGKTSEEVAERYLEELRNRSLIQVAKVTSDGRINAYWVHDILREILLTKSKDQ  494

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKR-QGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             NF    +  TA     AR +++H +L N Q+ +    +LRSLL F V D   SS ++  L
Sbjct  495   NFAEISNPMTARCSGDARRVAIHCSLANPQLSKINAVRLRSLLMFGVPDLPSSSSLLPSL  554

Query  1258  -SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              +  ++++VLDL   SL++ P+EI +L  L++LSLR  K+  +P +I  L+ LEILDLK 
Sbjct  555   RNEFKLLEVLDLADASLDVFPKEIVRLYQLKHLSLRGKKIDRVPSTIGNLQKLEILDLKN  614

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T V+ELP  I +L+ LRHL++Y + S + L Y    GFKA  G+G L SL KL  +EA+ 
Sbjct  615   TSVSELPASIQRLRRLRHLLLYRYESGSDLYYR-KYGFKAQAGIGGLVSLRKLCCIEADG  673

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
              NG I +IG + +L +L +  LR EDGKA+CSSI+ L +L+ L L S++   VLD+  L 
Sbjct  674   KNGVIMDIGTMRQLTKLNVRSLRREDGKALCSSIQNLSRLQVLWLCSVDPAEVLDIEQL-  732

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             +PP  LQRLYL G + ++P W  SL ++ ++Y R S+L+ DPLE ++ LPNLV ++    
Sbjct  733   TPPCFLQRLYLEGCLERIPSWTSSLYSVTRLYLRHSRLQYDPLESMEALPNLVEIQLGDA  792

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y GE + F  G F  L+L+ L KL  L+ +++ EG  P LEKL ++RC  L  +PA  E 
Sbjct  793   YEGESLCFRRGGFPRLKLMWLIKLRNLKRMIMEEGTTPRLEKLTLRRCESLKEMPADFER  852

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVY  2271
             L +L+ + F  M  +  +            + SH+S+V+
Sbjct  853   LASLKVVVFDGMPRELFA--------RQNAEASHLSKVF  883



>ref|XP_010058431.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=951

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/777 (44%), Positives = 500/777 (64%), Gaps = 9/777 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             ++ R      +++E+VGIE  +K+L++LL++     +VISVVGMGG GKTTLV  VY D 
Sbjct  153   HEHRGKDCFSDKNELVGIEEQKKQLVALLVEGTSRPQVISVVGMGGLGKTTLVNEVYQDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF    WI  S +  + E+L+D+ +Q+   ++QP+P G  +MN   LK+++K+ L 
Sbjct  213   EVKKHFMVCTWINFSGSPSIGELLQDIHRQIGGVIRQPIPCGADTMNIYWLKMLIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
               +Y++V DD W    W+ +KH LP    G R +I+TR  D+A +S  +  G +Y+M PL
Sbjct  273   EARYLVVLDDTWRIDEWDVVKHALPSNMCGSRIIITTRNYDLAHTSCREFEGKVYKMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L C+K F  SSCPSHL +  + ILK+C GLPLAIVAIGGVLATK++  I+EW 
Sbjct  333   PVDQSWKLFCKKTFQGSSCPSHLEKTCEFILKKCEGLPLAIVAIGGVLATKDEHRIDEWE  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + HSL  +   +D+ ++L+ +LLL FNDLP YLK CF++LS++PE   I+   LI  W 
Sbjct  393   LVRHSLDTEINCDDKLKNLKRVLLLGFNDLPYYLKSCFLHLSLFPEGRCIKCKRLIRLWI  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT+EEVAE Y  EL+NR+LI        G++   RIHD   +I+ SKST+
Sbjct  453   AEGFVEKKEGKTLEEVAEDYFMELLNRNLIEVAARRAYGAVNYCRIHDFLWDIVTSKSTN  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     EE    P+K R LS+  TL   Q     ++LRSL  F +  S F + V  + 
Sbjct  513   QGFAEIAKEEKFEQPDKVRRLSLQKTLRALQQNWSLSQLRSLYMFGMERS-FMNKV--LA  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             +  +++ VLD+ +  L+  P ++    +LRYLS R T+V  +P SI KL+ LE LDLK+T
Sbjct  570   TDMKMLNVLDILAAPLKRFPAQVADWCYLRYLSFRGTEVSTVPTSIVKLKNLETLDLKHT  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              VTELPV+I KL+ LRHL+VY +    YL +    GFKA +G+G L SL+KL Y+EA+  
Sbjct  630   NVTELPVDIWKLRRLRHLLVYRYKLMPYLSFKV--GFKALQGIGALQSLQKLCYIEADDA  687

Query  1618  N--GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             N    + E+G L +L RL ILK++ EDG+ +CSSI KL +L+S+++ S++ED ++D+ +L
Sbjct  688   NSCSVMRELGMLTQLDRLAILKVKKEDGRDLCSSISKLTRLQSISIASVDEDEIIDLQHL  747

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPPP L+R+YL G +G +P W+ SL +L+K+  R+S LKDDPL  L++LPNLVHLE   
Sbjct  748   SSPPPFLERMYLYGRLGALPKWLPSLSSLMKLLLRYSCLKDDPLVSLENLPNLVHLELRQ  807

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + F A  F+ L +L LD  ++LR + + +GAMP L+KL I+RC  L ++P+G+E
Sbjct  808   VYGGSSLCFRAKGFKKLNILRLDLFDKLRCIEVEKGAMPFLQKLAIRRCKLLENLPSGVE  867

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQET  2322
              L  L+ L+ FDM D  +   +   + +DY KV+HI E+   Y +D  W++  +  +
Sbjct  868   NLTKLKVLKIFDMPDKLVKKLVQGAQDDDYHKVAHIPEIRCGYQRDEGWDIQLIDRS  924



>ref|XP_010023627.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=913

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/759 (45%), Positives = 492/759 (65%), Gaps = 14/759 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R +ALLLEE E+VGIE PR +L+  L+  D  L+V S+VGMGG GKT L K V+D   
Sbjct  155   DPRGNALLLEESELVGIEKPRNQLVEWLVGGDSKLEVTSIVGMGGLGKTALTKKVFDSAV  214

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VK HF SHAWIT+S++F V+++L+DMI+QLF E+K PVP G+ +MN ++LK  +  FL +
Sbjct  215   VKSHFASHAWITISRSFDVKDLLRDMIEQLFEEIKLPVPPGVSAMNGDRLKAFIHAFLQQ  274

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV DD+W+++ WE ++  LP+  HG R MI+TR  DVA     ++   +Y + PL 
Sbjct  275   RQYLIVLDDLWSSQAWELMQFALPRNFHGSRIMITTRAADVALGCCIESPDRVYNLQPLP  334

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              + SW L C+KAF  + CP HL +I + IL +C GLPLAIVAI GVLAT+  + + EW  
Sbjct  335   PQDSWLLFCKKAFQGNLCPPHLEDISRCILAKCRGLPLAIVAISGVLATRGTSRVGEWEM  394

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  +LG + EGND+  +LR IL L ++DLP YLK C +YLS++PEDH+I HN L++ W  
Sbjct  395   IRRNLGDELEGNDRLFNLRKILSLGYSDLPYYLKSCLLYLSVFPEDHIIGHNRLVHLWIT  454

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV++K GKT EEVAE YL EL NRSLI   K+  DG +    +HD+ REI+L+KS D 
Sbjct  455   EGFVEEKEGKTSEEVAERYLEELRNRSLIQVAKVTSDGRINAYWVHDILREILLTKSKDQ  514

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKR-QGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             NF    +  TA     AR +++H +L N Q+ +    +LRSLL F V D   SS ++  L
Sbjct  515   NFAEISNPMTARCSGDARRVAIHCSLANPQLSKINAVRLRSLLMFGVPDLPSSSSLLPSL  574

Query  1258  -SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              +  ++++VLDL   SL++ P+EI +L  L++LSLR  K+  +P +I  L+ LEILDLK 
Sbjct  575   RNEFKLLEVLDLADASLDVFPKEIVRLYQLKHLSLRGKKIDRVPSTIGNLQKLEILDLKN  634

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T V+ELP  I +L+ LRHL++Y + S + L Y    GFKA  G+G L SL KL  +EA+ 
Sbjct  635   TSVSELPASIQRLRRLRHLLLYRYESGSDLYYR-KYGFKAQAGIGGLVSLRKLCCIEADG  693

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
              NG I +IG + +L +L +  LR EDGKA+CSSI+ L +L+ L L S++   VLD+  L 
Sbjct  694   KNGVIMDIGTMRQLTKLNVRSLRREDGKALCSSIQNLSRLQVLWLCSVDPAEVLDIEQL-  752

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
             +PP  LQRLYL G + ++P W  SL ++ ++Y R S+L+ DPLE ++ LPNLV ++    
Sbjct  753   TPPCFLQRLYLEGCLERIPSWTSSLYSVTRLYLRHSRLQYDPLESMEALPNLVEIQLGDA  812

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y GE + F  G F  L+L+ L KL  L+ +++ EG  P LEKL ++RC  L  +PA  E 
Sbjct  813   YEGESLCFRRGGFPRLKLMWLIKLRNLKRMIMEEGTTPRLEKLTLRRCESLKEMPADFER  872

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVY  2271
             L +L+ + F  M  +  +            + SH+S+V+
Sbjct  873   LASLKVVVFDGMPRELFA--------RQNAEASHLSKVF  903



>gb|KCW72848.1| hypothetical protein EUGRSUZ_E01302, partial [Eucalyptus grandis]
Length=903

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/758 (45%), Positives = 482/758 (64%), Gaps = 9/758 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D+R +ALLL++ E+VG+  P K L+  L++   T +VISVVGMGG GKTTLVK VY+D 
Sbjct  151   QDQRGNALLLDKAELVGVSEPTKNLVGWLIEGASTRQVISVVGMGGLGKTTLVKQVYEDP  210

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AW+T+SQ+  +EE+L+ M++Q+    ++PVP    +M+    K+I+K+ L 
Sbjct  211   EVKKHFMIRAWMTLSQSPNIEELLQGMVRQIMRHTQEPVPPLEYNMDRLCQKMIIKDLLQ  270

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
               +Y+I+ DD W    W+AIKH LP    G R +I++R  D+A +S  +  G +Y+M PL
Sbjct  271   NARYLIIVDDAWHINDWDAIKHALPNNNCGSRIIITSRNSDLAYTSCGEFTGMVYKMGPL  330

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C K F  +SCP HL E  + IL++C GLPLAIVAI GVL +K+    NEW 
Sbjct  331   PAEQSWKLFCAKTFQGNSCPPHLEETCRLILRKCEGLPLAIVAISGVLVSKDTRKKNEWD  390

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              ++ SL  + + ND+F++L+ +L LSF+DLP YLK CF++LS++P  +LI+   L+  W 
Sbjct  391   LVHRSLRTEIDCNDKFKALKRVLSLSFDDLPYYLKSCFLHLSVFPRGYLIKRGRLLRLWI  450

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV +K G T EEVA  YL EL++RSL+       DG ++  R+HD   +II SKS+ 
Sbjct  451   AEGFVDKKEGMTEEEVAHSYLNELMSRSLVEMAIKTIDGRIEYCRVHDFLLDIITSKSSI  510

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     E+   WP+K R LS+  +L + Q KR  ++LRSL  F V  S ++  V+   
Sbjct  511   QGFAEIAIEKHHKWPDKVRRLSIQNSLQSIQQKRSLSQLRSLYIFGVERS-YTDAVLG--  567

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S  R++ VLDLQ+ SL   P +  +   LRYLS R +KV+ +P SI KL+ LE LDLK T
Sbjct  568   SEMRLLTVLDLQTPSLTRFPAQFAEWCFLRYLSFRGSKVRAVPNSIGKLQNLETLDLKNT  627

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN-P  1614
              VTELPV ILKLQ LRHLI+  H   A  P+    GFK  + +  L  L+KL Y+EA   
Sbjct  628   HVTELPVFILKLQRLRHLIIL-HRRKAPYPW-FRYGFKFLEEMVALQFLQKLYYIEAGEE  685

Query  1615  GNGTI-EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              NG++  E+GKL +L +L ILKLR E G+ +CSSIEKL KL+S++L S+ E+ ++D+  L
Sbjct  686   RNGSLMRELGKLKQLSKLAILKLRKEHGRELCSSIEKLTKLQSISLTSVNENEIIDLQPL  745

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPPP L+R+ L+G +  +PHWI SL +L+ +  R+S+LKD+PL  L +LPNLV LE + 
Sbjct  746   SSPPPFLRRINLAGCLDALPHWISSLDSLMVLELRYSRLKDNPLSSLGNLPNLVCLELVQ  805

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + FN   F  LR+L L   E    V + +G+MP LE L ++ C  +  +P+GI+
Sbjct  806   AYEGTKLRFNTNNFMKLRILVLGPFERPERVEVEKGSMPCLEDLTMESCKLMEKLPSGID  865

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISE  2265
              L  L  L+F DM D+ +     D + +DY KV+H+ E
Sbjct  866   HLEKLEVLKFIDMPDELVKKLRRDGQDDDYLKVAHVPE  903



>gb|ABF81446.1| NBS-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=1997

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/737 (47%), Positives = 485/737 (66%), Gaps = 10/737 (1%)
 Frame = +1

Query  28    LLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKHFQS  201
             ++EE  IVGIE P+K LI  L++     +VISVVGMGG GKTTLV+ VY D  VKKHFQ 
Sbjct  157   IVEEANIVGIEKPKKLLIGWLVRGRSEREVISVVGMGGLGKTTLVRKVYHDADVKKHFQF  216

Query  202   HAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVIVF  381
               WIT+S +FK E++LKD+IQQLF  L++ VP+GM   + ++LK  +  FL +++Y+IV 
Sbjct  217   RVWITLSPSFKEEDLLKDIIQQLFRVLQKNVPQGM---DNDRLKTAINRFLQKKRYLIVL  273

Query  382   DDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSWAL  561
             DDVW A  W+A + V P    G   +++TR  +VA ++  +    +Y + PLS E SW L
Sbjct  274   DDVWHADAWDAFEPVFPNNSRGSHILLTTRKTEVALTACIEFPDKVYNLDPLSPEESWTL  333

Query  562   LCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSLGP  741
              C+  F  S CP HL  + ++IL RC GLPLAI A+ GVLAT++++ I+EW  +  SLG 
Sbjct  334   FCKMVFQNSHCPEHLKNVSERILGRCEGLPLAIEAMSGVLATRDRSKIDEWEKVCLSLGA  393

Query  742   DFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVKQK  921
              FE N++  +   IL LS+ DLP YLK C +Y S++PE   I+   LI  W  EGFVK +
Sbjct  394   GFEDNNRMRNALKILSLSYYDLPYYLKSCLLYFSMFPEGIPIQRMRLIRLWIAEGFVKGR  453

Query  922   AGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTTID  1101
              G T EEVAE +L ELI RSL+  V+    G +K  RIHDL REI+++K+ + +FV    
Sbjct  454   EGMTSEEVAEDFLNELIKRSLVQVVEATSYGQVKTCRIHDLLREILITKAKEQDFVAIAK  513

Query  1102  EETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSCRVIKV  1281
             E+   W EK R +S+H  + + +     ++LRSLL F   DS          S  R++ V
Sbjct  514   EQNMIWSEKVRRVSIHNDMPSMRQIHVASRLRSLLVFWGKDSFPGPPKFISPSRSRLLTV  573

Query  1282  LDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTELPVE  1461
             LD++ T L+  P E+  L+ L+YLSLR+TKV  +P SI KL+ LE LDLK+  VTELPV+
Sbjct  574   LDMEGTPLKEFPNEVVSLIFLKYLSLRNTKVNSVPSSISKLQNLESLDLKHAQVTELPVD  633

Query  1462  ILKLQHLRHLIVY---SHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIE  1632
             ILKLQ LRHL+VY   +H S   +      GFKAP  +G L S++KL ++EA+ G   + 
Sbjct  634   ILKLQKLRHLLVYRYETHESDDQI--RNKHGFKAPAQIGNLLSVQKLCFLEADQGQKLMS  691

Query  1633  EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLL  1812
             E+G+L  L+RL ILK R EDGK +CSSI+ L  LR+L++ SI E  V+D+ YLSSPP  L
Sbjct  692   ELGRLIHLRRLGILKFRKEDGKDLCSSIDMLTNLRALSVTSITESEVIDLEYLSSPPQFL  751

Query  1813  QRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHM  1992
             QRLYL+G + ++P WI SL +LVK+  +WS+L++DPL  LQ+LPNLVHLEF+  Y+GE +
Sbjct  752   QRLYLTGRLERLPDWILSLDSLVKLVLKWSRLREDPLLFLQNLPNLVHLEFIQVYSGEAL  811

Query  1993  HFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRY  2172
             HF+   F+ L++L L+KLE L ++ + +GA+P L+KLV+Q C  L  VP+GI+ L  L+ 
Sbjct  812   HFSNEGFEKLKVLGLNKLERLESITVQKGALPSLQKLVVQGCKLLQKVPSGIKHLAKLKT  871

Query  2173  LEFFDMTDDFISTFLPD  2223
             L+FFDM  DF+    PD
Sbjct  872   LDFFDMPYDFVKRLRPD  888


 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/633 (50%), Positives = 426/633 (67%), Gaps = 3/633 (0%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             + DALLLEE ++VGIE P+K+LI  LL      +VISVVGMGG GK+TLVK VYDD  VK
Sbjct  1157  QKDALLLEEADLVGIEKPKKQLIEWLLGSKSGREVISVVGMGGLGKSTLVKKVYDDSDVK  1216

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             KHF+  AWITVSQ+FK E++LKDMIQQLF   ++P P+G+ SMN NKL+ ++ EFL ++K
Sbjct  1217  KHFKFRAWITVSQSFKREDLLKDMIQQLFRVHRKPDPKGVDSMNYNKLRSVIHEFLRQKK  1276

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E
Sbjct  1277  YLIVLDDVWHTSAWRAFQHALPNNICGSRILVTTRNTEVASTSCMDSPDKVYPLNPLSQE  1336

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L C+K F  + CP HL  + + IL RC GLPLAIVAI GVLATK+K+  +EW  ++
Sbjct  1337  ESWTLFCKKIFQDNLCPPHLKNVSETILGRCEGLPLAIVAISGVLATKDKSKTDEWEMVH  1396

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SLG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+   LI  W  EG
Sbjct  1397  LSLGAGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMRLIRLWIAEG  1456

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FVK K G TVEEVA+ YL EL+ RSL+  V+   DG +K  R+HDL REI+++K+ D +F
Sbjct  1457  FVKGKEGMTVEEVAQDYLNELMKRSLVQVVRATSDGRVKTCRVHDLLREIMITKAKDQDF  1516

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-  1263
             V    EE   WPEK R +S+H  + + Q +   ++ RSLLTF V D  + S V  + S  
Sbjct  1517  VAIAKEEGTIWPEKVRRVSMHNVMPSKQQRHVASRFRSLLTFWVADCSYESPVHNLFSGR  1576

Query  1264  CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
              R++ VLDL+   L+  P E+  L  L+YLSLR+T+V  +P SI KL+ LE LDLK+  V
Sbjct  1577  LRLLHVLDLEGAPLKEFPNEVVSLFLLKYLSLRNTRVSFIPSSISKLKNLETLDLKHAQV  1636

Query  1444  TELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNG  1623
             + LP EI KL+ L +L+VY +   +        GFKAP  +G L S++KL +VEA+ G  
Sbjct  1637  SILPAEIRKLRKLCYLLVYRYEIDSDDRIPTKYGFKAPAHIGGLQSIQKLCFVEAHQGRN  1696

Query  1624  TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPP  1803
              + E+G+L +L+RL I+KL+ + GKA+CSSIE+L  LR+L+L SI E  ++D++YL+SPP
Sbjct  1697  LMLELGRLKQLRRLGIVKLKKKHGKALCSSIERLTNLRALSLTSITESEIIDLDYLASPP  1756

Query  1804  PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWS  1902
               LQRLYL+G M K P WI SL +LVK+  +W+
Sbjct  1757  QFLQRLYLAGRMEKFPDWISSLDSLVKLVLKWN  1789



>gb|KCW72850.1| hypothetical protein EUGRSUZ_E01306, partial [Eucalyptus grandis]
Length=904

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/761 (45%), Positives = 487/761 (64%), Gaps = 15/761 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D+R +ALLL++ E+VGI  P K+L+  L++   T +VISVVGMGG GKTTLVK VY+D 
Sbjct  152   QDQRGNALLLDKAELVGISEPTKKLVGWLIEGASTRQVISVVGMGGLGKTTLVKQVYEDP  211

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF   AWIT+SQ+  +EE+L+ M++Q+  E ++PVP    + +    K+I+K+ L 
Sbjct  212   EVKKHFMVRAWITLSQSPNIEEILQGMVRQIMRETEEPVPPPEDNKDRLCQKMIIKDLLQ  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             + +Y+I+ DD W    W+AIKHV P    G R +I++R  D+A +S  +  G +Y+M PL
Sbjct  272   KARYLIIVDDAWRLNEWDAIKHVFPNNTCGSRIIITSRNSDLAYTSCGEFRGMVYKMEPL  331

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               E SW L C K F  +SCP HL E  + IL +C GLPLAIVAI GVL +K+     EW 
Sbjct  332   PPEQSWKLFCAKTFQGNSCPPHLEETCRLILGKCEGLPLAIVAISGVLVSKDMRKKEEWD  391

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +   L  +   N++F++L+ +L LS +DLP YLK CF++LS++P+  +I+   LI  W 
Sbjct  392   RVRRGLRTEINCNNKFKTLKRVLSLSLDDLPYYLKSCFLHLSVFPKGCIIDCGKLIRLWI  451

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLI-LPVKLNDDGSMKQGRIHDLYREIILSKST  1074
              EGFV +K G   EEV + YL EL+NRSLI + VK N DG MK  RIHD   +II S+S+
Sbjct  452   AEGFVDKKEGMKEEEVGQDYLNELLNRSLIEVAVKAN-DGRMKYCRIHDFLLDIITSQSS  510

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             +  F     E     P+K R LS+  +L   Q KR  ++LRSL  F V  S   +    +
Sbjct  511   NQGFAEIATERHHKLPDKVRRLSIQTSLPAMQKKRSLSQLRSLYMFGVERSSIDA---VL  567

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              S  R++ VLDLQ+  L   P ++ +   LRYL  R +KV+ +P SI  L+ LE LDLKY
Sbjct  568   GSEMRLLTVLDLQAAPLTRFPAQVAEWCCLRYLCFRYSKVRTVPNSIGNLQNLETLDLKY  627

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFA--YLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             T+V ELP+ ILKLQ LRHL++Y + + A  +  Y    GFK+P+ +G L SL+KL Y+EA
Sbjct  628   TYVRELPIAILKLQQLRHLLIYRYENTADSWFKY----GFKSPEDIGALQSLQKLCYIEA  683

Query  1609  NP--GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
             +    +G + E+GKL +L RL I+KLR ED + +CSSIEKL KL+S+++ S++E+ ++ +
Sbjct  684   DDRRNSGLMRELGKLTQLVRLGIVKLRKEDARELCSSIEKLTKLQSISVSSVDENEIIVL  743

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
               LSSPPP LQR+YL G +  +PHWI SL +L  +  R S+LKD PL  L +LPNLVHL 
Sbjct  744   QPLSSPPPFLQRIYLIGRLEALPHWISSLDSLTVLQLRCSQLKDSPLLSLGNLPNLVHLR  803

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
              +  Y G  ++F A  F  LR L L   ++L+ V + +G+MP LE+L+I+ C QL  +P+
Sbjct  804   LIQVYEGTKLYFKANSFMKLRFLALGPFDKLKCVEVEKGSMPCLEELIIESCKQLEKLPS  863

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISE  2265
             GIE L  L+ L+F DM D+F+   + D + + Y KV+H+ E
Sbjct  864   GIEHLEKLKVLKFIDMLDEFVKKLMRDGQDDCYQKVAHVPE  904



>emb|CDP19368.1| unnamed protein product [Coffea canephora]
Length=921

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/774 (45%), Positives = 487/774 (63%), Gaps = 18/774 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV-  183
             D R+ +L +EE ++VGI  P+ EL+S +L D   LKV+SVVGMGG GKTTLVK VYDDV 
Sbjct  153   DIRAQSLFIEEAQLVGIGKPKAELMSKILDDHSQLKVVSVVGMGGLGKTTLVKKVYDDVA  212

Query  184   -KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
              KK FQSHAWITVSQ F+  +++K++IQQL+ E++ PVP  + SM+   L   V++FL +
Sbjct  213   VKKQFQSHAWITVSQNFQFRDIIKNLIQQLYDEIRLPVPRRVESMDDKMLIEFVRDFLQK  272

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y++V DDVW+   WEAIK VLP      R +++TR+ DVAS+    +  +IY+M PLS
Sbjct  273   RRYILVLDDVWSIAAWEAIKCVLPDCDITGRVVLTTRIADVASAPCLGSLHFIYKMKPLS  332

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             +E SW L C + F ++ CP +L E+ K+ILK+C GLPLAIVAIGGVLA K+K   +EW  
Sbjct  333   DEESWTLFCNRTFQSNDCPPNLEEVAKKILKKCEGLPLAIVAIGGVLALKDKEKTDEWEM  392

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
               H  G + +GN     ++ +LLLS+NDLP YLK C +YLSIYPED+ I+ + +  +W  
Sbjct  393   TLHDFGGEADGN----RIKRVLLLSYNDLPCYLKSCLLYLSIYPEDYPIDVDVIFLKWIA  448

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
              GFV++K G T  ++A  Y+ ELINRSLI      DDG++    IHD  REII SKS + 
Sbjct  449   LGFVEEKGGITSTDIAMRYMKELINRSLIQVKSTLDDGTLNTCGIHDFVREIIASKSKEQ  508

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             +F T        WPEK RHL++H    N Q       LRS++ F   D   ++ + + L 
Sbjct  509   SFTTVATRYYTRWPEKVRHLAIHNFTDNPQEFSGLKCLRSVVIFGYEDPLKTTFLSKFLR  568

Query  1261  SC-RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                +++KVLDL   +L+ +P+ +F+L HLRYL+L  T VK++P+SI KL+ LE+++L  T
Sbjct  569   GGPKLLKVLDLDGANLDSIPKHVFKLFHLRYLNLARTGVKIIPKSIGKLQNLEVINLGGT  628

Query  1438  FVTELPVEILKLQHLR--HLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
              VTELPVEIL L+ LR  HL      S  Y    C    K P G+GKL SLE+L  +EA+
Sbjct  629   NVTELPVEILNLRKLRSLHLGGVGDYSNEYAIGGC----KCPLGIGKLISLEELYGIEAD  684

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
               +  + E+GKL +L+ L I KLR EDGK + SS+ +L  LR L +  IEED  LD+ + 
Sbjct  685   S-DKIVMEVGKLTQLRGLAITKLRREDGKELLSSLSRLTNLRDLIISCIEEDETLDLQHS  743

Query  1792  SSPP-PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDP--LEHLQDLPNLVHLE  1962
              SP    L RL L G + ++P W+ SL++L  ++   S+L++D   +  L  LPNLV L 
Sbjct  744   VSPKLGFLTRLMLKGRLERVPQWVTSLQSLRHLWLDNSRLREDENVIGSLGHLPNLVSLG  803

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
                 Y GE + F  G FQ L+ L L +L  L+ V + E +MP L  + +  C  +  +P+
Sbjct  804   LYGAYEGETLCFEVGGFQKLQNLELVQLTRLKWVRVEEESMPSLRDVHLVGCKLMQELPS  863

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWKDGCWE  2301
             GI+ L  L++L FFDM+D+ +      D++ EDY  +SHI +V+  +W DG WE
Sbjct  864   GIQNLTGLQFLGFFDMSDELMQKVQNLDQQSEDYQTISHIPQVFTGHWIDGHWE  917



>ref|XP_010271935.1| PREDICTED: disease resistance protein RPM1-like [Nelumbo nucifera]
Length=748

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/745 (46%), Positives = 478/745 (64%), Gaps = 16/745 (2%)
 Frame = +1

Query  133   MGGSGKTTLVKMVYDD--VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGM  306
             MGG GKTTLV+ VYDD  VK HFQSH W+T S++ ++ E+L  M +Q++ E  QP+P G+
Sbjct  1     MGGLGKTTLVRKVYDDQRVKGHFQSHVWVTFSESPRIHELLIHMTKQIYEEHHQPIPHGV  60

Query  307   GSMNANKLKVIVKEFLLRRKYVIVFDDVWTARVWEAIKHVLPK--EKHGCRAMISTRLMD  480
              +M   KLK +++EFL +++YVIV DD+W+ + W++I+HV P      G R MI+TR   
Sbjct  61    ETMEDAKLKQLLQEFLKQKRYVIVVDDIWSIQAWKSIEHVFPDTDSNRGSRIMITTR-SK  119

Query  481   VASSSSTDTNGYIYEMTPLSEEVSWALLCRKAFHAS---SCPSHLTEILKQILKRCGGLP  651
             V + S   ++ ++Y +  LS++ SW L C K F +S   SCP+HL E+ + I+++CGGLP
Sbjct  120   VVAESCMKSHLHVYTLKTLSQKKSWTLFCNKTFRSSPDHSCPTHLEELSQSIVRKCGGLP  179

Query  652   LAIVAIGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCF  831
             LAIV +GGVL+TK KT ++ W     SL  +   +D   S+  IL LS+NDLP +LK CF
Sbjct  180   LAIVTVGGVLSTKQKTEMD-WEMFDRSLATELYEDDSLRSMVKILTLSYNDLPYHLKSCF  238

Query  832   MYLSIYPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLND-  1008
             + LS++PED LI+   LI  W  EGF+++K GKT+EE+ E YL+EL+NRSLI   + +D 
Sbjct  239   LCLSMFPEDELIDKTRLIRIWMAEGFIQRKEGKTLEEIGESYLYELVNRSLIQIAETSDF  298

Query  1009  DGSMKQGRIHDLYREIILSKSTDHNFVTTI--DEETAAWPEKARHLSVHGTLGNA-QMKR  1179
             DG +K+ R+HDL REIILSK+ + NF T I  D++     EK R LS H +     Q + 
Sbjct  299   DGRVKKCRVHDLIREIILSKAREQNFGTIIKQDQDVKVDNEKIRRLSFHHSCELVPQQEE  358

Query  1180  QGTKLRSLLTFNVTDSQFSSHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSL  1359
               T LRSL TFNV+    +       S   ++KVLDL++  L    EE   L HL+YLSL
Sbjct  359   SITHLRSLFTFNVSTLSDTFRSGAFFSRLELLKVLDLRNAPLNEFLEEFTNLFHLKYLSL  418

Query  1360  RSTKVKVLPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVS-FAYLPYNC  1536
             R+T +K +P SIKKL+ LE LDLK T+V+ELP+ IL L  LRHL+VY   + FA   ++ 
Sbjct  419   RNTNIKQIPDSIKKLQNLETLDLKQTYVSELPIGILSLHKLRHLLVYYRTTDFASGTFDE  478

Query  1537  SPGFKAPkglgklgsleklVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSI  1716
               GFKAP G+G L SL+KL ++ AN  +  I+E+G+L +L++L I+ L+ EDG  +CSSI
Sbjct  479   YLGFKAPNGIGVLESLQKLSFMIANTASVLIKELGRLVQLRKLWIMMLKREDGIHLCSSI  538

Query  1717  EkllklrslnlksIEEDVVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFR  1896
             EK+  L+SL + +IEE  +LD+  LSSPP  L++L L G +  +PHWI SLR+L  I   
Sbjct  539   EKMSCLKSLAVTAIEESEILDLESLSSPPRFLRKLALVGRLQSLPHWIPSLRSLSSIALA  598

Query  1897  WSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGE  2076
              +KLKDDPLE L  LP+L  L     Y GE + F +G FQ L  L L+ L  LR V + E
Sbjct  599   GAKLKDDPLEALNGLPDLRVLSLGDAYQGEQLRFQSGGFQRLTYLILNSLGGLRMVTMEE  658

Query  2077  GAMPHLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSH  2256
             G++P+LE++ I  C  L  VP+GIE L  L  + F +M D+F      +  GED+ KV+H
Sbjct  659   GSLPNLERIEITYCRILEKVPSGIERLTKLEEILFCNMPDEFRLKMWYN--GEDHAKVAH  716

Query  2257  ISEVYYTYWKDGCWEVNSVQETSSG  2331
             +  V +  W DG WE+  + +T+S 
Sbjct  717   VPSVRFPNWIDGQWEIYDLNDTASA  741



>ref|XP_009623392.1| PREDICTED: disease resistance protein RPM1-like [Nicotiana tomentosiformis]
Length=486

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/556 (58%), Positives = 396/556 (71%), Gaps = 76/556 (14%)
 Frame = +1

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             L H+LGP+ + ND+F S+RI+LLLSFNDLP YLK CF+YLSIYPEDHLIE N+LIY+W  
Sbjct  2     LNHNLGPELDSNDKFGSMRIVLLLSFNDLPYYLKPCFLYLSIYPEDHLIERNTLIYRWIT  61

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFVKQK G+TVE+VAEGYL ELINRSL+ PV+ NDDGSMK GRIHDLYRE+ILSKS D 
Sbjct  62    EGFVKQKEGRTVEDVAEGYLNELINRSLLHPVQYNDDGSMKLGRIHDLYRELILSKSRDD  121

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF  T++E+T  WPEK R +S+HGTLGN Q+K                            
Sbjct  122   NFTATVNEQTTLWPEKTRRMSIHGTLGNLQVK----------------------------  153

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               R+++VLDL+   LE++PE +FQL HLRYLSLR+T V+VL RSI++L+ LEILDLK T+
Sbjct  154   --RMLRVLDLRRAPLEMIPETVFQLFHLRYLSLRNTSVRVLSRSIERLKQLEILDLKQTY  211

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VTELPVEILKL++LR L+VYSHVS++YLPYNCSPGFKA +G G L +L+KLVY+EA PG+
Sbjct  212   VTELPVEILKLENLR-LLVYSHVSYSYLPYNCSPGFKALRGFGTLRALQKLVYIEATPGS  270

Query  1621  GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSP  1800
               + E+G L+EL+RLCILKLR EDG+ VCSSI KL KL SLNLKS+EE  +LD++Y+SSP
Sbjct  271   DILREVGMLSELRRLCILKLRKEDGRIVCSSIVKLRKLESLNLKSLEEHEILDISYMSSP  330

Query  1801  PPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYT  1980
             PPLLQRLYL+G + K P          +I++R + L+                       
Sbjct  331   PPLLQRLYLTGRIVKFP----------RIHWRGTTLEQ----------------------  358

Query  1981  GEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLF  2160
                     GKFQ L+LLNLDK E LR V I EGA+PHLEK+VIQRC  L SVP GIECL 
Sbjct  359   --------GKFQKLKLLNLDKWEGLRRVTIKEGAIPHLEKMVIQRCTLLESVPIGIECLL  410

Query  2161  NLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQE-----TS  2325
             +L+ LEFFDM+D+FI T  PDK G D  KVSHI EVYYTYW+DGCW V+S++E      S
Sbjct  411   SLKILEFFDMSDEFIMTLRPDKLGADSWKVSHIPEVYYTYWRDGCWMVHSLKEKCNNQIS  470

Query  2326  SGPETAVKISGRRNSL  2373
             S      +  GRRNSL
Sbjct  471   SHSGAVTRTYGRRNSL  486



>ref|XP_010056218.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Eucalyptus 
grandis]
Length=785

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/621 (50%), Positives = 423/621 (68%), Gaps = 9/621 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R +ALLL++  +VGIE P+ ELI  LL      +VISV+GMGG GKTTLVK V++D  
Sbjct  154   DNRGNALLLDKTGLVGIEQPKNELIGQLLDGVHRREVISVLGMGGLGKTTLVKQVFEDPS  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF  +AWIT+S+  ++EE+LKDM+ Q+   +++PVP G  +MN++ LK+I+ + L R
Sbjct  214   VKKHFAVYAWITLSRPSEIEELLKDMLDQIVRVMRKPVPPGANAMNSDWLKMIINDQLQR  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+IV DD W    W+A+ H LP   HG R +I+TR  D+AS+S  + NG +  M PL+
Sbjct  274   RRYLIVLDDAWYRDKWDAVMHALPNNDHGSRVIITTRNADLASTSCKEFNGLVKNMEPLN  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C++ F  +SCPSHL EI + IL +C GLP AI+AI GVLA K+K  I+EW A
Sbjct  334   PEQSWKLFCQRTFQKNSCPSHLEEICEYILGKCDGLPFAIMAISGVLAAKDKQRIDEWDA  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             L  +L  + +GN++  +L+ +L LSF+DLP YLK CF++LS++PE HLIE   L   W  
Sbjct  394   LRCNLRAEIDGNNRLMNLKRVLSLSFSDLPYYLKSCFLHLSVFPEGHLIERRRLTRLWVA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV+++ GKT++EVA+ Y  EL+NRSL+   +   D  ++  RIHD  REII SKS+D 
Sbjct  454   EGFVERREGKTLDEVAKEYFSELLNRSLVQVAETTTDRRVRLCRIHDFQREIITSKSSDQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             +F T   E+T  WP K R LS+H +L  AQ  R  ++LRSL  F V D  F   V+    
Sbjct  514   SFATITKEQTDMWPNKVRRLSLHNSLQAAQQNRSLSRLRSLYMFGV-DRGFIDFVLG--C  570

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               +++ VLD+Q+T L   P ++    +LRYL+LR T+VK +P SI +L+ LE LDLKYT 
Sbjct  571   DIKLLNVLDMQATPLSRFPVQVVDCYYLRYLNLRHTEVKTIPTSIGRLQNLETLDLKYTN  630

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VT LPVEI KLQ L+HL+VY + + +YL Y    GFKA   +G L SL+KL Y+EAN   
Sbjct  631   VTRLPVEIFKLQKLQHLLVYRYANISYLCYKY--GFKALTEIGALQSLQKLCYIEANDER  688

Query  1621  GTI--EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
               I   E+GKL +L RL ILKLR EDG+A+CSSIEKL  L +L++ S+E+D +LD+ +L+
Sbjct  689   NDILMRELGKLTQLSRLGILKLRKEDGRALCSSIEKLTNLCALSVASVEDDEILDLQHLT  748

Query  1795  SPPPLLQRLYLSGYMGKMPHW  1857
             SPPPLLQR+YL G +  +P+W
Sbjct  749   SPPPLLQRIYLKGRLKTLPNW  769



>emb|CDP13422.1| unnamed protein product [Coffea canephora]
Length=960

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/787 (45%), Positives = 495/787 (63%), Gaps = 29/787 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VG+++P+K LIS LLK DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAKLVGVDHPKKHLISQLLKRDDYQLKVVSVVGMGGLGKTTLVKKVHEDPEV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   AW TVSQT   +++LKD+IQQL  E K+PVP+ + SM+ ++LK IVK+FL + 
Sbjct  219   RRHFPVRAWATVSQTCDFQDLLKDLIQQLHKEGKKPVPQSIESMSTSELKKIVKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  HG R M++TR  DVAS+S T++ GYIY M PLS
Sbjct  279   GRYAIVFDDVWDVEFWNTIKFALPESSHGNRVMLTTRKADVASASCTESLGYIYRMEPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  +SCP HL ++ K IL +C GLPLAI+AI G+LA K+   I EW  
Sbjct  339   LEDSWTLFCNKIFKGNSCPGHLMDVAKSILDKCEGLPLAILAISGLLALKDVNRIEEWEM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + ++ IL LS+ DLP +LK+C +Y SIYPED+ I    L+  W  
Sbjct  399   VRRSLGVELEGTGKLDRVKRILSLSYTDLPWHLKICLLYTSIYPEDYKIGCLRLVNLWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E++A GY  EL+NRSLI    +  +G     RIHDL REII+SKS + 
Sbjct  459   ERFVEWREGMSIEDIAWGYFSELVNRSLIQVTGVFYEGMPGYCRIHDLLREIIISKSREQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK------LRSLLTFNVTDSQFSS  1239
             N VT    +   WP EK R L VH +  N     Q T+      LRS +T   T+   S 
Sbjct  519   NMVTITTGQPTRWPSEKVRRLIVHTSSSNNTQHHQQTQNCCFDHLRSFVTVGSTNPLLSR  578

Query  1240  HVV-QILSSCRVIKVLDLQSTSL-EIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRML  1413
              ++ ++L S +++KVLDL      E VP EIF L HL++L L  T+V+ +P++I KL+ L
Sbjct  579   MLLSKVLESSKLLKVLDLTGQETPEEVPNEIFNLFHLKHLDLCGTRVERVPKAIGKLQHL  638

Query  1414  EILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslekl  1593
             E L+L  T V ELP+EILKLQ LR L V+  V  ++  Y    GFKAP  +G L +LE L
Sbjct  639   EYLNLGNTGVRELPMEILKLQKLRVLKVHQRVDASHDDYG-HHGFKAPSNMGGLLALEIL  697

Query  1594  VYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EE  1764
               ++ + G+  ++EIGKL +L+ L I KLR EDGK +CSS+  L  L+ L + SI   ++
Sbjct  698   NCIDVSSGSAILKEIGKLTQLRELGITKLRREDGKELCSSLANLTSLQVLRVASIAKGDD  757

Query  1765  DVVLDVNY--------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--D  1914
               ++D+N+         SS P  L+ L L G + KMP W+  L +LV+I   WS+L+  +
Sbjct  758   HEIIDLNHHPPPLSSSSSSFPQSLRMLILCGRLEKMPQWVAHLHSLVRIDLDWSRLRGEE  817

Query  1915  DPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHL  2094
             DPLE LQ LPNL  + F   Y GE + F AG F  L+ L+L ++E LR + + EGA+PH+
Sbjct  818   DPLESLQHLPNLGEINFCGSYQGEGLCFKAGGFLKLKQLHLKRMEGLRWMRVEEGALPHV  877

Query  2095  EKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKR--GEDYCKVSHISEV  2268
             +KL +Q+   L  +P GI+ L  L+ L  ++M+       L +++   EDY +++HI E+
Sbjct  878   QKLFLQQLPSLEELPMGIQHLIQLQRLNLYEMSSQLREKLLENQKEDSEDYRRIAHIPEI  937

Query  2269  YYTYWKD  2289
                Y+ D
Sbjct  938   LIGYYTD  944



>gb|KCW72838.1| hypothetical protein EUGRSUZ_E01289, partial [Eucalyptus grandis]
Length=890

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/742 (45%), Positives = 481/742 (65%), Gaps = 9/742 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             ++ R      +++E+VGIE  +K+L++LL++     +VISVVGMGG GKTTLV  VY D 
Sbjct  153   HEHRGKDCFSDKNELVGIEEQKKQLVALLVEGTSRPQVISVVGMGGLGKTTLVNEVYQDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VKKHF    WI  S +  + E+L+D+ +Q+   ++QP+P G  +MN   LK+++K+ L 
Sbjct  213   EVKKHFMVCTWINFSGSPSIGELLQDIHRQIGGVIRQPIPCGADTMNIYWLKMLIKDLLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
               +Y++V DD W    W+ +KH LP    G R +I+TR  D+A +S  +  G +Y+M PL
Sbjct  273   EARYLVVLDDTWRIDEWDVVKHALPSNMCGSRIIITTRNYDLAHTSCREFEGKVYKMEPL  332

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L C+K F  SSCPSHL +  + ILK+C GLPLAIVAIGGVLATK++  I+EW 
Sbjct  333   PVDQSWKLFCKKTFQGSSCPSHLEKTCEFILKKCEGLPLAIVAIGGVLATKDEHRIDEWE  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + HSL  +   +D+ ++L+ +LLL FNDLP YLK CF++LS++PE   I+   LI  W 
Sbjct  393   LVRHSLDTEINCDDKLKNLKRVLLLGFNDLPYYLKSCFLHLSLFPEGRCIKCKRLIRLWI  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV++K GKT+EEVAE Y  EL+NR+LI        G++   RIHD   +I+ SKST+
Sbjct  453   AEGFVEKKEGKTLEEVAEDYFMELLNRNLIEVAARRAYGAVNYCRIHDFLWDIVTSKSTN  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
               F     EE    P+K R LS+  TL   Q     ++LRSL  F +  S F + V  + 
Sbjct  513   QGFAEIAKEEKFEQPDKVRRLSLQKTLRALQQNWSLSQLRSLYMFGMERS-FMNKV--LA  569

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             +  +++ VLD+ +  L+  P ++    +LRYLS R T+V  +P SI KL+ LE LDLK+T
Sbjct  570   TDMKMLNVLDILAAPLKRFPAQVADWCYLRYLSFRGTEVSTVPTSIVKLKNLETLDLKHT  629

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              VTELPV+I KL+ LRHL+VY +    YL +    GFKA +G+G L SL+KL Y+EA+  
Sbjct  630   NVTELPVDIWKLRRLRHLLVYRYKLMPYLSFKV--GFKALQGIGALQSLQKLCYIEADDA  687

Query  1618  N--GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
             N    + E+G L +L RL ILK++ EDG+ +CSSI KL +L+S+++ S++ED ++D+ +L
Sbjct  688   NSCSVMRELGMLTQLDRLAILKVKKEDGRDLCSSISKLTRLQSISIASVDEDEIIDLQHL  747

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPPP L+R+YL G +G +P W+ SL +L+K+  R+S LKDDPL  L++LPNLVHLE   
Sbjct  748   SSPPPFLERMYLYGRLGALPKWLPSLSSLMKLLLRYSCLKDDPLVSLENLPNLVHLELRQ  807

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G  + F A  F+ L +L LD  ++LR + + +GAMP L+KL I+RC  L ++P+G+E
Sbjct  808   VYGGSSLCFRAKGFKKLNILRLDLFDKLRCIEVEKGAMPFLQKLAIRRCKLLENLPSGVE  867

Query  2152  CLFNLRYLEFFDMTDDFISTFL  2217
              L  L+ L+ FDM D  +   +
Sbjct  868   NLTKLKVLKIFDMPDKLVKKLV  889



>emb|CDP20055.1| unnamed protein product [Coffea canephora]
Length=925

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/771 (44%), Positives = 493/771 (64%), Gaps = 13/771 (2%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             R  ALL+EE ++VGI  P++EL + +L D   LK++SVVGMGG GKTTLVK VYDD  VK
Sbjct  156   RDQALLIEEAQLVGINKPKEELTAKILDDHSHLKIVSVVGMGGLGKTTLVKKVYDDSAVK  215

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             K FQSHAWITVSQ F+   ++K++IQQL+ E++QPVP  + S++  +L   VK+FL  R+
Sbjct  216   KQFQSHAWITVSQKFQFNVIIKNLIQQLYDEIRQPVPSQVESIDGIRLSEFVKDFLKERR  275

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y++V DDVW+   WEAIK++LP      R +++TR+ DVAS+S   ++ ++++M PLS+E
Sbjct  276   YILVLDDVWSLDFWEAIKYILPDYNVASRVVLTTRIADVASASCLASHDFVHKMKPLSDE  335

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L C + F ++ CP  L E+ ++ILK+C GLPLAIVAIGGVLA K+K  ++EW  + 
Sbjct  336   QSWTLFCNRTFQSNGCPPSLEEVSRKILKKCEGLPLAIVAIGGVLALKDKERMDEWEMIL  395

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
             H  G + +G+ + + ++ ILLLS+NDLP +LK C +YLSI+PED  I+  +++ +W   G
Sbjct  396   HGFGSEVDGSGKLDRIKRILLLSYNDLPHHLKGCLLYLSIHPEDFPIQVINILEKWITLG  455

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FV++K G    ++A  YL ELINRSLI      DDG +K   +HD   EII+SKS + +F
Sbjct  456   FVEEKEGMATTDIAMRYLKELINRSLIQIKDTWDDGQLKACGLHDFLHEIIISKSKEQSF  515

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSC  1266
              TT       WP K RHL++H      Q       LRS+  F   D   +S + + L   
Sbjct  516   TTTATGYYTRWPVKVRHLAIHNFTNKPQDFSSLKCLRSVQIFRYEDPLTTSFLSKFLCGG  575

Query  1267  -RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
              + +KVL L+   L+ +P+E+F+L HL+YL+LR T+VK++P+SI +L+ LE+L L  T +
Sbjct  576   PKFLKVLGLEGAELDNIPKEVFKLFHLKYLNLRGTRVKIIPKSIGQLQNLEVLGLAETNI  635

Query  1444  TELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNG  1623
             TELPVEILKL+ LR L+V     ++    N   GFK+P G+GKL SLE L  +EA+  + 
Sbjct  636   TELPVEILKLRKLRVLVVGRTGDYS---NNTIWGFKSPDGIGKLISLENLGSIEAD-SDE  691

Query  1624  TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPP  1803
              + EIGKL  L++L I KLR EDGK + SS+ +L  L+ L+++SI+E+  LD+ +   PP
Sbjct  692   IVREIGKLIRLQKLTITKLRREDGKELLSSLLRLTNLQELDIQSIKEEETLDLQHF-FPP  750

Query  1804  PL--LQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDP--LEHLQDLPNLVHLEFLV  1971
              L  L+ L+L G++ ++P W+ SL++L ++  ++S LK+D   +  L  LPNL  L    
Sbjct  751   RLGFLRVLHLRGHLERVPQWVISLQSLSELRLQYSGLKEDENVIGSLGQLPNLRFLMLHR  810

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y GE M F  G F+ LR L L +L  L+ V + EG+MP L+      C  +  +P G++
Sbjct  811   AYEGETMCFKIGGFRKLRRLQLQQLRRLKWVRVEEGSMPSLQLFTFAGCKLMEGLPLGLQ  870

Query  2152  CLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWKDGCWE  2301
              L  L  L  +DM+++ I      DK+  DY  +SHI +V   +W DG WE
Sbjct  871   NLTGLEGLGLYDMSNELIHKVQNLDKQSGDYQIISHIPQVCIGHWIDGRWE  921



>ref|XP_010024987.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
 ref|XP_010024988.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=930

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/750 (44%), Positives = 479/750 (64%), Gaps = 13/750 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DA L++EDE+VGI+ PR+EL+  L+  +P L+V+S+ GMGG GKTTL K V+D+ 
Sbjct  149   HDLREDACLVDEDELVGIDEPREELVKWLVDSEPGLQVLSIFGMGGLGKTTLAKRVFDNQ  208

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK +FQSH W+TVSQ++++  +L++M++QL  E+KQP P+GM S N+ KLK ++K+ L 
Sbjct  209   QVKAYFQSHVWVTVSQSYEIANILREMVEQLHREIKQPAPQGMESANSTKLKQMLKDLLQ  268

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YVIV DDVW+++  E IK+ +P      R +I+TR  D+A+     +   +YE+  L
Sbjct  269   QKRYVIVLDDVWSSKALEGIKNAMPNNSLCSRIIITTRTADIATVLFNQSK--VYELKGL  326

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S E SW+L C+KAF+ + CP +L  + +QILK+C GLPLAIV +GG+L  K+   + EW 
Sbjct  327   SLEESWSLFCKKAFYGNPCPPYLEHLSRQILKKCEGLPLAIVTVGGLLFGKD---VLEWQ  383

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + E ND+ ++ R IL LS+NDL   LK CF+YL ++PEDH+I  N LI  W 
Sbjct  384   MISRSLPAELEDNDRMQNFRKILSLSYNDLRYNLKSCFLYLGVFPEDHVIACNRLIRLWI  443

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+++ G T EEV   YL ELINRSL+        G ++  R+HDL RE I+ K+ D
Sbjct  444   AEGFVEKREGMTREEVGRRYLKELINRSLVQIAGTKTGGMLQSCRVHDLMRECIIYKARD  503

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NFV    E+     E+ R LS+  T  NA  +     LRSLL F    S  S     + 
Sbjct  504   ENFVLFASEQKVELHERVRRLSIKYTCNNALKQLNLPSLRSLLIFESATSSNSDEQF-VP  562

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S C++++VLDL  + L   P++I  + HL+YLSL+ TKV ++PRSI KL+ LE LDLK T
Sbjct  563   SGCQLLRVLDLGDSPLHEFPQQILVMFHLKYLSLKGTKVCIIPRSIGKLQNLETLDLKQT  622

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFA-YLPYNCSPGFKAPkglgklgsleklVYVEA--  1608
              V+ELPVEI KL+ L++L VYS V F    P+  + GF  P+G+G L SL KL YV+A  
Sbjct  623   LVSELPVEITKLKKLQYLFVYSRVDFTPSQPFCSTTGFFTPQGIGMLASLHKLCYVKAGG  682

Query  1609  NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
             +    T++E+G+L +L+RL ++ L+ +D K +C S+EK+  LR+L++ +  E  V+D+++
Sbjct  683   HRSKNTMQELGELYQLRRLGVMDLKKDDAKELCHSLEKMTDLRALDVNAENEYEVIDLDF  742

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             LSSPP LL+RLY++G + K+PHW+  L NL K+Y   S+LK  PL   Q+LPNLV L+  
Sbjct  743   LSSPPQLLERLYINGCLNKLPHWLPLLNNLTKVYLISSRLKSIPLFAFQNLPNLVELQLD  802

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL--ASVPA  2142
               + GE++ F    F  L+ L L  L+ LR V++   AMP+L+ L I RC      S+  
Sbjct  803   GAFDGENLVFGDKGFPKLKKLLLKNLQNLRFVLMNGQAMPYLQSLFICRCRHFDWQSLLV  862

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRG  2232
              I  L  L YL F +M  +F   F P   G
Sbjct  863   VIRNLTLLTYLRFQEMPREFALAFSPCSSG  892



>emb|CDP11700.1| unnamed protein product [Coffea canephora]
Length=927

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/779 (45%), Positives = 496/779 (64%), Gaps = 21/779 (3%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R  ALL+EE ++VGI+ P+KELIS +L D   LK++SVVGMGG GKTTLVK VYDD  
Sbjct  154   DIRDQALLIEEAKLVGIDQPKKELISKILDDHSHLKLVSVVGMGGLGKTTLVKKVYDDAA  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK FQSHAWITVSQ F+ + ++K++IQ+L+ E++QPVP  + SM+  +L   VK+FL  
Sbjct  214   VKKQFQSHAWITVSQNFQFKVIIKNLIQRLYEEIRQPVPPQVESMDGIRLSEFVKDFLKE  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y++V DDVW+   WEAIK+VLP      R +++TR++DVAS+S   ++ +I+ M  LS
Sbjct  274   RRYILVLDDVWSLDAWEAIKYVLPDYNIASRVVLTTRIIDVASASCLASHDFIHIMKSLS  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C + F ++ CPS+L E+ ++ILK+C GLPL IV +GGVLA K+K  I+EW  
Sbjct  334   YEDSWTLFCIRTFQSNGCPSNLEEVCRKILKKCEGLPLGIVTMGGVLALKDKDRIDEWEM  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             ++   G + +G+ + + +R ILLLS++DLP +LK C +YLSIYPEDH I+   L+ +W +
Sbjct  394   IFCGFGCEMDGSSKLDRIRKILLLSYSDLPHHLKNCLLYLSIYPEDHPIDVVKLLDKWIV  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
              GF++++ G    ++A  YL ELINRSLI       DG +K+  +HD  REII+SKS + 
Sbjct  454   LGFIEKEEGMMATDIAMRYLKELINRSLIQVKDTRVDGGLKECGLHDFLREIIVSKSKEQ  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTK-LRSLLTFNVTDSQFSSHVVQIL  1257
             +F T        WP+K RHL++H    N        K LRS+ TF   D   +S + + L
Sbjct  514   SFTTVSTGYCTRWPDKVRHLAIHNFTDNPPQGFSSLKCLRSVETFGYEDPLTTSFLSKFL  573

Query  1258  SSC-RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
                 + +KVL+L    L+ +P+E+F+L HL+YL + ST++KV+P+SI +L+ LE L L  
Sbjct  574   CGGPKFLKVLNLTGAELDNIPKEVFKLFHLKYLVISSTRIKVIPKSIGQLQNLEFLILAQ  633

Query  1435  TFVTELPVEILKLQHLRHLIV-----YSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             T + ELPVEILKL+ LR L V     YS+ +FA        GFK+P G+GKL SLE L  
Sbjct  634   TTIMELPVEILKLRKLRTLTVGKEGDYSN-NFALW------GFKSPDGIGKLTSLESLEC  686

Query  1600  VEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             +E N G   + EIGKL +L++L I KLR EDGK + SS+ +L  LR L + SI+ED  LD
Sbjct  687   IEVNNGK-IVREIGKLVQLRQLSITKLRREDGKELVSSLSRLTNLRELYICSIKEDETLD  745

Query  1780  VNYLSSPP-PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDD--PLEHLQDLPNL  1950
             + +  SP    L  L L+G + ++P W+ SL++L  +    S+L +D   ++ L  LPNL
Sbjct  746   LQHSVSPRLGFLTWLGLTGRLERVPEWVISLQSLRTLLLHNSELSEDENAIDCLGHLPNL  805

Query  1951  VHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLA  2130
             V L     Y GE + F AG F+ LR L L +L+ L+ V + E +M  L++ VI  C  + 
Sbjct  806   VKLTLYRAYEGETLCFKAGGFRKLRQLGLVQLKRLKWVRVEEESMSSLQEFVIMGCKLVE  865

Query  2131  SVPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWKDGCWEV  2304
             S+P G++ L  L  L   DM+DD I      DK+ EDY  VSHI +V+  +  +G W+ 
Sbjct  866   SLPLGLQNLTKLNVLGLADMSDDLIHEVQNLDKQSEDYQTVSHIPQVWTGHRINGRWKT  924



>ref|XP_008809624.1| PREDICTED: disease resistance protein RPM1-like [Phoenix dactylifera]
Length=916

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/771 (43%), Positives = 496/771 (64%), Gaps = 10/771 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +DR   AL +EE E+VGIE P++ELI  L+K +  LKVISVVGMGG GKTTLV+ VYD  
Sbjct  149   HDRHMAALFIEEAELVGIEKPKEELIGWLVKGESQLKVISVVGMGGLGKTTLVRKVYDHE  208

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK  F  HAWITV+Q F ++E+L+ ++ Q + E  +  P  + +M   +L   ++ FL 
Sbjct  209   RVKGWFSCHAWITVTQLFTIDELLRSILNQFYRERNEIFPGRIDAMEGIQLIETLRHFLR  268

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              R+YV+V DD+W  + W+ +K+ LP    G R +++TR+ DV  S   +T G++  + PL
Sbjct  269   DRRYVVVLDDLWHIQEWDYLKYALPVNNCGSRVLVTTRIRDVGLSC-LETCGHVCNLQPL  327

Query  538   SEEVSWALLCRKAFHA---SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
                 +W+L C+KAF +    +CP  L +I   I+  C GLPLAIVAI G+L +K ++++ 
Sbjct  328   PPAKAWSLFCKKAFRSIPGGTCPPELEDISHDIVSICDGLPLAIVAIAGLL-SKKESSVL  386

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  L  +L  +   N + E ++ ILLLS+NDLP +LK CF+Y SI+P+D+ ++  +LI 
Sbjct  387   EWRTLLDNLHAELANNPKLEPIKRILLLSYNDLPHFLKSCFLYFSIFPKDYPVKRITLIR  446

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGF++ + G+T+E+VA  YL +LI+R+++   +  D G ++  R+HDL  E IL K
Sbjct  447   LWIAEGFIESEKGETMEQVAVDYLNDLIDRNMVQVAEHYDYGRVRSCRVHDLIYETILLK  506

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
             S + NF  ++  +      + R LS+H    +       + LR+L  F V ++  +S + 
Sbjct  507   SKEKNFSMSLVRKKTHMHGRIRRLSIHNAGEDVLQNTSLSHLRALFMFGV-NALSASSMG  565

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              +  S R++KVLDL+   +E  P E  +LLHLRYLSLR+T++  L +S+ KL  LE LDL
Sbjct  566   NLFYSFRLLKVLDLEGAPIERFPIEFGKLLHLRYLSLRNTRINKLSKSLGKLENLETLDL  625

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K T+V+ELP +ILKLQ LRHL+ Y + +  + P+  + G K P+G+G+L  L+KL Y+EA
Sbjct  626   KGTYVSELPTKILKLQSLRHLLAYHYYTGRHPPFYHTNGVKVPQGIGRLRDLQKLTYIEA  685

Query  1609  NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
             N  +G + E+G L +L+RL I+KLR EDG  +C+SIE++  LRS+++ SI  D VLD+ Y
Sbjct  686   NQDSGIVRELGYLTQLRRLGIVKLRKEDGVNLCASIERMNNLRSISVTSIGMDEVLDLQY  745

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             L SPP  LQRLYL G +  +P+WI +L+NLV++  RWSKLK+D L  LQ LPNLV L  +
Sbjct  746   LKSPPSDLQRLYLRGPLETLPNWISTLQNLVRMRLRWSKLKEDSLRVLQVLPNLVELTLI  805

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y G  +++  G FQ L++L+L++L+ L  V++ +GAMP+L+K+ I++C QL +VP GI
Sbjct  806   RAYDGVQLYYQKGGFQKLKILDLEQLDNLNYVML-DGAMPNLQKMYIRQCVQLKAVPLGI  864

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWE  2301
             E L NL+ L  FDM + F+   L    G D  KV+HI  V     +D  +E
Sbjct  865   EQLVNLKELHLFDMPEVFVQN-LRRHEGADRPKVNHIPIVRSYDHEDRVYE  914



>ref|XP_010027152.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=955

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/783 (43%), Positives = 496/783 (63%), Gaps = 32/783 (4%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R D   ++E E+VGI+ PR+ELI  L+  +P L+V+S++GMGGSGKTTL + VYD+ 
Sbjct  153   HDLREDTFPVDEGELVGIDQPREELIKWLVDGEPELEVVSILGMGGSGKTTLAERVYDNH  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK +FQSHAWI+VSQ++K++++L+DMI QL  E++Q  P+G+ S N+ +LK I+K+FL 
Sbjct  213   QVKAYFQSHAWISVSQSYKIQDILRDMIGQLHGEIEQRAPQGIESANSVRLKQILKDFLH  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YVIV DDVW     E IK  +P +    R +I+TR+ ++A+ SS  +  YI +  PL
Sbjct  273   QKRYVIVLDDVWNLEALEGIKSAMPNDSCSSRIIITTRIANIATFSSNQSKVYIRK--PL  330

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S E SW+L C+KAF    CP HL ++ +QILK+C GLPLAIVAIGG+L  K+   + EW 
Sbjct  331   SPEESWSLFCKKAFRGKLCPPHLKKLSRQILKKCEGLPLAIVAIGGLLFAKD---VQEWE  387

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + H+L  + E ND+ +  R IL LS+ DL   LK CF+YL ++PED +IE  +LI  W 
Sbjct  388   MISHNLAIELESNDRMQIFRKILSLSYIDLHYNLKSCFLYLGLFPEDRVIECMTLIRLWI  447

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF+ ++   T EEVA+ YL ELINR+L+   + + +G +K  R+HDL RE ILSK  D
Sbjct  448   AEGFIVERERMTQEEVAQRYLNELINRNLVQIAETDLEGRLKTCRVHDLMRESILSKLKD  507

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNV-----TDSQFSSH  1242
              NFV+ + E+T    E+ R LSV     NA  +     LRSLL F +     TD QF   
Sbjct  508   ENFVSFLSEQTKELHERVRRLSVQYNCNNALNQLNLPSLRSLLIFQLRTSSSTDEQF---  564

Query  1243  VVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEIL  1422
                  ++ ++++VLDL  + L   P++I   +HL+YLSLR + V+++PRSI KL+ LE L
Sbjct  565   ---FPTNSKLLRVLDLGGSCLHKFPQQILDFVHLKYLSLRRSNVRIIPRSIVKLQNLETL  621

Query  1423  DLKYTFVTELPVEILKLQHLRHLIVYSHVSFAY-LPYNCSPGFKAPkglgklgsleklVY  1599
             DLK+TFV+ +P+EI KL+ L+HL+VYS       +P+    GF APKG+  L SL+ L  
Sbjct  622   DLKHTFVSGIPMEITKLKKLQHLLVYSDAKITTSVPFGFRKGFSAPKGIATLTSLQNLCC  681

Query  1600  VEA--NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVV  1773
             V+A  +    T++E+G+L+ L+RL +  L+ +D K +C S+EK+  L+SLN+ +  E  +
Sbjct  682   VKAGGDQSKNTMQELGELSRLRRLGVTDLKKDDAKELCHSLEKMTNLQSLNVNAKSEFDI  741

Query  1774  LDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLV  1953
             +D+++LSS PP L+ L++ G + K+PHW+  L +L K+   W+KLK  PL  LQ+LPNLV
Sbjct  742   IDLDFLSSAPPFLRGLHIEGCLKKLPHWLPLLTSLTKLRLAWTKLKSSPLIALQNLPNLV  801

Query  1954  HLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL--  2127
              L     + G+ + F    F  L+ L    LE LR  ++   AMP L+ L+I  C  L  
Sbjct  802   ELYLSNAFDGKTLVFGDKGFPKLKKLFFANLENLRFALMNGQAMPCLQSLIIVGCRHLDW  861

Query  2128  ASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRG--------EDYCKVSHIS-EVYYTY  2280
              S+   I  L NL++L+F++M ++F   F P  R         E Y +V   + EVY+ +
Sbjct  862   QSLLVVICGLANLKHLQFYEMPEEFALVFYPYSRNRMRKGILQEHYEEVMERNPEVYFFW  921

Query  2281  WKD  2289
             WK+
Sbjct  922   WKE  924



>ref|XP_010928130.1| PREDICTED: disease resistance protein RPM1-like [Elaeis guineensis]
Length=916

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/771 (43%), Positives = 495/771 (64%), Gaps = 10/771 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +DR   AL +EE ++VGIE P++ELI  L+K +   KVISVVGMGG GKTTLV+ VYD  
Sbjct  149   HDRHMAALFIEEADLVGIEKPKEELIGWLIKGESQRKVISVVGMGGLGKTTLVRKVYDHE  208

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK  F  HAWITV+Q F V+E+L+ +I Q + E  +  P  + ++   +L   ++ FL 
Sbjct  209   RVKGWFSCHAWITVTQLFTVDELLRSIIDQFYKERNELFPGRIDAIEGIQLIETLRHFLR  268

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++YV+V DD+W  + W+ +K+ LP    G R +++TR+ DV  S   +T G++Y + PL
Sbjct  269   DKRYVVVLDDLWHIQEWDHLKYALPDNDCGSRVLVTTRIRDVGLSC-IETCGHVYNLQPL  327

Query  538   SEEVSWALLCRKAFHASS---CPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
                 +W+L C+KAF +++   CP  L +I + I+K C GLPLAI+AI G+L +K ++++ 
Sbjct  328   PPAKAWSLFCKKAFRSTTGGACPPELEDISQDIVKICDGLPLAIMAIAGLL-SKKESSVL  386

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  L  +L  +   N + E ++ ILLLS+NDLP +LK CF+Y SI+P+D+ ++  +LI 
Sbjct  387   EWRTLRDNLHAELANNPKLEPIKRILLLSYNDLPHFLKSCFLYFSIFPKDYPVKRITLIR  446

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFV+ + G+T+E+VA  YL +LI+R+++   +  D G ++  R+HDL  EIIL K
Sbjct  447   LWMAEGFVESEKGETMEKVAVDYLNDLIDRNMVQVAEHYDYGRVRSCRVHDLIHEIILLK  506

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
             S + NF T++  +      + R LS+H T  +       + LR+L      ++  +S + 
Sbjct  507   SKEENFSTSLFRQKTHMHGRIRRLSIHNTGKDVLQNTSLSHLRALFMIG-ANALSASSMR  565

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              +  S R++KVLDL+   +E +  E  +LLHLRYLSLR+T++  L +S+ KL+ LE LDL
Sbjct  566   NLFYSFRLLKVLDLEGAPIERIQIEFGKLLHLRYLSLRNTRINKLSKSLGKLKNLETLDL  625

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K T+V+ELP +ILKLQ LRHL+ Y + +  + P+  + G K P+G+G+L  L+KL Y+EA
Sbjct  626   KGTYVSELPTKILKLQSLRHLLAYHYYTGRHPPFYHTNGVKVPQGIGRLRDLQKLTYIEA  685

Query  1609  NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
             N  +G + E+G L +L+RL I+KLRTEDG  +C+SIE++  LRS+++ SI  D  LD+ Y
Sbjct  686   NQDSGIVRELGYLTQLRRLGIVKLRTEDGVNLCASIERMNNLRSISVTSIGMDEFLDLQY  745

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             L SPP  LQRLYL G +  +P WI +L+NLV++  RWSKLK+D L  LQ LPNLV L  +
Sbjct  746   LKSPPSDLQRLYLRGPLQTLPDWISTLQNLVRMRLRWSKLKEDSLGVLQALPNLVELTLI  805

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               Y G  +    G FQ L++L+L++L+ L  V++ +GAMP+L+K+ I+ C QL  VP GI
Sbjct  806   RAYDGVKLCCQKGGFQKLKILDLEQLDNLNYVIL-DGAMPNLQKMYIRHCVQLKVVPLGI  864

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWE  2301
             E L NL+ L  FDM + F+   L  + G D  K  HI  V     +D  +E
Sbjct  865   EQLINLKELHLFDMPEAFVQR-LRRQGGADRLKAKHIPIVRSYDHEDQVYE  914



>gb|KCW78492.1| hypothetical protein EUGRSUZ_D02635 [Eucalyptus grandis]
Length=909

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/746 (43%), Positives = 468/746 (63%), Gaps = 41/746 (5%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
              D R DALL  + ++VGIE P+K+LI  +++  P  +++SVVGMGG GKTTLVK  Y+D 
Sbjct  153   QDHRGDALLFAQKDLVGIEKPKKKLIEWMIEGRPGRQIVSVVGMGGLGKTTLVKQAYEDP  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSM------NANKLKVI  339
              VKK F + AW+T+S + + E VL+DM+QQ+    ++PVPEG+ ++      N + LK +
Sbjct  213   LVKKLFATRAWVTLSPSSETEGVLRDMLQQITGGRRKPVPEGIPALDGLDVSNRDLLKTL  272

Query  340   VKEFLLRR--KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNG  513
             +K  L     +Y+IV DDVW    W+ +K+VLP ++   R +++TR  D+A ++ T+  G
Sbjct  273   IKNMLQESGTRYLIVLDDVWQLDRWDDVKYVLPNDEQDSRIILTTRKTDLALNACTEFTG  332

Query  514   YIYEMTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKN  693
              ++ M PLS+E SW L C + F  +SCP +L +I + IL+ C GLPLAIVA+ G+LATK+
Sbjct  333   EVHNMEPLSDEQSWELFCMRTFRDNSCPLYLEKICRSILRNCEGLPLAIVAVSGILATKD  392

Query  694   KTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEH  873
             +  I+EW  +  SL     GN     L+ +L LSFNDLP YLK CF++LS++PEDH IE 
Sbjct  393   QGRIDEWAKVCRSL----HGNVGLNKLKKVLSLSFNDLPHYLKSCFLHLSVFPEDHKIER  448

Query  874   NSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYRE  1053
               LI  W  EGFV+ K G+T EEVAE YL +L+NRSL+   +   DG ++  RIH   ++
Sbjct  449   MRLIRLWMAEGFVEPKEGETPEEVAEDYLNDLLNRSLLQVAETTTDGRVQMCRIHHHLQK  508

Query  1054  IILSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQF  1233
             I ++KS + N+    D++     +  R+LS+H  L  ++     ++LRS   F + +S  
Sbjct  509   ICITKSKERNYTIVRDKQCPERLDGTRYLSIHKLLEISRQNMNHSELRSPFIFKLDESS-  567

Query  1234  SSHVVQILSSC--RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLR  1407
                 + ++ SC  +++ VLD Q   L+  P ++  +  LRYL+LR+T+VK +PRSI  L+
Sbjct  568   ----INMVLSCDFKLVWVLDFQGAPLKRFPMQVLDMHFLRYLNLRNTEVKTIPRSIGWLQ  623

Query  1408  MLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsle  1587
              LE LDLK++ VTELPVEI+KLQ LRHL+VY +   +Y  Y+   GFK    +       
Sbjct  624   HLETLDLKHSKVTELPVEIIKLQKLRHLLVYRYEQDSY--YHTKHGFKTLAEI-------  674

Query  1588  klVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED  1767
                        GT++ + KL  + RLCILKL+ EDGK +CSSI +L  L SL++ S  +D
Sbjct  675   -----------GTLQNLQKLCYIVRLCILKLKKEDGKNLCSSIAELTNLLSLSVSSFTDD  723

Query  1768  VVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPN  1947
               +D+ +LSSPPPLLQR+YL G +  +PHWI +L++LV ++ RW +L+DDPL  L  LPN
Sbjct  724   EEIDLGHLSSPPPLLQRIYLRGRLHTLPHWIANLQSLVILHLRWCQLRDDPLIPLTSLPN  783

Query  1948  LVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL  2127
             LVHLE L  +  E +      F+ L++L LD  E L  +    GAMP LEKL+I RC  L
Sbjct  784   LVHLELLQAHNWETLTLTKEGFKKLKILALDHFENLTFIGFENGAMPCLEKLMISRCELL  843

Query  2128  ASVPAGIECLFNLRYLEFFDMTDDFI  2205
              +VP+GIE L  L+ LEFF M D  I
Sbjct  844   KNVPSGIEYLTKLKLLEFFVMPDTLI  869



>emb|CDP21446.1| unnamed protein product [Coffea canephora]
Length=905

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/778 (45%), Positives = 479/778 (62%), Gaps = 33/778 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE E+VGI+NPR++LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  137   RDDALLVEEAELVGIDNPRQQLISQLLEGDDSQLKVVSVVGMGGLGKTTLVKKVHEDLDV  196

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   A++TVSQT   +E+LKD+ +QL  ELK+PVPE + +M A +LK  VK+FL + 
Sbjct  197   RRHFPVRAFVTVSQTCNFQELLKDLTRQLHNELKKPVPESIEAMTAIQLKQFVKDFLQQA  256

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W AI+  LPK  +G R M++TR  DVA +S T +  Y++ M PLS
Sbjct  257   GRYAIVFDDVWDTEFWNAIRIALPKNGYGNRVMLTTRKADVAFASCTQSQDYVFRMVPLS  316

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HLT++ K IL +C GLPLAI+AI G+LA K+ T   EW  
Sbjct  317   FEDSWTLFCNKIFKGNGCPAHLTDVAKGILGKCQGLPLAILAISGLLALKHLTIAEEWEM  376

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SL  + EG+   + +R IL LS+NDLP +LK C +YLSIYPED  I  + L+  W+ 
Sbjct  377   VRRSLVGELEGSGMLDRVRKILSLSYNDLPCHLKTCLLYLSIYPEDFEIRCHRLVQLWSA  436

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             +GFV +  G  + +V   YL EL+NRSLI   K   +G     RIHDL RE++LSKS + 
Sbjct  437   DGFVGKTEGIPMTDVGFNYLRELVNRSLIQVTKSFYEGIPYTCRIHDLVREVVLSKSREQ  496

Query  1081  NFVTTIDEETAAW-PEKARHLSVHGTLGNAQMKRQG-----TKLRSLLTFNVTDSQFSSH  1242
             N +T    +   W  EK R L VH +  N + +++        LRS +T    +   S  
Sbjct  497   NMITITSGQCTRWSSEKVRRLVVHSSSNNTEQQQESQYYCLNHLRSFITIECMNPLVSRA  556

Query  1243  VV-QILSSCRVIKVLDLQS-TSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
             ++ + L S R++KVLDL    +LE +P EIF L HLRYL+L  T VK +P+ I KLR LE
Sbjct  557   LLSKALKSSRLLKVLDLSDEETLEEIPNEIFNLYHLRYLNLYRTGVKAVPKFIGKLRNLE  616

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              LDL  T V ELP+EILKLQ L HLIVY +V F+   Y    GFK+P  LG L +L+ L 
Sbjct  617   YLDLGETQVKELPMEILKLQKLEHLIVYENVDFSRESYGFD-GFKSPSKLGGLSALQTLD  675

Query  1597  YVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
              ++A+ G+ T++EIG L +LKRL I  LR EDGK +CSS+  L  L+ LN+ SI  D V 
Sbjct  676   TIDASSGSVTVKEIGTLTQLKRLGISNLRREDGKVLCSSLATLTSLQLLNIASIRNDGV-  734

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKD--DPLEHLQDLPNL  1950
                             L G + KMP WI  L++LV+IY +WS L+D  DPLE L  LPNL
Sbjct  735   ----------------LHGPLEKMPKWIAHLQSLVRIYLKWSGLRDEEDPLEPLHYLPNL  778

Query  1951  VHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLA  2130
             V + F   Y GE + F AG F  L+ L L KLE+L+ + + EGA+P+L +L + R   L 
Sbjct  779   VTIHFCGSYQGEGLCFKAGGFLKLKDLYLQKLEKLKWLKVEEGALPNLHELGLDRLPLLE  838

Query  2131  SVPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWKDGCWE  2301
              +P  I+ L +L+ L    ++   +      ++  E Y K++ I EV   +  +  W+
Sbjct  839   ELPVDIQHLGHLQKLALLGLSYQLMEKLNNLNEDSEHYGKIARIPEVEIAFLTNEGWK  896



>gb|KCW61558.1| hypothetical protein EUGRSUZ_H04290, partial [Eucalyptus grandis]
Length=851

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/709 (45%), Positives = 463/709 (65%), Gaps = 11/709 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DA L++EDE+VGI+ PR+EL+  L+  +P L+V+S+ GMGG GKTTL K V+D+ 
Sbjct  149   HDLREDACLVDEDELVGIDEPREELVKWLVDSEPGLQVLSIFGMGGLGKTTLAKRVFDNQ  208

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK +FQSH W+TVSQ++++  +L++M++QL  E+KQP P+GM S N+ KLK ++K+ L 
Sbjct  209   QVKAYFQSHVWVTVSQSYEIANILREMVEQLHREIKQPAPQGMESANSTKLKQMLKDLLQ  268

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YVIV DDVW+++  E IK+ +P      R +I+TR  D+A+     +   +YE+  L
Sbjct  269   QKRYVIVLDDVWSSKALEGIKNAMPNNSLCSRIIITTRTADIATVLFNQSK--VYELKGL  326

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S E SW+L C+KAF+ + CP +L  + +QILK+C GLPLAIV +GG+L  K+   + EW 
Sbjct  327   SLEESWSLFCKKAFYGNPCPPYLEHLSRQILKKCEGLPLAIVTVGGLLFGKD---VLEWQ  383

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SL  + E ND+ ++ R IL LS+NDL   LK CF+YL ++PEDH+I  N LI  W 
Sbjct  384   MISRSLPAELEDNDRMQNFRKILSLSYNDLRYNLKSCFLYLGVFPEDHVIACNRLIRLWI  443

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFV+++ G T EEV   YL ELINRSL+        G ++  R+HDL RE I+ K+ D
Sbjct  444   AEGFVEKREGMTREEVGRRYLKELINRSLVQIAGTKTGGMLQSCRVHDLMRECIIYKARD  503

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NFV    E+     E+ R LS+  T  NA  +     LRSLL F    S  S     + 
Sbjct  504   ENFVLFASEQKVELHERVRRLSIKYTCNNALKQLNLPSLRSLLIFESATSSNSDEQF-VP  562

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S C++++VLDL  + L   P++I  + HL+YLSL+ TKV ++PRSI KL+ LE LDLK T
Sbjct  563   SGCQLLRVLDLGDSPLHEFPQQILVMFHLKYLSLKGTKVCIIPRSIGKLQNLETLDLKQT  622

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFA-YLPYNCSPGFKAPkglgklgsleklVYVEA--  1608
              V+ELPVEI KL+ L++L VYS V F    P+  + GF  P+G+G L SL KL YV+A  
Sbjct  623   LVSELPVEITKLKKLQYLFVYSRVDFTPSQPFCSTTGFFTPQGIGMLASLHKLCYVKAGG  682

Query  1609  NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
             +    T++E+G+L +L+RL ++ L+ +D K +C S+EK+  LR+L++ +  E  V+D+++
Sbjct  683   HRSKNTMQELGELYQLRRLGVMDLKKDDAKELCHSLEKMTDLRALDVNAENEYEVIDLDF  742

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             LSSPP LL+RLY++G + K+PHW+  L NL K+Y   S+LK  PL   Q+LPNLV L+  
Sbjct  743   LSSPPQLLERLYINGCLNKLPHWLPLLNNLTKVYLISSRLKSIPLFAFQNLPNLVELQLD  802

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQR  2115
               + GE++ F    F  L+ L L  L+ LR V++   AMP+L+ L I R
Sbjct  803   GAFDGENLVFGDKGFPKLKKLLLKNLQNLRFVLMNGQAMPYLQSLFICR  851



>gb|KCW61517.1| hypothetical protein EUGRSUZ_H04242 [Eucalyptus grandis]
Length=931

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/781 (43%), Positives = 494/781 (63%), Gaps = 38/781 (5%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R D   ++E E+VGI+ PR+ELI  L+  +P L+V+S++GMGGSGKTTL + VYD+ 
Sbjct  139   HDLREDTFPVDEGELVGIDQPREELIKWLVDGEPELEVVSILGMGGSGKTTLAERVYDNH  198

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK +FQSHAWI+VSQ++K++++L+DMI QL  E++Q  P+G+ S N+ +LK I+K+FL 
Sbjct  199   QVKAYFQSHAWISVSQSYKIQDILRDMIGQLHGEIEQRAPQGIESANSVRLKQILKDFLH  258

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YVIV DDVW     E IK  +P +    R +I+TR+ ++A+ SS  +  YI +  PL
Sbjct  259   QKRYVIVLDDVWNLEALEGIKSAMPNDSCSSRIIITTRIANIATFSSNQSKVYIRK--PL  316

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S E SW+L C+KAF    CP HL ++ +QILK+C GLPLAIVAIGG+L  K+   + EW 
Sbjct  317   SPEESWSLFCKKAFRGKLCPPHLKKLSRQILKKCEGLPLAIVAIGGLLFAKD---VQEWE  373

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              + H+L  + E ND+ +  R IL LS+ DL   LK CF+YL ++PED +IE  +LI  W 
Sbjct  374   MISHNLAIELESNDRMQIFRKILSLSYIDLHYNLKSCFLYLGLFPEDRVIECMTLIRLWI  433

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF+ ++   T EEVA+ YL ELINR+L+   + + +G +K  R+HDL RE ILSK  D
Sbjct  434   AEGFIVERERMTQEEVAQRYLNELINRNLVQIAETDLEGRLKTCRVHDLMRESILSKLKD  493

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNV-----TDSQFSSH  1242
              NFV+ + E+T    E+ R LSV     NA  +     LRSLL F +     TD QF   
Sbjct  494   ENFVSFLSEQTKELHERVRRLSVQYNCNNALNQLNLPSLRSLLIFQLRTSSSTDEQF---  550

Query  1243  VVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEIL  1422
                  ++ ++++VLDL  + L   P++I   +HL+YLSLR + V+++PRSI KL+ LE L
Sbjct  551   ---FPTNSKLLRVLDLGGSCLHKFPQQILDFVHLKYLSLRRSNVRIIPRSIVKLQNLETL  607

Query  1423  DLKYTFVTELPVEILKLQHLRHLIVYSHVSFAY-LPYNCSPGFKAPkglgklgsleklVY  1599
             DLK+TFV+ +P+EI KL+ L+HL+VYS       +P+    GF APKG+  L SL+ L  
Sbjct  608   DLKHTFVSGIPMEITKLKKLQHLLVYSDAKITTSVPFGFRKGFSAPKGIATLTSLQNLCC  667

Query  1600  VEA--NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVV  1773
             V+A  +    T++E+G+L+ L+RL +  L+ +D K +C S+EK+  L+SLN+ +  E  +
Sbjct  668   VKAGGDQSKNTMQELGELSRLRRLGVTDLKKDDAKELCHSLEKMTNLQSLNVNAKSEFDI  727

Query  1774  LDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLV  1953
             +D+++LSS PP L+ L++ G + K+PHW+  L +L K+   W+KLK  PL  LQ+LPNLV
Sbjct  728   IDLDFLSSAPPFLRGLHIEGCLKKLPHWLPLLTSLTKLRLAWTKLKSSPLIALQNLPNLV  787

Query  1954  HLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
              L     + G+ + F    F  L+ L    LE LR  ++   AMP L+ L+I     +  
Sbjct  788   ELYLSNAFDGKTLVFGDKGFPKLKKLFFANLENLRFALMNGQAMPCLQSLII-----VGF  842

Query  2134  VPAGIECLFNLRYLEFFDMTDDFISTFLPDKRG--------EDYCKVSHIS-EVYYTYWK  2286
             V  G   L NL++L+F++M ++F   F P  R         E Y +V   + EVY+ +WK
Sbjct  843   VICG---LANLKHLQFYEMPEEFALVFYPYSRNRMRKGILQEHYEEVMERNPEVYFFWWK  899

Query  2287  D  2289
             +
Sbjct  900   E  900



>emb|CDP11695.1| unnamed protein product [Coffea canephora]
Length=894

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/783 (42%), Positives = 476/783 (61%), Gaps = 59/783 (8%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R  ALL+EE ++VGI+ P+KELIS +L D   LKV+SVVGMGG GKTTL K VYDD  
Sbjct  154   DIRDQALLIEEAKLVGIDQPKKELISKILDDHSHLKVVSVVGMGGLGKTTLAKKVYDDAA  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK FQSHAWITVSQ F+ + ++K++IQQL+ E++QPVP  + SM+  +L   VK+FL  
Sbjct  214   VKKQFQSHAWITVSQNFQFKVIIKNLIQQLYEEIRQPVPPQVDSMDGIRLSEFVKDFLKE  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y++V DD+WT   WEAIK+VLP      R +++TR+ DVAS+S    + +I++M+PLS
Sbjct  274   RRYILVLDDLWTIDAWEAIKYVLPDCNIASRVVLTTRITDVASASCLTFHNFIHKMSPLS  333

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW LLC + F ++ CPS+L E+ ++ILK+C GLPL IV +GGVLA K+K  I+EW  
Sbjct  334   YEDSWTLLCNRTFQSNGCPSNLEEVCRKILKKCEGLPLGIVTMGGVLALKDKDKIDEWEM  393

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             ++   G + +G+ + + +R ILLLS++DLP +LK C +YLSIYPEDH I+ + ++ +W  
Sbjct  394   IFRGFGSEVDGSGKLDRIRKILLLSYSDLPHHLKNCLLYLSIYPEDHPIDVDEILGKWIA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
              GF++++ G T  ++A  YL EL+NRSLI   +  DDG +    +HD  REII+ KS + 
Sbjct  454   LGFIEEEEGMTATDIAMRYLKELVNRSLIQVKETWDDGKLVNCGLHDFLREIIVLKSKER  513

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTK-LRSLLTFNVTDSQFSSHVVQIL  1257
              F T     +  WP+K RHL++H   GN        K LRS+ TF   DS  +S + + L
Sbjct  514   CFTTIATGYSTRWPDKVRHLAIHNFTGNPPQGFSSLKCLRSVETFGNEDSLTTSFLSKFL  573

Query  1258  SSC-RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
                 + +KVL+L    L+ +P+E+F+L HL+YL L  T+VK++P+SI +L+ LE L L  
Sbjct  574   CGGPKFLKVLNLTGAELDNIPKEVFKLFHLQYLDLSGTRVKIIPKSIGQLQNLEFLILAE  633

Query  1435  TFVTELPVEILKLQHLRHLIVYS----HVSFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             T + ELPVEILKL+ LR L +Y       +FA        GFK+P               
Sbjct  634   TTIMELPVEILKLRKLRSLNLYGIGDYSNNFALW------GFKSP---------------  672

Query  1603  EANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
                      + IGKL  L+RL  ++  +E    +CS               I+E+  LD+
Sbjct  673   ---------DGIGKLTSLERLHNIEADSE--LHICS---------------IKEEETLDL  706

Query  1783  NYLSSPP-PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDD--PLEHLQDLPNLV  1953
              +  SP    L RL+L+G++ ++P W+ SL+ L  +    S+L +D   +  L  LPNLV
Sbjct  707   QHSVSPRLGFLTRLWLNGHLERVPEWVISLQYLGTLVLLNSELSEDENAIGCLGHLPNLV  766

Query  1954  HLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
             HL  L  Y GE + F AG+FQ L+ L+L + + L+ V + E +MP+L++  I     +  
Sbjct  767   HLFLLRAYEGETLCFKAGRFQKLQRLDLVQFQRLKWVRVEEASMPNLQEFAIVGSKLMTG  826

Query  2134  VPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWKDGCWEVNS  2310
             +P G++ L  L++L  FDM D+ I      DK+ EDY  +SHI +V   +W +G W+   
Sbjct  827   LPLGLQNLIGLKFLRLFDMCDELIHKVQNLDKQSEDYQTISHIPQVCTGHWINGDWKTEI  886

Query  2311  VQE  2319
             + E
Sbjct  887   LSE  889



>ref|XP_011098143.1| PREDICTED: disease resistance protein RPM1-like [Sesamum indicum]
Length=919

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/752 (44%), Positives = 476/752 (63%), Gaps = 10/752 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKD-DPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             D R DALLLEE E+VG E P+++LI  L    +  L+VISVVG GG GKTTL + VYDD 
Sbjct  159   DGRGDALLLEEAEVVGFEKPKRQLIEWLCSSYNYGLRVISVVGTGGLGKTTLARKVYDDA  218

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK HF SH W+TVS +F +EE L+ +I++L  E+ QP PEG+ +M+A+++K  + +FL 
Sbjct  219   VVKMHFHSHVWMTVSHSFNLEEFLRKLIRKLVGEINQPRPEGLDAMDADEMKEFIYQFLQ  278

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR YVIV DDVW    WEAI++  P+       +I+TR   +   +S + NG++Y + PL
Sbjct  279   RRTYVIVLDDVWRLNAWEAIRYAFPRTGAYGFVIITTRFHSIGHGASIECNGHVYNLEPL  338

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S+E S  L CRKAF   SCP++L +    +LK+C GLPLAIV IG +LATKN + I EW 
Sbjct  339   SQEESKTLFCRKAFLGGSCPTYLEDAAAIVLKKCEGLPLAIVVIGSLLATKNNS-IEEWN  397

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
                 SLG + EG D    +  +L LS+ +LP YLK CF+Y SI+PE+  I  + LI  W 
Sbjct  398   KFDRSLGDELEG-DHLRRMTKLLSLSYYNLPHYLKPCFLYFSIFPENFRIYKSKLIRLWV  456

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF+  K GKT+EEVAE ++ EL++RSLI   +  + G   + R+HDL R I+L+KS +
Sbjct  457   AEGFIHPKEGKTMEEVAEDHVKELLDRSLIQVAETTNYGRPIRVRVHDLLRMIVLTKSKE  516

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NFVT        WP K+R +++H + GN +  +   +LRSLL  +   +    ++ ++L
Sbjct  517   QNFVTIESGGETRWPNKSRRVAIHCSTGNTEDIKGCDQLRSLLVLDSVHALSKRNLSKLL  576

Query  1258  -SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              +    +KVL+L+    + +P+ +F+L  L+YL L++T VK +P+SI KLR LE LDL+ 
Sbjct  577   CAGSSPLKVLELKGALSDKIPDHVFRLRLLKYLGLKNTVVKTIPKSIAKLRNLETLDLRC  636

Query  1435  TFVTELPVEILKLQHLRHLIVYSH-VSFAYLPYNCSPGFKAPkglgklgsleklVYVEA-  1608
             T VTELP+EILKL+ LRHL++YS+  S  Y P++    F+AP  +G L +L+ L  +EA 
Sbjct  637   TKVTELPIEILKLRRLRHLLLYSNKKSRGYRPFDDVQSFQAPYKIGCLSALQNLSDIEAT  696

Query  1609  NPGNGT--IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
               G  T  + EIG+L E++ L I KL+ EDGK +CSS+ KL  LRSL + S  ED ++D+
Sbjct  697   QAGEDTSIVREIGELTEMRSLGIKKLKKEDGKDLCSSLAKLTNLRSLYVASTAEDEIIDM  756

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
              Y   P P L+ L L G + ++P W+ +L  L ++Y RWS++K DPL  LQDLP L+  E
Sbjct  757   QYPVYPTPPLETLELRGRLRELPEWLPALHGLTRLYLRWSRMKHDPLNSLQDLPYLMEFE  816

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
                 Y G+ + F A  FQ L+ L L  L  LR V++ +G MP L++L +  C  L  VP+
Sbjct  817   LSHAYEGDRLCFRASGFQRLKKLWLLSLNRLRLVIVEKGCMPLLQELYMSGCRSLEEVPS  876

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGED  2238
             GI+ L +L++++F DM + F++     + G D
Sbjct  877   GIQHLGSLQHMDFSDMAEGFVTKIESQREGGD  908



>emb|CDP12947.1| unnamed protein product [Coffea canephora]
Length=958

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/793 (45%), Positives = 506/793 (64%), Gaps = 27/793 (3%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKD-DPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P++ LIS LL+  D  LKV+SVVGMGG GKTTLVKMV++D  V
Sbjct  156   RDDALLVEEAKLVGIDQPKQHLISKLLEGHDHQLKVVSVVGMGGLGKTTLVKMVHEDPDV  215

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +++F   AW+TVSQT    ++LKD+I+QL+ ELK+ VP  + S    +LK IVK+FL + 
Sbjct  216   RQNFPVRAWVTVSQTCDFPKLLKDLIRQLYEELKESVPGSIESKTTAELKKIVKDFLQKA  275

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W AIK  LP+  +G R M++TR  DVA +S T++  ++Y+M PLS
Sbjct  276   GRYAIVFDDVWDMEFWNAIKFALPEGNYGNRVMLTTRKADVAPASCTESQDFVYKMEPLS  335

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HL ++ K +L +C GLPLAIVAIGG+LA+K+ + I+EW  
Sbjct  336   NEDSWTLFCNKIFKENCCPAHLMDVAKAVLDKCDGLPLAIVAIGGLLASKDVSRIDEWEM  395

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EG  + E ++ IL LS+NDLP +LK C +YLSIYPED+LI+  +LI  W  
Sbjct  396   IQHSLGGELEGTGKLERVKRILSLSYNDLPSHLKPCLLYLSIYPEDYLIDCQTLIPLWIA  455

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA GY  ELI+RSLI   ++  +G     RIHDL RE+IL KS + 
Sbjct  456   EKFVEWREGMSIEDVAWGYFSELISRSLIQAAEVFYEGLPDTFRIHDLLREVILMKSREQ  515

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK-------LRSLLTFNVTDSQFS  1236
             N VT    +   WP EK R L++H +  ++ ++    +       LRS +  + T+   S
Sbjct  516   NMVTVTTGQPMTWPSEKVRRLALHSSSNSSNIQYHQQRQFYSFEHLRSFIAVSSTNPLLS  575

Query  1237  -SHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRML  1413
              + + ++L S +++KVLDL+   +E  P EIF LLHL YLSL  TKV  +PR+I KL+ L
Sbjct  576   KTFLSKVLRSSKLLKVLDLRGEEIEETPNEIFSLLHLTYLSLYGTKVARVPRAIGKLQHL  635

Query  1414  EILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslekl  1593
             E L+L  T V ELPVEILKL  LRHL VY  V  +   Y    GFK P  LG L +L++L
Sbjct  636   EHLNLGNTGVRELPVEILKLLKLRHLRVYQQVDPSDSDYGYH-GFKGPSKLGGLLALQRL  694

Query  1594  VYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EE  1764
               ++A+ G+  ++EIGKL +L+ L I +LR EDGK +CSS+  L  LR L + S+   ++
Sbjct  695   NTIDASSGSVIVKEIGKLTQLRVLYITQLRREDGKELCSSLANLTSLRELRIASVGKGDD  754

Query  1765  DVVLDVNY----LSSPPPL--LQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDP  1920
               ++D+N+    LSS   L  L+ L + G +  MP WI  L+NLVKI   WS+L+  +DP
Sbjct  755   FEIIDLNHHQHSLSSCSFLQSLRVLLVRGRLETMPVWITHLQNLVKINLSWSRLRADEDP  814

Query  1921  LEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEK  2100
             L+ LQ LPNL  + F   Y GE + F AG F  L+ L L ++E LR + + EGA P+L K
Sbjct  815   LKSLQHLPNLGEIGFSGSYQGERLCFKAGGFLKLKRLWLRRMEGLRWMTVEEGACPNLRK  874

Query  2101  LVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFL-PDKRGEDYCKVSHISEVYYT  2277
             LV+ +   L  +P+GI+ L +L+ L  ++M+   +      ++  E+Y +V+HI E+   
Sbjct  875   LVLYQLPSLEDLPSGIQHLSHLQELGLYEMSSQLMEKVENQEEESENYRRVTHIPEIVIG  934

Query  2278  YWK-DGCWEVNSV  2313
             ++  DG W +  +
Sbjct  935   FYADDGEWRIRQL  947



>emb|CDP12939.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/785 (44%), Positives = 472/785 (60%), Gaps = 57/785 (7%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKD-DPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P++ LIS LL+  D   KVISVVGM G GKTTLV  V +D  V
Sbjct  9     RDDALLVEEAKLVGIDQPKQHLISKLLEGHDHQFKVISVVGMAGLGKTTLVNKVQEDPDV  68

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +K+F   AW+TVSQT    ++LKD+I+QL  E  +PV + + SM   +LK  V +FL + 
Sbjct  69    RKNFPVRAWVTVSQTCDFPKLLKDLIRQLHEEGNEPVSQSIESMTTARLKKFVNDFLQKA  128

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W AIK  LP+  +G R M++TR  DVAS+S T++  Y+Y M PLS
Sbjct  129   GRYAIVFDDVWDVEFWNAIKFALPEGNYGNRVMLTTRKADVASASCTESQDYVYRMEPLS  188

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HL ++ K +L +C GLPLAI+AIGG+LA+K+   I+EW  
Sbjct  189   IEDSWTLFCNKIFKGNRCPAHLMDVAKAVLDKCEGLPLAILAIGGLLASKDANRIDEWEM  248

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EG  + E ++ IL LS+NDLP +LK C +YLSIYPED+LIE + L   W  
Sbjct  249   IQHSLGGELEGAGKLERVKRILSLSYNDLPSHLKPCLLYLSIYPEDYLIECHRLTLLWIA  308

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA  YL ELI+RSLI   K+  +G+    RIHDL RE+IL KS + 
Sbjct  309   ERFVEWREGMSIEDVAWAYLSELISRSLIQATKVFYEGTPHTCRIHDLLREVILIKSREQ  368

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             N  T    +   WP EK R L++H +                                IL
Sbjct  369   NMATVTTGQPMTWPSEKVRRLAIHSS------------------------------SNIL  398

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
              S +++KVLDL    +E  P EIF LLHL YL L  TKV+ +PR+I KL+ LE L+L YT
Sbjct  399   RSSKMLKVLDLNGEEIEETPNEIFNLLHLTYLRLCGTKVERVPRAIGKLQHLEYLNLGYT  458

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V ELPVEILKLQ LRHL+V+  V  +   Y    GFK P  LG L +L+ L  ++A+ G
Sbjct  459   GVRELPVEILKLQKLRHLLVFHPVDPSDEDYGYY-GFKGPPKLGGLLALQTLNTIDASSG  517

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN----  1785
             +  ++EIGKL +L+ L I +LR EDGK +CSS+        +NL S+ E  ++D+N    
Sbjct  518   SIIVKEIGKLTQLRVLYITQLRGEDGKELCSSL--------VNLTSLRELSIIDLNHHQH  569

Query  1786  -----YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLEHLQDLP  1944
                     S    L+ L + G +  MP WI  L+NLVKI   WS L+  +DPLE LQ LP
Sbjct  570   SLSSSSSCSFLQSLRVLIMRGRLETMPVWITHLQNLVKILMNWSGLRAEEDPLESLQHLP  629

Query  1945  NLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQ  2124
             NL  + F   Y GE + F AG F  L+ L L ++E LR + + EGA P+L+KLV+ +   
Sbjct  630   NLGEIGFCGSYQGERLCFKAGGFLKLKRLWLRRMEGLRWMTVEEGACPNLQKLVLNQLPS  689

Query  2125  LASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKR-GEDYCKVSHISEVYYTYWK-DGCW  2298
             L  +P GI+ L +L+ L  ++M+   I      K   EDY +++HI E+   ++  DG W
Sbjct  690   LEDLPWGIQHLSHLQELALYEMSSQLIEKVENQKEDSEDYRRMAHILEIVIGFYADDGEW  749

Query  2299  EVNSV  2313
              +  +
Sbjct  750   RIRRL  754



>gb|KCW61515.1| hypothetical protein EUGRSUZ_H04240 [Eucalyptus grandis]
 gb|KCW61516.1| hypothetical protein EUGRSUZ_H04240 [Eucalyptus grandis]
Length=980

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/745 (43%), Positives = 468/745 (63%), Gaps = 50/745 (7%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             R D   +EEDE+VGI+ PR+ELI  L+  +P L+V+S++GMGGSGKTTL + VYD+  VK
Sbjct  156   REDTFPVEEDELVGIDQPREELIKWLVDGEPGLEVVSILGMGGSGKTTLAERVYDNHQVK  215

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
              +FQSHAWI+VSQ++K++ +L+DMI+QL  E++Q  P+G+ S N+ +LK I+K+FL  ++
Sbjct  216   AYFQSHAWISVSQSYKIQNILRDMIEQLHGEIEQRAPQGIESANSVRLKQILKDFLRHKR  275

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW     E IK  +P      R +I+TR+ D+A+ SS  +   +Y   PLS E
Sbjct  276   YIIVLDDVWNLEALEGIKSAMPNGSCNSRIIITTRMADIATFSSNQSK--VYSRKPLSPE  333

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW+L C+KAFH   CP HL  + +QILK+C GLPLAIVAIGG+L  K+   + EW  + 
Sbjct  334   ESWSLFCKKAFHGKLCPPHLKNLSQQILKKCEGLPLAIVAIGGLLFAKD---VQEWEMIS  390

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
             HSL  + E ND+ +  R IL LS+ DL   LK CF+YL ++PEDH+IE  +LI  W  EG
Sbjct  391   HSLAIELESNDRMQIFRKILSLSYIDLHHNLKSCFLYLGLFPEDHVIECMTLIRLWIAEG  450

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             F++++   T EEVA+ YL ELINR+L+   + N +G ++  R+HDL RE ILSK  D NF
Sbjct  451   FIEEREHMTREEVAQRYLNELINRNLVQIAETNLEGGLQTCRVHDLMRESILSKLKDENF  510

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL--S  1260
             V+                                 LRSLL F    S+ SS + +    +
Sbjct  511   VS---------------------------------LRSLLIFQ---SRTSSSIDEQFFPT  534

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
             S ++++VLDL  + L   P++I   +HL+YLSLR + V ++PRSI KL+ LE LDLK TF
Sbjct  535   SSKLLRVLDLGGSCLHKFPQQILVFVHLKYLSLRRSNVCIIPRSIVKLQNLETLDLKQTF  594

Query  1441  VTELPVEILKLQHLRHLIVYSHVSF-AYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
             V+++PVEI KL+ L+HL+VYS      Y+P+    GF AP G+G L SL+ L  V+A+ G
Sbjct  595   VSKMPVEITKLKKLQHLLVYSEAEITTYVPFGIRKGFSAPNGIGALTSLQNLCCVKASGG  654

Query  1618  --NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
                 T++E+G+L+ L+RL +  L+ +D K +C SIEK+  L+SL + +  E  ++D+++L
Sbjct  655   RSKNTMQELGELSRLRRLGVRDLKKDDAKELCHSIEKMTNLQSLYVNAESEYDIMDLDFL  714

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SS PP L+ L++ G + K+PHW+  L NL K+   W+KLK  PL  LQ+LPNLV L    
Sbjct  715   SSAPPFLRALHIGGCLKKLPHWLPLLTNLTKLRLAWTKLKSSPLIALQNLPNLVELYLSN  774

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL--ASVPAG  2145
              + G+ + F    F  L+ L    L+ LR  ++   AMP L+ L+I  C  L   S+   
Sbjct  775   AFDGKTLVFGDKGFPKLKKLFFANLKNLRFALMNGQAMPCLQSLIIVGCRHLDWQSLLVV  834

Query  2146  IECLFNLRYLEFFDMTDDFISTFLP  2220
             I  L NL++L+F++M ++F   F P
Sbjct  835   IRGLANLKHLQFYEMPEEFALAFYP  859



>emb|CDP12953.1| unnamed protein product [Coffea canephora]
Length=960

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/791 (44%), Positives = 494/791 (62%), Gaps = 30/791 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKD-DPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P++ LIS LL+  D  LKVISVVGM G GKTTLVK V++D  V
Sbjct  156   RDDALLVEEAKLVGIDQPKQHLISKLLEGHDHQLKVISVVGMAGLGKTTLVKKVHEDPDV  215

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +K+F   AW+TVSQT    ++L+D+I+QL+ E K+PVP+ + S    +LK  VK+FL + 
Sbjct  216   RKNFPVRAWVTVSQTCDFPKLLRDLIRQLYEEGKEPVPQSIESKTTAELKEFVKDFLQQA  275

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  +G R M++TR  DVAS+S T++  Y+Y+  PLS
Sbjct  276   GRYAIVFDDVWDVEFWNEIKFALPEGNYGNRVMLTTRKADVASASCTESQDYVYKKEPLS  335

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HL ++ K +L +C GLPLAIVAIGG+LA+K+ + I+EW  
Sbjct  336   IEDSWTLFCNKIFKGNRCPAHLMDVAKAVLDKCDGLPLAIVAIGGLLASKDVSRIDEWEM  395

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + ++ IL LS+NDLP +LK C +YL+IYPED+LI  + L+  W  
Sbjct  396   VRRSLGGELEGTGKLDRVKRILSLSYNDLPSHLKPCLLYLTIYPEDYLIHCSVLVLSWIA  455

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA GYL ELINRSLI    +   G  ++ +IHDL RE+IL KS + 
Sbjct  456   ERFVEWREGMSIEDVAWGYLSELINRSLIQVTDVFYGGLPEKCQIHDLLREVILIKSREQ  515

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK-------LRSLLTFNVTDSQFS  1236
             N VT    +   WP EK R L +H +   + +     +       LRS +TF+ T+   S
Sbjct  516   NMVTVTTGQPMTWPSEKVRRLVLHSSSNRSIIPHHQHRQFYSFEHLRSFITFSSTNPLLS  575

Query  1237  -SHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRML  1413
              + + ++L S +++KVLDL+   +E  P EIF LLHL YLSL  TKV  +PR+I+KL+ L
Sbjct  576   KTFLSEVLRSSKLLKVLDLEDEEIEETPNEIFNLLHLTYLSLYGTKVARVPRAIRKLQHL  635

Query  1414  EILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslekl  1593
             E L+L  T V ELPVEILKLQ LR L VY  V  +   +    GFK P  LG L +L++L
Sbjct  636   EYLNLGNTRVRELPVEILKLQRLRDLRVYQQVDPSDEDFGFH-GFKGPSKLGGLLALQRL  694

Query  1594  VYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EE  1764
               ++A+ G+  ++EIGKL +L+ L I +LR EDGK +CSS+  L  LR L++ S+   ++
Sbjct  695   DTIDASSGSVIVKEIGKLTQLRDLYITQLRREDGKELCSSLANLTSLRQLSVDSVGKGDD  754

Query  1765  DVVLDVNY---------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--  1911
               ++D+N+           S    L+ L + G +  MP W   L+NLVKI   WS L+  
Sbjct  755   SEIIDLNHYHHSLSSSSSCSFLRSLRVLIMHGRLETMPAWTTHLQNLVKINLYWSGLRGE  814

Query  1912  DDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPH  2091
              DPLE LQ LPNL  + F   Y GE + F AG FQ LR L+L  +E LR + + EGA PH
Sbjct  815   KDPLEFLQHLPNLDTINFCGCYQGEGLCFKAGGFQKLRWLSLKGMEGLRWMAVEEGACPH  874

Query  2092  LEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKR-GEDYCKVSHISEV  2268
             L  LV+ R   L  +P+GI+ L +L+ L   +M+   +      K  GEDY +++HI E+
Sbjct  875   LRTLVLDRLPSLEDLPSGIQHLSHLQELYLNEMSSQLMEKVGNQKEDGEDYRRMAHIPEI  934

Query  2269  YYTYWK-DGCW  2298
                ++  DG W
Sbjct  935   VIGFYADDGEW  945



>emb|CDP19454.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/788 (45%), Positives = 485/788 (62%), Gaps = 26/788 (3%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLL-KDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE E+VGI++P+++LIS LL +DD  LKV+SVVGMGG GKTTLVK V++D  +
Sbjct  159   RDDALLVEEAELVGIDHPKQQLISQLLERDDSQLKVVSVVGMGGLGKTTLVKKVHEDLGI  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   A++TVSQ    +E+LKD+ +QL  +LK+PVPE + +M A +LK  VK+FL + 
Sbjct  219   RRHFPVRAFVTVSQPCNFQELLKDLTRQLHNDLKKPVPESIETMTAIQLKQCVKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W AI+  LP+  +G R M++TR  DVAS+S   +  Y+Y+M PLS
Sbjct  279   GRYAIVFDDVWDVEFWNAIRFALPENGYGNRVMLTTRKADVASASCNKSQDYVYKMVPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HLT++ K IL +C GLPLAI+AI G+LA K+     EW  
Sbjct  339   FEDSWTLFCNKIFKGNGCPAHLTDVAKGILGKCQGLPLAILAISGLLALKDLNIAEEWEI  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SL  + EG+   + ++ IL LS+NDLP +LK C +YLSIYPED  I    L+  W+ 
Sbjct  399   VRRSLVGELEGSGMLDRVKKILSLSYNDLPSHLKSCLLYLSIYPEDFEIPCGRLVQLWSA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV ++ G TVE+V   YL EL+NRSLI   ++  +G     RIHDL REI+LSK+ + 
Sbjct  459   ERFVGKREGMTVEDVGYNYLRELVNRSLIQVTQIFYEGIPYACRIHDLVREIVLSKAREQ  518

Query  1081  NFVT-TIDEETAAWPEKARHLSVHGTLGNAQMKRQG-----TKLRSLLTFNVTDSQFSSH  1242
             N +  T  + T  W EK R L VH +  N +  ++        LRS +T    +   S  
Sbjct  519   NMIAITTGQYTKWWSEKVRRLVVHSSSNNTEQHQESQCYSFNHLRSFITIESMNPLISRT  578

Query  1243  VV-QILSSCRVIKVLDLQS-TSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
             ++ ++L + R++KVLDL    +LE +P EIF L HLR+L+L  T VKV+P  I KLR LE
Sbjct  579   LLSEVLKNSRLLKVLDLSDEETLEEIPNEIFNLYHLRHLNLCRTGVKVVPNFIGKLRNLE  638

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              LDL+ T V ELPVEILKLQ L HL+VY  V  +   Y    GFKAP  LG L +L+ L 
Sbjct  639   NLDLRETQVKELPVEILKLQKLEHLVVYQKVDVSDTTYGYH-GFKAPSKLGGLLALQSLT  697

Query  1597  YVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED---  1767
              ++A+ G+  ++EIG L +L+RL I  LR EDGK +CSS+  L  LR LN+ SI  D   
Sbjct  698   TIDASSGSVVVKEIGALTQLRRLGISNLRREDGKVLCSSLATLTSLRQLNIASIRNDGGD  757

Query  1768  -VVLDVNYLSSPPPL------LQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKD--DP  1920
               V+D+N+  S          L+ L L G +  MP WI  L++L +I   WS L+D  DP
Sbjct  758   YEVMDLNHSLSSSMRSSFLQSLRMLVLRGRLEMMPQWIAHLQSLARIDLYWSGLRDEEDP  817

Query  1921  LEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEK  2100
             L  L  LPNLV ++F   Y GE + F AG F  L+ L L KLE+LR + + +GA+P L++
Sbjct  818   LAPLHHLPNLVTIQFCGSYQGEGLCFKAGGFLKLKDLYLKKLEKLRWMEVEKGALPSLQE  877

Query  2101  LVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYT  2277
             L +     L  +P  I+ L  LR L  +++    +      ++  EDY K++HISEV   
Sbjct  878   LSLDTLPLLEELPLDIQHLSCLRKLGLYELGSQLMEKLENLNEETEDYRKIAHISEVVIE  937

Query  2278  YWKDGCWE  2301
                D  W+
Sbjct  938   LRTDEGWK  945



>ref|XP_011095361.1| PREDICTED: disease resistance protein RPM1-like [Sesamum indicum]
Length=926

 Score =   556 bits (1432),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 330/764 (43%), Positives = 486/764 (64%), Gaps = 13/764 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPT--LKVISVVGMGGSGKTTLVKMVYDD  180
             D R DALLLEE E+VGI+ P+K+L+  L   D T  LKVISVVG GG GKTTLV+ VYDD
Sbjct  151   DSRGDALLLEETEVVGIKKPKKQLVEWLSSTDHTSGLKVISVVGTGGLGKTTLVRKVYDD  210

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               V+  F +  W+TVS +FK+ E+L+ MI++L A++ +  P+G+ +M+A+++K  V +FL
Sbjct  211   AAVRLRFSTRVWMTVSNSFKLYELLRTMIRRLTADVNKQPPQGLEAMDADEMKEFVHKFL  270

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
                 Y++V DD+W    WEAI++  P+       +I+TR   +  ++ST++NGY+Y M P
Sbjct  271   QNSTYIVVLDDIWNLTAWEAIRYAFPRSGTSGFIIITTRFQSIGCAASTESNGYLYNMQP  330

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             L +E S  L  RKAF   SCPS+L +I   +LKRC GLPLAIV IG +LATKN  NI EW
Sbjct  331   LPQEESKTLFYRKAFLGGSCPSYLEQIANIVLKRCEGLPLAIVVIGSLLATKN-NNIEEW  389

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
                  +LG + EG D+   +  +L LS+ DLP YLK CF+YLSI+PEDH I    LI  W
Sbjct  390   NKFLRNLGDELEG-DRLRRMTKLLSLSYYDLPYYLKSCFLYLSIFPEDHNIYMTRLIRLW  448

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFV+ K  KT+EEVAE Y+ EL++RSLI   +  D     +  IHD+   +I+SKS 
Sbjct  449   IAEGFVQPKEAKTMEEVAEDYVKELLDRSLIQVRETPDYNMPVRIHIHDILHRMIISKSK  508

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             + +FVT  +     WP + R L++HG++ N         ++S++  +      +  + ++
Sbjct  509   EQSFVTIANGGHTQWPARVRRLAIHGSVDNMADLGSNHHIQSVVVLDNHHRVSNLTLSKL  568

Query  1255  L-SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             L S+C ++KVL+L+ +  E +P+E+F+L  LRYL L +T V  +P+SI+ L  LE LDL 
Sbjct  569   LGSACGLLKVLELRGSLTEKIPDEVFKLYQLRYLGLNTTNVNSIPKSIQNLENLETLDLS  628

Query  1432  YTFVTELPVEILKLQHLRHLIVY-SHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
              T V ELPVEIL+L+ LRHL+VY S +   Y P++     +AP  +G L SL+ L ++EA
Sbjct  629   DTKVAELPVEILRLRRLRHLLVYNSTIHRGYWPFDEEHNCRAPYRIGCLSSLQTLSHIEA  688

Query  1609  NPGNGT--IEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
                N T  + EIGKL +LK+L + KLR EDG+ +C S+ KL  L+SL + SI+E+ ++D+
Sbjct  689   TQANETRVVREIGKLTQLKKLGVTKLREEDGEELCISLTKLTVLQSLLIASIDEEEIMDL  748

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
              Y  SP P ++ L L G + K+P WI SL+ L  ++ RWSK+ +DP E LQ LPNL  LE
Sbjct  749   QYPLSPAPPIRWLELRGRLLKVPEWIPSLQGLTGLHLRWSKINEDPTESLQHLPNLRFLE  808

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
               + Y G+ + F +  F+ L+ L L +L  L+ V I EG+MP L+ L ++ C  +  VP 
Sbjct  809   LDLAYEGDRLCFKSAGFKRLKKLLLVRLNGLKWVEIEEGSMPFLQALCVRGCKLVEEVPL  868

Query  2143  GIECLFNLRYLEFFDMTDDFISTF--LPDKRGEDYCKVSHISEV  2268
             GI+ L +L+ +EF DM++ F+       D+ G+D+ K++H+ ++
Sbjct  869   GIDHLTHLKCIEFSDMSERFVEKLEKQRDEEGDDW-KLAHLPKI  911



>emb|CDP20168.1| unnamed protein product [Coffea canephora]
Length=735

 Score =   549 bits (1415),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 327/736 (44%), Positives = 459/736 (62%), Gaps = 18/736 (2%)
 Frame = +1

Query  133   MGGSGKTTLVKMVYDD--VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGM  306
             MGG GKTTLVK VYDD  VKK FQSHAWITVSQ F+  +++K++IQQL+ E++QPVP  +
Sbjct  1     MGGLGKTTLVKKVYDDAAVKKQFQSHAWITVSQNFQFRDIIKNLIQQLYNEIRQPVPPEV  60

Query  307   GSMNANKLKVIVKEFLLRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVA  486
              SMN   L   V++FL  R+Y++V DDVW+   WEAIK VLP      R +++TR+ DVA
Sbjct  61    ESMNDIMLSEFVRDFLQERRYILVLDDVWSIDAWEAIKCVLPDCNTASRVVLTTRIADVA  120

Query  487   SSSSTDTNGYIYEMTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVA  666
             S+S   +  +IY+M PLS+  SW L C + F  + CP +L E+ K+ILK+C GLPLAIVA
Sbjct  121   SASCLGSLDFIYKMEPLSDTESWTLFCNRTFQCNYCPPNLEEVAKKILKKCDGLPLAIVA  180

Query  667   IGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSI  846
             IGGVLA K+K   +EW  + H  G + +G+ + + ++ +LLLS+NDLP YLK C +YLSI
Sbjct  181   IGGVLALKDKEKTDEWEMILHGFGGEADGSGKLDRIKRVLLLSYNDLPFYLKSCLLYLSI  240

Query  847   YPEDHLIEHNSLIYQWTMEGFVKQ----KAGKTVEEVAEGYLFELINRSLILPVKLNDDG  1014
             YPED+ I+ + ++ +W   GF+++    K G T  ++A  Y+ ELINRSLI      DDG
Sbjct  241   YPEDYSIDVDHILPKWIALGFLEEKEGMKGGITSTDIAMSYMKELINRSLIQVKSTWDDG  300

Query  1015  SMKQGRIHDLYREIILSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKL  1194
              +    +HD  REII+SKS + +F T        WPEK RHL++H    N Q       L
Sbjct  301   RLITCGLHDFLREIIVSKSKEQDFTTVATRYYTRWPEKVRHLAIHNFTDNPQEFSSLKCL  360

Query  1195  RSLLTFNVTDSQFSSHVVQILSS-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTK  1371
             RS++ F   D   ++ + + LS   +++KVLDL    L+ +P+++F+L HLRYL+L  T 
Sbjct  361   RSVVIFGYEDPLTATFLSKFLSGDPKLLKVLDLDGAELDNIPKQVFKLFHLRYLNLSGTG  420

Query  1372  VKVLPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIV--YSHVSFAYLPYNCSPG  1545
             VK++P+SI KL+ LE++DL  T VTELPVEILKL+ LR L +  +   S  Y  + C   
Sbjct  421   VKIIPKSIGKLQNLEVIDLTRTNVTELPVEILKLRKLRSLWLGGWGDYSNEYANWGC---  477

Query  1546  FKAPkglgklgsleklVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkl  1725
              K P G+GKL  LE+L  +EA+  +  + E+GKL +L+ L I KLR EDGK + SS+ KL
Sbjct  478   -KCPLGIGKLICLEELYGIEAD-SDRIVMEVGKLTQLRGLAITKLRREDGKELLSSLLKL  535

Query  1726  lklrslnlksIEEDVVLDVNYLSSPP-PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWS  1902
               LR L +  IEED  LD+ +   P    L  L L G + ++P W+ SL +L  +    S
Sbjct  536   SNLRDLIISCIEEDETLDLQHSVFPKLGFLTLLILKGRLERVPQWVTSLHSLRMLRLENS  595

Query  1903  KLKDDP--LEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGE  2076
             +L+DD   +  L  LPNLV L     Y GE + F  G FQ L+ L L +L+ L+ V + E
Sbjct  596   RLRDDENVVGSLGHLPNLVSLTLHRAYEGETLCFKVGGFQKLQRLELGQLKRLKWVRVEE  655

Query  2077  GAMPHLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVS  2253
              +MP L KL +  C  +  +P+GI+ L  L  L FF+M+D+ +      DK+ EDY  +S
Sbjct  656   ESMPSLRKLRLGDCKLMQELPSGIQNLTGLESLGFFEMSDELVHKVRNLDKQSEDYQTIS  715

Query  2254  HISEVYYTYWKDGCWE  2301
             HI EV+  +W DG WE
Sbjct  716   HIPEVFIGHWIDGQWE  731



>emb|CDP12951.1| unnamed protein product [Coffea canephora]
Length=865

 Score =   553 bits (1424),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 345/789 (44%), Positives = 477/789 (60%), Gaps = 65/789 (8%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLL-KDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P++ LIS LL + D  LKVISVVGM G GKTTLVK V++D  V
Sbjct  110   RDDALLVEEAKLVGIDQPKQHLISKLLERHDHQLKVISVVGMAGLGKTTLVKKVHEDPEV  169

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +K+F   AW+TVSQT    ++L+D+I+QL  +L + VP+ + SM   +LK  VK+FL R 
Sbjct  170   RKNFPVRAWVTVSQTCDFPKLLRDLIRQLNKDLDKSVPQSIESMTTAELKEFVKDFLRRA  229

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  +G R M++TR  DVA +S T++  Y+Y++ PLS
Sbjct  230   GRYAIVFDDVWDVEFWNEIKFALPEGNYGNRVMLTTRNADVALASCTESQDYVYKIEPLS  289

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HL ++ K +L +C GLPLAIVAIGG+LA+K+ + I+EW  
Sbjct  290   IEDSWTLFCNKIFKGNRCPAHLMDVAKAVLDKCDGLPLAIVAIGGLLASKDVSRIDEWEK  349

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EG  + E ++ IL LS+NDLP +LK C +YLSIYPED+LI  + LI  W  
Sbjct  350   IQHSLGGELEGTGKLERVKRILSLSYNDLPSHLKPCLLYLSIYPEDYLIGCHRLINLWIA  409

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G  +E+VA GYL ELI+RSLI   ++  +GS    RIHDL RE+IL KS + 
Sbjct  410   ERFVEWREGMNIEDVAWGYLSELISRSLIQVTEVFYEGSPGICRIHDLMREVILIKSREQ  469

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             N VT I  +   WP EK R L +H +                                IL
Sbjct  470   NMVTVITRQPMTWPSEKVRRLVIHSS------------------------------SNIL  499

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
              S +++KVLDL S  +   P EIF LLHL YLSL  TKV+ +P++I KL+ LE L+L +T
Sbjct  500   RSSKLLKVLDLNSEKIAETPTEIFNLLHLTYLSLYGTKVERVPKAIGKLQHLEYLNLGHT  559

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V ELPVEILKLQ LR+L V+  V  +   Y    GFK P  LG L SL+ L  ++A+ G
Sbjct  560   GVRELPVEILKLQKLRYLAVFQRVDPSDSDYGFH-GFKGPSKLGGLLSLQTLNTIDASSG  618

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN----  1785
             +  ++EIGKL +L+ L I +LR EDGK +CSS+        +NL S+ E  ++D+N    
Sbjct  619   SVIVKEIGKLTQLRELFITQLRREDGKELCSSL--------VNLTSLRELGIIDLNHHQH  670

Query  1786  ---------YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKL--KDDPLEHL  1932
                      +L S    L+ L L G + KMP W+  L +L +I   WS L  ++D LE L
Sbjct  671   SISSSSSSSFLQS----LRMLTLCGRLEKMPQWVARLHSLERIDLNWSGLSGEEDLLESL  726

Query  1933  QDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQ  2112
             Q LPNLV + F   Y GE + F AG F  L+ L L ++E LR + + EGA P+L KLV+ 
Sbjct  727   QHLPNLVSINFCGSYQGEGLCFKAGGFLKLKELWLRRMEGLRWMTVEEGACPNLRKLVLY  786

Query  2113  RCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKR-GEDYCKVSHISEVYYTYW-K  2286
             +   L  +P+ I+ L +L+ L  + M+   I      K   EDY +++HI E+   ++  
Sbjct  787   QLPSLEDLPSAIQHLSHLQELGLYKMSSQLIEKVENQKEDSEDYRRMAHILEIVIGFYAN  846

Query  2287  DGCWEVNSV  2313
             DG W +  +
Sbjct  847   DGEWRIRRL  855



>ref|XP_010105407.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXC04630.1| Disease resistance protein RPM1 [Morus notabilis]
Length=935

 Score =   555 bits (1430),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 328/779 (42%), Positives = 472/779 (61%), Gaps = 14/779 (2%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVV-GMGGSGKTTLVKMVY--DD  180
             RR +ALLLEE ++VGIE P++EL+S LLKD+ +   +  V GMGG GKTTLV  VY  D+
Sbjct  160   RRDEALLLEEGQLVGIEKPKQELVSWLLKDEVSNVQVVAVVGMGGLGKTTLVYQVYRDDE  219

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VK+ FQ  AWITVSQ+F + E+L  +I+QL   + QP+P      +   LK  V  FL  
Sbjct  220   VKQRFQHRAWITVSQSFDLRELLVQIIEQLLRGIAQPIPNETYFKDILSLKQDVICFLGD  279

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDT-NGYIYEMTPL  537
             +KY+IV DD+W+   W+ +K+  P+  HG R M+++R+++VAS+++TD   GY + + PL
Sbjct  280   KKYLIVLDDLWSVGSWDDLKNAFPQNNHGSRLMVTSRIVEVASATTTDRFGGYTFPLKPL  339

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S E SW L C + FH  SCP+HL +I + ILKRC GLPLAIVA+ GVLATK+ + I+EW 
Sbjct  340   SSEESWNLFCARTFHRKSCPNHLEDISQDILKRCMGLPLAIVAVSGVLATKDTSKISEWK  399

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
                 S    F+ ND+ ++++ IL LSF+DLP  LK CF+YLS++PED +     +I  W 
Sbjct  400   IFRRSFEAGFDNNDKLKNVKKILSLSFSDLPYRLKSCFLYLSLFPEDFMFSKLYIINIWV  459

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF+++    T+EEV E Y  EL NRSLI     + D + K   +HDL REI+L KS D
Sbjct  460   AEGFIREMEDMTLEEVGEWYFNELCNRSLIETAAEDVDEAFKYFVLHDLVREIVLQKSKD  519

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              NF T I E+     E ARHLSV  TL N +     +++R+LL F    S  S    ++ 
Sbjct  520   QNFATIISEQNPVLLEPARHLSVSTTLENFRGGHNFSRVRTLLLFGAKGSISSISFSELC  579

Query  1258  SS---CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
             S     +++KVLD Q   L+  PE I +L +LRYL+L  TKV  +PR+I +LR LE+L+L
Sbjct  580   SKYGRLKLLKVLDCQGLPLDTFPECITKLYNLRYLNLSGTKVASIPRTIGRLRNLEMLNL  639

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             + + V ELP +IL+L  L  ++ +  ++     +  + G + PK +G L  L+ L  + A
Sbjct  640   ENSLVEELPAKILQLHRLFRVMAFQSINDGS-AFTKNIGVRVPKDIGNLKFLQDLGVIRA  698

Query  1609  NPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             + G    +  +G L +L+ L I +L  E G A+CS+IEKL  LR L +++ EE  +L+V 
Sbjct  699   SEGGLELMRSLGNLKQLRTLDIQQLEAEHGAALCSAIEKLGCLRRLYMETGEEAEILEVQ  758

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              +SSPP  L+RLY+ G +  +P W+  L +L  +  RWSKL+ DPL+ LQ LPNL  L F
Sbjct  759   NISSPPQCLKRLYMYGRLEMLPQWVPRLSSLGVLRLRWSKLRLDPLQSLQALPNLQELIF  818

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
                + GE +   AG FQ+L+ L    L  LR V + +GAMP L++L ++ C  L  VP G
Sbjct  819   EKAHDGEELCIKAGGFQNLKHLTFICLSGLRKVTVEQGAMPKLQELWLEDCKLLEEVPLG  878

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQET  2322
             +E L  L  L   +M D  +S   P  +  DY +V H+ +VY      G  + + + ET
Sbjct  879   VEFLACLNKLHIINMGDQLLSKLDPSSQDSDYLRVKHVPKVYI-----GSRDADGLHET  932



>emb|CDP12966.1| unnamed protein product [Coffea canephora]
Length=965

 Score =   555 bits (1431),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 349/800 (44%), Positives = 483/800 (60%), Gaps = 33/800 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P+K LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAKLVGIDQPKKHLISQLLEGDDHQLKVVSVVGMGGLGKTTLVKRVHEDPEV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   AW+TVSQT   + +LKD+I+QL  E K+PVP+ + SM    LK  VK+FL + 
Sbjct  219   RRHFPVRAWVTVSQTCDFQYLLKDLIRQLHEEGKKPVPQSIESMTTTGLKKFVKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  +G R M++TR  DVAS+S  ++  ++Y M PLS
Sbjct  279   GRYAIVFDDVWDVEFWNTIKFALPESSYGNRVMLTTRKADVASASCIESRRFVYRMEPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F   +CP HL ++ K IL +C GLPLAI+AI G+LA+K+   + EW  
Sbjct  339   TEDSWTLFCNKIFDGGNCPGHLMDVAKGILDKCEGLPLAILAISGLLASKDVNRVEEWEM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + +R IL LS+ DLP +LK C +YLSIYPEDH I    L+  W  
Sbjct  399   VRRSLGGELEGTGKLDRIRKILFLSYGDLPWHLKTCLLYLSIYPEDHEIRCLRLVNLWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA GYL ELINRSLI    +  +G+    RIHDL RE+IL KS + 
Sbjct  459   ERFVEWREGMSIEDVALGYLSELINRSLIQVTGVFYEGTPDTCRIHDLLREVILLKSREQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGT------KLRSLLTFNVTDSQFS-  1236
             N       +   WP EK R L VHG+  N     Q         LRS +    T+   S 
Sbjct  519   NIAIAATGQPTLWPFEKVRRLVVHGSSNNNTQHHQQRPNYYFDHLRSFIAVGSTNPLLSK  578

Query  1237  SHVVQILSSCRVIKVLDL--QSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRM  1410
             S +  +L S +++KVLDL  Q T  EI P EIF++ +L++L L  T+V+ +P+ I KL+ 
Sbjct  579   SLLYDVLRSSKLLKVLDLSDQETQEEI-PNEIFKMFYLKHLDLYGTRVERVPKGIGKLQH  637

Query  1411  LEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslek  1590
             LE L+L  T V ELP+EILKLQ LR L VY     +   Y    GFKAP  +G L  LE 
Sbjct  638   LEYLNLGNTGVRELPMEILKLQKLRFLRVYQPADPSDDDYG-GHGFKAPSNMGGLRGLEI  696

Query  1591  lVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---E  1761
             L  ++A+ G+  +EEIGKL +L+ L I + R EDGK +CS +  L  L  L+++SI   +
Sbjct  697   LNRIDASSGSKIVEEIGKLTQLRELYITEFRREDGKVLCSCLANLASLHRLSIESIGNGD  756

Query  1762  EDVVLDVNY---------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK-  1911
             +  ++D+N+           S    L+ L L G + KMP W+  L  LV+I   WS+L+ 
Sbjct  757   DHEIIDLNHHHPSLSFSSSCSFLQSLRMLILRGRLEKMPQWVARLHGLVRIDLNWSRLRG  816

Query  1912  -DDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMP  2088
              +DPLE LQ LPNL  + F   Y GE + F AG+F  L  L+L ++E LR + + EGA+P
Sbjct  817   EEDPLESLQHLPNLGEINFCGSYQGEGLCFKAGEFLKLNRLHLKRMEGLRWMRVAEGALP  876

Query  2089  HLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDK--RGEDYCKVSHIS  2262
             HL+KL +Q+   L  +P GI+ L  L+ L  ++M+       L ++    EDY +++HI 
Sbjct  877   HLQKLFLQQLPLLEELPMGIQHLIQLQRLNLYEMSSQLREKLLENQMEESEDYTRIAHIP  936

Query  2263  EVYYTYW-KDGCWEVNSVQE  2319
             E+   Y+  D  W   S+ E
Sbjct  937   EILIGYYTNDRKWRRLSLWE  956



>ref|XP_002265617.2| PREDICTED: disease resistance protein RPM1 [Vitis vinifera]
 emb|CAN60254.1| hypothetical protein VITISV_025805 [Vitis vinifera]
Length=934

 Score =   554 bits (1428),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 333/764 (44%), Positives = 489/764 (64%), Gaps = 18/764 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D+R  +L ++E EIVGIE  R ELIS L++ +P   VISVVGMGG GKTT  K VYD+ 
Sbjct  156   HDQRVTSLFMDETEIVGIEPLRNELISRLVEGNPKRTVISVVGMGGLGKTTFAKKVYDNQ  215

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V  HF  +AW+TVSQ+FK+EE+L++M ++ +   K+ VPEG+ +++   L  +++++L 
Sbjct  216   RVVGHFDCNAWVTVSQSFKMEELLRNMTKKFYQGRKEAVPEGIDTIDEMSLIALIRQYLQ  275

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++YV+VFDDVW    W  IK+VLP+   G R +I+TR  +VASS    +  YI+++ PL
Sbjct  276   DKRYVVVFDDVWKLDFWGFIKYVLPENGKGSRIIITTRNDEVASSCKESSFDYIHKLQPL  335

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S + SW L C+K F    CP  L ++   I+KRCGGLPLAIVAIGG+L+ K   N +EW 
Sbjct  336   SPKSSWELFCKKTFQGG-CPPELEKLSLDIVKRCGGLPLAIVAIGGLLSRKQ--NESEWK  392

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
                 +LG + E N + + +  IL LS++DLP YLK CF+YL+I+PED+ I+   L   W 
Sbjct  393   NFSDNLGSELESNSRLQPINTILSLSYHDLPYYLKSCFLYLAIFPEDYTIKCTKLTRLWI  452

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFVK K G T+EE+AE +L ELINRSL+    ++ +G ++   IHDL RE+IL  + +
Sbjct  453   AEGFVKAKKGVTMEELAEEFLTELINRSLVQVSDVDLEGKIRSCHIHDLMREMILKMAEE  512

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNA-QMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
              +F   +  E +++  K+R +SVH +  N      + + +RS+  FN ++  F+S +   
Sbjct  513   MSFCRVLAGEGSSFDGKSRRISVHNSTNNILDTIDKNSHVRSIFLFN-SEMIFTSTLA--  569

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              S C+++KVLD +   LE VPE++  L HL++LSLR TKVK+LP+SI KL+ L+ LDLK+
Sbjct  570   -SKCKLVKVLDFKDAPLESVPEDLGNLFHLKFLSLRKTKVKMLPKSIGKLQNLQTLDLKH  628

Query  1435  TFVTELPVEILKLQHLRHLIVYSH---VSFAYLPYNCSPGFKAPkglgklgsleklVYVE  1605
             + V ELPVEI +LQ LRH++ Y++   V F+ +      G    +G+G L  L+KL +VE
Sbjct  629   SLVEELPVEINRLQKLRHILAYNYNFDVEFSSVSVK---GVHVKEGIGCLEDLQKLCFVE  685

Query  1606  ANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
              N G   I+E+GKL +L++L I KL  E+G+ +C+SI K+  L+SL++ S  ED +LD+ 
Sbjct  686   GNQGTDVIKELGKLRQLRKLGITKLTRENGQPLCASIMKMNHLKSLSISSSTEDEILDLQ  745

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHL-QDLPNLVHLE  1962
             ++S PPP L RL L G + K+P WI  L++LVK+    S+L  DP+  L   LPNL+ LE
Sbjct  746   HVSDPPPCLSRLELYGRLDKLPDWISKLKSLVKLGLWKSRLSHDPMGVLGAQLPNLLELE  805

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
              L  +  E + F A  FQ L++L +  L EL+ V I  GA+P +E+L I    QL  VP 
Sbjct  806   LLQTHAVEQLCFEAIGFQKLKVLRICDLIELKKVKIENGALPQVEELEIGPSPQLEEVPH  865

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYY  2274
             GI  L  L+ L F DM ++F  + +P  RG +Y  V HI  V++
Sbjct  866   GIYYLRKLKTLAFRDMQEEFELSMIP-YRGRNYDIVEHIPNVFF  908



>emb|CDP12946.1| unnamed protein product [Coffea canephora]
Length=959

 Score =   555 bits (1429),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 344/789 (44%), Positives = 496/789 (63%), Gaps = 35/789 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P++ LIS LL+ DD  LK ISVVGM G GKTTLVK V+DD  V
Sbjct  156   RDDALLVEEAKLVGIDQPKQHLISKLLEGDDHQLKAISVVGMAGLGKTTLVKKVHDDPEV  215

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +K+F   AW+TVSQT    ++L+D+I+QL  +L + VP+ + SM   +LK  VK+FL R 
Sbjct  216   RKNFPVRAWVTVSQTCDFPKLLRDLIRQLHKDLDKSVPQSIESMTTAELKEFVKDFLRRA  275

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W AIK  LP+  +G   M +TR  DVAS+S T++  Y+Y+M PLS
Sbjct  276   GRYAIVFDDVWHVEFWNAIKFALPEGNYGNCVMQTTRKADVASASCTESQDYVYKMEPLS  335

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HL ++ K +L +C GLPLAIVAIGG+LA+K+ + I+EW  
Sbjct  336   IEDSWTLFCNKIFKGNRCPAHLMDVAKAVLDKCDGLPLAIVAIGGLLASKDASRIDEWDK  395

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EG  + E ++ IL LS+NDLP +LK C +YLSIYPED LI   +LI  W  
Sbjct  396   IQHSLGGELEGAGKLERVKRILSLSYNDLPSHLKPCLLYLSIYPEDDLIACQTLILLWIA  455

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA GYL ELI+RSLI    +  +G     RIHDL RE+IL KS + 
Sbjct  456   ERFVEWREGMSIEDVAWGYLSELISRSLIQVTDVFYEGLPYDCRIHDLMREVILIKSREQ  515

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK-------LRSLLTFNVTDSQFS  1236
             N +T    +   WP EK R L++H +  ++ ++    +       LRS +T   T+   S
Sbjct  516   NMMTVTTGQPMTWPSEKVRRLAIHSSSNSSNIQYHQQRQFYCFEHLRSFITVRSTNPLLS  575

Query  1237  -SHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRML  1413
              + + ++L S +++ VL+L    +E  P EIF LLHL YL+L  TKV  +PR+I KL++L
Sbjct  576   KTFLSEVLRSSKLLMVLELGGEEIEETPNEIFNLLHLTYLNLYGTKVAKVPRAIGKLQIL  635

Query  1414  EILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslekl  1593
             E L+L  T V ELPVEILKL  LR+LIV+  V  +   Y    GFK P  LG+L +L++L
Sbjct  636   EYLNLGDTGVRELPVEILKLLKLRYLIVFQRVDPSGSDYGYH-GFKGPSKLGRLQALQRL  694

Query  1594  VYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI-EEDV  1770
               ++ + G+  ++E+GKL +L+ L I +LR EDGK +CSS+  L  LR L++ S+ + D 
Sbjct  695   GTIDVSSGSVIVKELGKLTQLRELFITQLRREDGKELCSSLVNLTGLRQLSVDSVGKGDD  754

Query  1771  VLDVN-------------YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK  1911
              +D+N             +L S    L+ L + G + KMP WI  L+NLV++   WS L+
Sbjct  755   YVDLNHHQHSLSSYSSCSFLQS----LRVLIMRGRLEKMPIWITHLQNLVRLDLIWSGLR  810

Query  1912  --DDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAM  2085
               +DPLE LQ LPNL  + F   Y GE + F AG F  L+ L L ++E LR + + EGA 
Sbjct  811   AEEDPLESLQHLPNLGEISFCGSYQGERLCFKAGGFLKLKQLWLRRMEGLRRMTMEEGAC  870

Query  2086  PHLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFL-PDKRGEDYCKVSHIS  2262
             PHL++L++++   L  +P+GI+ L +L+ L  ++M+   +      ++  EDY +++HI 
Sbjct  871   PHLQRLILKQLPLLEDLPSGIQNLSHLQELGLYEMSSRMMEKVENQEEESEDYRRMTHIP  930

Query  2263  EVYYTYWKD  2289
             E+   ++ D
Sbjct  931   EIVIGFYTD  939



>emb|CDP13421.1| unnamed protein product [Coffea canephora]
Length=956

 Score =   555 bits (1429),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 343/789 (43%), Positives = 487/789 (62%), Gaps = 28/789 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P++ LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAKLVGIDQPKQHLISQLLQGDDCQLKVVSVVGMGGLGKTTLVKKVHEDPEV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   AW+TVSQT   + +LKD+I+QL  E  +PVP+ + S+N  +LK  VK+FL + 
Sbjct  219   RRHFPVRAWVTVSQTCDFQYLLKDLIRQLHKEGNKPVPQSIESLNITELKEFVKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  HG R M++TR  DVAS+S  ++ G++Y M PLS
Sbjct  279   GRYAIVFDDVWDVEFWNTIKFALPESGHGNRVMLTTRKADVASASCIESLGFVYRMEPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  +SCP HL ++ K IL +C GLPLAI+AI G+LA K+     EW  
Sbjct  339   FEDSWTLFCNKIFKGNSCPGHLMDVAKVILGKCEGLPLAILAISGLLALKDVNRTEEWEM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + +R IL LS+ DLP +LK C +Y SIYPED  I    L+  W  
Sbjct  399   VRRSLGGELEGTGKLDRIRKILSLSYGDLPWHLKTCLLYTSIYPEDCEIPCYKLVNLWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+V  GY  EL++RSLI    +  +G     RIHDL REII+SKS + 
Sbjct  459   ERFVEWREGMSIEDVVWGYFSELVSRSLIQVTDVFYEGMPGYCRIHDLLREIIISKSREQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVH-GTLGNAQMKRQG---TKLRSLLTFNVTDS-QFSSH  1242
             N VT    +   WP EK R L VH  +  N Q +R       LRS +T   T+   + + 
Sbjct  519   NMVTVTTGQPTTWPSEKVRRLVVHSSSSNNTQQQRPNYCFDHLRSFITVGSTNPLLYKTL  578

Query  1243  VVQILSSCRVIKVLDLQST-SLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEI  1419
             + ++L S +++KVLDL+   + E +P EIF L HL++L L  T+V+ +P++I KL+ LE 
Sbjct  579   LSEVLGSSKLLKVLDLKGQETQEEIPNEIFNLFHLKHLDLYGTRVERVPKAIGKLQHLEF  638

Query  1420  LDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             LDL  T V ELP+EILKLQ LR L VY  V  +   Y    GFKAP  +G L +LE L  
Sbjct  639   LDLGDTGVRELPMEILKLQKLRFLKVYQQVDSSDDDYGLE-GFKAPSNMGGLLALEILNC  697

Query  1600  VEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EEDV  1770
             ++A+ G+  ++EIGKL +L+ L I KLR EDGK +CSS+  L  L  L+++SI   ++  
Sbjct  698   IDASSGSTVVKEIGKLTQLRELYITKLRREDGKELCSSLANLTSLHRLSIESIGKGDDHE  757

Query  1771  VLDVNY--------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDP  1920
             ++D+N+         SS    L+ L L G + KMP W+  L +LV+I   WS+L+  +DP
Sbjct  758   IIDLNHHHPSLSSSSSSFLQSLRMLILYGRLEKMPQWVAHLHSLVRIDLDWSRLRGEEDP  817

Query  1921  LEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEK  2100
             LE L+ LPNL  + F   Y GE + F AG F  L+ ++L ++E LR + + EGA+P L+K
Sbjct  818   LESLRHLPNLHSINFCGSYQGEGLCFKAGGFLKLKWMHLKRMEGLRWMRVEEGALPRLQK  877

Query  2101  LVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDK--RGEDYCKVSHISEVYY  2274
             L +++   L  +P GI+ L +L+ L  ++ +       L ++    ED  +++HI E+  
Sbjct  878   LFLEQLPSLEELPMGIQHLSHLQRLTLYETSSQLTGKLLDNQEEESEDDRRIAHIPEILI  937

Query  2275  TYW-KDGCW  2298
              Y+  DG W
Sbjct  938   GYYTDDGEW  946



>emb|CDP15682.1| unnamed protein product [Coffea canephora]
Length=950

 Score =   551 bits (1420),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 346/789 (44%), Positives = 486/789 (62%), Gaps = 23/789 (3%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE E+VGI+NP+++LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  +
Sbjct  158   RDDALLVEEAELVGIDNPKQQLISQLLEGDDSQLKVVSVVGMGGLGKTTLVKKVHEDLAI  217

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   A++TVSQ     E+LKD+ +QL  +LK+PVPE + +M A +LK+ VK+FL + 
Sbjct  218   RRHFPVRAFVTVSQPCNFLELLKDLTRQLHNDLKKPVPESIEAMTAFQLKLRVKDFLQQA  277

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  I+  LP+  +G R M++TR+ +VAS+S   + GY+Y M PLS
Sbjct  278   GRYAIVFDDVWNVEFWNEIRFALPENGYGNRVMLTTRIANVASASCNKSQGYVYNMVPLS  337

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              + SW L C K F  + CP+HLTE+ K IL +C GLPLAI+AI G+LA K+     EW  
Sbjct  338   FKDSWTLFCNKIFKGNGCPAHLTEVAKGILGKCEGLPLAILAISGLLALKDLYIAEEWEM  397

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SL  + EG+   + +R IL LS+NDLP +LK C +YLSIYPED  I    L+  W+ 
Sbjct  398   VRRSLVGELEGSGMLDRVRKILSLSYNDLPCHLKSCLLYLSIYPEDFEIRCGRLVQLWSA  457

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV ++ G T+ +V   YL EL+NRSLI   ++  +G     RIHDL RE++LSK+ + 
Sbjct  458   ERFVGKREGMTMNDVGYNYLSELVNRSLIQVTEIFYEGIPYACRIHDLVREVVLSKAREQ  517

Query  1081  NFVTTIDEETAAW-PEKARHLSVHGTLGNAQMKRQG-----TKLRSLLTFNVTDSQFSSH  1242
             N +     +  +W  EK R L VH +  N +  ++        LRS +T    +   S  
Sbjct  518   NMIAITTGQCTSWLSEKVRRLVVHSSSNNTEQHQESQCYSFNHLRSFITIESMNPLISRA  577

Query  1243  VV-QILSSCRVIKVLDLQS-TSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
             ++ ++L S R++KVLDL    +L  +P EIF L  LRYL+L  T VK +P+ I KLR LE
Sbjct  578   LLSEVLKSSRLLKVLDLSDEKTLVEIPNEIFNLYRLRYLNLYGTGVKAVPKFIGKLRNLE  637

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              L L  T V ELPVEILKLQ L HL+VY  V  +        GFKAP  LG L +L+ L 
Sbjct  638   YLGLGETQVKELPVEILKLQKLEHLMVYQKVDSSD-DTQGYHGFKAPPKLGGLLALQSLT  696

Query  1597  YVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED---  1767
              ++A+ G+  ++EIG L +L+RL I  LR EDGK +CSS+  L  LR L++ SI ++   
Sbjct  697   NIDASSGSVVVKEIGTLTQLRRLGISNLRREDGKVLCSSLATLTSLRLLDIASIRDEGGD  756

Query  1768  -VVLDVNYLSSPPPLLQRLYLSGYMG---KMPHWIKSLRNLVKIYFRWSKLKD--DPLEH  1929
               V+D+N+       L  L L    G   KMP WI  L++L +I  RWS L+D  DPLE 
Sbjct  757   YEVMDLNHHDQQQHSLSSLRLLLLHGRLEKMPKWIAHLQSLTRIDLRWSGLRDEEDPLEP  816

Query  1930  LQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVI  2109
             L  LPNLV ++F   Y GE + F AG F+ L+ L L+KLE+L+ + + EGA+P+L +L +
Sbjct  817   LHHLPNLVTIQFWGSYQGEGLCFKAGGFRKLKHLYLEKLEKLKWLKVEEGALPNLHQLFL  876

Query  2110  QRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWK  2286
              R   L  +P GI+   NLR L   +++   +      ++  EDY K++H+SEV    W 
Sbjct  877   DRLPLLEELPLGIQHSRNLRKLGLSELSSQLMEKLENLNEETEDYRKIAHVSEVVIGLWT  936

Query  2287  DGCWEVNSV  2313
             D  W ++ +
Sbjct  937   DEGWRLHRL  945



>ref|XP_010102641.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXB93791.1| Disease resistance protein RPM1 [Morus notabilis]
Length=936

 Score =   550 bits (1417),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 333/765 (44%), Positives = 464/765 (61%), Gaps = 14/765 (2%)
 Frame = +1

Query  10    RRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVV-GMGGSGKTTLVKMVY--DD  180
             RR +ALLLEE ++VGIE P++EL+S LLKD+ +   +  V GMGG GKTTLV  VY  D 
Sbjct  160   RRDEALLLEEWQLVGIEKPKQELVSWLLKDEVSNVQVVAVVGMGGLGKTTLVNQVYRYDK  219

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VK+ FQ  AWITVSQ+F + ++L  +I+QL   + QP+P    S +   LK  +  FL  
Sbjct  220   VKQRFQHRAWITVSQSFDIRKLLVKIIEQLLRGIAQPIPNETYSKDILSLKQDIICFLGD  279

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTD-TNGYIYEMTPL  537
             +KY+IV DD+W+   W+ +K+  P+  HG R M+++R+++VAS++STD   GY + +  L
Sbjct  280   KKYLIVLDDLWSVGSWDNLKNAFPQNNHGSRLMVTSRIVEVASATSTDHFGGYTFPLKRL  339

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S E SW L C + FH  SCP HL +I + ILKRC GLPLAIVA+ GVLATK+   I+EW 
Sbjct  340   SSEESWNLFCARTFHGKSCPHHLEDISQDILKRCMGLPLAIVAVSGVLATKDTNKISEWQ  399

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
                 S    F+ ND+ ++++ IL LSF+DLP  LK CF+YLS++PED   +   +I  W 
Sbjct  400   IFRRSFEAGFDNNDKLKNVKKILSLSFSDLPYLLKSCFLYLSMFPEDWRFKKFFIIRLWI  459

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGF+++    T+EEV E Y  EL NRSLI     + D + K   +HDL REI+L KS D
Sbjct  460   AEGFIREMKDMTLEEVGELYFNELCNRSLIQTAVDDIDENFKYFVLHDLVREIVLQKSKD  519

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTF--NVTDSQFS-SHVV  1248
              NF T I E+     E ARHLSV  TL N +     +++R+LL F  N + S  S S + 
Sbjct  520   QNFATIISEQNPVLQEPARHLSVSTTLENFRGGHNFSRVRTLLLFGKNCSISSISFSELF  579

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
                   +++KVLD Q   L+  PE I +L +LRYLSL  TKV  LPR+I  LR LE+L+L
Sbjct  580   SKYGRLKLLKVLDCQGLPLDTFPECITKLYNLRYLSLSGTKVASLPRTIGWLRNLEMLNL  639

Query  1429  KYTFVTELPVEILKLQHL---RHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             + T V ELP EIL+L  L   R L+  + +  A++ Y    G + PK +G L  L+ L  
Sbjct  640   ENTLVEELPAEILQLHRLFLVRALLYINDIGSAFIKYK---GVRVPKDIGNLNFLQDLGV  696

Query  1600  VEANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             + A+ G    +  +G L +L+ L I +L  E G A+CSSIEKL  LR L +++ EE  +L
Sbjct  697   IRASEGGLELMRSLGNLKQLRTLGIQQLEAEHGAALCSSIEKLSYLRELIMEAREEAEIL  756

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             +V  +SSPP  LQRL + G +  +P W+  L +LV +  RWSKL+ DPL+ LQ LPNL  
Sbjct  757   EVQNISSPPQCLQRLLMCGRLEMLPQWVPRLSSLVLLLLRWSKLRLDPLQSLQALPNLQM  816

Query  1957  LEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
             L F   Y GE +   AG FQ+L+ L       LR V + +GAMP L++L ++ C  L  V
Sbjct  817   LIFQKAYDGEELCVKAGGFQNLKRLAFYCSSGLRKVTVEQGAMPKLQELWLEDCTLLEEV  876

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVY  2271
             P+G+E L  L  L   +M D  +S      +  D+ +V H+ +VY
Sbjct  877   PSGVEFLACLNTLAIINMGDQLLSKLDRSSQDSDFSRVKHVPKVY  921



>gb|KCW72842.1| hypothetical protein EUGRSUZ_E01294, partial [Eucalyptus grandis]
Length=812

 Score =   544 bits (1401),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 320/757 (42%), Positives = 438/757 (58%), Gaps = 90/757 (12%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D + + LLL++ ++V IE P+ +L+  LL      +VISVVGMGG GKTTLVK VY+D  
Sbjct  142   DHQGNTLLLDKADLVDIEQPKNKLVRRLLDGALVREVISVVGMGGLGKTTLVKQVYEDPA  201

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF+ +AWIT+S++ K+EE+LKDM+ Q+   +++PVP G  +MN+  LK I+K+ L R
Sbjct  202   VKKHFRVYAWITLSRSLKIEELLKDMLDQIMRVIRRPVPPGAYTMNSLWLKTIIKDLLQR  261

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y+I+ +DVW    W+A+KH  P   +G R +I+T+  D+AS+S  + NG +  M PL 
Sbjct  262   RRYLIILNDVWHINEWDAVKHAFPNNSNGSRVIITTQNADLASTSCKEFNGQVKNMEPLD  321

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
                SW L C K F  + CPSHL EI + IL++C GL LAIVAI GVLA K+K  I EW  
Sbjct  322   PAQSWELFCWKTFQGNPCPSHLEEICEYILRKCEGLLLAIVAISGVLAAKDKRRIYEWEL  381

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SL  + + ND+ + L+ +LLLSFNDLP YLK CF++LS++PE H I+   LI  W  
Sbjct  382   VRCSLRTEIDCNDKLKYLKRVLLLSFNDLPYYLKSCFLHLSLFPEGHRIKCGRLIRLWVA  441

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGF                   L NRSLI       DG +K  RIHD  R+II SKST+ 
Sbjct  442   EGF-------------------LSNRSLIEVAAKRSDGRVKYCRIHDFLRDIITSKSTNQ  482

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
              F     EE   WP+K   LS+  TL   Q  R  ++LRSL  F +  S  ++ +    S
Sbjct  483   GFAEIAKEENHEWPDKVCRLSIQNTLHALQQNRSLSQLRSLYMFGMERSLVNTVLA---S  539

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
               +++ VLD+Q+  L   P ++    HLRYLS R T+V  LP SI KL+ LE LDLK T 
Sbjct  540   DMKLLTVLDMQAAPLTRFPAQVGDWYHLRYLSFRFTEVSTLPSSIGKLKNLETLDLKQTN  599

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN--P  1614
             VTELPVEILKLQ LR L                             SL+KL Y+EA+   
Sbjct  600   VTELPVEILKLQRLRAL----------------------------QSLQKLCYIEADDES  631

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
                 + E+G L +L RL ILKLR EDG+ +C                             
Sbjct  632   SGNVMRELGMLTQLDRLAILKLRKEDGRNLCL----------------------------  663

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
                     +YL G +  +PHW+ SL +L+K++ R S+LK+DPL  LQ+LPNLVHLE L  
Sbjct  664   --------IYLRGRLKALPHWLPSLSSLMKLHLRGSRLKNDPLVSLQNLPNLVHLELLQV  715

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
             Y G  + F A  F+ L+ L LD  EELR V + +GAMP+LEK +IQRC  L  +P+G E 
Sbjct  716   YEGSSLCFEAESFKKLKTLGLDYFEELRCVEVEKGAMPYLEKFIIQRCKLLEKLPSGFEY  775

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISE  2265
             L  L+ L+ FDM D+ ++  +   + +D+ KV+H+ +
Sbjct  776   LKKLKVLKIFDMPDELVNKLVRGGQNDDFQKVAHVPQ  812



>emb|CAN62150.1| hypothetical protein VITISV_018440 [Vitis vinifera]
Length=898

 Score =   546 bits (1406),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 325/761 (43%), Positives = 478/761 (63%), Gaps = 12/761 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L +++ EIVGIE+ + EL S L++  P   VISVVGMGG GKTTL   +YD+ 
Sbjct  130   HDPRVTSLFIDDAEIVGIESQKIELTSRLVEVTPERTVISVVGMGGLGKTTLANKIYDNK  189

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              +  HF   AWITVSQ+FK+EE+L++M  + +   K+PVPEG+ +M+ + L  + +++L 
Sbjct  190   VLVGHFDCSAWITVSQSFKMEELLRNMSMKFYQARKEPVPEGINTMDQSSLMTLTRQYLQ  249

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++YV+VFDDVW    W  IK+VLP+ K G R +I+TR  +VASS    +  YI+++ PL
Sbjct  250   DKRYVVVFDDVWKLDFWGFIKYVLPENKKGSRIIITTRNDEVASSCKESSFDYIHKLQPL  309

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L C+KAF    CP  L ++   I++RCGGL LAIVAIGG+L+ K K  ++EW 
Sbjct  310   PPKSSWKLFCKKAFQGG-CPPELEKLSHDIVRRCGGLRLAIVAIGGLLSRKEKL-VSEWK  367

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
                 +LG + + N   ES+  IL LS++DLP  LK CF+Y +I+PED  I+   L   W 
Sbjct  368   KFSDTLGSELQSNSHLESINTILSLSYHDLPYQLKSCFLYFAIFPEDCTIKCRPLTRLWI  427

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFVK K G T+EEVAE +L ELI RSL+L  ++  DG ++   +HDL REIIL+K+ +
Sbjct  428   AEGFVKAKRGVTLEEVAEEFLTELIQRSLVLVSEVFADGKIRSCHVHDLMREIILTKAEE  487

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNA-QMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
              +F   +  E +++  + R LS+H +  N   +  + + +RS+  +N   SQ  +  + I
Sbjct  488   LSFCCVMTGEESSFDGRFRRLSLHYSSNNVVNITGKKSHIRSIFLYN---SQ--TFFLGI  542

Query  1255  LSS-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             L+S   +++VL L  + L+ +PE +  LLHLRYLSLR+T+V++LPRSI KL+ L+ LDLK
Sbjct  543   LASKFNLLEVLHLDDSGLDSIPENLGNLLHLRYLSLRNTEVRMLPRSIGKLQNLQTLDLK  602

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             YT V +LPVEI +L+ LR+++V ++     L      G    +G+G L  L+KL  VEAN
Sbjct  603   YTLVEDLPVEINRLKKLRNILVQNYDFDVDLGLFSFKGVHVKEGIGCLEELQKLSCVEAN  662

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              G G I+E+GKL +L++L + KL  E+G+ +C+SI K+  L+SL + S+ ED +LD+ Y+
Sbjct  663   HGVGVIKELGKLGQLRKLSVSKLTRENGEHLCASITKMDCLKSLFISSLREDEILDLQYI  722

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             S PPP L RL L G + K+P WI  L+NL  +    S L +DP++ LQ LP+L  L+   
Sbjct  723   SYPPPSLSRLKLFGLLEKLPDWISKLQNLSTVLLYGSNLMNDPMQVLQTLPSLQELDLFR  782

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
                 E + F A  FQ L++L +  L  L+ V I  GA+P LE L +  C QL  +P GI 
Sbjct  783   ASVIEQLCFEATGFQKLKILRIVWLIGLKRVKIEHGALPQLETLRVGPCPQLEELPPGIR  842

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYY  2274
              L  L  LEF D+ ++   + +P  RG +Y  V HI  V +
Sbjct  843   HLTRLTTLEFDDLQEELKLSMIPS-RGRNYEIVGHIPNVLF  882



>ref|XP_009415397.1| PREDICTED: disease resistance protein RPM1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415398.1| PREDICTED: disease resistance protein RPM1-like [Musa acuminata 
subsp. malaccensis]
Length=915

 Score =   546 bits (1407),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 319/761 (42%), Positives = 480/761 (63%), Gaps = 15/761 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +DR   AL +EE E+VGI+ P++++I  L+K +   KVISVVGMGG GKTTLV+ +YDD 
Sbjct  145   HDRHVAALFIEEAELVGIDKPKEDIIRWLVKGESNQKVISVVGMGGLGKTTLVRKIYDDE  204

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK  F SHAWITV+Q+F+V E+LK +I Q + E  + +P  + +M   +L  I+++FL 
Sbjct  205   KVKGWFNSHAWITVTQSFEVSELLKSIINQFYEERHEVLPGRIETMGDIQLIDILRQFLQ  264

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++Y++V DD+W    W+ +K+ LP    G R +I+TR+ DV  S   +T G++Y++ PL
Sbjct  265   DKRYLVVLDDLWHINAWDDLKYALPNNDCGSRILITTRIGDVGISC-LETPGHVYKLQPL  323

Query  538   SEEVSWALLCRKAFHA---SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
                 +W+L C+KAF +     CPS L EI + I++ C GLPLAIV I G+L+ K    + 
Sbjct  324   PPTKAWSLFCKKAFRSIPGRVCPSELQEISEDIVRVCEGLPLAIVTIAGLLSKKE--GVL  381

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  +  +L  +   N + E+++ ILLLS+NDLP +LK CF+Y SI+P++  ++  +LI 
Sbjct  382   EWRTMRDNLHAELANNPKLETIKRILLLSYNDLPYFLKSCFLYFSIFPKECSVKRITLIR  441

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGF++ + G+T+E VA  YL +LI+RS+I   +  D G ++  R+HDL  ++I+ K
Sbjct  442   LWIAEGFIESEKGETMERVAVEYLNDLIDRSMIQVAEHYDYGRVRSCRVHDLIHDLIVLK  501

Query  1069  STDHNFVTTI----DEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFS  1236
             S + NF T +     E       + R LS H T  +       + LR+   F       S
Sbjct  502   SKEENFSTALIRQNREIQGRILGRIRRLSTHDTGEHLLQTIDLSHLRAFFVFGENGFSIS  561

Query  1237  SHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
             S +  + +  +++K+LDL+   ++  P E  +L HLRYLS R+T++  L +S+ +L  LE
Sbjct  562   S-MGNLFNRLKLLKILDLEGAPIDSFPVEFGKLPHLRYLSFRNTRINKLSKSLGRLNNLE  620

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              LDLK T+VTELP  I+ LQ LRH++ Y + +  + P+  + G K P+G+G+L  L+KL 
Sbjct  621   TLDLKGTYVTELPKTIINLQRLRHILAYHYYTGNHPPFYHADGVKLPQGIGRLRELQKLT  680

Query  1597  YVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             Y+E +  +G + E+G L +LKRL I+KLR EDG  +C+SIEK+  LRS ++ SI  D  L
Sbjct  681   YLETDQDSGIVRELGNLTQLKRLGIVKLRREDGPGLCTSIEKMELLRSFSVTSIGMDEFL  740

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             ++  L SPPPLLQRLYL G +  +P+WI SL+ LV++  RWS+LK++ L  L+ LPNL+ 
Sbjct  741   NLQSLKSPPPLLQRLYLRGPLETLPNWISSLKYLVRMRLRWSRLKENSLGILEALPNLIE  800

Query  1957  LEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
             L  +  Y G  +    G FQ L++L+L++L  L  V++ +GAMP+L+K+ I+ C QL  V
Sbjct  801   LTLIHAYDGLKLLCQKGGFQKLKILDLERLNNLNYVIV-DGAMPNLQKMYIRSCMQLKMV  859

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHI  2259
             P GIE L NL+ L  FDM D F+   L    G D+ KVSHI
Sbjct  860   PTGIEQLINLKELHLFDMPDVFVQR-LRRLGGMDHQKVSHI  899



>emb|CDP21814.1| unnamed protein product, partial [Coffea canephora]
Length=858

 Score =   544 bits (1401),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 332/760 (44%), Positives = 454/760 (60%), Gaps = 75/760 (10%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKD-DPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P++ LIS LL+  D  LKV+SVVGM G GKTTLVK V++D  V
Sbjct  156   RDDALLVEEAKLVGIDQPKQHLISKLLEGHDHQLKVVSVVGMAGLGKTTLVKKVHEDPDV  215

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR-  360
             +K+F   AW+TVSQT    ++L+D+I QL  ELK+ VP+ + S++  +LK  VK+FL R 
Sbjct  216   RKNFPVRAWVTVSQTCDFPKLLRDLIWQLHKELKKSVPQLIESISTIELKKFVKDFLRRV  275

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  +G R M++TR  DVAS+S T++  Y+Y+  PLS
Sbjct  276   GRYAIVFDDVWDVEFWNEIKFALPEGNYGNRVMLTTRKADVASASCTESQDYVYKKEPLS  335

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HL ++ K +L +C GLPLAIVAIGG+LA+K+ + I+EW  
Sbjct  336   IEDSWTLFCNKIFKGNRCPAHLMDVAKAVLDKCDGLPLAIVAIGGLLASKDASRIDEWEM  395

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG + EG  + E ++ IL LS+NDLP +LK C +YLSIYPEDHLI    LI  W  
Sbjct  396   IQHSLGGELEGIGKLERVKRILSLSYNDLPSHLKPCLLYLSIYPEDHLIACQRLIQLWIA  455

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA GYL ELI+RSLI   ++  +GS    RIHDL RE+IL KS + 
Sbjct  456   ERFVEWREGMSIEDVAWGYLSELISRSLIQVTEVFYEGSPNTCRIHDLMREVILIKSREQ  515

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             N VT    +   WP EK R L++H                                  IL
Sbjct  516   NMVTVTTGQPMTWPSEKIRRLAIHS---------------------------------IL  542

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
              S +++KVL+L    +E  P E+F LLHL +LSL  TKV  +PR+I KL+ LE L+L  T
Sbjct  543   RSSKLLKVLELGGQEIEETPNEVFDLLHLTFLSLYGTKVARVPRAIGKLQHLEHLNLGNT  602

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V ELPVEILKLQ LRHL V+  V  +   Y    GFK P  LG L +L+ L  V+A+ G
Sbjct  603   GVRELPVEILKLQKLRHLTVFQRVDPSDSDYGFH-GFKGPSKLGGLLALQTLNTVDASSG  661

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
             +  ++EIGKL +L+ L I +LR EDGK +CSS+                     VN +S 
Sbjct  662   SVIVKEIGKLTQLRELYITQLRREDGKELCSSL---------------------VNLIS-  699

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLEHLQDLPNLVHLEFLV  1971
                   RL        MP W+  L +LV++  +WS L+  +DPLE  Q LPNL  + F  
Sbjct  700   -----LRLL------SMPQWVAHLHSLVRLDLKWSGLRAEEDPLESFQHLPNLGEITFCG  748

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y GE + F AG F  L+ L L ++E LR + + EGA P+L KLV+ R   L  +P+ I 
Sbjct  749   SYQGERLSFKAGGFLKLKQLWLRRMEGLRWMTVEEGACPNLRKLVLDRLPSLEDLPSAIR  808

Query  2152  CLFNLRYLEFFDMTDDFISTFLPD-KRGEDYCKVSHISEV  2268
              L +L+ L  ++M+   +       +  EDY +++HI E+
Sbjct  809   HLSHLQELGLYEMSSRMMEKVESQHEESEDYRRIAHIPEI  848



>emb|CDP21933.1| unnamed protein product [Coffea canephora]
Length=732

 Score =   538 bits (1385),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 318/731 (44%), Positives = 466/731 (64%), Gaps = 11/731 (2%)
 Frame = +1

Query  133   MGGSGKTTLVKMVYDD--VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGM  306
             MGG GKTTL K VYDD  V+K FQSHAWITVSQ F+   ++KD+IQQL+ E++QPVP  +
Sbjct  1     MGGLGKTTLAKKVYDDAAVEKQFQSHAWITVSQNFQFNVIIKDLIQQLYEEIRQPVPPQV  60

Query  307   GSMNANKLKVIVKEFLLRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVA  486
              SMN  +L   V++FL  R+Y++V DDVW+   WEAIK+VLP      R +++TR+ DVA
Sbjct  61    ESMNRVRLSQFVRDFLKERRYILVLDDVWSLDAWEAIKYVLPDCNIASRVVLTTRITDVA  120

Query  487   SSSSTDTNGYIYEMTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVA  666
             S+S  +++ +I++M+PLS E SW L C + F ++ CPS+L ++ ++ILK+C GLPL IV 
Sbjct  121   SASCLESHDFIHKMSPLSYEDSWTLFCNRTFQSNGCPSNLEKVCRKILKKCEGLPLGIVT  180

Query  667   IGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSI  846
             +GGVLA K+K  I+EW  ++   G + +G+ + + +R ILLLS+NDLP +LK C +YLSI
Sbjct  181   MGGVLALKDKDKIDEWEMIFRGFGSEVDGSGKLDRIRRILLLSYNDLPHHLKNCLLYLSI  240

Query  847   YPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQ  1026
             YPEDH I    L+ +W   GF++++ G T  ++A  YL ELINRSLI       DG + +
Sbjct  241   YPEDHPINVEILLGKWIALGFIEEEEGMTATDIAMRYLKELINRSLIQVKGTWVDGKLVK  300

Query  1027  GRIHDLYREIILSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTK-LRSL  1203
               +HD  REII+ KS +  F T     +  WP+K RHL++H   GN        K LRS+
Sbjct  301   CGLHDFLREIIVLKSKEQCFTTIATGYSTRWPDKVRHLAIHNFTGNPPQGFSSLKCLRSV  360

Query  1204  LTFNVTDSQFSSHVVQILSSC-RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKV  1380
              TF   DS  +S + + L    + +KVL+L S  L+ +P+E+F+L  L YL L  T+VK+
Sbjct  361   ETFGNKDSLTTSFLSKFLCGGPKFLKVLNLASAELDNIPKEVFKLFQLEYLDLSGTRVKI  420

Query  1381  LPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPk  1560
             +P+SI +L+ LE L+L  T VTELPVEILKL+ LR L+V     ++   Y    GFK+P 
Sbjct  421   IPKSIGQLQNLEFLNLLETTVTELPVEILKLRKLRSLVVCRMGDYSN-NYAIG-GFKSPD  478

Query  1561  glgklgsleklVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrs  1740
             G+GKL SLE L  +EA+ G   + EIGKL +L++L I +LR EDGK + SS+ +L  LR 
Sbjct  479   GIGKLTSLEFLGNIEADRGK-IVREIGKLIQLRKLYITELRREDGKELVSSLLRLTNLRE  537

Query  1741  lnlksIEEDVVLDVNYLSSPP-PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDD  1917
             L ++SI+E+  LD+ +  SP    L  L+LSG + ++P W+ SL++L  +    S L +D
Sbjct  538   LYIRSIKEEESLDLQHSVSPRLGFLTALWLSGRLERVPEWVISLQSLSTLALLNSALSED  597

Query  1918  --PLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPH  2091
                +  L+ LPNLV L    GY GE + F AG+F  L+ L+L +L+ L+ V + + ++  
Sbjct  598   ENAIGCLEHLPNLVDLSLHNGYEGETLCFKAGRFPKLKRLDLGQLKRLKWVRVEKESLSS  657

Query  2092  LEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEV  2268
             L++ +I  C  +  +P G++ L  L+ L   DM+D+ I      DK+ EDY  +SHI +V
Sbjct  658   LQRFLISGCKLMEGLPLGLQNLTELKVLGLLDMSDELIHEVQNLDKQSEDYQTISHIPQV  717

Query  2269  YYTYWKDGCWE  2301
                +W +G W+
Sbjct  718   CIGHWINGEWK  728



>ref|XP_009343524.1| PREDICTED: disease resistance protein RPM1-like, partial [Pyrus 
x bretschneideri]
Length=897

 Score =   543 bits (1399),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 331/789 (42%), Positives = 488/789 (62%), Gaps = 23/789 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             ND R  +L +EE EIVGIE+ R EL  LL++  P  +VISVVGMGG GKTTL K VYD  
Sbjct  87    NDPRVASLFIEEAEIVGIESARDELTRLLVEGAPRREVISVVGMGGLGKTTLAKKVYDQP  146

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V  HF  +AWITVSQ+++VE++L+ +I++ +A  K+ +PE +  M+   L    +E+L 
Sbjct  147   KVMAHFDCYAWITVSQSYRVEDLLRTVIKKFYASRKERLPEEIDKMDEESLISTSREYLQ  206

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YV+VFDDVW    W AI+H LP +  G R +I+T++ DVA+        Y++ + PL
Sbjct  207   QKRYVVVFDDVWKVDFWGAIEHALPDK--GGRIIITTQIQDVANFCKRSCFVYVHHLQPL  264

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
              ++ +W L CRKAF       CP  L E+   I+KRC GLPLAIV+IGG+L+TK K  ++
Sbjct  265   PQDKAWELFCRKAFQFELEGKCPEELEELSLNIVKRCEGLPLAIVSIGGLLSTKAKV-VS  323

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  LY+SL  + E N    SL  IL LS++ LP YLK C +Y  I+PED+ +    L+ 
Sbjct  324   EWQKLYNSLSSELERNPHLTSLTRILSLSYHHLPYYLKSCVLYFGIFPEDYSVSCIRLVR  383

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVK K GKT+EEV + YL ELI+RSL+   ++  DG  +  R+HDL  +++L K
Sbjct  384   LWIAEGFVKPKWGKTLEEVGDEYLMELIHRSLVQVSEVYIDGKARACRVHDLLHDVLLKK  443

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D +F   + ++   +    R LS+  +   A      + +RS+ TF++ +    S + 
Sbjct  444   GLDSSFCHVLSKDELTFKPTTRRLSMDISPLEALGSSTQSHIRSVFTFDLEEWP-KSFLD  502

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              +  + +++KVLD     +  +P+ +  L  L YLSLR+TKVK+LP SI  L+ LE LDL
Sbjct  503   TLSGNIKLLKVLDFTDAPINQLPKYVGDLYLLTYLSLRNTKVKLLPDSIGNLQNLETLDL  562

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAY---LPYNCSPGFKAPkglgklgsleklVY  1599
             K + V E+P +I KL  LRHL+ Y H  + Y   L  N   G K  +G+G L +L+KL Y
Sbjct  563   KQSLVYEIPAKISKLVKLRHLLAY-HRDYNYDVGLFLNMEKGVKIHEGIGCLQALQKLSY  621

Query  1600  VEANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             VEAN G    I+E+GKL +L++L +  L++EDG+AVC+S+EK+  L SL L ++ ED VL
Sbjct  622   VEANHGGMRLIKELGKLRQLRKLGLKNLKSEDGRAVCASVEKMNHLESLILTAVNEDEVL  681

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             D+  +S+PP  ++ L L G + ++P WI +L++LVKI   WS+L+D PL+ LQ+LPNL+ 
Sbjct  682   DLESISTPPQFIRALRLIGRLEQLPGWISNLQHLVKITIFWSRLRDSPLKALQNLPNLLE  741

Query  1957  LEFLV-GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
             L   +  Y G  +HF  G FQ LR+L L ++E L +++I +G MP L++  +    +L  
Sbjct  742   LVLAINAYDGVQLHFEEGGFQKLRVLGLREMEGLNSLIIDDGVMPLLQEFHVGPSPELKE  801

Query  2134  VPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY-----WKDGCW  2298
             VP+GI  L NL YL F DM  +F     P K G+ Y  V HI  V ++Y     W  G +
Sbjct  802   VPSGIHHLRNLTYLNFCDMPKEFTRQMDP-KNGQHYWIVEHIKNVCFSYKVGQRW--GAY  858

Query  2299  EVNSVQETS  2325
             E ++++++S
Sbjct  859   ESHALRDSS  867



>gb|KDP40944.1| hypothetical protein JCGZ_24943 [Jatropha curcas]
Length=933

 Score =   542 bits (1397),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 339/788 (43%), Positives = 509/788 (65%), Gaps = 21/788 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDE--IVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD  177
             N +   AL+LEE E  +VGI+  ++ LI  L+      +V+SVVG+GG GK+TL K VY+
Sbjct  150   NAKHEPALVLEEAEAGLVGIDWAKECLIEWLITGKSDRQVVSVVGVGGLGKSTLAKTVYE  209

Query  178   D--VKKHFQSHAWITVSQTFKVEEVLKDMIQQLF--AELKQPVPEGMGSMNANKLKVIVK  345
             D  VK+HF+  AWI  SQ+FK+E++LK++I+QLF   ++ +PV  G   +   KL  ++ 
Sbjct  210   DAQVKRHFKFRAWIRASQSFKIEDLLKNLIKQLFHVGKISKPVEVGKDKI---KLTTLIN  266

Query  346   EFLLRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYE  525
             +FL +++Y+IV D+V     ++A    LP    G R +++TR + +AS++S+D    +Y 
Sbjct  267   QFLRQKRYLIVLDNVCDTYSFDAFAGALPNNNSGSRILLTTRNV-IASTNSSDK---VYN  322

Query  526   MTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNI  705
             +TPLS++ SW+L C+K FH +SCP  L  + +++L RC GLPLAIV I G+LATK+K+ I
Sbjct  323   LTPLSQKDSWSLFCKKIFHYNSCPPQLKNLSEKLLGRCEGLPLAIVTISGILATKDKSRI  382

Query  706   NEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLI  885
             +EW  ++ SLG     +D+  ++R ILLLS+++LP YLK CF+Y S++PE + I    LI
Sbjct  383   DEWEMIHRSLGDRLLDSDKMTNMRKILLLSYSNLPYYLKSCFLYFSVFPEGYPINCTRLI  442

Query  886   YQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILS  1065
               W  EGFV ++ G+T+EE+AE YL ELINR+L+  V+   DG +K+  IHDL REIILS
Sbjct  443   RLWIAEGFVNEQGGRTLEEIAESYLNELINRNLVQVVETTMDGRLKRCLIHDLLREIILS  502

Query  1066  KSTDHNFVTTID-EETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSH  1242
             K+ D  F+TT+  +      EK R +S++ T     + +  + LRSLL F   DS   S 
Sbjct  503   KAGDQEFITTVKTQNNNNLSEKVRRISIYNT--TPSIHQISSHLRSLLMFWGVDSLSVSP  560

Query  1243  VVQI-LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEI  1419
             +  +  +  +++ VLDL+   L+  P EI  L+ L+YLSL+ TKV  +PRSI KL+ LE 
Sbjct  561   LFNLSFNRLKLLTVLDLEGAPLKEFPNEIVNLMLLKYLSLKKTKVNSIPRSICKLQNLET  620

Query  1420  LDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             L+LK+ +V ELP EILKLQ L HL+VY +            GFKAP  +G L SL++L +
Sbjct  621   LNLKHAYVDELPAEILKLQKLHHLLVYRYEISLDDEIRTKYGFKAPAQIGNLQSLQRLCF  680

Query  1600  VEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             +E N       E+GKL++L+RL I+KLR EDGKA+ SSIE++  L++L++ S+ E  ++D
Sbjct  681   LEVNQDGHLTLELGKLSQLRRLGIVKLRKEDGKALSSSIERMKNLQALSITSMNESEIID  740

Query  1780  VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHL  1959
             + +L SPP  LQRLYL+G + K+P W+ SL +LVKI  +W +L +DPL  LQ LPNLVHL
Sbjct  741   LEFLCSPPHNLQRLYLAGRLEKLPEWVCSLHSLVKIVLKWGQLSEDPLLSLQHLPNLVHL  800

Query  1960  EFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVP  2139
             E +  Y G+  +F    F  L+LL L+KL++L  + I + AMP LEKL+ Q C+ L +VP
Sbjct  801   ELVQAYYGKEFYFQQKGFPRLKLLGLNKLQKLEKIYIEKEAMPSLEKLIFQSCHSLLTVP  860

Query  2140  AGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQE  2319
              GI+ L +L  L+F +M  + I   +    G+++ KV H+ EV+++Y+ +G W+  S+  
Sbjct  861   LGIQHLIHLNVLQFINMPIELI---MEMDHGDNW-KVEHVPEVHFSYFNNGNWDTFSLNG  916

Query  2320  TSSGPETA  2343
             +     +A
Sbjct  917   SRRDKNSA  924



>emb|CDP13418.1| unnamed protein product [Coffea canephora]
Length=958

 Score =   543 bits (1399),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 342/785 (44%), Positives = 487/785 (62%), Gaps = 27/785 (3%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P+K LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAKLVGIDQPKKHLISQLLRGDDYQLKVVSVVGMGGLGKTTLVKRVHEDPEV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +KHF   AW+TVSQT   + +LKD+I+QL  E K+PVP+ + S N  +LK I+K+FL + 
Sbjct  219   RKHFPVRAWVTVSQTCDFQYLLKDLIRQLHKEGKKPVPQSIESSNTTELKEIIKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  HG R +++TR  DVAS+S  ++  ++Y M PLS
Sbjct  279   GRYAIVFDDVWDVEFWNTIKFALPESSHGNRVLLTTRRADVASASCIESRRFVYRMKPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              + S  L   K F+  +CP HL ++ K IL +C GLPLAI+AI G+LA+K+   I+EW  
Sbjct  339   VKDSRTLFYNKIFNGGNCPGHLMDVAKGILDKCEGLPLAILAISGLLASKDVNRIDEWEM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + ++ IL LS++DLP +LK+C +Y SIYPED+ I    L+  W  
Sbjct  399   VRRSLGGELEGTGKLDRVKKILSLSYSDLPWHLKICLLYTSIYPEDYKIGCLRLVNLWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA GY  EL++RSLI    +  +GS    RIHDL RE+I  KS + 
Sbjct  459   ERFVEWREGMSIEDVAWGYFIELVSRSLIQVTGVFYEGSPDTCRIHDLLREVIFLKSREQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK------LRSLLTFNVTDSQFSS  1239
             N VTT   ++  WP  K R L VH +  N     Q  +      LRS +    T+     
Sbjct  519   NMVTTTTGQSMMWPSNKVRRLIVHSSSSNNTQHLQQMQNYCFDHLRSFVRIGSTNPLLYK  578

Query  1240  HVV-QILSSCRVIKVLDLQSTSLEI-VPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRML  1413
              ++  +L S +++KVLDL+    +  +P EIF++ HL++L L  T V+ +P++I KL+ L
Sbjct  579   MLLYDVLRSSKLLKVLDLRGQKKQKEIPNEIFKMFHLKHLDLYGTGVERVPKAIGKLQHL  638

Query  1414  EILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslekl  1593
             E L+L  T V ELP+EILKLQ LR L VY  V  +   Y    GFKAP  +G L +LE L
Sbjct  639   EYLNLGKTGVRELPMEILKLQKLRCLEVYQQVDSSDDNYGFH-GFKAPSNMGGLLALEIL  697

Query  1594  VYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EE  1764
              Y++A+ G+  I+E+GKL +L+ L I KLR EDGK +CSS+  L  LR L ++SI   ++
Sbjct  698   SYIDASSGSIIIKEVGKLTQLRELRITKLRREDGKELCSSLANLTSLRELRVESIGKGDD  757

Query  1765  DVVLDVNY------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDP  1920
               ++D+N+       SS    LQ L L G + KMP W+  LR LV+I   WS L+  +DP
Sbjct  758   HEIIDLNHPSLSSFSSSFLQSLQMLLLCGRLEKMPEWVAHLRGLVRIDLDWSGLRGEEDP  817

Query  1921  LEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEK  2100
             LE LQ LPNL H+ F   Y GE + F AG F  L+ ++L ++E LR + + EGA+P L+K
Sbjct  818   LESLQHLPNLHHINFCGSYQGEGLCFKAGGFLKLKWMHLKRMEGLRWMRVEEGALPRLQK  877

Query  2101  LVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKR--GEDYCKVSHISEVYY  2274
             L +Q+   L  +P GI+ L NL+ L  ++ +       L +++   EDY  ++HI E+  
Sbjct  878   LFLQQLPLLEELPLGIQHLSNLQRLSLYETSSHLREKVLENQKEESEDYTGIAHIPEILI  937

Query  2275  TYWKD  2289
              Y+ D
Sbjct  938   GYYTD  942



>ref|XP_002265419.1| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]
Length=919

 Score =   541 bits (1394),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 326/761 (43%), Positives = 475/761 (62%), Gaps = 12/761 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +D R  +L ++E EIVGIE+ + EL S L++  P   VISVVGMGG GKTTL   VYD+ 
Sbjct  156   HDPRVTSLFIDEAEIVGIESQKIELTSRLVEGTPERTVISVVGMGGLGKTTLANKVYDNK  215

Query  184   K--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             +   HF   AWITVSQ+FK+EE+L++M  + +   K+PVPEG+ +M+ + L  + +++L 
Sbjct  216   ELVGHFDCSAWITVSQSFKMEELLRNMSMKFYQARKEPVPEGINTMDESSLMTLTRQYLQ  275

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++YV+VFDDVW    W  IK+VLP+ K G R +I+TR  +VAS     +  YI+++ PL
Sbjct  276   DKRYVVVFDDVWKLDFWGFIKYVLPENKKGSRIIITTRNDEVASCCKESSFDYIHKLQPL  335

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L C+KAF    CP  L ++   I++RCGGLPLAIVAIGG+L+ K K  ++EW 
Sbjct  336   PPKSSWKLFCKKAFQGG-CPPELEKLSHDIVRRCGGLPLAIVAIGGLLSRKEKL-VSEWK  393

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
                 +LG + + N   ES+  IL LS++DLP  LK CF+Y +I+PED  I+   L   W 
Sbjct  394   KFSDTLGSELQSNSHLESINTILSLSYHDLPYQLKSCFLYFAIFPEDCTIKCRPLTRLWI  453

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFVK K G T+EEVAE +L ELI RSL+L  ++  DG ++   +HDL REIIL+K+ +
Sbjct  454   AEGFVKAKRGVTLEEVAEEFLTELIQRSLVLVSEVFADGKIRSCHVHDLMREIILTKAEE  513

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGN-AQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
              +F   +  E +++  + R LS+H +  N   +  + + +RS+  +N   SQ  +  + I
Sbjct  514   LSFCCVMTGEESSFDGRFRRLSLHYSSNNVVNITGKKSHIRSIFLYN---SQ--TFFLGI  568

Query  1255  LSS-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             L+S   +++VL L  + L+ +PE +  LLHLRYLSLR+TKV++LPRSI KL+ L+ LDLK
Sbjct  569   LASKFNLLEVLHLDDSGLDSIPENLGNLLHLRYLSLRNTKVRMLPRSIGKLQNLQTLDLK  628

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             YT V +LPVEI +L+ LR+++V ++     L      G    +G+G L  L+KL  VEAN
Sbjct  629   YTLVEDLPVEINRLKKLRNILVQNYDFDVDLGLFSFKGVHVKEGIGCLEELQKLSCVEAN  688

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              G G I+E+GKL +L++L I+KL  E+G+ +C+SI  + +L SL + S+ ED  LD+ Y+
Sbjct  689   HGAGVIKELGKLRQLRKLEIIKLTRENGEHLCASITNMNRLESLLISSLSEDETLDLQYI  748

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             S PP  L RL L G + K+PHWI  L+NL  +    S L +DP++ LQ LP+L  L  + 
Sbjct  749   SHPPSCLSRLQLFGPLEKLPHWISELQNLSIVTLYGSNLMNDPVQVLQALPSLQELALVR  808

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
                 E + F    FQ L+LL L  L  L+ V I  GA+P L+ L +  C QL  +P GI 
Sbjct  809   DSVVEQLCFETSGFQKLKLLFLRFLVGLKRVKIENGALPQLKTLRVGPCPQLEEIPPGIR  868

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYY  2274
              L  L  L F ++ ++   + +P  RG +Y  V HI  V +
Sbjct  869   HLTRLTTLGFDNLQEELKVSMIP-TRGRNYEIVEHIPNVLF  908



>ref|XP_009374540.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Pyrus 
x bretschneideri]
Length=948

 Score =   540 bits (1390),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 332/789 (42%), Positives = 482/789 (61%), Gaps = 22/789 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             ND R  +L +EE EIVGIE+ R EL  LL++  P  +VISVVGMGG GKTTL K VYD  
Sbjct  160   NDPRVASLFVEEAEIVGIESARDELTRLLVEGAPRREVISVVGMGGLGKTTLAKKVYDQP  219

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V  HF  +AWITVSQ+++VE++L+ +I++ +   K+  PE +  M+   L    +E+L 
Sbjct  220   KVMAHFDCYAWITVSQSYRVEDLLRTVIKKFYTSRKERFPEEIDKMDEESLISTSREYLQ  279

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YV+VFDDVW    W AI+H LP  K G R +I+TR+ DVA+        +++ + PL
Sbjct  280   QKRYVVVFDDVWKVDFWGAIEHALPDNK-GGRIIITTRIQDVANFCKRSCFVHVHHLQPL  338

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
                 +W L CRKAF        P  L E+    +KRC GLPLAIV+IGG+L+TK K  ++
Sbjct  339   PPNKAWELFCRKAFQFELEGKYPEELEELSLNFVKRCEGLPLAIVSIGGLLSTKVKV-VS  397

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  LY+SL  + E N    SL  IL LS++ LP YLK C +Y  I+PED+ +    L+ 
Sbjct  398   EWQKLYNSLSSELERNPHLTSLTRILSLSYHHLPYYLKSCVLYFGIFPEDYSVSCIRLVR  457

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVK K GKT+EEV E YL ELI+RSL+   ++  DG  +  R+HDL  +++L K
Sbjct  458   LWIAEGFVKLKRGKTLEEVGEEYLMELIHRSLVQVSEVYIDGKARGCRVHDLLHDVLLKK  517

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D +F   + ++ + +    R LS+  +   A      + +RS+ TFN+ +    S + 
Sbjct  518   GLDSSFCHVLSQDKSTFKPTNRRLSMDISPSEALGSITQSHIRSVFTFNLEEWP-ESFLD  576

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              +  + +++KVLD     +  +P+ +  L  L YLSLR+TKVK+LP SI  L+ LE LDL
Sbjct  577   TLSGNIKLLKVLDFMDAPINQLPKYVGDLYLLTYLSLRNTKVKLLPDSIGNLQNLETLDL  636

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAY---LPYNCSPGFKAPkglgklgsleklVY  1599
             K + V E+P  I KL  LRHL+ Y H  + Y   L  N   G K  +G+G L +L+KL Y
Sbjct  637   KQSLVYEIPARISKLVKLRHLLAY-HRDYNYDVGLFLNMEKGVKIHEGIGCLQALQKLCY  695

Query  1600  VEANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             VEAN G    I+E+GKL +L++L +  L++EDG+AVC+SIEK+  L SL L ++ ED VL
Sbjct  696   VEANHGGIRLIKELGKLRQLRKLGLKNLKSEDGRAVCASIEKMNHLESLILTAVNEDEVL  755

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             D+  +S+PP  ++ L L G + ++P WI +L++LV+I   WS+L+D PL+ LQ+LPNL+ 
Sbjct  756   DLESISTPPQFIRALRLIGRLEQLPGWISNLQHLVRITIFWSRLRDSPLKALQNLPNLLK  815

Query  1957  LEFLV-GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
             L   +  Y G  +HF  G FQ LR+L L ++E L +++I +G MP L++  +    QL  
Sbjct  816   LVLAINAYDGVQLHFEEGGFQKLRVLGLREMEGLNSLIIDDGVMPLLQEFHVGPSPQLKE  875

Query  2134  VPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY-----WKDGCW  2298
             VP+GI  L NL YL F DM  +F     P K G+ Y  V HI  V ++Y     W  G +
Sbjct  876   VPSGIHHLRNLTYLNFCDMPKEFTRQMDP-KNGQHYWIVEHIKNVSFSYKVRPRW--GAF  932

Query  2299  EVNSVQETS  2325
             E ++++++S
Sbjct  933   ESHALRDSS  941



>gb|KCW61556.1| hypothetical protein EUGRSUZ_H04288 [Eucalyptus grandis]
Length=925

 Score =   538 bits (1387),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 319/789 (40%), Positives = 471/789 (60%), Gaps = 63/789 (8%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  A L++E E+VGI+ PR+E+I  L+ ++P L+++S++GMGG GKTTL    Y++ 
Sbjct  152   HDLREGAFLVDEGELVGIDEPREEIIKWLVDEEPRLEIVSILGMGGLGKTTLAGQAYNNQ  211

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK +FQSHAWI VSQ++K+E++L+DMI QL  E +QP+P+G+  M +  LK + K+FL 
Sbjct  212   QVKAYFQSHAWINVSQSYKIEDILRDMIVQLHNEFEQPIPQGIEIMRSTSLKKMGKDFLQ  271

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YVIV DD+W     E IK+ +P      R +I+TR+  VA  SS  +   IY   PL
Sbjct  272   QKRYVIVLDDLWDKEALEGIKNAMPNSNFCSRILITTRIAHVAMVSSNKSK--IYTCKPL  329

Query  538   SEEVSWALLCRKAFHASSCPSHLTE--ILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             S + SW+L C+KAF  +  P HL +  + +QILK+  GLPLAIVA+G +L  K+   ++E
Sbjct  330   SSKHSWSLFCKKAFRGNVYPPHLEQESLCRQILKKSEGLPLAIVALGSLLFAKD---VHE  386

Query  712   WGALYHSLGPDFEGNDQFESLRI-ILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             W  +  SL  + E ND  ++ +  IL LS+NDL   LK CFMYL ++PED +IE   LI 
Sbjct  387   WEMISRSLATELESNDVMQNFKKKILSLSYNDLHYNLKSCFMYLGVFPEDCVIECARLIR  446

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFV+++ G T EEVA+ YL ELIN+SL+  V    DG ++  R+HDL RE ILS+
Sbjct  447   LWIAEGFVEEREGMTQEEVAQRYLKELINKSLVQIVGTTLDGRIRSCRVHDLMRESILSR  506

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D NFV+   ++     ++ R LSV  T  NA  +     L SLL F +  +  SS+  
Sbjct  507   LRDINFVSFASKQRVELHKRVRRLSVQYTCNNALEQLNLPSLHSLLIFELA-TLSSSYEQ  565

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              I S CR+++VLDL  + L   P++I  L HL+YLSLR TKV+++PRSI KL  LE LD 
Sbjct  566   FIPSGCRLLRVLDLGDSPLHEFPQQILVLFHLKYLSLRRTKVRIIPRSIGKLENLETLDF  625

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFA-YLPYNCSPGFKAPkglgklgsleklVYVE  1605
             K+T V+ELP+EI KL+ L++L+VY++  F    P+    GF APK L             
Sbjct  626   KHTLVSELPMEITKLKKLQYLLVYNYADFTPSRPFCSITGFPAPKALEHC----------  675

Query  1606  ANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
                   T++E+G+L +L+RL ++ L+ +D K +C S++K+  L+SL + +  ED V+D++
Sbjct  676   ----KNTMQELGELCQLRRLGVMDLKKDDAKELCHSLKKMTDLQSLVVVAESEDEVIDLD  731

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNL----V  1953
             +LSSPP LL RLY+ G + K+PHW+  L NL ++  +WS+LK  PL  LQ+LPNL    +
Sbjct  732   FLSSPPRLLGRLYIRGCLKKLPHWLPLLNNLARVRLKWSRLKSSPLIALQNLPNLDRGFL  791

Query  1954  HLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL--  2127
              L+ L     E++ F                     V++   AMP L+ L I RC  L  
Sbjct  792   KLKQLSLANLENLRF---------------------VLMNGQAMPCLQSLFIYRCKHLDW  830

Query  2128  ASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGE-------DYCK---VSHISEVYYT  2277
               +   I  L  L+YL+F ++ ++F   F P              C    +   SEVY+ 
Sbjct  831   QLLLVVIHGLTILKYLQFREIPEEFALAFYPYSSSRMMREGIMQKCYEEVMERNSEVYFV  890

Query  2278  YWKDGCWEV  2304
             +W++  WE+
Sbjct  891   WWEEDHWEL  899



>ref|XP_009374541.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Pyrus 
x bretschneideri]
Length=948

 Score =   539 bits (1388),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 325/789 (41%), Positives = 487/789 (62%), Gaps = 22/789 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             ND R  +L +EE EIVGIE+ R EL  LL++  P  +VIS VGMGG GKTTL K VYD  
Sbjct  160   NDPRVASLFIEEAEIVGIESTRDELTLLLVEGAPRREVISTVGMGGLGKTTLAKKVYDQK  219

Query  184   K--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             K   HF  +AWITVSQ+++VE++L+ +I++ ++  K+  PE + +M+   L    +E+L 
Sbjct  220   KVVAHFDCYAWITVSQSYRVEDLLRTVIKKFYSSRKERFPEEIDTMDEESLISTSREYLQ  279

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YV+VFDDVW    W AI+H LP + +G R +I+TR+ DVA         +++ + PL
Sbjct  280   QKRYVVVFDDVWKVDFWGAIEHALP-DNNGGRIIITTRIQDVADFCKRSCFVHVHHLQPL  338

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
                 +  L CRKAF       CP  L E+   I++RC GLPLAIV+IGG+L+TK K  ++
Sbjct  339   PPNKALELFCRKAFQFELEGKCPEELEELSLSIVERCKGLPLAIVSIGGLLSTKAKV-VS  397

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  LY+SL  + E N    S+  IL LS++ LP YLKLC +Y  I+PED+ +    L+ 
Sbjct  398   EWQKLYNSLSSELESNPHLTSVTRILSLSYHHLPYYLKLCVLYFGIFPEDYSVSCIRLVR  457

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVK K GKT+EEV E YL ELI+RSL+   ++ +DG  +  R+HDL  +++L K
Sbjct  458   LWIAEGFVKLKRGKTLEEVGEEYLMELIHRSLVQVSEVYNDGKARACRVHDLLHDVLLKK  517

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D +F   + ++ + +    R LS+  +   A+     + +RS+  FN+ +    S + 
Sbjct  518   GLDSSFCHVLSKDESTFKPTTRRLSIDISPSEARGSITQSHIRSVFIFNLEECP-ESFLN  576

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
             ++  + +++KVLD     +  +P+ +  L  L YLSLR+TKVK+LP S+  L+ LE LDL
Sbjct  577   KLSGNFKLLKVLDFSDAPINQLPKYVGDLYLLTYLSLRNTKVKLLPDSVGNLQNLETLDL  636

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSF---AYLPYNCSPGFKAPkglgklgsleklVY  1599
             K + V E+P +I  L  LRHL+ Y H  +     L +N   G K  +G+G L +L+KL Y
Sbjct  637   KQSLVYEIPAKINNLVKLRHLLAY-HRDYNCEVGLFWNMEKGVKIHEGIGCLQALQKLSY  695

Query  1600  VEANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             V+AN G    I+E+GKL +L++L +  L++EDG+AVC+SIEK+  L SL L +I ED VL
Sbjct  696   VDANHGGIRLIKELGKLRQLRKLSLTNLKSEDGRAVCASIEKMNHLESLLLTAINEDEVL  755

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             D+  +S+PP  ++ L L G + ++P WI +L++LV++   WS+L+D PL+ LQ+LPNL+ 
Sbjct  756   DLESISTPPQFIRSLGLIGRLEQLPGWISNLQHLVRLVIFWSRLRDSPLKALQNLPNLLK  815

Query  1957  LEFLV-GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
             L   +  Y G  +HF  G FQ LR+L L ++E L +++I +G MP L++  +    QL  
Sbjct  816   LVLAINAYDGVQLHFEEGGFQKLRVLGLREMEGLNSLIIDDGVMPLLQEFHVGPSPQLKE  875

Query  2134  VPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY-----WKDGCW  2298
             VP+GI  L NL YL F DM  +F     P K G+ Y  V HI  V ++Y     W  G +
Sbjct  876   VPSGIHHLRNLTYLNFCDMPKEFTRQMDP-KNGQHYWIVEHIKNVSFSYKVRPRW--GAF  932

Query  2299  EVNSVQETS  2325
             E ++++++S
Sbjct  933   ESHALRDSS  941



>ref|XP_010651614.1| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]
 ref|XP_010651615.1| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]
Length=727

 Score =   529 bits (1363),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 303/731 (41%), Positives = 453/731 (62%), Gaps = 7/731 (1%)
 Frame = +1

Query  133   MGGSGKTTLVKMVYDDVK--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGM  306
             MGG GKTTL K VYD+ +  +HF   AWITVSQ+FK+EEVL+++I+Q +   K+ +P+G 
Sbjct  1     MGGLGKTTLAKKVYDNKRMVEHFDCRAWITVSQSFKMEEVLRNVIKQFYLARKESIPDGT  60

Query  307   GSMNANKLKVIVKEFLLRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVA  486
              +M+   L   ++E+L  ++YV+VFDDVW    W  IK++LP+ K G R +I+TR ++V 
Sbjct  61    DAMDEMSLITRLREYLEDKRYVVVFDDVWKLEFWRFIKYILPENKRGSRIVITTRNVEVG  120

Query  487   SSSSTDTNGYIYEMTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVA  666
             S+    +  YI+ +  L  E SW L C+KAF    CP  L EI   I+KRC GLPLAIVA
Sbjct  121   SAVKESSFHYIHNLQALPPESSWELFCKKAFQGCFCPPELEEISLAIVKRCEGLPLAIVA  180

Query  667   IGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSI  846
             +GG L+TK K  + EW    +SLG   E N   E++  IL LS++DLP YLK CF+Y +I
Sbjct  181   MGGALSTKEKNEL-EWQKFNNSLGSQLESNPHLENITKILSLSYDDLPHYLKSCFVYFAI  239

Query  847   YPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQ  1026
             +PED+ I    LI  W  EGFVK K G T+E+VAE YL ELI+RSL+    ++  G ++ 
Sbjct  240   FPEDYSINCGRLIRLWIAEGFVKGKKGITLEQVAEEYLTELIHRSLVQLSYVDYRGKIRS  299

Query  1027  GRIHDLYREIILSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGN-AQMKRQGTKLRSL  1203
              R+HDL REIIL K+ + +   +  EE +++  K R  SV  +  N  +   +  ++RS+
Sbjct  300   CRVHDLMREIILRKAEELSLCRSFGEEDSSFDGKFRRGSVQKSTDNVVEAINRNPQIRSI  359

Query  1204  LTFNVTDSQFSSHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVL  1383
             L F++ D+         L++ +++KVLD +   L  VPE++  L HLRYLSLR TKVK+L
Sbjct  360   LLFDI-DAVPMLFTGTFLANFKLLKVLDFEKAPLYSVPEDLGNLFHLRYLSLRRTKVKML  418

Query  1384  PRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkg  1563
             P+SI KL+ L+ LDLK++ V  LPVEI KLQ LRH++ YS+   +        G    + 
Sbjct  419   PKSIGKLQNLQTLDLKHSLVDALPVEIKKLQKLRHILAYSYNYHSAYQLPSVRGILVGEV  478

Query  1564  lgklgsleklVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrsl  1743
             +G +  L+KL YVEAN G G I E+GKL +L++L I  L  EDG ++ +SI  +  L +L
Sbjct  479   IGSMVELQKLCYVEANHGKGLIAELGKLKQLRKLGITNLMEEDGLSLYASISNMKYLEAL  538

Query  1744  nlksIEEDVVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPL  1923
              + + ++D +L +  +S PP  L+ L+L G + K+P W+ +LR+LV++  R S+L  DP+
Sbjct  539   CICARDDD-ILKLETISDPPRYLRTLFLQGCLSKLPEWLLTLRSLVRVCLRRSRLSYDPV  597

Query  1924  EHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKL  2103
             E LQ LPNL+ +E    Y GE + F+   FQ L  L L  ++ L+ + I +GA+P L+  
Sbjct  598   EVLQALPNLLEVELHTAYDGECLCFSELGFQKLERLQLRDMKGLKTLKIRDGALPLLKHF  657

Query  2104  VIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYW  2283
              I    QL  VP GI  L  L  +EF+ M+++F  + +PD  G++Y  V H+  V++ ++
Sbjct  658   EIGPSPQLEEVPPGIRLLKTLTSIEFWGMSEEFAFSMVPD-HGQNYHIVEHVPNVFFHFF  716

Query  2284  KDGCWEVNSVQ  2316
             + G +   +++
Sbjct  717   RSGGYSTKTLR  727



>ref|XP_008376470.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
Length=834

 Score =   533 bits (1372),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 321/766 (42%), Positives = 473/766 (62%), Gaps = 13/766 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R  +L +EE E+VGIE+ RKEL  LL+   P  +VISVVGMGG GKTTL + VYD   
Sbjct  49    DPRVASLFIEEAEVVGIESARKELTDLLVGGAPRREVISVVGMGGLGKTTLARKVYDSLT  108

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             V  HF+ +AWITVSQ+++VE++L+ +++  +   K+  PE + + +   L    +E+L +
Sbjct  109   VMDHFKCYAWITVSQSYRVEDLLRTVVKMFYNSRKENFPEDIDTTDEESLIRKSREYLQQ  168

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             ++YV+VFDDVW  + WEAI+H LP  K G R MI+TR+ +VA         +++ + PL 
Sbjct  169   KRYVVVFDDVWKVKFWEAIEHALPDNKGG-RIMITTRIQEVADFCKKSCFVHVHHLQPLP  227

Query  541   EEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
              + +W L CRKAF      +CP  L ++ ++I+K+C GLPLAIV IGG+L+TK K  ++E
Sbjct  228   PKNAWKLFCRKAFQFELEGNCPLELEDMSREIVKKCEGLPLAIVCIGGLLSTKVKV-VSE  286

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W  LY+SL  + + N     L  IL LS+  LP YLK C +Y  I+PED+ I    LI  
Sbjct  287   WQKLYNSLSSELKSNPHLTGLTRILSLSYEHLPYYLKSCVLYFGIFPEDYSINCVRLIRL  346

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EGFVK K GKT+EEV E YL E+I+RSL+   ++  DG  +  R+HD+ RE++L K 
Sbjct  347   WIAEGFVKLKKGKTLEEVGEEYLTEVIHRSLVQVSEVYIDGKARSCRVHDILREVLLKKG  406

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              D +F   + E    +    R LS+  +  +A      +++RS+  FN  +    S++  
Sbjct  407   VDSSFCHILSEFELTYKPTIRRLSIDNSPSDASGIITQSQIRSVFAFN-QEEWPESYLNT  465

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             +  + +++KVLD     +  +P+ +  L  L YLSLR+TKV++LP SI  L+ LE LDLK
Sbjct  466   LRGNFKLLKVLDFMDAPINQLPKYVGDLYLLTYLSLRNTKVELLPDSIGNLQNLETLDLK  525

Query  1432  YTFVTELPVEILKLQHLRHLIV-YSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
              + V+E+P +I KL  LRHL+  Y   S A+   N   G K  +G+G L +L+KL +VEA
Sbjct  526   QSLVSEIPAKINKLVKLRHLLAYYRDYSLAFWS-NMERGVKIHEGIGCLQALQKLYFVEA  584

Query  1609  NPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             N G    I+E+G+L +L++L + KL+ EDGKA+C+ IEK+  L +L L +I ED VLD+ 
Sbjct  585   NHGGIKLIKELGQLRQLRKLGLTKLKREDGKALCACIEKINHLETLELTAISEDEVLDLE  644

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              +S+PP  +++L L G + ++P WI +L++LV +   WS+L+D PL+ LQ+LPNL+ L  
Sbjct  645   SISTPPQFIRKLILYGRLEQLPSWISNLQHLVALVIYWSRLRDFPLKALQNLPNLLDLGL  704

Query  1966  -LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
               +G+ G  +HF  G FQ LR L L ++E L +++I  G MP L++  I    QL  VP+
Sbjct  705   GQMGHEGMRLHFEEGGFQKLRKLRLREVEGLNSLIIDNGVMPILQEFHIGPSPQLKDVPS  764

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
             GI  L NLR L F+DMT +F     P+  G  Y  V HI  V + Y
Sbjct  765   GICRLRNLRDLRFYDMTKEFARQMDPNN-GPHYWIVKHIRHVDFIY  809



>emb|CDP19455.1| unnamed protein product [Coffea canephora]
Length=957

 Score =   536 bits (1381),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 343/793 (43%), Positives = 489/793 (62%), Gaps = 35/793 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R +A+L+EE E+VGI  P+++L+S LL+ D+  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDEAILVEEAELVGINKPKQQLVSQLLEGDESQLKVVSVVGMGGLGKTTLVKKVHEDLDV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   A++TVSQT   +E+LKD+I+QL  ELK+PVPE + +M A +LK  VK+FL + 
Sbjct  219   RRHFPVRAFVTVSQTCNFQELLKDLIRQLHNELKKPVPESIEAMTAIQLKQCVKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW  + W AI+  LPK  +G R M++TR  DVA +S T +  Y+++M PLS
Sbjct  279   GRYAIVFDDVWDTKFWNAIRIALPKNGYGNRVMLTTRKADVAFASCTQSQDYVFKMVPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HLT++ K IL +C GLPLAI+AI G+LA K+     EW  
Sbjct  339   FEDSWTLFCNKIFKGNGCPAHLTDVAKGILGKCEGLPLAILAISGLLALKDLNIAEEWKM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG+   + +R IL LS+NDLP +LK C +YLSIYPED  I  + L+  WT 
Sbjct  399   VRCSLGGELEGSGMLDKVRKILSLSYNDLPCHLKTCLLYLSIYPEDFEIGCHRLVQLWTA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+++   T+E+V   YL EL+NRSLI   +   +G     RIHDL RE+ILSKS + 
Sbjct  459   ERFVEKREEMTLEDVGYNYLKELVNRSLIQVSESFYEGIPYSCRIHDLVREVILSKSREQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK------LRSLLTFNVTDSQFSS  1239
               V     +   WP  KAR L VH +  N   + Q ++      LRS +     +   S 
Sbjct  519   YMVAITTGQYTRWPSSKARRLVVHNS--NHTQQHQESQYYCFDHLRSFIAIGSMNPLVSK  576

Query  1240  HVV-QILSSCRVIKVLDLQS-TSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRML  1413
             +++ ++L S R++KVLDL+   +LE +P EIF L  LRYL+L  T +K +P+SI KLR L
Sbjct  577   NLLPKVLRSGRLLKVLDLRGEKTLEDIPNEIFHLCRLRYLNLYGTGIKAIPKSIGKLRNL  636

Query  1414  EILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslekl  1593
             E L+L  T V ELP+EILKLQ L+HL V+  V      Y    GF AP  LG L +L+ L
Sbjct  637   EYLNLSDTQVRELPMEILKLQKLQHLRVFKLVDPLDHNYGFR-GFMAPSKLGGLFALQSL  695

Query  1594  VYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED--  1767
               ++A+  +  ++EIGKL EL+ L I  LR EDGK +CSS+  L  LR L + SI +D  
Sbjct  696   FGIDASE-SIIVKEIGKLTELRELGISNLRREDGKELCSSLANLTSLRELTVSSIRKDDD  754

Query  1768  --VVLDVNY-----------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKL  1908
                V+++N+            SS    L+ L LSG + KMP WI  L++LV+I   WS L
Sbjct  755   DYEVMNLNHHHQQHSNSSSVSSSFLVSLRMLVLSGCLEKMPWWIAHLQSLVRIDLNWSSL  814

Query  1909  --KDDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGA  2082
               ++DPLE L  LPNL  ++F   Y GE + F AG F  L+ L L K+++LR + + EGA
Sbjct  815   SEEEDPLESLHHLPNLGAVQFCGSYQGEGLCFKAGGFLRLKTLYLKKIDKLRWMKMEEGA  874

Query  2083  MPHLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFL-PDKRGEDYCKVSHI  2259
             +P L+++ +     + ++P GIE L +L+ L  + ++       +  ++  EDY +++HI
Sbjct  875   LPSLQEITLVELPLMQALPWGIEHLSHLQKLRLYQLSSQLTRNLVDQNEESEDYTRIAHI  934

Query  2260  SEVYYTYWKDGCW  2298
              E+   +  +  W
Sbjct  935   PEIVIGFLSNKGW  947



>ref|XP_002265568.1| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]
Length=908

 Score =   534 bits (1376),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 316/754 (42%), Positives = 466/754 (62%), Gaps = 13/754 (2%)
 Frame = +1

Query  22    ALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDVK--KHF  195
             +L +++ EIVGI + + ELIS L+K      VISVVGMGG GKTTL K VY +++  KHF
Sbjct  162   SLFIDDSEIVGIGSQKNELISRLVKGTLKRTVISVVGMGGLGKTTLAKKVYANMRVVKHF  221

Query  196   QSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVI  375
               HAWITVSQ+F+++E+L+ M+++ +   K+ VPE +  M+   L   V+E+L  ++YV+
Sbjct  222   DCHAWITVSQSFQMKELLRRMMEKFYEARKEKVPEDINRMDNESLITQVREYLQDKRYVV  281

Query  376   VFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSW  555
             VFDDVW A  WE+I   LP+ K G R +I+TR  DVA+    D   YI+ +  LS + S 
Sbjct  282   VFDDVWKAGFWESITPALPENKKGSRIIITTRKDDVATCCKDD---YIHRLPHLSPDSSR  338

Query  556   ALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSL  735
              L C+KAF    CP  L ++   I+KRCGGLPLAIVAIGG+L+ K K  ++ W     SL
Sbjct  339   ELFCKKAFQGR-CPPELKKLSDDIVKRCGGLPLAIVAIGGLLSRKEKI-VSLWKKFSDSL  396

Query  736   GPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVK  915
             G + E N   ES+  IL LS+ DLP +LK CF+YL+I+PED+ I+   L   W  EGFVK
Sbjct  397   GSELESNSHLESINTILSLSYYDLPYHLKSCFLYLAIFPEDYTIKCGILTRLWIAEGFVK  456

Query  916   QKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTT  1095
              K G T+EE AEG+L ELI RSL+    +  DG++K+  IHDL REIIL K+ + +F + 
Sbjct  457   TKRGVTLEETAEGFLTELIRRSLVQVSDVYIDGNIKRCHIHDLMREIILKKAEELSFFSV  516

Query  1096  IDEETAAWPEKARHLSVHGTLGNA-QMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSCRV  1272
             +  E + +  + R LSV  +  N   +  + + +RS+  +N     FS  +  + S  + 
Sbjct  517   MAGEASCFDGRFRRLSVQNSSNNVLDIPSKKSHIRSIFLYN--SEMFS--LGTLASKFKF  572

Query  1273  IKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTEL  1452
             +KVLDL    LE +PE++  LLHLRYLSLR T+V++LPRSI KL+ L+ LDLKY+ V +L
Sbjct  573   LKVLDLGGAPLERIPEDLGNLLHLRYLSLRKTRVRMLPRSIGKLQNLQTLDLKYSLVEDL  632

Query  1453  PVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIE  1632
             PVEI +LQ L +++ + +   A L ++   G    +G+G L  L+KL  V+   G   I 
Sbjct  633   PVEINRLQKLCNILCFDYAYKADLRWDSVRGVHVKEGIGGLEDLQKLTAVDVTHGVQIIT  692

Query  1633  EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLL  1812
             E+GKL +L++L I KL   +G+ +C+SI  ++ L+ L++ S+ ED +LD+ Y+S+PPP L
Sbjct  693   ELGKLRQLRKLGITKLSRGNGQRLCASISNMVHLKYLSVCSLSEDEILDIQYMSNPPPFL  752

Query  1813  QRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHM  1992
               +YL G + ++P WI  L +LV++    S L +DP++  Q LP+L  L        E +
Sbjct  753   STVYLMGRLERLPDWISKLPSLVRVILTRSNLANDPMQVFQALPSLQALSLFQTSVVEQL  812

Query  1993  HFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRY  2172
              F A   Q L+ L +  L  L+ V I +G +P LE+L+I RC QL  +P+GI  L  L  
Sbjct  813   CFGATGIQKLKRLRIYDLIGLKRVKIEDGTLPLLEELMIGRCPQLEELPSGIRHLSKLTT  872

Query  2173  LEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYY  2274
             L FFD+ ++     + D+ G ++  V HI  +++
Sbjct  873   LTFFDLQEELRLGMIRDQ-GRNFEIVKHIPYIHF  905



>emb|CDP19587.1| unnamed protein product [Coffea canephora]
Length=960

 Score =   533 bits (1374),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 337/788 (43%), Positives = 491/788 (62%), Gaps = 31/788 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P+K LIS LLK DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAKLVGIDQPKKHLISQLLKGDDYQLKVVSVVGMGGLGKTTLVKKVHEDPEV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR-  360
             ++HF   AW+TVSQT   + +LKD+I+QL  E K+PVP+ + S+N  +LK  +K+FL + 
Sbjct  219   RRHFPVRAWVTVSQTCDFQYLLKDLIRQLHKEGKKPVPQSIESLNITELKEFIKDFLQQA  278

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y IVFDDVW    W  IK  LP+  HG R M++TR  DVAS+S  ++  ++Y M PLS
Sbjct  279   RRYAIVFDDVWDVEFWNTIKFALPESSHGNRVMLTTRRADVASASCIESRRFVYRMEPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F+  +CP HL ++ K I+ +C GLPLAI+AI G+LA+K+   I EW  
Sbjct  339   PEDSWTLFCNKIFNEGNCPGHLMDVAKGIVDKCEGLPLAIIAISGLLASKDANRIEEWEM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + ++ IL LS+ DLP +LK C +Y SIYPED+ I    LI  W  
Sbjct  399   VRCSLGGELEGTGKLDRIKKILSLSYGDLPWHLKTCLLYTSIYPEDYEIGGYELINLWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV  + G ++++VA GYL EL+NRSLI   ++  +G     RIHDL+RE+IL KS + 
Sbjct  459   ERFVGWREGMSIQDVAWGYLSELVNRSLIQVTRVFYEGLPYTCRIHDLFREVILLKSWEQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK------LRSLLTFNVTDS-QFS  1236
             N V     +   WP +K R L VH +  N     Q  +      LRS +T    +S  + 
Sbjct  519   NMVIVTTGQPTMWPSDKVRRLVVHSSSSNNTQHHQQRRNYCFDHLRSFITVGSMNSLLYK  578

Query  1237  SHVVQILSSCRVIKVLDLQST-SLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRML  1413
             + + ++L S +++KVL+L+   + E VP EIF L HL++L L  T+V+ +P++I KL+ L
Sbjct  579   TLLSEVLGSSKLLKVLNLRGQETQEEVPNEIFDLFHLKHLGLYGTRVERVPKAIGKLQHL  638

Query  1414  EILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCS-PGFKAPkglgklgslek  1590
             E LDL  T V +LP+E+LKL+ L+ L VY  V  + +  +C   GFKAP  +G L +LE 
Sbjct  639   EFLDLGNTRVRDLPMELLKLKKLQVLKVYQQVDTSDI--DCGYHGFKAPSSMGGLLALEI  696

Query  1591  lVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---E  1761
             L Y++A+ G+  I+EIGKL +L+ L I KLR EDGK +CSS+  L  L+ L++ SI   +
Sbjct  697   LSYIDASSGSIIIKEIGKLTQLRGLYITKLRREDGKELCSSLANLTSLQRLSVASIGKGD  756

Query  1762  EDVVLDVNY--------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--  1911
             +  ++D+N+         S     L+ L L G + KMP W+  L  L++I   WS+L+  
Sbjct  757   DHEIIDLNHHHPSLSSSSSLFLQSLRLLILRGRLEKMPQWVARLHGLLRIDLDWSRLRGE  816

Query  1912  DDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPH  2091
             +DPLE LQ LPNL  + F   Y GE + F A  F +L+ L+L ++E LR + + EGA+P 
Sbjct  817   EDPLESLQYLPNLGEINFCGSYQGEGLCFKAAGFLNLKWLHLKRMEGLRWMRVEEGALPR  876

Query  2092  LEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPD--KRGEDYCKVSHISE  2265
             L+ L +++   L  +P GI+ L +LR+L  ++ +       L +  +  E+Y +++HI E
Sbjct  877   LQTLSLRQLPLLEELPMGIQHLSHLRWLILYETSSQLREKLLENYKEESEEYRRIAHIPE  936

Query  2266  VYYTYWKD  2289
             +   Y+ D
Sbjct  937   ILIGYYAD  944



>ref|XP_009345009.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Pyrus 
x bretschneideri]
Length=945

 Score =   530 bits (1366),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 326/766 (43%), Positives = 474/766 (62%), Gaps = 11/766 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L +EE E+VGIE  R +L +LL+   P  +VISVVGMGG GKTTL K VYD+ 
Sbjct  159   HDPRVASLFIEEAEVVGIEPARAKLTNLLVGGAPRREVISVVGMGGIGKTTLAKKVYDNQ  218

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V   F  +AWI VSQT+KVE++L+ +I++L+   KQ +P+G+ +++   L    +E+L 
Sbjct  219   AVLYQFDCYAWIMVSQTYKVEDLLRTVIKRLYNSGKQNLPKGIDTIDKESLIRKSREYLQ  278

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++YV+VFDDVW    W AI+H LP  K G R MI+TR  DVA         +++ + PL
Sbjct  279   EKRYVVVFDDVWEVDFWGAIEHALPDNKGG-RIMITTRSQDVADFCKKSCFVHVHHLQPL  337

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
               E +W L CRKAF       CP  L ++ ++I+K+C GLPLAIV IGG+L+TK+K  ++
Sbjct  338   PPEKAWELFCRKAFQFELEGKCPPELEDMSREIVKKCEGLPLAIVCIGGLLSTKDKV-VD  396

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  LY+SL  + E N    SL  IL LS++ LP YLK C +Y  I+PED+ I    LI 
Sbjct  397   EWRKLYNSLSSELESNPHLTSLTRILSLSYHHLPYYLKSCVLYFGIFPEDYSISCVRLIR  456

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVK + GKT+EEV E YL ELI+RSL+   K+  +G  +  R+HDL RE++L K
Sbjct  457   LWIAEGFVKLQEGKTLEEVGEEYLTELIHRSLVQVSKVYMNGKARSCRVHDLLREVLLKK  516

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D +F   + ++ + +    R LS++ +          + +RS+ TFN  +    S + 
Sbjct  517   GGDSSFCHVLSKDKSTFKPTNRRLSINVSPSEVLGSITQSHIRSVFTFN-QEEWPESFLN  575

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              +  + +++KVLD     +  +P+ +  L  L YLSLR+TKV++LP SI  L+ LE LDL
Sbjct  576   TLRGNFQLLKVLDFMDAPINQLPKYVGDLYLLTYLSLRNTKVELLPDSIGNLKNLETLDL  635

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K + V E+P +I KL  LR L+VY          N   G K  +G+G L +L+KL +VEA
Sbjct  636   KQSLVYEIPAKINKLVKLRFLLVYYRNYSMRFCLNTERGVKIHEGIGCLQALQKLYHVEA  695

Query  1609  NPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             N G    I+E+GKL +L++L + KL+ EDG+A+C+SIEK+ +L SL+L +I ED VLD+ 
Sbjct  696   NHGGIKLIKELGKLRQLRKLGLKKLKREDGRALCASIEKMNRLESLDLSAISEDEVLDLE  755

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              +S+PP  ++ L L G + ++P WI +L++LV++   WS+L+D PL+ LQ+LPNL+ L  
Sbjct  756   SISTPPEFIRSLILKGRLEQLPSWISNLQHLVRLVIHWSRLRDSPLKALQNLPNLLELRL  815

Query  1966  -LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
               +GY G  +HF  G FQ LR+L L +++ L +++I  G MP L++  I  C QL  VP+
Sbjct  816   GQMGYDGVQLHFEEGGFQKLRVLLLKEMQGLNSLIIDNGVMPLLQEFYIGSCPQLKEVPS  875

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
             GI  L NLR L F DMT +      P+  G  Y  V HI +V + Y
Sbjct  876   GIHHLRNLRGLAFNDMTKELARQMDPNN-GPHYWIVKHIRQVCFCY  920



>ref|XP_008380436.1| PREDICTED: LOW QUALITY PROTEIN: disease resistance protein RPM1-like, 
partial [Malus domestica]
Length=584

 Score =   518 bits (1333),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 287/569 (50%), Positives = 386/569 (68%), Gaps = 14/569 (2%)
 Frame = +1

Query  652   LAIVAIGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCF  831
             LAIVA+ GVLATK+K  I+EW  + HSLG + EGND+ + L+ +L LSFNDLP YLK CF
Sbjct  1     LAIVAVSGVLATKDKRRIDEWDMVGHSLGAEMEGNDKLKDLKKVLSLSFNDLPYYLKSCF  60

Query  832   MYLSIYPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDD  1011
             +YLSI+PEDHLIEH  L+  W  EGF+++  GKT+E+VAE YL EL+NRS+I   +   D
Sbjct  61    LYLSIFPEDHLIEHMRLVRLWMAEGFIEETQGKTLEDVAEDYLNELLNRSMIQVAETTTD  120

Query  1012  GSMKQGRIHDLYREIILSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTK  1191
             G +K  R+HDL REII SK  D NF T   E+   WP+K R LS+H +L   Q  R  ++
Sbjct  121   GRVKSFRVHDLLREIITSKIRDQNFATIAKEQNMPWPDKVRRLSMHTSLQYIQKNRSASQ  180

Query  1192  LRSLLTFNVTDSQFSSHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTK  1371
             LRSL  F VT+      +       R++ VLDLQS  L + P E   L  L+YLSL+ T+
Sbjct  181   LRSLFMFGVTEKPLLQTIFP--GGFRLLSVLDLQSAPLNVFPVEAVNLFFLKYLSLKGTR  238

Query  1372  VKVLPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPY-------  1530
             VK +P+ I KL+ LE LDLK++ VTELPVEILKLQHLRHL+VY    + ++PY       
Sbjct  239   VKTIPKFIGKLQNLETLDLKHSLVTELPVEILKLQHLRHLLVYR---YEFVPYGDFHSKY  295

Query  1531  -NCSPGFKAPkglgklgsleklVYVEANPGNGTI-EEIGKLNELKRLCILKLRTEDGKAV  1704
              +   GFK    +G L  L+KL ++EAN   G I  E+GKL +L+RL I+ LR +DGKA+
Sbjct  296   GHSKYGFKVLAKIGALTCLQKLCFIEANQDGGAILRELGKLIQLRRLGIVHLRKQDGKAL  355

Query  1705  CSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVK  1884
             C SI+KL KL +L++ S+EED ++D+ ++SSPP LLQRLYL G +  +PHWI SL +LV+
Sbjct  356   CLSIDKLTKLCALSITSVEEDEIIDLQHISSPPLLLQRLYLRGRLETLPHWIPSLHSLVR  415

Query  1885  IYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnV  2064
             +Y +WS+LKD+PL  +Q LPNLVHLE    + G+ + F AG ++ L+ L +DK +ELR +
Sbjct  416   LYLKWSRLKDNPLVFIQHLPNLVHLELSQVFEGDTLCFGAGGYKKLKHLGIDKFDELRCI  475

Query  2065  VIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYC  2244
              + EGAMP +EKL IQRC  L  VP+GIE L  L+ LEFFDM +  I T  P ++G DY 
Sbjct  476   EVQEGAMPFIEKLSIQRCKSLEKVPSGIEHLNKLKVLEFFDMPETLIKTLSPHEQGNDYW  535

Query  2245  KVSHISEVYYTYWKDGCWEVNSVQETSSG  2331
             KV+HI EVY+TY ++  WEV +++  + G
Sbjct  536   KVAHIPEVYFTYLRESGWEVYTLEGFNEG  564



>emb|CDP11714.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   521 bits (1343),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 307/690 (44%), Positives = 434/690 (63%), Gaps = 15/690 (2%)
 Frame = +1

Query  244   VLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVIVFDDVWTARVWEAIKH  423
             +LKD+IQQL  E+++PVP+ +  M  N+L+  VK+FL  R+Y+IV DD+W+   WEAIK+
Sbjct  4     ILKDLIQQLHNEIREPVPQQVECMEGNQLRAFVKDFLQERRYIIVLDDIWSMNSWEAIKY  63

Query  424   VLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSWALLCRKAFHASSCPSH  603
              LP   +  R M++TR+ D+A  S  ++  YI+EM PL  E SW L C K F  + CP +
Sbjct  64    ALPNGSYSSRIMLTTRIADIAIGSCIESRDYIHEMKPLPVEESWNLFCSKTFGDNCCPQN  123

Query  604   LTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRII  783
             L ++ ++IL +C GLPLAIVAIGG+LA KNK  ++EW   + SLG + EG  + E ++ I
Sbjct  124   LEDVSRRILSKCKGLPLAIVAIGGLLALKNKGKLDEWEMTHRSLGGELEGIGKLEKVKNI  183

Query  784   LLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLF  963
             LLLS+NDLP +LK C +Y+SIYPED  I+   +I +W  EGF+  K G T  EVA GYL 
Sbjct  184   LLLSYNDLPFFLKSCLLYISIYPEDQKIDPELVIPRWIAEGFIHGKKGMTTTEVALGYLN  243

Query  964   ELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFV---TTIDEETAAWPEKAR  1134
             EL+NRSLI   +   DGS++  R+HD+ REIIL+KS + NFV   ++   + A  P+K R
Sbjct  244   ELVNRSLIQVAEFYRDGSIRYCRVHDILREIILTKSREQNFVNVASSCSRDCARLPDKPR  303

Query  1135  HLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSC-RVIKVLDLQSTSLEI  1311
              L++HG   N Q  ++   LRSL+ F  TD  F+S + +ILS   ++++VL L+   L  
Sbjct  304   RLAIHGYNENHQECKRFRHLRSLVIFGYTDPLFNSSLSKILSGGPKMLEVLHLEGAKLTN  363

Query  1312  VPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHL  1491
             +P+E+FQL  L++L+LR T V+++P  I KL  LE L+L  T V ELPV IL+L+ LR L
Sbjct  364   IPKEVFQLFRLKFLNLRDTGVQIIPPCIGKLHNLEYLNLIGTKVRELPVGILQLRKLRIL  423

Query  1492  IVYSHVS--FAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIEEIGKLNELKRL  1665
             +VY H+   FA        G K P  +  L  LE L  ++A+     + EIGKL +L++L
Sbjct  424   LVY-HIGKDFALC------GVKPPSQIANLLFLEILHSIDADHDKTLVMEIGKLTQLRKL  476

Query  1666  CILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPP-LLQRLYLSGYMG  1842
              I KLR  DG  +CSS+ KL  LR L + SI+ED  LD+ +  SP P  LQ L L G + 
Sbjct  477   GISKLRKIDGAILCSSLGKLTNLRQLCVNSIKEDDTLDLLHPISPTPRALQVLELGGRLE  536

Query  1843  KMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSl  2022
              +P W+ SL+NL  I    S+L+ D LE LQ LPNLV +     Y GE ++F AG FQ L
Sbjct  537   MIPPWVASLQNLTTIQLFGSRLRHDLLESLQSLPNLVDVSLNNAYEGEELYFMAGGFQKL  596

Query  2023  rllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDF  2202
             + L L +L++L+ V +G+ AMP L KLV+  C  +  +P GI+ L  L+ L   DM+++ 
Sbjct  597   KRLELTRLQKLKCVRVGDRAMPCLHKLVMAECKLVEKLPWGIQNLNELKSLGLADMSNEL  656

Query  2203  ISTFLPDKRGEDYCKVSHISEVYYTYWKDG  2292
             I   L DK  E+Y K++ +SEV    WKDG
Sbjct  657   IVK-LQDKGSEEYQKIALVSEVVIANWKDG  685



>emb|CDP12967.1| unnamed protein product [Coffea canephora]
Length=947

 Score =   530 bits (1364),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 341/793 (43%), Positives = 486/793 (61%), Gaps = 35/793 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P+K LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAKLVGIDQPKKRLISQLLEEDDYQLKVVSVVGMGGLGKTTLVKKVHEDLEV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   AW+TVSQT   +++LKD+I+QL  E K+PVP+ + S+N  +LK  +K+FL + 
Sbjct  219   RRHFPVRAWVTVSQTCDFQDLLKDLIRQLHKEGKKPVPQSIESLNTTELKEFIKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  HG R M++TR  DVAS+  T++ GYI+ M PL 
Sbjct  279   GRYAIVFDDVWDVEFWNTIKFALPESSHGNRVMLTTRKADVASAPCTESLGYIHRMEPLP  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  +SCP HL ++ K IL +C GLPLAI+AI G+ A K+     EW  
Sbjct  339   FEDSWTLFCNKIFKGNSCPGHLMDVAKVILDKCEGLPLAILAISGLFALKDVNRTEEWEM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + ++ IL LS+++LP +LK C +Y SIYPEDH IE   L+  W  
Sbjct  399   VRCSLGSELEGTGKLDRVKKILSLSYSELPWHLKTCLLYTSIYPEDHKIECYRLVNLWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+V   YL EL+NRSLI    +  +G     RIHDL RE+IL KS + 
Sbjct  459   ERFVEGREGMSIEDVVWSYLSELVNRSLIQVTGVFYEGLPDYCRIHDLLREVILLKSREQ  518

Query  1081  NFVTTI-DEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV-QI  1254
             N VT I  + T +     +H   H  + N         LRS +T   T+   S  ++ ++
Sbjct  519   NMVTVITGQPTISSSNNTQH---HQQIPNYCFDH----LRSFVTIGCTNPLLSKPLLSEV  571

Query  1255  LSSCRVIKVLDL--QSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
             L S +++KVLDL  Q T  EI P EIF++ HL++LSL  T V  +P++I KL+ LE L+L
Sbjct  572   LGSSKLLKVLDLGDQETQEEI-PNEIFKMFHLQHLSLGDTGVGRVPKAIGKLQHLEHLNL  630

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
               T V ELP+EILKL+ LR L V+  V  + + Y    GFKAP  +G L +LE L  ++A
Sbjct  631   GNTRVRELPMEILKLKKLRFLRVFQQVDSSDVDYGYH-GFKAPSNMGGLLALEVLDSIDA  689

Query  1609  NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EEDVVLD  1779
             + G+  ++EIGKL +L+ L I KLR EDGK +CSS+  L  LR L++ SI   ++  ++D
Sbjct  690   SSGSTIVKEIGKLTQLRELYITKLRREDGKELCSSLANLTNLRELSVTSIGKGDDHEIID  749

Query  1780  VNYLSSP----------PPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDD--PL  1923
             +N+   P             L+ L L G + +MP WI  L  LV+I   WS+L+++  PL
Sbjct  750   LNHHHHPSLSSSSSSSFLQSLRMLILRGRLERMPKWIVHLHGLVRIDLDWSRLREEENPL  809

Query  1924  EHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKL  2103
             E LQ LPNL  + F   Y GE + F A  F  L+ L L ++E LR + + EGA+P L+KL
Sbjct  810   ESLQHLPNLGEINFCGSYQGEGLCFKAEGFLKLKCLELRRMEGLRWMRVEEGALPRLQKL  869

Query  2104  VIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDK--RGEDYCKVSHISEVYYT  2277
              +++   L  +P GI+ L  L+ L  ++M+       L ++  + EDY +++HI E+   
Sbjct  870   FLEQLPLLEELPMGIQHLTQLQELSLYEMSCQLSEKLLENQKEKSEDYTRIAHIPEILIG  929

Query  2278  YW-KDGCWEVNSV  2313
             Y+  DG W  +S+
Sbjct  930   YYTDDGEWRHHSL  942



>ref|XP_009345010.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Pyrus 
x bretschneideri]
Length=945

 Score =   529 bits (1363),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 326/766 (43%), Positives = 474/766 (62%), Gaps = 11/766 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L +EE E+VGIE  R +L +LL+   P  +VISVVGMGG GKTTL K VYD+ 
Sbjct  159   HDPRVASLFIEEAEVVGIEPARAKLTNLLVGGAPRREVISVVGMGGIGKTTLAKKVYDNQ  218

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V   F  +AWI VSQT+KVE++L+ +I++L+   KQ +P+G+ +++   L    +E+L 
Sbjct  219   AVLYQFDCYAWIMVSQTYKVEDLLRTVIKRLYNSGKQNLPKGIDTIDKESLIRKSREYLQ  278

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++YV+VFDDVW    W AI+H LP  K G R MI+TR  DVA         +++ + PL
Sbjct  279   EKRYVVVFDDVWEVDFWGAIEHALPDNKGG-RIMITTRSQDVADFCKKSCFVHVHHLQPL  337

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
               E +W L CRKAF       CP  L ++ ++I+K+C GLPLAIV IGG+L+TK+K  ++
Sbjct  338   PPEKAWELFCRKAFQFELEGKCPPELEDMSREIVKKCEGLPLAIVCIGGLLSTKDKV-VD  396

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  LY+SL  + E N    SL  IL LS++ LP YLK C +Y  I+PED+ I    LI 
Sbjct  397   EWRKLYNSLSSELESNPHLTSLTRILSLSYHHLPYYLKSCVLYFGIFPEDYSISCVRLIR  456

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVK + GKT+EEV E YL ELI+RSL+   K+  +G  +  R+HDL RE++L K
Sbjct  457   LWIAEGFVKLQEGKTLEEVGEEYLTELIHRSLVQVSKVYMNGKARSCRVHDLLREVLLKK  516

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D +F   + ++ + +    R LS++ +          + +RS+ TFN  +    S + 
Sbjct  517   GGDSSFCHVLSKDKSTFKPTNRRLSINVSPSEVLGSITQSHIRSVFTFN-QEEWPESFLN  575

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              +  + +++KVLD     +  +P+ +  L  L YLSLR+TKV++LP SI  L+ LE LDL
Sbjct  576   TLRGNFQLLKVLDFMDAPINQLPKYVGDLYLLTYLSLRNTKVELLPDSIGNLKNLETLDL  635

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K + V E+P +I KL  LR L+VY          N   G K  +G+G L +L+KL +VEA
Sbjct  636   KQSLVYEIPAKINKLVKLRFLLVYYRNYSMRFCLNRERGVKIHEGIGCLQALQKLYHVEA  695

Query  1609  NPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             N G    I+E+GKL +L++L + KL+ EDG+A+C+SIEK+ +L SL+L +I ED VLD+ 
Sbjct  696   NHGGIKLIKELGKLRQLRKLGLKKLKREDGRALCASIEKMNRLESLDLSAISEDEVLDLE  755

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              +S+PP  ++ L L G + ++P WI +L++LV++   WS+L+D PL+ LQ+LPNL+ L  
Sbjct  756   SISTPPEFIRSLILKGRLEQLPSWISNLQHLVRLVIHWSRLRDSPLKALQNLPNLLELRL  815

Query  1966  -LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
               +GY G  +HF  G FQ LR+L L +++ L +++I  G MP L++  I  C QL  VP+
Sbjct  816   GQMGYDGVQLHFEEGGFQKLRVLLLKEMQGLNSLIIDNGVMPLLQEFYIGSCPQLKEVPS  875

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
             GI  L NLR L F DMT +      P+  G  Y  V HI +V + Y
Sbjct  876   GIHHLRNLRGLAFNDMTKELARQMDPNN-GPHYWIVKHIRQVCFCY  920



>emb|CDP13423.1| unnamed protein product [Coffea canephora]
Length=916

 Score =   528 bits (1359),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 335/781 (43%), Positives = 476/781 (61%), Gaps = 29/781 (4%)
 Frame = +1

Query  1     ANDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD  180
             AN    DA+L+ ++ +V I+ P++ELIS LL  D  LKVISV+GM G GKTTLVK V++D
Sbjct  145   ANTWWDDAILVGKERLVAIQQPKQELISQLLDGDSNLKVISVLGMQGLGKTTLVKKVHED  204

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               V+K FQ  AWITVSQT  ++E+L+D+I+Q+  ++K+P+   + S+   +LK  V + L
Sbjct  205   GDVRKQFQITAWITVSQTRSIKELLQDLIRQIVNQIKRPINYAVESIT--ELKSSVTKLL  262

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
             L ++Y IVFDDV    +W +IK  LP   +G R MI+T+L  VA +SS ++ GY+YEM P
Sbjct  263   LGKRYGIVFDDVCDMGIWNSIKSALPDSGNGSRVMITTQLPHVAQASSPESQGYVYEMKP  322

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLAT--KNKTNIN  708
             LS E SW L C K F  S CP HL  I+  IL +C GLPLAI AI GVLA+  K+K   +
Sbjct  323   LSFEDSWTLFCDKTFQQSYCPMHLKAIVHDILSKCRGLPLAIAAIAGVLASKDKDKDKAD  382

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             +W  +  SL  + E   + + ++ ILLLS+ DLP +LK C +Y+SI+PED+ I+ + LI 
Sbjct  383   QWEIVRDSLAGEEEKTGEQDMVKKILLLSYKDLPSHLKTCLLYISIFPEDYEIQCHRLIQ  442

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFV+ + G T EEVA  YL ELI RSL+   +++ DGS    RIHDL RE IL K
Sbjct  443   LWIAEGFVQDRGGMTAEEVAFDYLKELIRRSLVRVTEVSWDGSPDHCRIHDLMREFILRK  502

Query  1069  STDHNFVTTID-EETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHV  1245
             S + N +T    + T    EK   L ++ +L   Q       LRSL+T   T+    S +
Sbjct  503   SQEQNMITLASLQHTRGPSEKVHRLVINNSL--TQRSNYLKHLRSLITLTNTEPTLLSEL  560

Query  1246  VQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILD  1425
             +       +      +   LE +P E+F+L HLR+L LR T+VK +P+SIKKL+ LE L 
Sbjct  561   LLSKLLKLLDL----RDVQLEEIPNEVFKLFHLRFLCLRGTRVKKVPKSIKKLKNLEHLH  616

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVE  1605
             L  T V ELP+++LKL+ LRHL V+  V  +   Y C  GFKAP  +G+L SL  L++++
Sbjct  617   LGQTNVRELPIQVLKLKKLRHLRVFQVVDSSDANYECY-GFKAPSKIGELLSLHTLLFID  675

Query  1606  A-NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
             A N     + EIGKL +L+ L I KLR +DG+ +CSS++KL  LR LN+ +I +D V+D+
Sbjct  676   AQNDEETVVGEIGKLLQLRELGITKLRRQDGEELCSSLKKLTNLRELNVTAITKDEVIDI  735

Query  1783  NYLSSPPP--LLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK-DDPLEHLQDLPNLV  1953
             ++   P    LL+ L L   + K+P WI SL +L+KI   WS+L+ DDPLE LQ LP+LV
Sbjct  736   DHALPPSSLQLLRGLILRARLEKLPRWINSLHSLMKIDLIWSRLRGDDPLESLQRLPSLV  795

Query  1954  HLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
              +     Y GE ++F+AG F  L  L L  ++ L+ +++G GAMP L++L +    QL  
Sbjct  796   EVRLSQAYEGEELYFSAGAFLKLETLYLGDMQGLKWIMVGNGAMPQLQQLYMSELPQLEE  855

Query  2134  VPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDY------CKVSHISEVYYTYWKDGC  2295
             +P GI+ L  L+ L       D +S+ L +K    Y        ++HI EV   +  DG 
Sbjct  856   LPLGIQHLRKLQSLHL-----DDVSSKLTEKLKNPYDVTGVRGNIAHIREVVIGFRADGE  910

Query  2296  W  2298
             W
Sbjct  911   W  911



>gb|EYU19236.1| hypothetical protein MIMGU_mgv1a021128mg [Erythranthe guttata]
Length=944

 Score =   528 bits (1361),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 332/755 (44%), Positives = 474/755 (63%), Gaps = 32/755 (4%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPT---LKVISVVGMGGSGKTTLVKMVYD  177
             D R DALLLEE E+VGIE P+K+LI  L     T   LKVISVVG GG GKTTLV+ VY+
Sbjct  154   DGRGDALLLEEAEVVGIEKPKKQLIEWLSSTGRTRGGLKVISVVGTGGLGKTTLVRKVYE  213

Query  178   D---VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKE  348
             D   VK  F  H W+ VS +FK++  L+ MI++L  E+KQP P+G+ +M+A+++K  V +
Sbjct  214   DDASVKTLFSCHVWMNVSSSFKLDVFLRTMIRRLVGEVKQPPPQGLETMDADEMKEFVYK  273

Query  349   FLLRRKYVIVFDDVWTARVWEAIKHVLPKE-KHGCRAMISTRLMDVASSSSTDTNGYIYE  525
             FL  R Y+IV DD+W    WEAI++  P+    G   +I+TR   ++ ++S ++NG++Y 
Sbjct  274   FLQSRSYIIVLDDIWRLDAWEAIRYAFPRSGTRGSIIIITTRFQSISHTASIESNGHVYS  333

Query  526   MTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNI  705
             M PLS+E S  L CRKAF  SSCPS+L EI   IL +C GLPLAIV IG +LATKN  NI
Sbjct  334   MEPLSQEESKTLFCRKAFLGSSCPSYLEEIAGIILNKCEGLPLAIVVIGSLLATKN-NNI  392

Query  706   NEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLI  885
              EW   + SLG + EGN     +  +L LS+ DLP YLK CF+YLSI+P D  +    LI
Sbjct  393   EEWRKFHRSLGDELEGN-HLRGMTRLLSLSYYDLPYYLKSCFLYLSIFPGDRSVYMLRLI  451

Query  886   YQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLI-LPVKLNDDGSMKQGRIHDLYREIIL  1062
               W  EGF++ K GKT+EEVAE Y+ EL NRSLI L    N D S++  R+HDL   +I+
Sbjct  452   RLWISEGFIQPKEGKTLEEVAEDYVKELFNRSLIQLEETPNYDRSIRV-RVHDLLHTMII  510

Query  1063  SKSTDHNFVTTID-EETAAWP-EKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFS  1236
             SKS +  FVT  +  +   WP  K R +++HG++ +    +    LRS+L  +  ++  +
Sbjct  511   SKSREQGFVTIANSSQDTQWPANKIRRVAIHGSIEDMAGIKGCQHLRSVLVLDNVNTLTA  570

Query  1237  SHVVQILSS-CRVIKVLDLQST-SLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRM  1410
               +   L +  +++KVL+L+ T S   +P+E+F+  HL+YL L+ +KVK +PR I KL  
Sbjct  571   ITLSDFLRNLSKLLKVLELRGTLSSGKIPDEVFKFYHLKYLGLKYSKVKSIPRLIGKLEN  630

Query  1411  LEILDLKYTFVTELPVEILKLQHLRHLIVYSHV--SFAYLPYNCSPGFKAPkglgklgsl  1584
             LE LDL+ T VTELPVEILKL  LRHL+VY+    +  Y P++     + P  +G L SL
Sbjct  631   LETLDLRNTQVTELPVEILKLGRLRHLMVYNLYIRNRGYHPFDDVHSCRIPYRIGSLSSL  690

Query  1585  eklVYVEANPGN---GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlks  1755
             + L  ++A   +     ++EIGKL +LK L ++KLR EDGK +C+S+ KL +L +L++ S
Sbjct  691   QTLSDIDATRADVDTTVVKEIGKLTQLKELGVMKLRQEDGKDLCTSLAKLTRLETLHIAS  750

Query  1756  IEEDVVLD-VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK---DDPL  1923
              +ED VLD ++ +S  PP+         +            L ++  RWS+++   DDPL
Sbjct  751   SQEDEVLDLLDPVSPTPPIRSLELRGRLLLLH--------GLTRLLLRWSRIENNDDDPL  802

Query  1924  EHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKL  2103
             EHLQ+LPNL++LE    Y G+ + F A  FQ L+ L L +LE L +V + EG+MP L +L
Sbjct  803   EHLQNLPNLMYLELSHAYQGDGICFKAAGFQRLKKLWLIRLEGLESVKVEEGSMPVLREL  862

Query  2104  VIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFIS  2208
              I  C  +   P+GIE L +L+Y++F DM+D F++
Sbjct  863   YIWGCKLVGEAPSGIEHLSDLQYVDFSDMSDGFVA  897



>ref|XP_008376467.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
Length=945

 Score =   528 bits (1359),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 324/766 (42%), Positives = 471/766 (61%), Gaps = 11/766 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L +EE E+VGIE+ RKEL  LL+   P  +VISVVGMGG GKTTL   VYD+ 
Sbjct  159   HDPRVASLFIEEAEVVGIESARKELTDLLVGGAPRREVISVVGMGGLGKTTLANKVYDNH  218

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V   F  +AW+TVSQT+KVE++L+ +++   +  K+  PEG+ +M+   L    +E+L 
Sbjct  219   AVLDQFDCYAWVTVSQTYKVEDLLRTVVKMFCSSRKENFPEGIDTMDEKSLIRKSREYLQ  278

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YV+ FDDVW    W AI+H LP  K G R MI+TR  DVA         +++ + PL
Sbjct  279   QKRYVVAFDDVWRVDFWGAIEHALPDNKGG-RIMITTRSQDVAHFCKKSCFVHVHHLQPL  337

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
                 +W L C+K F      +CP  L ++  +I+++CGGLPLAIV IGG+L+TK K  ++
Sbjct  338   PPNKAWELFCKKVFQFELEGNCPPELKDMSLEIVRKCGGLPLAIVCIGGLLSTKVKV-VH  396

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  LY+SL  + + N    SL  IL LS++ LP YLK C +Y  I+PED+ I    LI 
Sbjct  397   EWQKLYNSLSSELDSNPHLTSLTRILSLSYHHLPYYLKSCVLYFGIFPEDYSINCVRLIR  456

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVK K GKT+EEV E YL ELI+RSL+   ++  DG  ++ R+HDL RE++L K
Sbjct  457   LWIAEGFVKLKKGKTLEEVGEEYLTELIHRSLVQVSEVYIDGKARECRVHDLLREVLLKK  516

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D  F   + ++ +A+  K R LS+  +  +A      + +RS+ TFN  +    S + 
Sbjct  517   CVDSCFCHVLSKDESAFKPKTRRLSMAISPSDALGSITESHIRSVFTFN-QEEWPESFLN  575

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              +  + +++KVLD     +  +P+ +  L  L YLSLR+TKV++LP SI  L+ LE LDL
Sbjct  576   TLRGNFKLLKVLDFMDAPINQLPKYVGDLHLLTYLSLRNTKVELLPDSIGNLQNLETLDL  635

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K + V E+P +I KL  LRHL+ Y          N   G K  +G+G L +L+KL YVEA
Sbjct  636   KQSLVYEIPAKINKLVKLRHLLAYYRDYSMEFGVNFGRGVKIHEGIGCLQALQKLYYVEA  695

Query  1609  NPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             N G    I+E+G L +L++L + KL+ EDG+A+C++IEK+  L SL+L +I ED VLD+ 
Sbjct  696   NHGGIKLIKELGNLRQLRKLGLKKLKREDGRALCAAIEKMNHLESLDLTAISEDEVLDLE  755

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              +S+PP L++ LYL G + ++P WI +L+ LV++   WS+L+D PL+ L++LPNL+ L  
Sbjct  756   SISTPPELIRSLYLKGRLEQLPSWISNLQQLVRLGIYWSRLRDSPLKALKNLPNLMELRL  815

Query  1966  -LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
               +GY GE +HF  G FQ LR L L+ +E L +++I    MP L++  I RC QL  VP+
Sbjct  816   GQMGYDGEQLHFEEGGFQKLRTLELEDMEGLNSLIIDNRVMPLLQEFYIDRCPQLKEVPS  875

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
             GI  L NLR L  + M  +F     P+  G  +  V HI +V + Y
Sbjct  876   GIHHLRNLRDLWIYGMPKEFARHMDPNN-GPHFWIVKHIRKVCFCY  920



>ref|XP_011012867.1| PREDICTED: disease resistance protein RPM1-like [Populus euphratica]
Length=917

 Score =   527 bits (1357),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 324/773 (42%), Positives = 459/773 (59%), Gaps = 20/773 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DAL L+E ++VGIENP+  L+S L++ +  L  ISVVGMGG GKTTLVK VYD  
Sbjct  151   HDPRLDALYLDEADVVGIENPKHLLVSWLVEGEEKLSSISVVGMGGLGKTTLVKKVYDSH  210

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              +++ F +H+W+TVS++F   E+L+  +Q       +PVP  + SM   +L   ++ +L 
Sbjct  211   PIRRSFDTHSWVTVSKSFASTELLRVALQGFLVTANEPVPANLQSMTDLQLIDALRNYLW  270

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR +VIV DDVWT   WE IK+  P    G R + +TRL ++A S   +   ++YE+  L
Sbjct  271   RRTFVIVLDDVWTVNAWETIKYAFPDCNCGSRIIFTTRLSNLAES--IENTSHVYELQAL  328

Query  538   SEEVSWALLCRKAF---HASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
              E  +W L C KAF   H + CP  L E+ + IL++C GLPLAIVAIGG+L+ K    + 
Sbjct  329   PENEAWTLFCMKAFRGEHKAVCPPELEEMSRNILRKCEGLPLAIVAIGGLLSKKKNEGL-  387

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  ++  L  + + N+   SLR IL LS++DLP YLK C++YLS++PED+LI+   LI 
Sbjct  388   EWKKVHDCLATELKSNNDLGSLRRILQLSYDDLPYYLKQCYLYLSVFPEDYLIKRMKLIR  447

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              WT+E FV++K G T EEVAE YL EL+NRSLI  V++N    +K  R+HDL REII  K
Sbjct  448   LWTVERFVEEKQGFTKEEVAEEYLNELVNRSLIQVVEMNYFNRVKTCRVHDLMREIIQMK  507

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
             S + +FV   +    +  EK R LS+H      Q     + +R    +++          
Sbjct  508   SREESFVMIANGARISKNEKVRRLSIHENSEEVQ-----SDMRFPYLWSLLSFSSHHSFE  562

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
                 + ++++VL+L    L     E+ +L+HLRYLSLR T +  LP SI+KL+ LEILDL
Sbjct  563   HSFRNYKLLRVLNLDRAPLSSFLPELVELIHLRYLSLRWTMISELPESIRKLKYLEILDL  622

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSP---GFKAPkglgklgsleklVY  1599
             K TFV+ LP  I +L  L  L  Y H   ++ P +  P   G + P G+G+L SL+KL  
Sbjct  623   KRTFVSSLPAGITQLTCLCQLRNYRH---SFQPSSFFPDTHGMRVPSGIGRLTSLQKLGS  679

Query  1600  VEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             VE N     + E+GKL  L+RL ILKLR E G  +C ++++L  L +L L S+ +   L 
Sbjct  680   VEVNEDYELVRELGKLTSLRRLGILKLREEQGMDLCYTLDRLKHLTALYLVSLNKTESLQ  739

Query  1780  VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHL  1959
              + LSSPP  LQRLYL   +  +P WI SL+ + K+  ++S LK DPL+ LQ LP+LV L
Sbjct  740   FDSLSSPPKYLQRLYLKCSLPALPEWIPSLQYISKLVLQYSNLKSDPLKALQKLPSLVLL  799

Query  1960  EFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVP  2139
             E    Y GE +  +   F  L+ L L +L  LR + I +G+MP LE+L I  C  L +VP
Sbjct  800   ELRQAYAGEELCCDPSGFSKLKRLGLHELGRLRRIRIAKGSMPGLERLDITACTVLETVP  859

Query  2140  AGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCW  2298
              GIE L N+  L  + M   FI T +   RGED+ +V H++ +   Y   G W
Sbjct  860   DGIENLKNIEDLVLWHMPPTFIKT-IERYRGEDFWRVQHVTTITRIYENQGRW  911



>ref|XP_008376413.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
Length=1009

 Score =   529 bits (1363),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 321/770 (42%), Positives = 470/770 (61%), Gaps = 15/770 (2%)
 Frame = +1

Query  1     ANDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD  180
             +ND R  +L ++E EIVGIE+ R EL  LL++     +VISVVGMGG GKTTL K VYD 
Sbjct  216   SNDPRVASLFIKEAEIVGIESARDELTRLLVEGATRREVISVVGMGGLGKTTLAKKVYDQ  275

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               V  HF  +AWITVSQ+++VE++L+ +I++ ++  K+  PE + +M+   L    +E+L
Sbjct  276   PKVMAHFDCYAWITVSQSYRVEDLLRTVIKKFYSSRKERFPEEIDTMDEESLISTSREYL  335

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
              +++Y++VFDDVW    W AI+H LP +  G R +I+TR+ DVA+        +++ +  
Sbjct  336   QQKRYIVVFDDVWKVDFWGAIEHALP-DNEGGRIIITTRIQDVANFCKRSCFVHVHHLQH  394

Query  535   LSEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNI  705
             L    +W L CRKAF       CP  L E+   I+KRC GLPLAIV++GG+L+TK K  +
Sbjct  395   LPPNKAWKLFCRKAFQFELEGKCPEELEELSLNIVKRCEGLPLAIVSVGGLLSTKAKV-V  453

Query  706   NEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLI  885
             +EW  LY+SL  + E N    SL  IL LS++ LP YLK C +Y  I+PED+ +    L+
Sbjct  454   SEWQKLYNSLSSELESNPHLTSLTRILSLSYHHLPYYLKSCVLYFGIFPEDYSVSCIRLV  513

Query  886   YQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILS  1065
               W  EGFVK K GKT+EEV E YL ELI+RSL+   ++  DG  +  R+HDL  +++L 
Sbjct  514   RLWIAEGFVKPKMGKTLEEVGEEYLMELIHRSLVQVSEVYIDGKARGCRVHDLLHDVLLK  573

Query  1066  KSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHV  1245
             K  D +F   + +    +    R LS+      A        +RS+ TFN+ +    S +
Sbjct  574   KGLDSSFCHVLSKGKLTFKPTTRRLSMDINPSEALESITQFHIRSVFTFNLEEWP-ESFL  632

Query  1246  VQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILD  1425
               +  + +++KVLD  +  +  +P+ +  L  L YLSLR+TKVK+LP SI  L+ LE LD
Sbjct  633   DTLSGNFKLLKVLDFTAAPINQLPKYVGDLYLLTYLSLRNTKVKLLPDSIGNLQNLETLD  692

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAY---LPYNCSPGFKAPkglgklgsleklV  1596
             LK + V E+P +I KL  LRHL+ Y H+ + Y   L  N   G K  +G+G L +L+KL 
Sbjct  693   LKQSLVYEIPAKINKLVKLRHLLAY-HLDYNYDLGLFLNXEKGVKIHEGIGCLQALQKLS  751

Query  1597  YVEANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVV  1773
             +VE N G    I+E+GKL +L++L +  L++EDG+AVC+SIEK+  L SL L +I ED V
Sbjct  752   HVEVNHGGIRJIKELGKLRQLRKLGLKNLKSEDGRAVCASIEKMNHLESLILTAINEDEV  811

Query  1774  LDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLV  1953
             LD+  +S+PP  ++ L+L G + ++P WI +L++LV+I   WS+L+D PL+ LQ+LPNL+
Sbjct  812   LDLESISTPPQFIRALFLIGRLEQLPGWISNLQHLVRIGIFWSRLRDSPLKALQNLPNLL  871

Query  1954  HLEFLV-GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLA  2130
              L   +  Y G  +HF  G FQ LR L+L ++  L  ++  +  MP L++  I    QL 
Sbjct  872   ELTLGINAYDGVQLHFEEGGFQKLRTLHLREMMGLNLLITDDDVMPLLQEFHIGPSPQLK  931

Query  2131  SVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
              VP+GI+ L NL YL F+DM  +F     P K G+ Y  V HI  V + Y
Sbjct  932   EVPSGIQHLRNLTYLYFYDMPKEFARQMDP-KNGQHYWIVEHIQNVRFGY  980



>ref|XP_009346946.1| PREDICTED: disease resistance protein RPM1-like [Pyrus x bretschneideri]
Length=945

 Score =   527 bits (1357),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 326/766 (43%), Positives = 471/766 (61%), Gaps = 11/766 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L +EE E+VGIE  R +L +LL+   P  +VISVVGMGG GKTTL K VYD+ 
Sbjct  159   HDPRVASLFIEEAEVVGIEPARAKLTNLLVGGAPRREVISVVGMGGLGKTTLAKKVYDNQ  218

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V   F  +AWI VSQT+KVE++L+ +I++L+   KQ +PEG+ +M+   L    +E+L 
Sbjct  219   AVLYQFDCYAWIMVSQTYKVEDLLRTVIKRLYNSGKQNLPEGIDTMDKESLIRKSREYLQ  278

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++YV+VFDDVW    W AI+H LP  K G R MI+TR  DVA         +++ + P+
Sbjct  279   EKRYVVVFDDVWEVDFWGAIEHALPDNKGG-RIMITTRSQDVADFCKKSCFVHVHHLQPM  337

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
               E +W L CRKAF       CP  L ++ ++I+K+C GLPLAIV IGG+L+TK+K  ++
Sbjct  338   PPEKAWELFCRKAFQFELEGKCPPELEDMSREIVKKCEGLPLAIVCIGGLLSTKDKV-VD  396

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  LY+SL  + E N    SL  IL LS++ LP YLK C +Y  I+PED+ I    LI 
Sbjct  397   EWRKLYNSLSSELESNPHLTSLTRILSLSYHHLPYYLKSCVLYFGIFPEDYSISCVRLIR  456

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVK + GKT+EEV E YL ELI+RSL+   ++  +G  +  R+HDL RE++L K
Sbjct  457   LWIAEGFVKLQEGKTLEEVGEEYLTELIHRSLVQMSEVYMNGKARSCRVHDLLREVLLKK  516

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D +F   + ++ + +    R LS++ +          + +RS+ TFN  +    S + 
Sbjct  517   GGDSSFFHVLSKDKSTFKPTNRRLSINVSPSEVLGSITQSHIRSVFTFN-QEEWPESFLN  575

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              +  + +++KVLD     +  +P+ +  L  L YLSLR+TKV++LP SI  L+ LE LDL
Sbjct  576   TLRGNFQLLKVLDFMDAPINQLPKYVGDLYLLTYLSLRNTKVELLPDSIGNLKNLETLDL  635

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K + V E+P +I KL  LR L+VY          N   G K  +G+G L +L+KL +VEA
Sbjct  636   KQSLVYEIPAKINKLVKLRFLLVYYRNYSMRFCLNRERGVKIHEGIGCLQALQKLYHVEA  695

Query  1609  NPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             N G    I+E+ KL +L++L + KL+ EDG+A+C+SIEK+ +L SL L +I ED VLD+ 
Sbjct  696   NHGGIKLIKELAKLRQLRKLGLKKLKREDGRALCASIEKMNRLESLELSAISEDEVLDLE  755

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              +S+PP  ++ L L G + ++P WI +L++LV++   WS+L+D PL+ LQ+LPNL+ L  
Sbjct  756   SISTPPECIRSLGLKGRLEQLPSWISNLQHLVRMVIHWSRLRDSPLKALQNLPNLLELRL  815

Query  1966  -LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
               +GY G  +HF  G FQ LR L L K++ L +++I  G MP L++  I  C QL  VP+
Sbjct  816   GQMGYDGVQLHFEEGGFQKLRFLRLRKMQGLNSLIIDNGVMPLLQEFYIGPCPQLKEVPS  875

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
             GI  L NLR L F DMT +      P+  G  Y  V HI +V + Y
Sbjct  876   GIHHLRNLRGLAFNDMTKELARQMDPNN-GPHYWIVKHIRQVRFCY  920



>emb|CDP19404.1| unnamed protein product [Coffea canephora]
Length=957

 Score =   526 bits (1354),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 339/792 (43%), Positives = 481/792 (61%), Gaps = 33/792 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DA+L+EE E+VGI+ P+++L+S LL  D+  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDAILVEEAELVGIDKPKQQLVSQLLGGDESQLKVVSVVGMGGLGKTTLVKKVHEDLDV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   A++TVSQT   +E+LKD+ +QL  ELK+ VPE + +M A +LK  VK+FL + 
Sbjct  219   RRHFPVRAFVTVSQTCNFQELLKDLTRQLHNELKKAVPESIEAMTAIQLKQCVKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W AI+  LPK  +G R M++TR  DVA +S T +  Y+++M PLS
Sbjct  279   GRYAIVFDDVWDTEFWNAIRIALPKNGYGNRVMLTTRKADVAFASCTQSQDYVFKMVPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HLT+  K IL +C GLPLAI+AI G+LA K+     EW  
Sbjct  339   FEDSWTLFCNKIFKGNGCPAHLTDFAKGILGKCEGLPLAILAISGLLALKDLNIAEEWKM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG+   + +R +L LS+NDLP +LK C +YLSIYPED  I  + L+  WT 
Sbjct  399   VRCSLGGELEGSGMLDKVRKVLSLSYNDLPCHLKTCLLYLSIYPEDFEIGCHRLVQLWTA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E +V+++   T+E+V   YL EL NRSLI   +   +G     RIHDL RE+ILSKS + 
Sbjct  459   ERYVEKREEMTLEDVGYNYLKELANRSLIQVSESFYEGIPYSCRIHDLVREVILSKSREQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGT-----KLRSLLTFNVTDSQFSSH  1242
             N V     +   WP  K R L VH +  N Q  ++        LRS +     +   S +
Sbjct  519   NTVAITTGQYTRWPSSKVRRLVVHNS-NNTQQHQESQYYCFDHLRSFIAIESMNPLVSKN  577

Query  1243  VV-QILSSCRVIKVLDLQS-TSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
             ++ ++L S R++KVLDL+   +LE +P EIF L  LRYL+L  T +K +P+SI KL+ LE
Sbjct  578   LLPKVLRSGRLLKVLDLRGEKTLEEIPNEIFHLYRLRYLNLYGTGIKAIPKSIGKLQNLE  637

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              L+L  T V ELP+EILKLQ L+HL V+  V      Y    GF AP  LG L +L+ L 
Sbjct  638   YLNLSDTQVRELPMEILKLQKLQHLRVFKLVDPLDHNYGFR-GFMAPSKLGGLFALQSLF  696

Query  1597  YVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED---  1767
              ++A+  +  ++EIGKL EL+ L I  LR EDGK +CSS+  L  LR L + SI +D   
Sbjct  697   GIDASE-SIIVKEIGKLTELRELGISNLRREDGKELCSSLANLTSLRELTVSSIRKDDDD  755

Query  1768  -VVLDVNY-----------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK  1911
               V+++N+            SS    L+ L LSG + KMP WI  L++LV++   WS L 
Sbjct  756   YEVMNLNHHHQQHSNSSSVSSSFLVSLRMLVLSGRLEKMPWWIAHLQSLVRVDLNWSSLS  815

Query  1912  D--DPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAM  2085
             D  DPLE L  LPNL  ++F   Y GE + F AG F  L+ L L K+++LR + + EGA+
Sbjct  816   DEEDPLESLHHLPNLGAVQFCGSYQGEGLCFKAGGFLRLKTLYLKKIDKLRWMKMEEGAL  875

Query  2086  PHLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFL-PDKRGEDYCKVSHIS  2262
             P L+++ +     +  +P GIE L +L+ L  + ++       +  ++  EDY +++HI 
Sbjct  876   PSLQEITLVELPLMQELPWGIEHLSHLQKLRLYLLSSQLTRNLVDQNEESEDYTRIAHIP  935

Query  2263  EVYYTYWKDGCW  2298
             E+   +  +  W
Sbjct  936   EIVIGFLSNEGW  947



>ref|XP_010244175.1| PREDICTED: disease resistance protein RPM1-like [Nelumbo nucifera]
Length=964

 Score =   526 bits (1355),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 316/774 (41%), Positives = 468/774 (60%), Gaps = 22/774 (3%)
 Frame = +1

Query  22    ALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKHF  195
             +L +EE  +VGIE  R+EL+  LL ++P  +V++VVGMGG GKTTLVK VYDD  V +HF
Sbjct  160   SLFIEETNLVGIEQRREELVGWLLDEEPDRRVLAVVGMGGLGKTTLVKKVYDDRRVNEHF  219

Query  196   QSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVI  375
                AW+TVS++F+V+E+LKDMI+Q     K+PVP  + +M   +++ ++  +L  ++YVI
Sbjct  220   DCQAWVTVSKSFRVQELLKDMIKQFCEARKEPVPADLEAMG--RVERLIMAYLQSKRYVI  277

Query  376   VFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSW  555
             +FDDVW+  +   ++HV P   +G R +++TRL DVASS +   N  IY++ PLS++ +W
Sbjct  278   IFDDVWSTDLRFLVEHVFPLNDYGSRIILTTRLTDVASSYARPPN-RIYDLQPLSQQDAW  336

Query  556   ALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSL  735
              L C+KAF    CP  L E+  +I+ +C G PLAI  +G +L  K   + +EW   Y S+
Sbjct  337   ELFCKKAF-GGDCPQELHELSHKIVDKCQGTPLAIATVGSLLGRKRVKSASEWKQFYDSM  395

Query  736   GPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVK  915
             G +    D   +++ +L LS+NDLP   K CF+Y+S +PED+ IE   L+  W  EG ++
Sbjct  396   GYEL---DSSPAMKRLLWLSYNDLPHPQKYCFLYISSFPEDYAIECGRLVKLWIAEGLIE  452

Query  916   QKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTT  1095
             +  GKT EEVA  YL ELI RSL+    LN  G + + R+HD+ REIILSKS D NF   
Sbjct  453   EVRGKTPEEVALNYLNELIQRSLVQVAHLNIYGEVSRCRVHDILREIILSKSKDDNFYEV  512

Query  1096  IDEETAAW-PEKARHLSVHGTLGNAQMK-RQGTKLRSLLTFNVTDSQFSSHVVQILSSCR  1269
               E    W P  AR LS+        +  R  ++LR+LL F +   Q  S   Q+LS+ +
Sbjct  513   YPEPKTRWQPINARRLSILENSDRVSLNTRNLSRLRTLLMFGIDGFQEKS-AKQLLSNFK  571

Query  1270  VIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTE  1449
             +++VLDLQ   LE  P+EI  L HLRYLSL+ TK++ +P+S+ KL+ LE LDL+ T V +
Sbjct  572   LLRVLDLQGAPLENFPDEIVTLYHLRYLSLKRTKIRKIPKSLGKLKYLETLDLRRTLVVK  631

Query  1450  LPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTI  1629
             LPV I KL HLRHL+  S++          P      G+G+L +L+KL ++EA  G+   
Sbjct  632   LPVRISKLHHLRHLLA-SNIDNDI----DHPAVDVHNGIGRLTALQKLSFIEATEGSSIA  686

Query  1630  EEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPL  1809
             EE+G L +L+   I  L  EDG+ +CSSI+K+  LRSL L  +++  ++D N +SSPP L
Sbjct  687   EELGSLTQLRTFGIKILGEEDGQNICSSIDKMNDLRSLKLD-VKQPKLVDFNLISSPPRL  745

Query  1810  LQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEH  1989
             L+RL+L   +  +P+W+ SL NLV +   WS L+DDP++ LQ LP L  L     Y  E 
Sbjct  746   LRRLWLDAKLNNLPYWLSSLENLVYLRLGWSWLRDDPIKVLQSLPKLEELYLNGVYEAEQ  805

Query  1990  MHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLR  2169
             +HF A  F  LR L +     +++VV+ +GA+P LE L +  C  L  +P GI+ L  L+
Sbjct  806   LHFEAQGFGRLRALEIGVSYNVKSVVMDDGALPVLESLYMSTCEALKQLPLGIQHLRKLK  865

Query  2170  YLEFFDMTDDFISTFLP---DKRGEDYCKVSHISEVYY-TYWKDGCWEVNSVQE  2319
             Y    +M ++F    L    ++  +    + HI+++ +     DG W   S +E
Sbjct  866   YFSSTNMPNEFDMAILQLDNEQEQDGLNPLQHINKINFGILLDDGRWLYYSKEE  919



>ref|XP_003632405.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Vitis 
vinifera]
Length=924

 Score =   523 bits (1347),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 319/760 (42%), Positives = 471/760 (62%), Gaps = 10/760 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +D R  +L +++ EIVGIE+  ++L S L++  P   VISVVGMGG GKTTL K VYD+ 
Sbjct  156   HDPRVTSLFIDDAEIVGIESQNRKLTSRLVEGTPKRTVISVVGMGGLGKTTLAKKVYDNK  215

Query  184   K--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             +   +F   AWITVSQ+FK+EE+L++M ++ +   K+ VPEG+ + +   L  + + +L 
Sbjct  216   ELVGYFDCSAWITVSQSFKMEELLRNMSKKFYQSRKEAVPEGLDTTDEMSLITLTRGYLQ  275

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++YV+VFDDVW    W  IK VLP+   G R +I+TR  +VASS    +  YI+++ PL
Sbjct  276   DKRYVVVFDDVWKLDFWGIIKCVLPENGKGSRIIITTRNDEVASSCIESSFDYIHKLQPL  335

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S + SW L C+K F    CP  L ++   I+KRCGGLPLAIVA+GG+L+ K K  I EW 
Sbjct  336   SPKSSWELFCKKTFQGG-CPPDLEKLSLDIVKRCGGLPLAIVAVGGLLSRKEKL-IPEWK  393

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
                 +L  +F+ N   ES+  IL LS++DLP YLK CF+YL+I+PED+ I    L   W 
Sbjct  394   KFSDNLRSEFQSNSHLESINTILSLSYHDLPYYLKSCFLYLAIFPEDYTIRCGPLTRLWI  453

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFVK K    +E+VAE +L ELI+R+L+    +  DG ++   IHDL REIIL K+ +
Sbjct  454   AEGFVKAKKDVMLEDVAEEFLTELIHRNLVQVSDVYADGKIESCHIHDLIREIILKKAAE  513

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNA-QMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
              +F   +  E +++    RHLSVH +  N   +  + + +RS+  +N   SQ    + ++
Sbjct  514   LSFCCLMTGEASSFDGGFRHLSVHNSSYNVVNIIGKKSHIRSIFLYN---SQMF-FLEKL  569

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              S   ++KVLDL  + L+  PE +  LLHLRYLSLR+TKV++LPRSI KL+ L+ LDLKY
Sbjct  570   ASRFNLLKVLDLNDSGLDSFPENLGNLLHLRYLSLRNTKVRMLPRSIGKLQNLQTLDLKY  629

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             + V +LPVEI +L+ LR+++  ++     L      G +  +G+G L  L+KL  VEAN 
Sbjct  630   SLVEDLPVEINRLKKLRNILAQNYDFDGDLGMFSVKGVQVKEGIGCLEELQKLSCVEANH  689

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             G G I+E+GKL +L++L I KL  E+GK + +SI  + +L SL++ S+ E+ +LD+ ++S
Sbjct  690   GVGVIKELGKLRQLRKLSITKLTRENGKHLFASITNMNRLESLSISSLSEEEILDLQHVS  749

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
              PP  L RL L G + K+P WI  L+NL  +    S L +DP++ LQ LPNL  L+ +  
Sbjct  750   YPPSCLTRLKLIGPLEKLPDWISELQNLSIVILYGSNLMNDPVKVLQALPNLQMLQLMRA  809

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIEC  2154
                E + F A  FQ L+ L +  L  ++ V I  GA+P LE L++  C QL  +P GI  
Sbjct  810   SAVEELCFEATGFQKLKRLVVLYLVGVKRVKIENGALPLLETLLVGPCPQLEELPPGIRH  869

Query  2155  LFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYY  2274
             L  L  LEF+++ ++   + +P  RG +Y  V HI  V++
Sbjct  870   LTRLTTLEFYNLQEELKLSMIPS-RGRNYKIVEHIPNVFF  908



>ref|XP_010027151.1| PREDICTED: disease resistance protein RPM1-like [Eucalyptus grandis]
Length=894

 Score =   521 bits (1343),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 313/775 (40%), Positives = 455/775 (59%), Gaps = 83/775 (11%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             R D   +EEDE+VGI+ PR+ELI  L+  +P L+V+S++GMGGSGKTTL + VYD+  VK
Sbjct  156   REDTFPVEEDELVGIDQPREELIKWLVDGEPGLEVVSILGMGGSGKTTLAERVYDNHQVK  215

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
              +FQSHAWI+VSQ++K++ +L+DMI+QL  E++Q  P+G+ S N+ +LK I+K+FL  ++
Sbjct  216   AYFQSHAWISVSQSYKIQNILRDMIEQLHGEIEQRAPQGIESANSVRLKQILKDFLRHKR  275

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW     E IK  +P      R +I+TR+ D+A+ SS  +   +Y   PLS E
Sbjct  276   YIIVLDDVWNLEALEGIKSAMPNGSCNSRIIITTRMADIATFSSNQSK--VYSRKPLSPE  333

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW+L C+KAFH   CP HL  + +QILK+C GLPLAIVAIGG+L  K   ++ EW  + 
Sbjct  334   ESWSLFCKKAFHGKLCPPHLKNLSQQILKKCEGLPLAIVAIGGLLFAK---DVQEWEMIS  390

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
             HSL  + E ND+ +  R IL LS+ DL   LK CF+YL ++PEDH+IE  +LI  W  EG
Sbjct  391   HSLAIELESNDRMQIFRKILSLSYIDLHHNLKSCFLYLGLFPEDHVIECMTLIRLWIAEG  450

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             F++++   T EEVA+ YL ELINR+L+   + N +G ++  R          S S D  F
Sbjct  451   FIEEREHMTREEVAQRYLNELINRNLVQIAETNLEGGLQTCRSRT-------SSSIDEQF  503

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSC  1266
               T                                              SS ++++    
Sbjct  504   FPT----------------------------------------------SSKLLRV----  513

Query  1267  RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVT  1446
                  LDL  + L   P++I   +HL+YLSLR + V ++PRSI KL+ LE LDLK TFV+
Sbjct  514   -----LDLGGSCLHKFPQQILVFVHLKYLSLRRSNVCIIPRSIVKLQNLETLDLKQTFVS  568

Query  1447  ELPVEILKLQHLRHLIVYSHVSF-AYLPYNCSPGFKAPkglgklgsleklVYVEANPG--  1617
             ++PVEI KL+ L+HL+VYS      Y+P+    GF AP G+G L SL+ L  V+A+ G  
Sbjct  569   KMPVEITKLKKLQHLLVYSEAEITTYVPFGIRKGFSAPNGIGALTSLQNLCCVKASGGRS  628

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
               T++E+G+L+ L+RL +  L+ +D K +C SIEK+  L+SL + +  E  ++D+++LSS
Sbjct  629   KNTMQELGELSRLRRLGVRDLKKDDAKELCHSIEKMTNLQSLYVNAESEYDIMDLDFLSS  688

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
              PP L+ L++ G + K+PHW+  L NL K+   W+KLK  PL  LQ+LPNLV L     +
Sbjct  689   APPFLRALHIGGCLKKLPHWLPLLTNLTKLRLAWTKLKSSPLIALQNLPNLVELYLSNAF  748

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL--ASVPAGIE  2151
              G+ + F    F  L+ L    L+ LR  ++   AMP L+ L+I  C  L   S+   I 
Sbjct  749   DGKTLVFGDKGFPKLKKLFFANLKNLRFALMNGQAMPCLQSLIIVGCRHLDWQSLLVVIR  808

Query  2152  CLFNLRYLEFFDMTDDFISTFLP--DKRGEDYCKVSHISE-------VYYTYWKD  2289
              L NL++L+F++M ++F   F P    R        H  E       VY+ +WK+
Sbjct  809   GLANLKHLQFYEMPEEFALAFYPYSHNRIRKGILQKHYEEVMERNPKVYFFWWKE  863



>ref|XP_010092597.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXB51693.1| Disease resistance protein RPM1 [Morus notabilis]
Length=988

 Score =   524 bits (1350),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 313/742 (42%), Positives = 451/742 (61%), Gaps = 11/742 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +D R D+  L+E E+VGIE+ R ELI  L  +     VI+VVGMGG GKTTLV  VY+ V
Sbjct  160   SDPRKDSCFLKETEVVGIESARAELIESLEGESCQRSVIAVVGMGGVGKTTLVHQVYEHV  219

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
                F  HAWI VSQ++   E+L+ +I ++     +  PEG+ +MN   +   +  +L  +
Sbjct  220   NGCFDCHAWIEVSQSYNKVELLRSLISKICQARGEFAPEGIDAMNERAVTTELSNYLQGK  279

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
              YV+VFDDVW    W  IK+ LP      R +I+TR ++VA+   T +  YI  + PL  
Sbjct  280   SYVVVFDDVWNINFWADIKNALPDNNRCGRIVITTRDVEVANFCRTTSFVYIRHLKPLPP  339

Query  544   EVSWALLCRKAFHA---SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             E +W L C +AFH+     CP++L E+  +I++RC GLPLAIV I G+L+TKNK+ + +W
Sbjct  340   EKAWELFCNRAFHSECEKDCPTYLKELSWKIVERCEGLPLAIVVIAGLLSTKNKS-VEQW  398

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               L+ SL  + + N+   S+  IL  S+NDLP YLK CF+Y  I+PE++ I+   L  QW
Sbjct  399   KKLHDSLSSELDSNEHLTSITRILSFSYNDLPYYLKSCFLYFGIFPEEYSIKPGRLTRQW  458

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFV+ K  K++E VAE YL ELINR+L+   +   DG  K  RIHDL REIIL K  
Sbjct  459   VAEGFVRPKKDKSLEIVAEEYLVELINRNLVQVPRTKLDGKAKSCRIHDLLREIILKKME  518

Query  1075  DHNFVTTIDEETAAWPEKARHLS-VHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
             D  F   + +        ++ LS +H +        + + +RS+ TFN  D+     V  
Sbjct  519   DLGFCQVLSQSYLTLKRTSQRLSIIHSSFNVLSRNLKLSHVRSIFTFN-EDNIPRPIVST  577

Query  1252  ILSSCRVIKVLDLQST-SLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
             ++++ +++KVLD +    L+ +P++I  L HLRYLS+R T+V++LP+SI KL  LE LDL
Sbjct  578   VINNFKLLKVLDFEGAPCLDYLPKDIGNLFHLRYLSVRRTRVQLLPKSIGKLENLETLDL  637

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLP-YNCSPGFKAPkglgklgsleklVYVE  1605
             K + V+ELPVE+ KL  LRHL+ Y H+ +          G K  KG+G L +L+KL +VE
Sbjct  638   KQSQVSELPVEVNKLHKLRHLLAY-HIEYKMDSIVRVQRGVKVEKGIGWLKALQKLYFVE  696

Query  1606  AN-PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
             AN  G    +E+ KL EL++L I KLR+ED + +C  I K+  L SL++ SI ED  +++
Sbjct  697   ANIEGFDLFKELCKLTELRKLGIKKLRSEDSRTLCDCIGKMEHLESLSIASISEDETINM  756

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
               +SSPP  L+ L L G++ K P WI  L+NLV+I F WSKL+DDPL+ LQ+L NL+ L 
Sbjct  757   ESMSSPPQFLRHLNLDGHLRKFPEWIAKLQNLVRIRFGWSKLEDDPLKGLQNLHNLLELG  816

Query  1963  -FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVP  2139
              +   Y G+ +HF  G FQ L++  L  L  L ++VI E A+  LE+ +I  C QL  VP
Sbjct  817   IYYDAYCGKQLHFEGGTFQKLKVFYLSDLSMLDSIVIEEEALCDLERFLIGSCPQLVEVP  876

Query  2140  AGIECLFNLRYLEFFDMTDDFI  2205
              G++ L NL+ L F +M   F+
Sbjct  877   CGLQHLRNLKVLGFIEMPTKFL  898



>gb|KCW73771.1| hypothetical protein EUGRSUZ_E02372 [Eucalyptus grandis]
Length=800

 Score =   517 bits (1332),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 300/656 (46%), Positives = 426/656 (65%), Gaps = 17/656 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DA  +EE E+VGI+ P++ELI  L+  +P LKV+S++GMG    TTL K VYD+ 
Sbjct  153   HDLREDAFPVEEGELVGIDKPKEELIKWLVDREPGLKVVSILGMG----TTLAKGVYDNH  208

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK +FQSHAWI+VSQ++ ++++L+DMI+QL  E+KQ VP+G+ SMN+ +LK IVKEFL 
Sbjct  209   QVKAYFQSHAWISVSQSYTIQDILRDMIEQLRGEIKQQVPKGIESMNSMQLKQIVKEFLQ  268

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YVIV DDVW     E IK+ LP      R +I+T + D+A+  S  +   +Y   PL
Sbjct  269   QKRYVIVLDDVWNLEALEGIKNALPNGSSCSRIIITTCIADIANVPSNQSK--VYNRQPL  326

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S E SW+L  +KAF  + CP HL  + +QILK+C GLPLAIVAIGG+L  K+   + EW 
Sbjct  327   SPEESWSLFYKKAFRGNPCPPHLEHLSQQILKKCEGLPLAIVAIGGLLFAKD---VQEWE  383

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + E N+  +  R IL LS+NDL   LK CF+YL ++PEDH+IE   LI  W 
Sbjct  384   MITCSLGAEIESNNMMQIFRKILSLSYNDLHYNLKSCFLYLGVFPEDHVIECMRLICLWI  443

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
             +EGFV+++ G T +EV + YL ELIN SL+   +   DG +K  R+HDL RE ILSK  D
Sbjct  444   VEGFVEEREGMTQDEVGQRYLKELINGSLVQIAETTLDGRLKSCRVHDLMRESILSKLRD  503

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTD-SQFSSHVVQI  1254
              NFV+   +  A   E+ R L V  T            LRSLL F +   S    + V  
Sbjct  504   ENFVSFASKHKAQLQERVRRLLVQYTCNETLKWLNLLSLRSLLIFELEKLSSLDENFVP-  562

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              S CR+++VLDL  +SL   P++I  + HL+YLSLR TKV ++P+SI KL+ LE LDLK+
Sbjct  563   -SGCRLLRVLDLGDSSLPKFPQQILVMFHLKYLSLRRTKVCIIPKSIGKLQNLETLDLKH  621

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAY-LPYNCSPGFKAPkglgklgsleklVYVEAN  1611
             T V+E+P+EI KL+ L+HL+VYS+        +    GF AP+G+  L SL+KL  V+A 
Sbjct  622   TLVSEVPMEITKLKKLQHLLVYSYALITTPQTFGLRKGFSAPQGIEVLASLQKLSSVKAR  681

Query  1612  PG--NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
              G    T++E+G+L++L+RL +  +R +D K +C S+EK+  LRSL + +  E  V+D++
Sbjct  682   GGRRKNTMQELGELSQLRRLGVSNIRKDDAKELCHSLEKITNLRSLCVTTESESEVIDLD  741

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLV  1953
             +LSS PPLL+ L + G + K+PHW+  L NL ++   W++LK  PL   ++LPNLV
Sbjct  742   FLSSCPPLLRTLNIEGCLRKLPHWLPLLNNLARVRLIWTRLKSSPLIAFRNLPNLV  797



>ref|XP_010244219.1| PREDICTED: disease resistance protein RPM1-like [Nelumbo nucifera]
Length=984

 Score =   523 bits (1346),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 317/769 (41%), Positives = 466/769 (61%), Gaps = 15/769 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R  +L +EED+IVGI  PR EL+  L++ +    V +VVGMGG GKTTLVK V+DD  
Sbjct  154   DFRVASLYMEEDQIVGIGKPRDELVRWLVEGESRRLVFAVVGMGGLGKTTLVKKVFDDEK  213

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             V  HF+  AW+TVS++F V+++L+ M++Q     K+   + M +M    L    +EFL  
Sbjct  214   VTTHFEFRAWVTVSKSFAVQDLLRAMLKQFCEARKESQIDRMDTMEQIDLIDKAREFLRH  273

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             +K+V++FDDVW    W +I+H LP    G R M++TR  +VAS    ++  ++Y + PL 
Sbjct  274   KKFVVIFDDVWNMDPWNSIQHALPCNNCGSRIMLTTRNHEVASYC-VESLSHVYNLKPLP  332

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
                SW L C KAF   +CP  L E+  +I+KRC G+PLAIV IGG+ + K ++   E   
Sbjct  333   FGDSWKLFCMKAFREHNCPLGLEELSHKIVKRCEGMPLAIVTIGGLFSRKTQSAF-ELQK  391

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             L+ S+G + E N     +  IL LS+NDLP +LK CF+YL I+PE+++I+   LI  W  
Sbjct  392   LHDSIGHELETNIMLTPMTRILSLSYNDLPFHLKSCFLYLGIFPENYIIKCGRLIRLWIA  451

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFVK+  GK++E+VAE YL ELI R+++  ++L  DG ++  R+HDL REI +SKS + 
Sbjct  452   EGFVKEARGKSLEDVAESYLRELIQRNMLQAMELYHDGRVRSCRVHDLLREISISKSEEE  511

Query  1081  NFV-TTIDEETAAWPEKARHLSVHGTLGNAQ--MKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              F   TI ++     +  R +SVH + G+     K   + LRSL  F V + +  + V +
Sbjct  512   RFCKVTIKQDLYFVHQSPRRVSVHHSCGDVSNWKKTDVSHLRSLFMFGVENLKKGNCVHR  571

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             +L   +++KVLDLQ   LE  P+EI  L HLRYLSL++TK++VLP S+  LR L +LDL+
Sbjct  572   LLGDLKLLKVLDLQDAPLESFPDEIVSLFHLRYLSLKNTKIRVLPNSLSNLRNLLVLDLR  631

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
              TFV +LPV  +KL+HLRHL  YS           + G      L KL        +EA+
Sbjct  632   NTFVNKLPVHTVKLRHLRHLFAYSFHRIGLQGVMMNKGIGQLTALQKLE------VIEAD  685

Query  1612  P-GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
               G   + E+G L +L+ L I KLR + GK +C+S+EK+  LR+L   SI ED +LD++ 
Sbjct  686   EDGTRIVRELGNLTKLRNLGITKLRRQHGKGLCASLEKMNDLRTLRAISIHEDELLDLHS  745

Query  1789  LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL  1968
             +SSPP +LQ L+L G + ++P WI SL +LV I  + S L+DDP+  LQ +PNL+ L   
Sbjct  746   MSSPPLMLQLLWLVGRLERLPSWITSLHSLVYIGLQSSMLRDDPIRVLQTMPNLMKLFLS  805

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
                  E ++F A  F+ L+ L++   + L +V + +GAMP LE+LVI+ C QL  +P+GI
Sbjct  806   RTSDAEDLYFEANGFRKLKELDICNFDRLNSVTVAKGAMPVLEELVIRSCGQLKILPSGI  865

Query  2149  ECLFNLRYLEFFDMTDDFISTFL-PDKRGEDYCKVSHISEVYYTYWKDG  2292
             E L NL+ L   DM +      L P+    ++ +V HI  +Y+T   +G
Sbjct  866   EHLTNLKDLNLIDMPEQLERMILCPNDVEHEHKRVKHIPNIYFTALCEG  914



>emb|CDP19241.1| unnamed protein product [Coffea canephora]
Length=728

 Score =   514 bits (1323),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 290/641 (45%), Positives = 420/641 (66%), Gaps = 11/641 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R+ +L +EE ++VGI+ P+ ELIS +L D   LKV+SVVGMGG GKTTLVK VYDD  
Sbjct  85    DIRAQSLFIEEAQLVGIDKPKAELISKILNDHSQLKVVSVVGMGGLGKTTLVKKVYDDAA  144

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK FQSHAWITVSQ  +  E++K+++QQL+ E++QPVP  +  M+   L   V++FL  
Sbjct  145   VKKQFQSHAWITVSQNSQFSEIIKNLMQQLYNEIRQPVPPEVEFMDVLMLSEFVRDFLRE  204

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y++V DDVW+   WEAIK +LP        +++TR+ DVAS+S   +  +IY+M PLS
Sbjct  205   RRYILVLDDVWSIAAWEAIKCILPDCNTASCVVLTTRIADVASASCLGSLNFIYKMKPLS  264

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             ++ SW L C + F ++  P +L E+ K+ILK+C GLPLAIVAIGGVL+ K+K   +EW  
Sbjct  265   DKQSWTLFCNRTFQSNDSPPNLEEVAKKILKKCEGLPLAIVAIGGVLSLKDKVKTDEWEM  324

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + H  G + +G+ + + ++ +LLLS+NDLP YLK C +YLSIYPE++ IE + ++ +W  
Sbjct  325   ILHGFGGEADGSGKLDRIKRVLLLSYNDLPHYLKSCLLYLSIYPEEYPIEVDGILLKWIA  384

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
              GFV++K G T  ++A GY+ ELINRSLI     +D+G +    +HD  REI++SKS + 
Sbjct  385   LGFVEEKEGMTSTDIAMGYMKELINRSLIQVKSTSDNGRLDTCGLHDFVREILVSKSKEQ  444

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
              F T   +    WPEK RHL++H    N Q       LRS++ F   D   ++ + + LS
Sbjct  445   GFTTVATKYYTRWPEKVRHLAIHNFTDNPQEFSSLNCLRSVVIFGYEDPLTTTFLSKFLS  504

Query  1261  S-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                +++KVLDL    L+ +P+++F+L HLRYLSL  T VK++P+SI KL+ LE++DL+ T
Sbjct  505   GDPKLLKVLDLDGAELDNIPKQVFKLFHLRYLSLNGTGVKIIPKSIGKLQNLEVIDLRGT  564

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFA--YLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
              VTELPVEILKL+ LR L++     ++  Y  + C    K P G+GKL  LE L  +EA+
Sbjct  565   NVTELPVEILKLRKLRSLLLGGLGDYSNEYAIWGC----KCPLGIGKLICLETLYNIEAD  620

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
               +  + EIGKL +L+RL I KLR EDGK + SS+ +L  LR L++  I+ED  LD+ Y 
Sbjct  621   -SDKIVREIGKLTQLRRLAITKLRREDGKELLSSLLRLTNLRELSVSCIKEDETLDLQYS  679

Query  1792  SSPP-PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK  1911
              SP    L  L L G + ++P W+ SL++L  +    S+L+
Sbjct  680   VSPKLKFLTSLRLKGRLERVPQWVTSLQSLRNLSLDNSRLR  720



>emb|CDP10113.1| unnamed protein product [Coffea canephora]
Length=949

 Score =   516 bits (1330),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 333/792 (42%), Positives = 464/792 (59%), Gaps = 47/792 (6%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGIE P+K LIS LLK DD  LKV+SVVGM G GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAKLVGIEQPKKHLISQLLKGDDCQLKVVSVVGMAGLGKTTLVKKVHEDPDV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
               HF   AW+TVSQT   +++LKD+I+QL  E K+PVP+ + SM   +LK  +K FL + 
Sbjct  219   ISHFPVRAWVTVSQTCDFQDLLKDLIRQLCKEGKKPVPQLIESMTTAELKEFIKNFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+   G R M++TR  DVAS+S  ++ G +Y+M PLS
Sbjct  279   GRYAIVFDDVWDVEFWNTIKFALPESSRGNRVMLTTRKADVASASCIESRGLVYKMEPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F+  +CP HL +  K IL +C GLPLAI+AI G+LA K+   I EW  
Sbjct  339   IEDSWTLFCNKIFNGDNCPGHLMDAAKGILDKCAGLPLAIIAISGLLALKDVNRIEEWEK  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + ++ IL LS+NDL   LK C +Y S++PED+ I+   LI  W  
Sbjct  399   VRRSLGGELEGTGKLDRVKKILCLSYNDLSWQLKTCLLYTSVFPEDYKIQGVRLINLWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G  +E++A GYL EL+NRS+I   ++  +G  +  +IHDL+REII+SKS + 
Sbjct  459   ERFVEWREGMNIEDIAWGYLSELVNRSIIQVTRVFYEGIPRHCQIHDLWREIIISKSREQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK------LRSLLTFNVTDSQFSS  1239
             N  T    +   WP EK R L VH +  N     Q         LRS +T    D     
Sbjct  519   NMATITAGQPTRWPSEKVRRLVVHSSRSNNTQHHQQRPNYCFDCLRSFITVGSMDP----  574

Query  1240  HVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEI  1419
                          +  +   +LE +P EIF L HL YL+L  T+V+ +P++I KL+ LE 
Sbjct  575   ------------PLFKIGQATLEKIPNEIFNLFHLNYLNLFGTRVERVPKAIGKLQHLEY  622

Query  1420  LDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             L+L  T V ELP+EILKLQ L  L V+  V  +   Y    GFKAP  +G L  LE L  
Sbjct  623   LNLGNTRVRELPMEILKLQKLWFLKVFQLVDSSDDDYGFH-GFKAPSNMGGLLGLEILEC  681

Query  1600  VEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EEDV  1770
             ++A+  +  I+EIGKL +L+ L I KL+ EDGK +CSS+  L  LR L + S+   ++  
Sbjct  682   IDASGESTIIQEIGKLTQLRELIITKLKREDGKELCSSLANLTNLRELTVNSVGKGDDHE  741

Query  1771  VLDVNY------------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK-  1911
             +LD+N+              S    L  L L G++ KMP W+  L +LV+I   WS+L+ 
Sbjct  742   ILDLNHHYSSLSSSSSSSSCSFLQSLHMLILLGHLEKMPKWVVHLHSLVRIDLNWSRLRG  801

Query  1912  -DDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMP  2088
              +DPLE LQ LPNL  + F   Y GE + F  G F  L+ L+L  +E LR + + EGA+P
Sbjct  802   EEDPLESLQYLPNLHSINFCGSYQGEGLCFKVGGFLKLKRLHLKSMEGLRWMRVEEGALP  861

Query  2089  HLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDK-RGEDYCKVSHISE  2265
             HL++L++++   L  +P GI+ L +L+ L  ++M+   +      K   E Y ++ HI E
Sbjct  862   HLQRLILEKLPLLEELPLGIQHLSHLQQLFLYEMSSQMMEKMENQKEESEGYTRIEHIPE  921

Query  2266  VYYTY-WKDGCW  2298
             +   Y   DG W
Sbjct  922   IVLGYNTNDGKW  933



>ref|XP_002324939.1| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
 gb|EEF03504.1| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
Length=916

 Score =   514 bits (1324),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 318/773 (41%), Positives = 457/773 (59%), Gaps = 21/773 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L L+E ++VGIENP+  L+S L++ +  L  ISVVGMGG GKTTLVK VYD  
Sbjct  151   HDPRLASLYLDEADVVGIENPKHLLVSWLVEGEEKLSSISVVGMGGLGKTTLVKKVYDSQ  210

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              +++ F +H W+TVS++F   E+L+  +Q       +PVP+ + SM   +L   ++++L 
Sbjct  211   PIRRSFDTHCWVTVSKSFASTELLRVALQGFLVTANEPVPDNLQSMTNLQLIDALRDYLQ  270

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+YVIV DDVWT   WE IK+  P    G R + +TRL ++A S   + + ++Y++  L
Sbjct  271   RRRYVIVLDDVWTVNAWETIKYAFPDCNCGSRIIFTTRLSNLAES--IENSSHVYDLQAL  328

Query  538   SEEVSWALLCRKAF---HASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
              E  +W L C KAF   H + CP  L ++ + ILK+C GLPLAIVAIGG+L+ K    + 
Sbjct  329   RENEAWTLFCMKAFRGEHKAVCPPELEKMSRNILKKCEGLPLAIVAIGGLLSKKKNEGL-  387

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  ++  L  + + N+   SLR IL LS++DLP YLK C++YLS++PED+LI+   LI 
Sbjct  388   EWKKVHDCLATELKSNNDLGSLRRILQLSYDDLPYYLKQCYLYLSVFPEDYLIKRMKLIR  447

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W +E FV++K G T+EEVAE YL EL+NRSLI  V++N    +K  R+HDL REII  K
Sbjct  448   LWIVERFVEEKQGFTMEEVAEEYLNELVNRSLIQVVEMNYFNRVKTCRVHDLMREIIQMK  507

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
             S + +FV   +       EK R LS+H            + +R    +++          
Sbjct  508   SREESFVMIANGARIGQNEKVRRLSIHENSEEVH-----SDMRFPYLWSLLSFSSHHSFE  562

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
                 + ++++VL+L    L     E+  L+HLRYLSLR T +  LP SI+KL+ LEILDL
Sbjct  563   HGFRNYKLLRVLNLDRAPLSSFLPELVDLIHLRYLSLRWTMISELPESIRKLKYLEILDL  622

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSP---GFKAPkglgklgsleklVY  1599
             K +FV+ LP  I +L  L  L  Y H   ++ P +  P   G + P G+G+L SL+KL  
Sbjct  623   KTSFVSSLPAGITQLTCLCQLRNYRH---SFQPSSFFPDTHGMRVPSGIGRLTSLQKLGS  679

Query  1600  VEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             VE N     + E+GKL  L+RL ILKLR E G  +C ++++L  L +L L S+ +   L 
Sbjct  680   VEVNEDYELVRELGKLTSLRRLGILKLREEQGMDLCYTLDRLKHLTALYLVSLNKTEFLQ  739

Query  1780  VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHL  1959
              + LSSPP  LQRLYL   +  +P WI SL+ + K+  ++S LK DPL+ LQ LP+LV L
Sbjct  740   FDSLSSPPKYLQRLYLKCSLPALPGWIASLQYISKLVLQYSNLKSDPLKALQKLPSLVLL  799

Query  1960  EFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVP  2139
             E    Y GE +  +   F  L+ L L +LE LR + I +G+MP LE+L I  C  L +VP
Sbjct  800   ELRQAYAGEELCCDPSGFPKLKKLGLHELERLRRIRIAKGSMPGLERLDITACTVLETVP  859

Query  2140  AGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCW  2298
              GIE L N+  L  + M   FI T    +  ED+ +V H++ +   Y   G W
Sbjct  860   DGIENLNNIEDLVLWHMPSTFIKTI--KRYSEDFWRVQHVTTITRIYESRGRW  910



>emb|CDP13416.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   511 bits (1317),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 308/682 (45%), Positives = 420/682 (62%), Gaps = 41/682 (6%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EED++VGI+ P K LI+ LLK DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  135   RDDALLVEEDKLVGIDQPNKHLIAELLKGDDYQLKVVSVVGMGGLGKTTLVKKVHEDPEV  194

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   AW+TVS+T   + +LKD+I+QL    K+PVP  + SM   +LK I K+FL + 
Sbjct  195   RRHFPVRAWVTVSETCDFQFLLKDLIRQLHEAGKKPVPRSIESMTTTQLKEITKDFLQQA  254

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK VLP+   G R M++TR  DVAS+S  ++ G +Y M PLS
Sbjct  255   GRYAIVFDDVWDVEFWNTIKFVLPESSRGSRVMLTTRKADVASASCIESRGLVYRMKPLS  314

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F+  +CP HL ++ K IL +C GLPLAI+AI G+LA K+     EW  
Sbjct  315   FENSWILFCNKIFNGGNCPGHLMDVAKGILDKCEGLPLAILAISGLLALKDVNRTEEWEM  374

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + ++ IL LS+NDLP +LK C +Y SI+PED+ I    LI  W  
Sbjct  375   VRRSLGGELEGTGKLDRVKRILSLSYNDLPGHLKTCLLYTSIFPEDYEIACIRLINLWIA  434

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E +V+ + G+T+E+VA  YL ELINRSLI   K+  +G     R+HDL REII+SKS + 
Sbjct  435   ERYVEWREGRTIEDVAWSYLSELINRSLIQVTKVFFEGIPGTCRVHDLLREIIISKSREQ  494

Query  1081  NFVTTIDEETAAWP-EKARHLSVH-GTLGNAQMKRQGTK-----LRSLLTFNVTDSQFSS  1239
             N VT    +   WP EK R L VH G+  N Q  ++        LRS +T    +   S 
Sbjct  495   NMVTITTGQPTRWPSEKVRRLVVHSGSSNNTQHHQERRNYCFDHLRSFVTVGSRNPLLSK  554

Query  1240  HVV-QILSSCRVIKVLDLQSTSL-EIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRML  1413
              ++ +I  S +++KVLD    ++ E +P EIF L HL++L L  T+++ +P++I KL+ L
Sbjct  555   MLLSEISRSSKLLKVLDFFGQNIVEEIPNEIFYLFHLKHLDLWGTRMETVPKAIGKLQHL  614

Query  1414  EILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslekl  1593
             E L+L  T V ELP+EILKLQ LR L VY  V  +   Y  S GFKAP  +G+L +L +L
Sbjct  615   EYLNLGNTGVRELPMEILKLQKLRFLEVYQLVDSSDDDYG-SHGFKAPSNMGRLLALHRL  673

Query  1594  VYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVV  1773
               ++A+ G+  ++EIGKL +L+ L I KLR EDGK +CSS+  L  LR L+++SI ++  
Sbjct  674   SCIDASSGSAILKEIGKLTQLRELRITKLRREDGKELCSSLANLTSLRELSVQSIGKE--  731

Query  1774  LDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLEHLQDLPN  1947
                                    KMP W+  L  LV+I   WS+L+  +DPLE LQ L N
Sbjct  732   -----------------------KMPQWVAHLHGLVRIDLDWSRLRGEEDPLESLQHLSN  768

Query  1948  LVHLEFLVGYTGEHMHFNAGKF  2013
             LV + F   Y GE + F AG F
Sbjct  769   LVSVNFCGSYQGEGLCFKAGGF  790



>emb|CDP12970.1| unnamed protein product [Coffea canephora]
Length=1010

 Score =   514 bits (1324),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 312/678 (46%), Positives = 427/678 (63%), Gaps = 34/678 (5%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P+K LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAKLVGIDQPKKRLISELLEGDDHQLKVVSVVGMGGLGKTTLVKKVHEDPEV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR-  360
             ++HF   AW+TVSQT   + +LKD+I+QL  E K+PVP+ + SM   +LK  VK+FL + 
Sbjct  219   RRHFPVRAWVTVSQTCDFQYLLKDLIRQLHEEGKKPVPQSIESMTTTELKKFVKDFLQQA  278

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  HG R M++TR  DVAS+S T++ GYI+ M PLS
Sbjct  279   ERYAIVFDDVWDVEFWNTIKFALPESSHGNRVMLTTRKADVASASCTESLGYIHRMEPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  +SCP HL ++ K IL +C GLPLAI+AI G+LA K+     EW  
Sbjct  339   FEDSWTLFCNKIFKGNSCPGHLMDVAKGILDKCEGLPLAILAISGLLALKDVNRAEEWEM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + +R IL LS+ DLP +LK C +Y SIYPED++IE N LIY W  
Sbjct  399   VRRSLGGELEGTGKLDRVRKILSLSYGDLPWHLKTCLLYTSIYPEDYVIECNRLIYLWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA  Y  EL+NRSLI   ++  +G     RIHDL RE+I+SK  + 
Sbjct  459   ERFVEWREGISIEDVAWAYFSELVNRSLIQVTRVFYEGMPDTCRIHDLLREVIISKLREQ  518

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGT---KLRSLLTFNVTDS-QFSSHVV  1248
             N VT     T   P  + +   H        +RQ      LRS +T   T+   F + + 
Sbjct  519   NIVTV----TTGQPTISNNTQHH-------QQRQNNCFDHLRSFVTIESTNQLLFKTLLS  567

Query  1249  QILSSCRVIKVLDL--QSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEIL  1422
             ++L S +++KVLD   Q T  EI P E+F++ HL++L L  T+V+ +P++I KL+ LE L
Sbjct  568   EVLGSSKLLKVLDFGGQETQEEI-PNEVFKMFHLKHLDLYGTRVERVPKAIGKLQHLEYL  626

Query  1423  DLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             +L  T V ELP+EILKLQ LR L VY  V  +   Y  S GFKAP  +G L +LE L  +
Sbjct  627   NLGNTGVRELPMEILKLQKLRFLKVYQQVDSSDDDYG-SHGFKAPSNMGGLLALEVLDCI  685

Query  1603  EANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EEDVV  1773
             +A+ G+  ++EIGKL +L++L I KLR EDGK +CSS+  L  LR L++ SI   ++  +
Sbjct  686   DASSGSTIVKEIGKLTQLRQLYITKLRREDGKELCSSLANLTSLRELSVYSIGKGDDHEI  745

Query  1774  LDVNY------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLEH  1929
             +D+N+       SS    L+ L L G + +MP W+  L  LV+I   WS+L+  +DPLE 
Sbjct  746   IDLNHHHPSLSSSSFLQSLRMLILCGRLERMPQWVAHLHGLVRIDLDWSRLRGEEDPLES  805

Query  1930  LQDLPNLVHLEFLVGYTG  1983
             LQ LPNLV + F     G
Sbjct  806   LQHLPNLVSINFFTQKLG  823



>emb|CDP20516.1| unnamed protein product [Coffea canephora]
Length=915

 Score =   511 bits (1317),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 337/789 (43%), Positives = 468/789 (59%), Gaps = 61/789 (8%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKD-DPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P++ LIS LLK  D  LKVISVVGM G GKTTLVK V++D  V
Sbjct  156   RDDALLVEEAKLVGIDQPKQHLISKLLKGHDHQLKVISVVGMAGLGKTTLVKKVHEDPEV  215

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +K+F   AW+TVSQT    ++L+D+I+QL  +L + VP+ M SM    LK  VK+FL R 
Sbjct  216   RKNFPVRAWVTVSQTCDFPKLLRDLIRQLNKDLDKSVPQSMESMTTAGLKEFVKDFLRRA  275

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  +G R M++TR  DVA+S  T++   +Y M PLS
Sbjct  276   GRYAIVFDDVWDMEFWNEIKFALPEGNYGNRVMLTTRNADVAASC-TESQDCVYRMKPLS  334

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HL ++ K +L +C GLPLAI+AIGG+LA+K+ + I+EW  
Sbjct  335   NEDSWTLFCNKIFKGNRCPAHLMDVAKAVLDKCDGLPLAILAIGGLLASKDVSRIDEWEM  394

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG       + E ++ IL LS+NDLP +LK C +YL+IYPED+ I    LI  W  
Sbjct  395   IQHSLG------GKLERVKRILSLSYNDLPSHLKPCLLYLTIYPEDYPINCQMLILLWIA  448

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+ A  YL ELINRSLI   +   +G+    RIHDL RE+IL KS + 
Sbjct  449   ERFVEWREGMSIEDAAWAYLRELINRSLIQVTEAFYEGTPHTCRIHDLLREVILIKSREQ  508

Query  1081  NFVTTIDEETAAWP--EKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             N VT    +    P  EK R L++H                            SS++++ 
Sbjct  509   NMVTVTTGQPMTCPSEEKVRRLAIHS---------------------------SSNILR-  540

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
                 +++KVL+L    +E  P EIF LLHL YLSL  TKV  +PR+I KL+ LE L L  
Sbjct  541   ---SKLLKVLELGGEEIEETPNEIFNLLHLTYLSLYGTKVARVPRAIGKLQHLEYLHLGD  597

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T V ELPVEILKL  LR+LIV+  V  +   Y    GFK P  LG L +L+ L  ++A+ 
Sbjct  598   TRVRELPVEILKLLKLRYLIVFQRVDPSDDSYGFH-GFKGPSKLGGLLALQVLRTIDASS  656

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EEDVVLDVN  1785
             G+  ++EIGKL +L+ L I +LR EDGK +CSS+  L  LR L++ S+   ++  ++D+N
Sbjct  657   GSVIVKEIGKLTQLRELYITQLRREDGKELCSSLVNLTSLRQLSVASVGKGDDYEIIDLN  716

Query  1786  ---------YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLEHL  1932
                         S    L+ L + G +  MP W   L+NLVKI   WS L+  +DPLE L
Sbjct  717   HHQHSLSSSSSCSFLQSLRVLIMYGRLETMPVWTTHLQNLVKIVMNWSGLRAEEDPLESL  776

Query  1933  QDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQ  2112
             Q LPNL  + F   Y GE + F AG F  L+ L L ++E LR + + EGA P+L KLV++
Sbjct  777   QHLPNLDEISFCGSYQGERLCFKAGGFLKLKRLWLRRMEGLRWMTVEEGACPNLRKLVLE  836

Query  2113  RCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKR-GEDYCKVSHISEVYYTY-WK  2286
             +   L  +P+ I+ L +L+ L  ++M+   I      K   EDY +++HI E+   +   
Sbjct  837   QLPSLEDLPSAIQHLSHLQELYLYEMSSRLIEKVENQKEDSEDYRRMAHIPEIVIGFSAD  896

Query  2287  DGCWEVNSV  2313
             DG W +  +
Sbjct  897   DGEWRIRRL  905



>ref|XP_006387370.1| hypothetical protein POPTR_1142s00200g, partial [Populus trichocarpa]
 gb|ERP46284.1| hypothetical protein POPTR_1142s00200g, partial [Populus trichocarpa]
Length=593

 Score =   499 bits (1286),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 273/559 (49%), Positives = 367/559 (66%), Gaps = 7/559 (1%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             + DALL EE ++VGIE P+K+LI  LL      +VISVVGMGG GK+TLVK VYDD  VK
Sbjct  37    QKDALLQEEADLVGIEKPKKQLIEWLLGSKSGREVISVVGMGGLGKSTLVKKVYDDSDVK  96

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             KHF+  AWITVSQ+FK E++LKDMIQQLF    +P P+G+ +MN NKL+ ++ EFL ++K
Sbjct  97    KHFKFCAWITVSQSFKREDLLKDMIQQLFRVHSKPDPKGVDNMNYNKLRSVIHEFLRQKK  156

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E
Sbjct  157   YLIVLDDVWHTSAWRAFQHALPNNICGSRILVTTRNTEVASTSCMDSPDKVYPLNPLSQE  216

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L C+K F  +  P HL  + + IL RC GLPLAIVAI GVLATK+K+  +EW  ++
Sbjct  217   ESWTLFCKKIFQDNPRPPHLKNVSETILGRCEGLPLAIVAISGVLATKDKSKTDEWEMVH  276

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SLG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+   LI  W  EG
Sbjct  277   LSLGVGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMRLIRLWIAEG  336

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FVK K G TVEEVA+ YL EL+ RSL+  V+   DG +K  R+HDL REI+++K+ D +F
Sbjct  337   FVKGKEGMTVEEVAQDYLNELMKRSLVQVVRATSDGRVKTCRVHDLLREIMITKAKDQDF  396

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-  1263
             V    EE   WPEK R +S+H  + + Q +   ++ RSLLTF   D  + S V  + S  
Sbjct  397   VAIAKEEGTIWPEKVRRVSMHNVMPSKQQRHVASRFRSLLTFWGADCSYESPVHNLFSGR  456

Query  1264  CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
              R++ VLDL+   L+  P E+  L  L+YLSLR+T+V  +P SI KL+ LE LDLK+  V
Sbjct  457   LRLLHVLDLEGAPLKEFPNEVVSLFLLKYLSLRNTRVSFIPSSISKLKNLETLDLKHAQV  516

Query  1444  TELPVEILKLQHLRHLIVYSHV--SFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
             + LP EI KL+ L +L+VY +   S  ++P     GFKAP  +G L S++KL +VEA+ G
Sbjct  517   SILPAEIRKLRKLCYLLVYRYEIDSDDWIPTKY--GFKAPAHIGGLQSIQKLCFVEAHQG  574

Query  1618  NGTIEEIGKLNELKRLCIL  1674
                + E+G+L +L+RL I+
Sbjct  575   RNLMLELGRLKQLRRLGIV  593



>gb|ABF81448.1| NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=676

 Score =   502 bits (1293),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 256/497 (52%), Positives = 338/497 (68%), Gaps = 3/497 (1%)
 Frame = +1

Query  19    DALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKH  192
             DALL+EE ++VGIE P+K+LI  LL      +VISVVGMGG GK+TLVK VYDD  VKKH
Sbjct  156   DALLIEEADLVGIEKPKKQLIEWLLGSKTGREVISVVGMGGLGKSTLVKRVYDDSNVKKH  215

Query  193   FQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYV  372
             F+  AW+TVSQ+FK E++LKDMIQQLF   ++P P+G+ SM+ NKL+ ++ EFL ++KY+
Sbjct  216   FKFRAWVTVSQSFKREDLLKDMIQQLFRVHRKPDPKGVNSMDYNKLRSVIHEFLQQKKYL  275

Query  373   IVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVS  552
             IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E S
Sbjct  276   IVLDDVWHPSAWHAFQHALPNNICGSRILVTTRNTEVASTSCMDSPDKVYPLNPLSQEES  335

Query  553   WALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHS  732
             W L C+K F  + CP HL  + + IL RC GLPLAIVAI GVLATK+K+ I+EW  ++ S
Sbjct  336   WTLFCKKIFQNNICPPHLKSVSETILDRCEGLPLAIVAISGVLATKDKSRIDEWEMVHRS  395

Query  733   LGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFV  912
             LG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+  +LI  W  EGFV
Sbjct  396   LGAGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMTLIRLWIAEGFV  455

Query  913   KQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVT  1092
             K K G TVEEVA+ YL EL+ RSL+  VK   DG +K  RIHDL REI+++ + D +FV 
Sbjct  456   KGKEGMTVEEVAQDYLNELMKRSLVQVVKTTTDGRVKTCRIHDLLREIMIAMAKDQDFVA  515

Query  1093  TIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-CR  1269
                EE   WPEK R +S+H  + N Q ++  ++LRSLLTF V D  + S V ++ S   R
Sbjct  516   IAREEGITWPEKVRRVSIHNAMPNKQRRQVASRLRSLLTFWVADCNYESPVRKLFSGRLR  575

Query  1270  VIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTE  1449
             ++ VLDL+   L+  P+EI  L  L+YLSLR+TKV  +P +I +L+ LE LD+K   V+E
Sbjct  576   LLHVLDLEGAPLKEFPKEIVSLFLLKYLSLRNTKVNFIPSTISQLKNLETLDMKRALVSE  635

Query  1450  LPVEILKLQHLRHLIVY  1500
             LP EI KLQ L +L+VY
Sbjct  636   LPAEIRKLQKLCYLLVY  652



>emb|CDP21655.1| unnamed protein product [Coffea canephora]
Length=758

 Score =   503 bits (1295),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 322/751 (43%), Positives = 460/751 (61%), Gaps = 32/751 (4%)
 Frame = +1

Query  133   MGGSGKTTLVKMVYDD--VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGM  306
             MGG GKTTLVK V++D  V++ F   AW+TVS+T   + +LKD+I+QL  E K+PVP  +
Sbjct  1     MGGLGKTTLVKKVHEDLEVRRQFPVRAWVTVSETCDFQFLLKDLIRQLHEEGKKPVPRSI  60

Query  307   GSMNANKLKVIVKEFLLRR-KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDV  483
              SM   +LK  VK+FL +  +Y IVFDDVW    W  IK  LP+  +G R +++TR  DV
Sbjct  61    ESMTTTELKKFVKDFLQQAGRYAIVFDDVWDVEFWNTIKFALPESSYGNRVLLTTRKADV  120

Query  484   ASSSSTDTNGYIYEMTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIV  663
             AS+S  ++ G++Y M PLS E S  L C K F+  +CP HL ++ K IL +C GLPLAI+
Sbjct  121   ASASCIESRGFVYRMEPLSVEDSRTLFCNKIFNGGNCPGHLMDVAKGILDKCEGLPLAIL  180

Query  664   AIGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLS  843
             AI G+LA+K+   I+EW  +  SLG + EG  + + ++ IL LS++DLP +LK C +Y S
Sbjct  181   AISGLLASKDVNRIDEWEMVRRSLGGELEGTGKLDRVKKILYLSYSDLPWHLKTCLLYTS  240

Query  844   IYPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMK  1023
             IYPEDH I  N LI  W  E FV+ + G ++E+VA GYL EL+NRSLI       +G   
Sbjct  241   IYPEDHKIGCNRLINLWIAERFVEWREGMSIEDVAWGYLGELVNRSLIQVTDAFYEGIPN  300

Query  1024  QGRIHDLYREIILSKSTDHNFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK---  1191
               RIHDL RE+IL KS + N VT    +   WP EK R L VHG+  N     Q  +   
Sbjct  301   SCRIHDLMREVILLKSREQNMVTVTTGQPTTWPSEKVRRLVVHGSSNNNTQHHQQRRSYC  360

Query  1192  ---LRSLLTFNVTDS-QFSSHVVQILSSCRVIKVLDL--QSTSLEIVPEEIFQLLHLRYL  1353
                +RS +T   T+   + + + ++L S +++KVLDL  Q T  EI P EIF++ HL++L
Sbjct  361   FDHIRSFITVGSTNPLPYKTLLSEVLGSSKLLKVLDLAGQETQEEI-PNEIFKMFHLKHL  419

Query  1354  SLRSTKVKVLPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYN  1533
              L  T+V+ +P++I KL+ LE LDL  T V ELP+EILKLQ LR L VY  V  +    +
Sbjct  420   DLWGTRVERVPKAIGKLQQLEFLDLGNTAVRELPMEILKLQKLRFLKVYQLVDSS--DDD  477

Query  1534  CS-PGFKAPkglgklgsleklVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCS  1710
             C   GFKAP  +G L +LE L +++A+ G+  ++EIGKL +L+ L I KLR EDGK +CS
Sbjct  478   CGYHGFKAPSNMGGLLALEILNFIDASSGSTIVKEIGKLTQLRVLYITKLRREDGKELCS  537

Query  1711  SIEkllklrslnlksI---EEDVVLDVNY-------LSSPPPLLQRLYLSGYMGKMPHWI  1860
             S+  L  LR L++ SI   ++  ++D+N+         S P  L+ L L G + KMP W+
Sbjct  538   SLANLTSLRELSVASIGKGDDHEIIDLNHPALSSSSSCSFPQSLRLLILRGRLEKMPQWV  597

Query  1861  KSLRNLVKIYFRWSKLK--DDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrlln  2034
               L  LV+I   WS L+  +DPLE LQ LPNL  + F   Y GE + F  G F +++ ++
Sbjct  598   ARLHGLVRIDLDWSGLRGEEDPLESLQHLPNLDSINFCGSYQGEGLCFKTGGFLNVKWMH  657

Query  2035  ldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTF  2214
             L ++E LR + + EGA+P L+KL++     L  +P GI+ L +L+ L  ++M+ +     
Sbjct  658   LKRMEGLRWMRVEEGALPRLQKLILDLLPLLEELPLGIQHLSHLQRLVLYEMSSEMREKL  717

Query  2215  LPDKR--GEDYCKVSHISE-VYYTYWKDGCW  2298
             L +++   EDY +++HI E V   Y  DG W
Sbjct  718   LENQKEESEDYTRIAHIPEIVIGCYTDDGEW  748



>ref|XP_009349723.1| PREDICTED: disease resistance protein RPM1-like [Pyrus x bretschneideri]
Length=951

 Score =   508 bits (1309),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 320/771 (42%), Positives = 466/771 (60%), Gaps = 20/771 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             ND R  +L + E EIVGIE  R EL  LL++  P  +VISVVGMGG GKTTL K VYD  
Sbjct  160   NDPRVASLFIGEAEIVGIECARDELTRLLVEGAPRREVISVVGMGGLGKTTLAKKVYDQK  219

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V  HF  +AWITVSQ+++V+++L+ +I++ +   K+  PE + +M+   L    +E+L 
Sbjct  220   KVMAHFDCYAWITVSQSYRVQDLLRTVIKKFYTSRKERFPEEIDTMDEESLISTSREYLQ  279

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YV+VFDDVW    W +I+H LP  K G R +I+TR+ DVA+        +++ + PL
Sbjct  280   QKRYVVVFDDVWKVDFWGSIEHALPDNK-GGRIIITTRIQDVANFCKRSCFVHVHHLQPL  338

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
                 +W L CRKAF      +CP  L E+   I+KRC GLPLAIV+IGG+L+TK K  ++
Sbjct  339   PPNKAWELFCRKAFQFELEGNCPGELEELSLNIVKRCEGLPLAIVSIGGLLSTKVKV-VS  397

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  LY+SL  + E N    SL  IL LS++ LP YLK C +Y  I+P+D+ I    L+ 
Sbjct  398   EWQKLYNSLSSELESNPHLTSLTRILSLSYHHLPYYLKSCVLYFGIFPKDYSISCIRLVR  457

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVK K GKT+EEV + YL ELI+RSL+   ++  DG  +  R+HDL  +++L K
Sbjct  458   LWIAEGFVKPKRGKTLEEVGKEYLMELIHRSLVQVTEVYIDGKARGCRVHDLLHDVLLKK  517

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D +F   + ++ + +    R LS+  +   A      + +RS+ TFN+   ++    +
Sbjct  518   GLDSSFCHVLSKDESTFKPTTRRLSMDISPSEALGGITQSHIRSVFTFNL--EEWPESFL  575

Query  1249  QILS-SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILD  1425
               LS S +++KVLD     +  +P+ +  L  L YLSLR+TKVK+LP SI  L+ LE LD
Sbjct  576   HTLSGSIKLLKVLDFLDAPINQLPKYVGDLYLLTYLSLRNTKVKLLPDSIGNLQNLETLD  635

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAY---LPYNCSPGFKAPkglgklgsleklV  1596
             LK + V E+P +I KL  LR+L+ + H    Y   L  N   G K  +G+G L +L+KL 
Sbjct  636   LKQSLVYEIPAKINKLVKLRYLLAH-HCDHNYDVGLLLNMENGVKIHEGIGCLQALQKLS  694

Query  1597  YVEANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVV  1773
             YVE N G    I+E+GKL +L++L +  L++EDG+AVC+SIEK+  L SL L +I ED V
Sbjct  695   YVEVNHGGIRLIKELGKLRQLRKLGLKNLKSEDGRAVCASIEKMNHLESLRLTAINEDEV  754

Query  1774  LDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKL---KDDPLE-HLQDL  1941
             LD+  +S+PP  ++ L L+G +G++P WI +L++LV+I   WS+L   +D PL+      
Sbjct  755   LDLESISTPPQFIRSLGLTGRLGQLPGWISNLQHLVRIGIVWSRLRDSRDSPLKALQNLP  814

Query  1942  PNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCN  2121
               L  L ++  Y G  +HF  G FQ LR L+L ++  L +++I +G MP L++  I    
Sbjct  815   NLLELLLYINAYDGVQLHFEEGGFQKLRKLHLREMMGLNSLIIDDGVMPLLQEFHIGPSP  874

Query  2122  QLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYY  2274
             QL  VP+GI  L NL  L F+DM  +F     P K G+ Y  V HI  V +
Sbjct  875   QLKEVPSGIHHLRNLTNLYFYDMPKEFARQMDP-KNGQHYWIVEHIQNVRF  924



>emb|CDP19598.1| unnamed protein product [Coffea canephora]
Length=842

 Score =   505 bits (1301),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 305/668 (46%), Positives = 412/668 (62%), Gaps = 28/668 (4%)
 Frame = +1

Query  82    SLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKHFQSHAWITVSQTFKVEEVLKD  255
             +L  +DD  LKV+SVVGMGG GKTTLVK V++D  V++HF   AW+TVS+T   + +LKD
Sbjct  65    NLRARDDYQLKVVSVVGMGGLGKTTLVKKVHEDLEVRRHFPVRAWVTVSETCDFQYLLKD  124

Query  256   MIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR-RKYVIVFDDVWTARVWEAIKHVLP  432
             +I+QL  E K+PVP+ + SM   +LK  VK+FL +  +Y IVFDDVW    W  IK  LP
Sbjct  125   LIRQLHEEGKKPVPQSIESMTTTELKKFVKDFLQQAERYAIVFDDVWDVEFWNTIKFALP  184

Query  433   KEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSWALLCRKAFHASSCPSHLTE  612
             +  HG R M++TR  DVAS+S T++ GYIY M PL  E SW L C K F   SCP HL +
Sbjct  185   ESSHGNRVMLTTRKADVASASCTESLGYIYRMKPLFFEDSWTLFCNKIFKGGSCPGHLMD  244

Query  613   ILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLL  792
             + K IL +C GLPLAI+AIGG+LA K+     EW  +  SLG + EG  + + ++ IL L
Sbjct  245   VAKGILDKCEGLPLAILAIGGLLALKDVNRTEEWEMVRCSLGGELEGTGKLDRVKKILTL  304

Query  793   SFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELI  972
             S+ DLP +LK C +Y SIYPED+ IE + LI  W  E FV+ + G ++ +VA GYL EL+
Sbjct  305   SYGDLPWHLKTCLLYTSIYPEDYEIECSRLINLWIAERFVEWREGTSIADVALGYLSELV  364

Query  973   NRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTTIDEETAAWP-EKARHLSVH  1149
             NRSLI    +  DG     RIHDL RE++L KS + N VT    +   WP +K R L VH
Sbjct  365   NRSLIQVTDVFYDGLPDTCRIHDLLREVLLLKSREQNLVTVTTGQPMMWPSDKVRRLVVH  424

Query  1150  GTLGNAQMKRQGT----KLRSLLTFNVTDSQFSSHVV-QILSSCRVIKVLDL--QSTSLE  1308
              +  N     Q +     LRS +TF       S  ++ +I  S +++KVLDL  Q T  E
Sbjct  425   SSSNNNTQHHQQSYSFDHLRSFVTFGSMSPLLSKTLLSEISRSSKLLKVLDLAGQETEEE  484

Query  1309  IVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRH  1488
             I P EIF++ HL+YL L  T+V+ +P++I KL+ LE L+L  T V ELP+EILKLQ LR 
Sbjct  485   I-PNEIFKMFHLKYLQLGGTRVERVPKAIGKLQHLEYLNLADTRVRELPMEILKLQKLRF  543

Query  1489  LIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIEEIGKLNELKRLC  1668
             L VY  V  +   Y    GFKAP  +G L +LE L  ++A+ G+  I+EIG+L +L+ L 
Sbjct  544   LKVYQQVDSSDDDYGYH-GFKAPSNMGGLLALEILTCIDASSGSIIIKEIGRLAQLRELS  602

Query  1669  ILKLRTEDGKAVCSSIEkllklrslnlksI---EEDVVLDVNYLSSPP--------PLLQ  1815
             I KLR +DGK +CSS+  L  L+ L++ SI   ++   +D+N+   PP          L+
Sbjct  603   ITKLRRDDGKELCSSLANLTSLQKLSVGSIGKGDDHEFIDLNH--HPPSLSSSSFLQSLR  660

Query  1816  RLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLEHLQDLPNLVHLEFLVGYTGEH  1989
              L L G + KMP W+  L +LV+I   WS+L+  +DPLE LQ LPNL  + F   Y GE 
Sbjct  661   MLLLCGRLEKMPQWVAHLHSLVRIDLDWSRLRSEEDPLESLQYLPNLGEIHFCGSYQGEE  720

Query  1990  MHFNAGKF  2013
             + F AG F
Sbjct  721   LCFKAGGF  728



>emb|CDP12974.1| unnamed protein product [Coffea canephora]
Length=1032

 Score =   509 bits (1310),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 328/758 (43%), Positives = 456/758 (60%), Gaps = 69/758 (9%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P+K LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAKLVGIDQPKKRLISELLEGDDHQLKVVSVVGMGGLGKTTLVKRVHEDPEV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   AW+TVSQT   + +LKD+I+QL  E K+PVP+ + S+N   LK IVK+FL + 
Sbjct  219   RRHFPVRAWVTVSQTCDFQYLLKDLIRQLHEEGKKPVPQSIESLNTTGLKKIVKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  HG R M++TR  DVAS+S T++ GYI+ M  LS
Sbjct  279   GRYAIVFDDVWDVEFWNTIKFALPESSHGNRVMLTTRKADVASASCTESLGYIHRMESLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  +SCP HL ++ K +L +C GLPLAI+AI G+LA K+     EW  
Sbjct  339   FEDSWTLFCNKIFKGNSCPGHLMDVAKGVLDKCEGLPLAILAISGLLALKDVNRTEEWEM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + ++ IL LS++DLP +LK C +Y SIYPED+ I+   LI  W  
Sbjct  399   VRRSLGGELEGTGKLDRVKKILSLSYSDLPCHLKTCLLYTSIYPEDYEIKCYRLINWWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA GYL EL+NRSLI    +  +G     RIHDL RE+IL KS + 
Sbjct  459   ERFVEWREGMSIEDVAWGYLSELVNRSLIQVTGIFYEGLPDNCRIHDLLREVILLKSREQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
             N VT    + A WP EK R L VH                                    
Sbjct  519   NMVTVTTGQPATWPSEKVRRLVVH------------------------------------  542

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                           S E +P EIF L HL++L L  T+V+ +P++I KL+ LE L+L  T
Sbjct  543   --------------SKEKIPNEIFNLFHLKHLDLWGTRVERVPKAIGKLQHLEYLNLGKT  588

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V ELP+EI+KLQ LR L VY  V  +   Y    GFKAP  +G L +LE L  ++A+ G
Sbjct  589   GVRELPIEIIKLQKLRVLKVYQQVDPSDDDYGFH-GFKAPSNMGGLLALEVLNCIDASSG  647

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EEDVVLDVNY  1788
             +  ++EIGKL +L++L I KLR EDGK +CSS+  L +LR L+++SI   ++  ++D+N+
Sbjct  648   STIVKEIGKLTQLRQLYITKLRREDGKELCSSLANLTRLRELSVESIGKGDDYEIIDLNH  707

Query  1789  -----LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLEHLQDLPN  1947
                   SS    L+ L+L G + KMP W+  L  LV++   WS L+  +DPLE LQ LPN
Sbjct  708   HHPSSSSSFLQSLRLLFLCGRLEKMPQWVAHLHGLVRVDLDWSGLRGEEDPLESLQHLPN  767

Query  1948  LVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQL  2127
             LV + F   Y GE + F AG F  L+ ++L ++E LR + + EGA+P L+KL +++   L
Sbjct  768   LVSINFCGSYQGEGLCFKAGGFLMLKRMHLKRMEGLRWMRVEEGALPRLQKLFLEQLPLL  827

Query  2128  ASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDY  2241
               +P GI+ L  L+ L        ++++ +P + G  Y
Sbjct  828   EELPLGIQHLSQLQELTLLQF---YLASTIPQEIGNLY  862



>emb|CDP11697.1| unnamed protein product [Coffea canephora]
Length=746

 Score =   499 bits (1285),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 315/734 (43%), Positives = 455/734 (62%), Gaps = 54/734 (7%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R  ALL+EE ++VGI+ P+KELIS +L DD  LKV+SVVG GG GKTTLVK VYD+  
Sbjct  42    DIRDQALLIEEAKLVGIDQPKKELISEVLDDDSHLKVVSVVGTGGLGKTTLVKKVYDEAV  101

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKK FQSHAWITVSQ F+   ++KD+IQQL+ E++QPVP  + SM   +L   VK+FL  
Sbjct  102   VKKQFQSHAWITVSQNFQFNVIIKDLIQQLYEEIRQPVPSQVESMKGIRLSEFVKDFLKE  161

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             R+Y++V DDVW+   WE IK+VLP      R +++TR+ DVAS+S   ++ +I++M+PLS
Sbjct  162   RRYILVLDDVWSLNAWETIKYVLPDCNIASRVVLTTRIADVASASCLASHDFIHKMSPLS  221

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C + F ++ CPS+L E+ ++ILK+C GLPL IV +GGVLA K+K  I+EW  
Sbjct  222   YEDSWTLFCNRTFQSNGCPSNLEEVCRKILKKCEGLPLGIVTMGGVLALKDKDKIDEWEM  281

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             ++   G + +G+ + + +R ILLLS++DLP +LK C +YLSIYPED+ I+          
Sbjct  282   IFRGFGSEVDGSGKLDRIRKILLLSYSDLPHHLKNCLLYLSIYPEDYPID----------  331

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
                V+++   T   +A  YL ELINRSLI       DG +    +HD  REII+SKS + 
Sbjct  332   ---VQERMIAT--NIAMRYLKELINRSLIQVKDTWYDGKLVNCGLHDFLREIIVSKSKEQ  386

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQG-TKLRSLLTFNVTDSQFSSHVVQIL  1257
             +F T        WP+K RHL++H   GN     QG ++L+ L +                
Sbjct  387   SFTTIATRYCTRWPDKVRHLAIHNFTGNPP---QGFSRLKCLRS----------------  427

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                    VL+L    L+ +P+E+F+L HL +L L  TKVKV+P+SI +L+ LE L L  T
Sbjct  428   -------VLNLTGAELDNIPKEVFKLFHLEFLDLSGTKVKVIPKSIGQLQNLEALVLLET  480

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFA--YLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
              +TELPVEILKL+ LR L +     ++  Y  +    GFK+P G+GKL SLE L  +EAN
Sbjct  481   TITELPVEILKLRKLRTLTIGGQGDYSNNYAIW----GFKSPDGIGKLTSLEILGIIEAN  536

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              G   + +IGKL +L++L I KLR EDGK + SS+ +L  LR L + SI+E+  LD+ + 
Sbjct  537   SGK-IVRQIGKLIQLRQLSITKLRREDGKELVSSLLRLTNLRELYIYSIKEEETLDLQHS  595

Query  1792  SSPP-PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDD--PLEHLQDLPNLVHLE  1962
              SP    L  L L+G + ++P W+ SL++L  +    S+L +D   ++ L  LPNLV L 
Sbjct  596   VSPRLGFLTTLLLNGRLERVPEWVISLQSLSTLSSLNSELSEDENAIDCLGHLPNLVDLS  655

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
                 Y GE + F AG+F+ L+ L L +L+ L+ V + + +MP+L++ +   C  +  +P 
Sbjct  656   LHRAYEGETLCFKAGRFRKLQRLLLMQLKRLKWVRVEKESMPNLQQFLFAGCKLMEGLPL  715

Query  2143  GIECLFNLRYLEFF  2184
             G++ L  L+ L + 
Sbjct  716   GLQNLTWLKVLGWL  729



>emb|CDP06250.1| unnamed protein product [Coffea canephora]
Length=843

 Score =   502 bits (1292),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 317/777 (41%), Positives = 440/777 (57%), Gaps = 107/777 (14%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P+K LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  140   RDDALLVEEAKLVGIDQPKKHLISQLLQGDDYQLKVVSVVGMGGLGKTTLVKRVHEDPEV  199

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   AW+TVSQT   + +LKD+I+QL  E ++PVP+ + SM   +LK  +K+FL + 
Sbjct  200   RRHFPVRAWVTVSQTCDFQYLLKDLIRQLHEEGQKPVPQSIESMTTTELKKFIKDFLQQA  259

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGC-RAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              +Y IVFDDVW    W  IK  LP+   G  R M++TR  DVAS+S  ++ G++Y M PL
Sbjct  260   GRYAIVFDDVWDMEFWNTIKFALPESSDGGNRVMLTTRKADVASASCIESLGFVYRMDPL  319

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S E SWAL C K F   +CP HL ++ K IL +C GLPLAI+AI G+LA K+     EW 
Sbjct  320   SFEDSWALFCNKIFKGGNCPGHLMDVAKGILGKCEGLPLAILAISGLLALKDVNRTEEWE  379

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              +  SLG + EG  + + ++ IL LS++DLP +LK C +Y SI+PED  I    LI  W 
Sbjct  380   MVRRSLGGELEGTGKLDRVKKILSLSYSDLPWHLKTCLLYTSIFPEDWDIGCVRLINLWI  439

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              E FV+ + G ++E+VA GYL EL+NRSLI   K+  +GS    R+HDL RE+IL KS +
Sbjct  440   AERFVEWRVGMSIEDVALGYLSELVNRSLIQVTKVFYEGSPDFCRVHDLLREVILLKSRE  499

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              N VT    +   WP+  + L + G         QG +                      
Sbjct  500   QNLVTATTGQPTRWPKMLKVLDLRG---------QGAQ----------------------  528

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                             E +P EIF++ HLRYL+L  T+V+ +P++I KL+ LE LDL  T
Sbjct  529   ----------------EEIPNEIFKMFHLRYLNLYGTRVERVPKAIGKLQHLEFLDLSNT  572

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V ELP+EILKLQ LR L V                                        
Sbjct  573   RVRELPMEILKLQKLRVLTVSQL-------------------------------------  595

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EEDVVLDVNY  1788
                  EIGKL +L+ L I  LR EDGK +CSS+  L  L+ L++ SI   ++  ++D+N+
Sbjct  596   -----EIGKLTQLRELGIANLRREDGKELCSSLANLTSLQELSVYSIGKGDDHEMIDLNH  650

Query  1789  ------LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLEHLQDLP  1944
                    SS    L+ L L G + KMP W+  L  LV+I   WS+L+  +DPLE LQ LP
Sbjct  651   PSLSSLSSSFLQSLRLLILHGRLEKMPQWVAHLHGLVRIDLDWSRLRGQEDPLESLQHLP  710

Query  1945  NLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQ  2124
             NL  + F   Y GE + F AG F  L+ L+L ++E LR + + EGA+PHL+KL +Q+   
Sbjct  711   NLGEINFCGSYQGEGLCFKAGGFPKLKELHLKRMEGLRWMRVEEGALPHLQKLFLQQLPS  770

Query  2125  LASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKR--GEDYCKVSHISEVYYTYWKD  2289
             L  +P GI+ L  LR L  F+M+       L +++   EDY +++HI E+   ++ D
Sbjct  771   LEELPMGIQHLIQLRRLNLFEMSSQLREKLLENQKEESEDYTRIAHIPEILIGFYTD  827



>emb|CDP20972.1| unnamed protein product [Coffea canephora]
Length=734

 Score =   498 bits (1283),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 326/789 (41%), Positives = 460/789 (58%), Gaps = 95/789 (12%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKD-DPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P++ LIS LL+  D  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  9     RDDALLVEEAKLVGIDQPKQHLISKLLEGHDHQLKVVSVVGMGGLGKTTLVKKVHEDPDV  68

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             +KHF   AW+TVSQT    ++LKD+I+QL+ ELK+ VP  + S    +LK IVK+FL + 
Sbjct  69    RKHFPVRAWVTVSQTCDFPKLLKDLIRQLYEELKESVPGSIESKTTAELKKIVKDFLQKA  128

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  +G R M++TR  DVA+S  T++   +Y M PLS
Sbjct  129   GRYAIVFDDVWDVEFWNEIKFALPEGNYGNRVMLTTRNADVAASC-TESQDCVYRMKPLS  187

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HL ++ K +L +C GLPLAI+AIGG+LA+K+ + I+EW  
Sbjct  188   NEDSWTLFCNKIFKGNRCPAHLMDVAKAVLDKCDGLPLAILAIGGLLASKDVSRIDEWEM  247

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + HSLG       + E ++ IL LS+NDLP +LK C +YL+IY ED+ I  + LI  W  
Sbjct  248   IQHSLG------GKLERVKRILSLSYNDLPSHLKPCLLYLTIYSEDYPINCHMLILLWIA  301

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA  YL ELINRSLI   K+  +G+    RIHDL RE++L KS + 
Sbjct  302   ERFVEWRDGMSIEDVAWAYLSELINRSLIQVTKVFYEGTPHTCRIHDLLREVMLIKSREQ  361

Query  1081  NFVTTIDEETAAWP--EKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             N V     +   WP  EK R L++H +                                I
Sbjct  362   NMVIVTTGQPMTWPSEEKVRRLAIHSS-------------------------------NI  390

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
             L S +++KVLDL +  +E  P EIF LL+L YLSL  TKVK +PR+I KL+ LE L+L  
Sbjct  391   LRSSKLLKVLDLTNEEIEATPNEIFNLLYLTYLSLYGTKVKRVPRAIGKLQHLEYLNLGD  450

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T V ELPVEILKLQ LR+LIV+  V                                 +P
Sbjct  451   TGVRELPVEILKLQKLRYLIVFQRV---------------------------------DP  477

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI---EEDVVLDVN  1785
              +  ++EIGKL +L+ L I +LR EDGK +CSS+  L  LR L++ S+   ++  ++D+N
Sbjct  478   SD--VKEIGKLTQLRELYITQLRREDGKELCSSLVNLTSLRQLSVASVGKGDDSEIIDLN  535

Query  1786  ---------YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLEHL  1932
                         S    L+ L + G +  MP W   L+NLVKI   WS L+  +DPLE L
Sbjct  536   HHQHSLSSSSSCSFLQSLRVLIMYGRLETMPVWTTHLQNLVKIVMNWSGLRAEEDPLESL  595

Query  1933  QDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQ  2112
             Q LPNL  + F   Y GE + F AG F  L+ L L ++E LR + + EG  P+L +LV++
Sbjct  596   QHLPNLDEISFCGSYQGERLCFKAGGFLKLKRLWLRRMEGLRWMTVEEGVCPNLRRLVLE  655

Query  2113  RCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFL-PDKRGEDYCKVSHISEVYYTYW-K  2286
             +   L  +P+GI+ L +L+ L  + ++   +      ++  EDY +++HI E+   ++  
Sbjct  656   QLPLLEDLPSGIQHLTHLQELGLYKLSSRLMEKVENQEEDSEDYRRMAHIPEIVIGFYTD  715

Query  2287  DGCWEVNSV  2313
             DG W +  +
Sbjct  716   DGGWSIRRL  724



>ref|XP_010092366.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXB51042.1| Disease resistance protein RPM1 [Morus notabilis]
Length=1024

 Score =   507 bits (1305),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 318/743 (43%), Positives = 453/743 (61%), Gaps = 13/743 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDVK  186
             D R D+  LEE E+VG+++ R ELI+++  + P  KVIS+VGMGG GKTTL   VY  VK
Sbjct  161   DPRQDSCFLEETEVVGVQSTRDELIAMVENESPQRKVISLVGMGGLGKTTLAHQVYIRVK  220

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
               F  HAWI VSQT+   E+L++++++ +   ++PVPE +  M+   L   ++++L  ++
Sbjct  221   GGFDCHAWIEVSQTYNKVELLQNLLRKFYEAREEPVPERIDVMDQITLTTKIRDYLRGKR  280

Query  367   YVIVFDDVWTARVWEAIKHVL--PKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             Y +VFDDVW +  W  +K+ L  P EK G R +I+TR ++VA      +  YI+EM  L 
Sbjct  281   YFVVFDDVWNSTFWADVKNALLDPNEKSG-RIIITTRYVNVAIFCKESSCVYIHEMQCLP  339

Query  541   EEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
                +W L C KAFH      CPS+L ++ ++I++RCGGLPLAIV I G+L+TKNKT  +E
Sbjct  340   LHNAWELFCNKAFHYDFQGHCPSNLEKLSREIVERCGGLPLAIVVIAGLLSTKNKT-ADE  398

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             WG L  SL  + E N++  S+  IL LS+NDLP +LK CF+Y  I+PED+ I    LI Q
Sbjct  399   WGRLLTSLSSELESNERLTSIEKILSLSYNDLPYHLKSCFLYFGIFPEDYSIRRRRLIRQ  458

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  EGFV  K  KT+E VAE YL ELINRSL+   +++ +G  K  RIHDL REI   K 
Sbjct  459   WIAEGFVNPKKDKTLEVVAEEYLVELINRSLVQVSEIDLNGKPKSCRIHDLLREIAFKKM  518

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTK-LRSLLTFNVTDSQFSSHVV  1248
              D +F   +    + +   AR +S++    +A      T  +RSLL F   D    S   
Sbjct  519   EDLHFCQVLSRRDSKFRGFARRISIYYCSDDAFASHSKTSHVRSLLIF-AKDGMLDSLGN  577

Query  1249  QILSSCRVIKVLDLQ-STSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILD  1425
              I  + +++KVLD + +  L+ +PE+I +L HLRYLS+R T+V+ LP+SI+KL  LE LD
Sbjct  578   IISHNFKLLKVLDFEDAPRLDHLPEDIGKLFHLRYLSVRGTRVQFLPKSIRKLENLETLD  637

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVE  1605
             L+ T V EL VEI +LQ LRHL+V+      Y   N   G K  KG+G L +L+KL +++
Sbjct  638   LRKTLVYELLVEINRLQKLRHLLVHHSDGGEYFRKNIQWGVKVNKGIGLLKALQKLYFLD  697

Query  1606  ANPGNGTIEEIGKLNELKR-LCILKLRTEDGKAVCSSIEkllklrsl-nlksIEEDVVLD  1779
             A+     + E        R L I  LR+EDGK +C SI+++  L +L    S+     LD
Sbjct  698   ASIVKVDVLEELSELMELRKLGIKNLRSEDGKTLCGSIQRMEYLETLDISSSVSGKGTLD  757

Query  1780  VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHL  1959
             +  +SSP   LQRLYL G+M K P+WI  L+NL++I    S+++DDPL  LQ+LPNL+ L
Sbjct  758   LESMSSPSKFLQRLYLEGHMTKFPNWITELQNLIRIRISRSRMQDDPLTSLQNLPNLLEL  817

Query  1960  EFLV-GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
             E  +  Y GE +HF  G F+ L++L L  L  L  +VI EGA+ +LEK  I  C Q+  +
Sbjct  818   ELNIESYCGEKLHFEEGAFRKLKVLYLIHLYGLNLIVIEEGALCNLEKFYIGPCPQMKEL  877

Query  2137  PAGIECLFNLRYLEFFDMTDDFI  2205
             P G + L NL+ + F +M   F+
Sbjct  878   PIGFQHLRNLKLVRFVEMPTHFL  900



>emb|CDP20946.1| unnamed protein product [Coffea canephora]
Length=831

 Score =   501 bits (1289),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 315/774 (41%), Positives = 443/774 (57%), Gaps = 74/774 (10%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE E+VGI+ P+++L+S LL+ D+  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  103   RDDALLVEEAELVGIDKPKQQLVSQLLEGDESQLKVVSVVGMGGLGKTTLVKKVHEDFDV  162

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   A++TVSQ     E+LKD+ +QL  +LK+PVPE + +M A +LK+ VK FL + 
Sbjct  163   RRHFPVRAFVTVSQPCNFLELLKDLTRQLHNDLKKPVPESIEAMTAFQLKLCVKNFLQQA  222

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW   VW  I+  LP+  +G R M++TR +DVAS+S   +  Y+++M PLS
Sbjct  223   GRYAIVFDDVWDVEVWNEIRFALPENGYGNRVMLTTRKVDVASASCNKSQDYVFKMAPLS  282

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F  + CP+HLT++ K IL +C GLPLAI+AIGG LA K+     EW  
Sbjct  283   FEDSWTLFCNKIFKGNGCPAHLTDVAKGILGKCQGLPLAILAIGGFLALKDFLIAEEWEM  342

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SL  + EG+   + +R IL LS+NDLP +LK C +YLSIYP+D+ I+ + L+  W+ 
Sbjct  343   VRRSLVGELEGSGMLDRVRKILSLSYNDLPCHLKTCLLYLSIYPDDYEIDCHKLVLLWSA  402

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV ++ G T+ +V   YL ELI+RSLI   +   +G     RIHDL RE++LSK+ + 
Sbjct  403   ERFVGKREGMTMMDVGFNYLRELISRSLIQVTQSFYEGIPYFCRIHDLVREVVLSKAREQ  462

Query  1081  NFVTTIDEETAAW-PEKARHLSVHGTLGNAQMKRQG-----TKLRSLLTFNVTDSQFSSH  1242
             N +     +   W  EK R L VH    N +  ++        LRS +T    +   S  
Sbjct  463   NMIAITTGQYTKWLSEKVRRLVVHSCSNNTEQHQESQCYSFNHLRSFITIESMNPLISRT  522

Query  1243  VV-QILSSCRVIKVLDLQS-TSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
             ++ ++L S R++KVLDL    +LE +P E+F L HLR+L+L  T VK +P  I KLR LE
Sbjct  523   LLSEVLKSSRLLKVLDLSDEETLEKIPNEVFNLYHLRHLNLCRTGVKAVPNFIGKLRNLE  582

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              L L+ T V ELPVEILKLQ L HL+V   V  +                          
Sbjct  583   YLGLRETQVKELPVEILKLQKLEHLMVLKKVDVSDERLQALQSLST--------------  628

Query  1597  YVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
              ++A+ G+  ++EIG L +L+RL I  LR EDGK +CSS+                   L
Sbjct  629   -IDASSGSVGVKEIGALTQLRRLGISNLRREDGKVLCSSL-----------------ATL  670

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKD--DPLEHLQDLPNL  1950
               N                           L++L +I   WS L+D  DPLE L  LPNL
Sbjct  671   TTN---------------------------LQSLARIDLYWSGLRDEEDPLEPLHHLPNL  703

Query  1951  VHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLA  2130
             V + F   Y GE + F AG F  L+ L L KLE+L+ + + EGA+P L +L + R   L 
Sbjct  704   VTIIFCGSYQGEGLCFKAGGFLKLKDLYLKKLEKLKWLKVEEGALPSLHELSLDRLPLLE  763

Query  2131  SVPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWKD  2289
              +P GI+   NLR L   +++   +      +++ EDY K++H+SEV    W D
Sbjct  764   ELPLGIQHSRNLRKLYLSELSSQLMEKLENLNEQTEDYRKIAHVSEVVIELWTD  817



>ref|XP_006388619.1| hypothetical protein POPTR_0137s00230g [Populus trichocarpa]
 gb|ERP47533.1| hypothetical protein POPTR_0137s00230g [Populus trichocarpa]
Length=820

 Score =   499 bits (1284),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 290/733 (40%), Positives = 423/733 (58%), Gaps = 85/733 (12%)
 Frame = +1

Query  28    LLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD-DVKKHFQSH  204
             ++EE  IVGIE P+K LI  L++                G++   K+ +D DVKKHFQ  
Sbjct  117   IVEEANIVGIEKPKKHLIEWLVR----------------GRSEREKVYHDADVKKHFQFR  160

Query  205   AWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVIVFD  384
              WIT+S +FK E++LKD+IQQLF  L++ VP+GM   + ++LK  +  FL +++Y+IV D
Sbjct  161   VWITLSPSFKEEDLLKDIIQQLFRVLQKNVPQGM---DNDRLKTAINRFLQKKRYLIVLD  217

Query  385   DVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSWALL  564
             DVW    W+A + V P    G   +++TR  ++  +       +++ +    ++  W L 
Sbjct  218   DVWHTDAWDAFEPVFPNNSRGSHILLTTRKTEIKCTI------WVHYL----QKSLWTLF  267

Query  565   CRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSLGPD  744
             C+K F  + CP+HL  + ++IL RC GLP AI A+ GVLAT++++ I+EW  +  SLG  
Sbjct  268   CKKVFQNNDCPAHLKNVSERILGRCEGLPFAIEAMSGVLATRDRSKIDEWEMVCLSLGAG  327

Query  745   FEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVKQKA  924
             F+ N++  +   IL LS+ DLP YLK C +Y S++PE   I+   LI  W  EGFVK + 
Sbjct  328   FKDNNRMRNALKILSLSYYDLPYYLKSCLLYFSMFPEGIPIQRMRLIRLWIAEGFVKGRE  387

Query  925   GKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTTIDE  1104
             G T+EEVAE +L ELI RSL+  V+    G +K  RIHDL REI+++K+ + +FV    E
Sbjct  388   GMTLEEVAEDFLNELIKRSLVQVVEATSYGQVKTCRIHDLLREILITKAKEQDFVAIAKE  447

Query  1105  ETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSCRVIKVL  1284
             +   W EK R +S+H  + + +     ++LRSLL F   D           S  R++ VL
Sbjct  448   QNMIWSEKVRRVSIHNDMPSMRQIHVASRLRSLLVFWGIDYFPGPPKFISPSRSRLLTVL  507

Query  1285  DLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTELPVEI  1464
             D++ T L+  P E+  L+ L+YLSLR+TKV  +P SI KL+ LE LDLK+  VTELP +I
Sbjct  508   DMEGTPLKEFPYEVVSLIFLKYLSLRNTKVNSVPSSISKLQNLESLDLKHAQVTELPADI  567

Query  1465  LKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIEEIGK  1644
             LKLQ LRHL+V   + F                                 G      I K
Sbjct  568   LKLQKLRHLLVLGILKF-----------------------------RKEDGKDLCSSIDK  598

Query  1645  LNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLLQRLY  1824
             L  L+ L +                           SI E  V+D+ YLSSPP  LQRLY
Sbjct  599   LTNLRALSV--------------------------TSITESEVIDLEYLSSPPQFLQRLY  632

Query  1825  LSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHMHFNA  2004
             L+G + ++P WI SL +LVK+  +WS+L++DPL  LQ+LPNLVHLEF+  Y+GE +HF+ 
Sbjct  633   LTGRLERLPDWILSLDSLVKLVLKWSRLREDPLLFLQNLPNLVHLEFIQVYSGEALHFSN  692

Query  2005  GKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRYLEFF  2184
               F+ L++L L+KLE L+++ + +GA+P L+KLV+Q C  L  VP+G++ L  L+ L+FF
Sbjct  693   EGFEKLKVLGLNKLERLKSITVQKGALPSLQKLVVQGCKPLQKVPSGMKHLTKLKTLDFF  752

Query  2185  DMTDDFISTFLPD  2223
             DM  DF+    PD
Sbjct  753   DMPYDFVKRLRPD  765



>ref|XP_010652498.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010652499.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Vitis 
vinifera]
Length=878

 Score =   500 bits (1287),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 305/718 (42%), Positives = 448/718 (62%), Gaps = 9/718 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +D R  +L +++ EIVGIE+  ++L S L++  P   VISVVGMGG GKTTL K VYD+ 
Sbjct  156   HDPRVTSLFIDDAEIVGIESQNRKLTSRLVEGTPKRTVISVVGMGGLGKTTLAKKVYDNK  215

Query  184   K--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             +   +F   AWITVSQ+FK+EE+L++M ++ +   K+ VPEG+ + +   L  + + +L 
Sbjct  216   ELVGYFDCSAWITVSQSFKMEELLRNMSKKFYQSRKEAVPEGLDTTDEMSLITLTRGYLQ  275

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++YV+VFDDVW    W  IK VLP+   G R +I+TR  +VASS    +  YI+++ PL
Sbjct  276   DKRYVVVFDDVWKLDFWGIIKCVLPENGKGSRIIITTRNDEVASSCIESSFDYIHKLQPL  335

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             S + SW L C+K F    CP  L ++   I+KRCGGLPLAIVA+GG+L+ K K  I EW 
Sbjct  336   SPKSSWELFCKKTFQGG-CPPDLEKLSLDIVKRCGGLPLAIVAVGGLLSRKEKL-IPEWK  393

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
                 +L  +F+ N   ES+  IL LS++DLP YLK CF+YL+I+PED+ I    L   W 
Sbjct  394   KFSDNLRSEFQSNSHLESINTILSLSYHDLPYYLKSCFLYLAIFPEDYTIRCGPLTRLWI  453

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFVK K    +E+VAE +L ELI+R+L+    +  DG ++   IHDL REIIL K+ +
Sbjct  454   AEGFVKAKKDVMLEDVAEEFLTELIHRNLVQVSDVYADGKIESCHIHDLIREIILKKAAE  513

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGN-AQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
              +F   +  E +++    RHLSVH +  N   +  + + +RS+  +N   SQ    + ++
Sbjct  514   LSFCCLMTGEASSFDGGFRHLSVHNSSYNVVNIIGKKSHIRSIFLYN---SQM-FFLEKL  569

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              S   ++KVLDL  + L+  PE +  LLHLRYLSLR+TKV++LPRSI KL+ L+ LDLKY
Sbjct  570   ASRFNLLKVLDLNDSGLDSFPENLGNLLHLRYLSLRNTKVRMLPRSIGKLQNLQTLDLKY  629

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             + V +LPVEI +L+ LR+++  ++     L      G +  +G+G L  L+KL  VEAN 
Sbjct  630   SLVEDLPVEINRLKKLRNILAQNYDFDGDLGMFSVKGVQVKEGIGCLEELQKLSCVEANH  689

Query  1615  GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLS  1794
             G G I+E+GKL +L++L I KL  E+GK + +SI  + +L SL++ S+ E+ +LD+ ++S
Sbjct  690   GVGVIKELGKLRQLRKLSITKLTRENGKHLFASITNMNRLESLSISSLSEEEILDLQHVS  749

Query  1795  SPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVG  1974
              PP  L RL L G + K+P WI  L+NL  +    S L +DP++ LQ LPNL  L+ +  
Sbjct  750   YPPSCLTRLKLIGPLEKLPDWISELQNLSIVILYGSNLMNDPVKVLQALPNLQMLQLMRA  809

Query  1975  YTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
                E + F A  FQ L+ L +  L  ++ V I  GA+P LE L++  C QL  +P G+
Sbjct  810   SAVEELCFEATGFQKLKRLVVLYLVGVKRVKIENGALPLLETLLVGPCPQLEELPPGM  867



>ref|XP_010092359.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXB51035.1| Disease resistance protein RPM1 [Morus notabilis]
Length=974

 Score =   502 bits (1293),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 308/741 (42%), Positives = 452/741 (61%), Gaps = 10/741 (1%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDVK  186
             D R D+L L+E E++GI++ R +LI  L       +VI++VGMGG GKTTL   +Y  VK
Sbjct  163   DPRKDSLFLQETEVMGIDSIRDKLIERLEDKSHNREVITLVGMGGLGKTTLANQIYYCVK  222

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
               F  HAW+ VSQ++   E+L+ ++++ F E ++PVP  + +M+ + +   +K++L  + 
Sbjct  223   GRFDYHAWVEVSQSYDNAELLRKLMKKFFQEREEPVPMEIDTMDESTVTTKLKDYLQGKS  282

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRA-MISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             Y++VFDDVW    W+ +K+ LP +   CR  +I+TR + VA+S    T+ YI+ M PL +
Sbjct  283   YIVVFDDVWNVSFWDGVKNALPYKNEQCRGIIITTRDVKVANSCKRSTSVYIHHMEPLHQ  342

Query  544   EVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             E +W L C +AF       CP+ L ++  +IL RC GLPLAIV I GVL+TK+KT   EW
Sbjct  343   ETAWELFCNRAFQYDFEGHCPADLEKLSLEILTRCEGLPLAIVVIAGVLSTKSKTP-EEW  401

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
                  +L  + E N+   S+  IL LS+N+LP YLK CF+Y  I+PE + I    LI QW
Sbjct  402   QKFRTTLSSELESNEHLASIDKILSLSYNNLPYYLKSCFLYFGIFPEHYSIRCRRLIRQW  461

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFV +K  KT+E VA  YL ELINRSL+   +++ DG  +  RIHDL REI++ K  
Sbjct  462   IAEGFVNKKKDKTLEVVAGEYLTELINRSLVQVSEVDFDGKPRSCRIHDLLREIVVKKME  521

Query  1075  DHNFVTTIDEETAAWPEKARHLSV-HGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
             D +F   +      +    R LS+ H +    +   + + +RSL  F V D    S    
Sbjct  522   DLHFCKVLSRSDTTFKGFTRRLSILHSSSDAFESFSKTSHVRSLFVF-VKDEIPVSLPSV  580

Query  1252  ILSSCRVIKVLDLQST-SLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
             I ++ +++KVLD +   SL+ +PE++  L  LRYLS+R T+V  LP++I KL  LE LDL
Sbjct  581   ISTNFKLLKVLDFEYVPSLDNLPEDVGNLFFLRYLSVRGTRVMFLPKAIGKLENLETLDL  640

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K + V E+P EI +L  LRHL+ Y     A    N   G K  KG+ +L +L+KL ++EA
Sbjct  641   KRSLVHEIPAEINRLHKLRHLLGYHFDEKADWSINSVRGVKIQKGIRRLRALQKLYFIEA  700

Query  1609  NP-GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             N  G     E+ +L EL++L I KLR+EDG+A+C  I+++  L SL++ S  ED  +D+ 
Sbjct  701   NTIGIDVFRELRELRELRKLGIKKLRSEDGRAMCDCIQEMEHLESLSICSTREDEKIDLE  760

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE-  1962
              LSSPP  L+RLYL G++GK+P WI  L+ LV+I   WSKL+DD +E LQ+L NL+ +  
Sbjct  761   CLSSPPQFLRRLYLKGHLGKLPEWIPKLQYLVRIRISWSKLEDDLIETLQNLQNLLEIGL  820

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
             F   Y GE +HF  G F  L++LN+  L  L ++ I EGA+ +LE+L I  C +L  +P 
Sbjct  821   FHDAYYGEKLHFKVGTFGKLKVLNMMSLNRLNSISIEEGALCNLEELSIGPCPELKKMPL  880

Query  2143  GIECLFNLRYLEFFDMTDDFI  2205
             G + L NL+ L F +M  +F+
Sbjct  881   GFQHLRNLKLLRFSEMPPEFM  901



>ref|XP_011011151.1| PREDICTED: disease resistance protein RPM1-like [Populus euphratica]
Length=895

 Score =   500 bits (1287),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 313/756 (41%), Positives = 456/756 (60%), Gaps = 18/756 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R DAL L+E ++VGIENP+  L+S L++ +  L  ISVVGMGG GKTTLVK VYD  
Sbjct  151   HDPRLDALYLDEADVVGIENPKHLLVSWLVEGEEKLSSISVVGMGGLGKTTLVKKVYDSH  210

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              +++ F +H+W+TVS++F   E+L+  +Q       + VP+ + SM   +L   ++ +L 
Sbjct  211   PIRRSFDTHSWVTVSKSFASTELLRVALQGFLVTANETVPDNLQSMTDLQLIDALRNYLW  270

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             RR+YVIV DDVWT   WE IK+  P    G R + +TRL ++A S   +   ++YE+  L
Sbjct  271   RRRYVIVLDDVWTVNAWETIKYAFPDCNCGSRIIFTTRLSNLAES--IENTSHVYELQAL  328

Query  538   SEEVSWALLCRKAF---HASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
              E  +W L C KAF   H + CP  L E+ + IL++C GLPLAIVAIGG+L+ K    + 
Sbjct  329   PENEAWTLFCMKAFRGEHKAVCPPELEEMSRNILRKCEGLPLAIVAIGGLLSKKKNGGL-  387

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  ++  L  + + N+   SLR IL LS+++LP  LK C++YL+ +PED+LI+   LI 
Sbjct  388   EWKKVHDCLATELKSNNDLGSLRRILQLSYDNLPYDLKQCYLYLNAFPEDYLIKRRKLIR  447

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W +E FV++K G T+EEVAE YL EL+NRSLI  V++N    +K  R+HDL REII  K
Sbjct  448   LWIVERFVEEKRGFTMEEVAEEYLNELVNRSLIQVVEMNYFNRVKTCRVHDLMREIIQMK  507

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
             S + +FV   +    +  EK R LS+H    N++  R   +   L  +++        + 
Sbjct  508   SREESFVMIANGTRISKNEKVRRLSIH---ENSEEARSDMRFPYL--WSLLSFSSHHSLE  562

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
                 + ++++VL+L    L     E+ +L+HLRYLSLR T +  LP SI+KL+ LEILDL
Sbjct  563   HGFRNYKLLRVLNLDRAPLSSFLPELVELIHLRYLSLRWTTISELPESIRKLKYLEILDL  622

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHV--SFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             K + V+ LP  I +L  L  L  Y ++  S ++ P   + G + P G+G+L SL+KL  V
Sbjct  623   KRSPVSSLPAGITQLTCLCQLRNYRYIFQSSSFFP--DTHGMRVPSGIGRLTSLQKLGSV  680

Query  1603  EANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
             E N     + E+GKL +L+RL +LKLR E G  +C ++++L  L +L L S+  +  L  
Sbjct  681   EVNEDYELVRELGKLTQLRRLDVLKLREEQGMDLCYALDRLKHLTALYLGSLNNNEFLHF  740

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
             + LSSPP  LQRL L   +  +P WI SL+ + K+  ++S LK DPL+ LQ LP+LV LE
Sbjct  741   DSLSSPPKYLQRLNLKCSLPALPGWIASLQYISKLVLQYSNLKSDPLKALQKLPSLVMLE  800

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
                 Y GE ++ +   F  L+ L L +LE LR + I +G+MP LE+L I  C  L +VP 
Sbjct  801   LCQAYAGEELYCDPNGFSKLKRLGLHELERLRRIRIAKGSMPGLERLDITACTVLETVPD  860

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKV  2250
             GIE L N+  L  + M   FI T +   RGED+ +V
Sbjct  861   GIENLKNIEDLVLWYMPSTFIKT-IEMHRGEDFWRV  895



>emb|CDP11699.1| unnamed protein product [Coffea canephora]
Length=739

 Score =   494 bits (1273),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 301/721 (42%), Positives = 447/721 (62%), Gaps = 29/721 (4%)
 Frame = +1

Query  130   GMGGSGKTTLVKMVYDD--VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEG  303
             G GG GKTTL K VYDD  VKK FQSHAWITVSQ F+ + +++++IQQL+ E++QPVP  
Sbjct  36    GNGGLGKTTLAKKVYDDAAVKKQFQSHAWITVSQNFQCDVIIRNLIQQLYEEIRQPVPPQ  95

Query  304   MGSMNANKLKVIVKEFLLRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDV  483
             + SM   +L   VK+FL  R+Y++V DDVW+   W+ IK+VLP      R +++TR+ DV
Sbjct  96    VESMKGIRLSEFVKDFLKERRYILVLDDVWSLNAWQTIKYVLPDCNIASRIVLTTRITDV  155

Query  484   ASSSSTDTNGYIYEMTPLSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIV  663
             AS+S   ++ +I++M+PLS + SW L C + F ++ CPS+L E+ ++ILK+C GLPL IV
Sbjct  156   ASASCLASHDFIHKMSPLSYDDSWTLFCNRTFQSNGCPSYLEEVCRKILKKCEGLPLGIV  215

Query  664   AIGGVLATKNKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLS  843
              +GGVLA K+K  I+EW  +    G + +G+ + + +R ILLLS++DLP +LK C +YLS
Sbjct  216   TMGGVLALKDKDKIDEWEMILREFGREVDGSGKLDRIRRILLLSYSDLPHHLKNCLLYLS  275

Query  844   IYPEDHLIEHNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMK  1023
              YPEDH I+   L+ +W   GF++++ G    ++A  YL EL+NRSLI       DG + 
Sbjct  276   TYPEDHPIDVAKLLDKWIALGFIEKEEGMIATDIAMRYLKELVNRSLIQVKVTWADGKLV  335

Query  1024  QGRIHDLYREIILSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTK-LRS  1200
             +  +HD  REII+SKS + +F T        WP+K RHL++H    N        K LRS
Sbjct  336   KCGLHDFLREIIVSKSKEQSFTTVATGYCTRWPDKVRHLAIHNFTDNLSQGFSRLKCLRS  395

Query  1201  LLTFNVTDSQFSSHVVQILSSC-RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVK  1377
             + TF   D   +S + + L    + +KVL+L    L+ +P+E+F+L HL++L+L  T+VK
Sbjct  396   VETFGYEDPLTTSFLSKFLCGGPKFLKVLNLYKAELDNIPKEVFKLFHLKFLNLSETRVK  455

Query  1378  VLPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAP  1557
             V+P+SI +L+ LE L L  T +TE+               YS+ +FA        GFK+P
Sbjct  456   VIPKSIGQLQNLEFLFLDETTITEVG-------------DYSN-NFALW------GFKSP  495

Query  1558  kglgklgsleklVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklr  1737
              G+GKL SLE L  +EA+ GN  + EIGKL +L++L I KLR EDGK + SS+ +L  LR
Sbjct  496   DGIGKLTSLETLRIIEADGGN-IVREIGKLIQLRQLFITKLRREDGKELVSSLLRLTNLR  554

Query  1738  slnlksIEEDVVLDVNYLSSPP-PLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKD  1914
              L++ SI+E+  LD+ +  SP    L RL L+G + ++P W+ SL++L  ++ + S+L +
Sbjct  555   ELHIGSIKEEETLDLQHSISPRLGFLTRLSLTGRLERVPEWVMSLQSLGTLFLQNSELSE  614

Query  1915  D--PLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMP  2088
             D   ++ L  LPNLV L     Y GE + F AG+F  L+ L L +L+ L+ V + E +M 
Sbjct  615   DKNAIDCLGHLPNLVDLILHRAYEGETLCFKAGRFPKLQRLELGQLKRLKWVRVEEESMF  674

Query  2089  HLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISE  2265
              LE  VI  C  +  +P G++ L  L++L F+DM DD I      D + + Y  +SHI +
Sbjct  675   SLEVFVIAGCKLMEGLPLGLQNLTKLKFLGFYDMFDDLIHKVQNLDNQSDYYQTISHIPQ  734

Query  2266  V  2268
             V
Sbjct  735   V  735



>ref|XP_004498891.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004498892.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Cicer 
arietinum]
 ref|XP_004498893.1| PREDICTED: disease resistance protein RPM1-like isoform X3 [Cicer 
arietinum]
 ref|XP_004498894.1| PREDICTED: disease resistance protein RPM1-like isoform X4 [Cicer 
arietinum]
Length=949

 Score =   500 bits (1287),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 306/764 (40%), Positives = 462/764 (60%), Gaps = 18/764 (2%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLK-VISVVGMGGSGKTTLVKMVYDD--V  183
             R  +L +EEDE+VG E PR E++  L+  +   + VISVVGMGG GKTTL K V+D+  V
Sbjct  167   RLASLFIEEDELVGFEKPRDEIVGWLVDGEVIDRSVISVVGMGGLGKTTLAKNVFDNPQV  226

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             K HF   A++ VSQ++ VE +L++M+ Q   E K+P+P G  +M+  +L  + + +L  +
Sbjct  227   KGHFDCRAFLVVSQSYNVEALLRNMMMQFSEETKEPLPRGTNTMDKMQLITLARSYLQSK  286

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +YVI FDDVWT   W+ I+   P  K G R MI+TR +DV++    D+   ++++  L  
Sbjct  287   RYVICFDDVWTINFWDEIQLATPDNKKGSRIMITTRNLDVSNYCRKDSCVQMHKLQSLPP  346

Query  544   EVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
               +W L C KAF      +CP  L +I ++I+++C GLPLAIVA+GG+L+TK+KT ++EW
Sbjct  347   NKAWELFCNKAFRFDFYGNCPPELKDISEEIVQKCEGLPLAIVAVGGLLSTKDKT-VSEW  405

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               L  +L  + + N    +L  IL LS+ DLP +LK C +Y  IYPED+ I  + LI QW
Sbjct  406   KKLCQNLSLELDRNPHLANLPRILGLSYEDLPHHLKSCMLYFGIYPEDYSIRSSRLIRQW  465

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFVK + GK++EEV E YL ELI+RSL+   +++ DG     RIHDL RE+I+ K  
Sbjct  466   IAEGFVKHEVGKSLEEVGEEYLIELIHRSLVHVSRVHYDGKATSCRIHDLLREMIMRKMK  525

Query  1075  DHNFVTTIDEETAAWPEKA----RHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSH  1242
             D +F   + E+            R L+V  +  N     +   +RSL  FN   +     
Sbjct  526   DLSFCHVVREDNQEHISDVIVTIRRLAVETSSSNVLRSIEHFPIRSLYIFNAFINFPDYF  585

Query  1243  VVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEIL  1422
               +I +  +++KVLDL+   L  VP+EI  L HL+YLSLR T VK LP+SI KL+ LE L
Sbjct  586   GSKIFAKSKLLKVLDLEGAWLNYVPDEIGNLFHLKYLSLRYTNVKNLPKSIGKLQNLETL  645

Query  1423  DLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             DLK T V ELP EI +L  LRHL+VY   +++ +  +   G K  +G+G +  L+KL ++
Sbjct  646   DLKETLVCELPSEINRLLKLRHLLVYCRKTYSSI--SGESGVKMMEGVGGMTVLQKLYHI  703

Query  1603  EANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             E N G    I E+ KL +L++L +  ++ E G A+C SI+++  L SL++ +I E  ++D
Sbjct  704   EVNHGGLNLIAELRKLRQLRKLGLKNVKREYGNALCDSIKEMNCLESLHVSAINEHEIID  763

Query  1780  VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHL  1959
             + ++SS P L Q L+L G + K+P+WI  L +LV++  R+SKLKDDPL+ L+DLPNL+ L
Sbjct  764   LQFISSLPQLRQ-LHLFGRLEKLPNWISRLDHLVRLSIRFSKLKDDPLKLLKDLPNLLRL  822

Query  1960  EFLV-GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
               +   Y GE +HF  G F+ L  L L +L  L +++I  GA P ++ + +    +L  +
Sbjct  823   AIVCDAYDGEMLHFQVG-FKKLNNLYLVQLNNLNSILIDNGACPAIKLIEMVHIPKLKEI  881

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEV  2268
             P  I  L +L  L F DM  +F  +  P+   +++  + H+ +V
Sbjct  882   PTDIHLLKSLETLYFIDMPYEFNQSIDPNGGPKNWV-IQHVQKV  924



>gb|ABF81443.1| NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=903

 Score =   498 bits (1282),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 310/802 (39%), Positives = 448/802 (56%), Gaps = 117/802 (15%)
 Frame = +1

Query  28    LLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDVKKHFQSHA  207
             ++EE  IVGIE P+K LI  L++             G S +  L  +V+  VK H+    
Sbjct  157   IVEEANIVGIEKPKKHLIEWLVR-------------GRSEREWLEWVVW--VKPHW---V  198

Query  208   WITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVIVFDD  387
             WIT+S +FK E++LKD+IQQLF  L++ VP+GM   + ++LK  +  FL +++Y+IV DD
Sbjct  199   WITLSPSFKEEDLLKDIIQQLFRVLQKNVPQGM---DNDRLKTAINRFLQKKRYLIVLDD  255

Query  388   VWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSWALLC  567
             VW    W+A + V P    G   +++TR  +VA ++  +    +Y + PLS E SW L C
Sbjct  256   VWHTDAWDAFEPVFPNNSRGSHILLTTRKTEVALTACIEFPDKVYNLDPLSPEESWTLFC  315

Query  568   RKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSLGPDF  747
             +  F  S CP HL  + ++IL RC GLPLAI A+ GVLAT++++ I+EW  +  SLG  F
Sbjct  316   KMVFQNSHCPEHLKNVSERILGRCEGLPLAIEAMSGVLATRDRSKIDEWEKVCLSLGAGF  375

Query  748   EGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVKQKAG  927
             E N++  +   IL LS+ DLP YLK C +Y S++PE   I+   LI  W  EGFVK + G
Sbjct  376   EDNNRMRNALKILSLSYYDLPYYLKSCLLYFSMFPEGIPIQRMRLIRLWIAEGFVKGREG  435

Query  928   KTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTTIDEE  1107
              T+EEVAE +L ELI RSL+  V+    G +K  RIHDL REI+++K+ + +FV    E+
Sbjct  436   MTLEEVAEDFLNELIKRSLVQVVEATSYGQVKTCRIHDLLREILITKAKEQDFVAIAKEQ  495

Query  1108  TAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSCRVIKVLD  1287
                W EK R +S+H  + + +     ++LRSLL F   D           S  R++ VLD
Sbjct  496   NMIWSEKVRRVSIHNDMPSMRQIHVASRLRSLLVFWGIDYFPGPPKFISPSRSRLLTVLD  555

Query  1288  LQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTELPVEIL  1467
             ++ T L+  P E+  L+ L+YLSLR+TKV  +P SI KL+ LE LDLK+  VTELP +IL
Sbjct  556   MEGTPLKEFPYEVVSLIFLKYLSLRNTKVNSVPSSISKLQNLESLDLKHAQVTELPADIL  615

Query  1468  KLQHLRHLIVY---SHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIEEI  1638
             KLQ LRHL+VY   +H S   +      GFKAP  +G L S++KL ++EA+ G   + E+
Sbjct  616   KLQKLRHLLVYRYETHESDDQI--RNKHGFKAPAQIGNLLSVQKLCFLEADQGQKLMSEL  673

Query  1639  GKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLLQR  1818
             G+L   ++   L  R E                                           
Sbjct  674   GRLISFEKRLYLTGRLE-------------------------------------------  690

Query  1819  LYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHMHF  1998
                     ++P WI SL +LVK+  +WS+L++DPL  LQ+LPNLVHLEF   Y+GE +HF
Sbjct  691   --------RLPDWILSLDSLVKLVLKWSRLREDPLLFLQNLPNLVHLEFTQVYSGEALHF  742

Query  1999  NAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRYLE  2178
             +   F+ L++L L+KLE L+++ + +GA+P L+KLV+Q C  L  VP+G++ L  L+ L+
Sbjct  743   SNEGFEKLKVLGLNKLERLKSITVQKGALPSLQKLVVQGCKLLQKVPSGMKHLAKLKTLD  802

Query  2179  FFDMTDDFIS-------------TFL---------------------------PDKRGED  2238
             FFDM  DF+              TFL                           PD  GED
Sbjct  803   FFDMPYDFVKRLRPDGTAQRAARTFLQKAVVQFIKIVQILPFDMANDFIRRLHPDGDGED  862

Query  2239  YCKVSHISEVYYTYWKDGCWEV  2304
             Y +V ++ E+Y TY K+G WE+
Sbjct  863   YHEVRNVPEIYCTYQKNGNWEI  884



>emb|CDP13419.1| unnamed protein product [Coffea canephora]
Length=824

 Score =   495 bits (1275),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 303/660 (46%), Positives = 415/660 (63%), Gaps = 24/660 (4%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE E+VGI+ P+K LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  159   RDDALLVEEAELVGIDQPKKHLISQLLEGDDHQLKVVSVVGMGGIGKTTLVKKVHEDPEV  218

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   AW+TVS+T   + +LKD+IQQL  E K+PVP+ + SM   +LK IVK+FL + 
Sbjct  219   RRHFPVRAWVTVSETCDFQYLLKDLIQQLHKEGKKPVPQSIESMTTTELKKIVKDFLQQA  278

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+   G R M++TR  DVAS+S  ++  ++Y M PLS
Sbjct  279   GRYAIVFDDVWDVEFWNTIKFALPESCCGNRVMLTTRKADVASASCIESRRFVYRMEPLS  338

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L   K F   +CP HL  + K IL +C GLPLAI+AI G+LA+K+   ++EW  
Sbjct  339   VEDSWTLFRNKIFDGGNCPGHLMGVAKGILDKCEGLPLAILAISGLLASKDVNRMDEWEM  398

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG +FEG  + + ++ IL LS++DLP +LK C +Y SI+PEDH I    LI  W  
Sbjct  399   VRRSLGGEFEGTGKLDRVKKILSLSYSDLPWHLKTCLLYTSIFPEDHKIGCARLINLWIA  458

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++E+VA GYL EL+NRSLI    +  +G   + RIHDL RE+IL KS + 
Sbjct  459   ERFVEWREGMSIEDVAWGYLRELVNRSLIQVTSVFYEGIPHKCRIHDLLREVILLKSGEQ  518

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTL-GNAQMKRQG---TKLRSLLTFNVTDSQFSSHV  1245
             N VT    +   WP EK R L VH +   N Q +R       LRS +TF       S  +
Sbjct  519   NMVTVTTGQPTTWPSEKVRRLVVHSSRSNNTQQQRPNYCFDHLRSFVTFESISPLLSKML  578

Query  1246  V-QILSSCRVIKVLDL--QSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
             + ++L S +++KVLDL  Q T  EI P EIF++ HL++L L  T+V+ +P++I KL+ LE
Sbjct  579   LSEVLGSNKLLKVLDLGGQETQEEI-PSEIFKMFHLKHLDLWGTRVERVPKAIGKLQHLE  637

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              L+L  T V ELP+EILKLQ LR L VY +V  +   Y    GFKAP  +G L +LE L 
Sbjct  638   YLNLGDTRVRELPMEILKLQKLRVLRVYQNVDPSDDDYGYH-GFKAPSNMGGLLALEILQ  696

Query  1597  YVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             +++A+ G+  ++EIGKL +L++L I K +TEDGK +CSS+  L  LR L++ SIE+    
Sbjct  697   FIDASSGSTIVKEIGKLIQLRKLYITKFKTEDGKELCSSLANLTSLRELSVASIEKGDDH  756

Query  1777  DVNYLSSPPPLLQRLY--------LSGYMGKMPHWIKSLRNLVKIYFRWSKLK--DDPLE  1926
             D   L+ P       +        L G + KMP W+  L  LV+I   WS L+  +DPL+
Sbjct  757   DTIDLNHPSLSSSSSFLQSLRLLILCGRLEKMPQWVVHLHGLVRIDLNWSGLRGEEDPLD  816



>ref|XP_006368333.1| hypothetical protein POPTR_0001s017003g, partial [Populus trichocarpa]
 gb|ERP64902.1| hypothetical protein POPTR_0001s017003g, partial [Populus trichocarpa]
Length=610

 Score =   486 bits (1252),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 250/497 (50%), Positives = 332/497 (67%), Gaps = 3/497 (1%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             + DALLLEE ++VGIE P+K+LI  LL      +VISVVGMGG GK+TLVK VYDD  VK
Sbjct  114   QKDALLLEEADLVGIEKPKKQLIEWLLGSKSGREVISVVGMGGLGKSTLVKKVYDDSDVK  173

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             KHF+  AWITVSQ+FK E++LKDMIQQLF   ++P P+G+ +MN NKL+ ++ EFL ++K
Sbjct  174   KHFKFRAWITVSQSFKREDLLKDMIQQLFRVHRKPDPKGVDNMNYNKLRSVIHEFLRQKK  233

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW    W A +H LP    G R +++TR  +VAS+S  D+   +Y + PLS+E
Sbjct  234   YLIVLDDVWHTSAWRAFQHALPNNICGSRILVTTRNTEVASTSCMDSPDKVYPLNPLSQE  293

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L C+K F  ++CP HL  + + IL RC GLPLAIVAI GVLATK+K+  +EW  ++
Sbjct  294   ESWTLFCKKIFQDNTCPPHLKNVSETILGRCEGLPLAIVAISGVLATKDKSKTDEWEMVH  353

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SLG   E ND   S R IL LS+NDLP YLK C +Y SI+P  + I+   LI  W  EG
Sbjct  354   LSLGAGLEENDMLMSARKILSLSYNDLPYYLKSCLLYFSIFPVGNRIKRMRLIRLWIAEG  413

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FVK K G TVEEVA+ YL EL+ RSL+  V+   DG +K  R+HDL REI+++K+ D +F
Sbjct  414   FVKGKEGMTVEEVAQDYLNELMKRSLVQVVRATSDGRVKTCRVHDLLREIMITKAKDQDF  473

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSS-  1263
             V    EE   WPEK R +S+H  + + Q +   ++ RSLLTF   D  + S V  + S  
Sbjct  474   VAIAKEEGTIWPEKVRRVSMHNVMPSKQQRHVASRFRSLLTFWGADCSYESPVHNLFSGR  533

Query  1264  CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
              R++ VLDL+   L+  P E+  L  L+YLSLR+T+V  +P SI KL+ LE LDLK+  V
Sbjct  534   LRLLHVLDLEGAPLKEFPNEVVSLFLLKYLSLRNTRVSFIPSSISKLKNLETLDLKHAQV  593

Query  1444  TELPVEILKLQHLRHLI  1494
             + LP EI KL+ L +L+
Sbjct  594   SILPAEIRKLRKLCYLL  610



>ref|XP_007220267.1| hypothetical protein PRUPE_ppa001015mg [Prunus persica]
 gb|EMJ21466.1| hypothetical protein PRUPE_ppa001015mg [Prunus persica]
Length=933

 Score =   495 bits (1275),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 320/787 (41%), Positives = 468/787 (59%), Gaps = 21/787 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPT---LKVISVVGMGGSGKTTLVKMVY  174
             +D R  +L +EE E+VG+E+ R ELI+ L++        +VISV+GMGG GKTTL K VY
Sbjct  154   HDPRVASLFIEEAEVVGVESARDELINWLVEGASKHERREVISVLGMGGLGKTTLAKKVY  213

Query  175   DDVK--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKE  348
             D+ K   HF   AWITVSQ++ VE++L+ MI+Q     K+ +PEG   M+   L V  +E
Sbjct  214   DNQKVMAHFDCCAWITVSQSYHVEDLLRMMIRQFCKSRKEYIPEGTDQMDQESLIVKSRE  273

Query  349   FLLRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEM  528
             +L +++YV+VFDDVW    W AI+H LP +  G R MI+TR+ DVA         +++ +
Sbjct  274   YLRQKRYVVVFDDVWKVDFWGAIEHALPDDNAG-RIMITTRIKDVADFCKKSCFVHVHHL  332

Query  529   TPLSEEVSWALLCRKAFHASS---CPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKT  699
              PL    +W L CRKAF       CP  L E+  +I+++C GLPLAIV++GG+L+TK+K 
Sbjct  333   QPLPPNKAWELFCRKAFQFEPEGICPEELEELSLEIVRKCEGLPLAIVSVGGLLSTKDKI  392

Query  700   NINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNS  879
              ++ W  LY SL  + E N    SL  IL  S++ LP YLK C +Y  I+P    I    
Sbjct  393   -LSGWQKLYSSLSSELESNPHLTSLTRILSFSYHHLPYYLKSCALYFGIFPSISCIR---  448

Query  880   LIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREII  1059
             LI  W  EGFVK K GKT+EEV E YL ELI+RSL+   ++  DG  +  R+HDL RE++
Sbjct  449   LIQLWIAEGFVKSKKGKTLEEVGEEYLTELIHRSLVQVSRVCIDGKARSCRVHDLLREVL  508

Query  1060  LSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSS  1239
             L K  + +F   + E  + +    R LS+  +  +A +  Q + +RS+ TFN  +    S
Sbjct  509   LRKGMESSFCHMLSEHGSNFTPITRRLSIDSSPSDALVSIQQSHIRSVFTFN-QEEWPES  567

Query  1240  HVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEI  1419
              +  +  + +++KVLD +   +  +P+ +  L  L+YLSLR TKVK LP SI  L+ LE 
Sbjct  568   FLNTLNGNFKLLKVLDFEDVPINQLPKYVGDLYLLKYLSLRHTKVKFLPESIGNLQNLET  627

Query  1420  LDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             LDL++  V E+P +I KL  LRH   +              G K   G+G L +L+KL +
Sbjct  628   LDLRHCLVYEIPAKINKLLKLRHFSAHYCDYSTNFSMTYERGVKIHDGIGCLQALQKLYH  687

Query  1600  VEANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             VEAN G    I+ +GKL +L+RL +  L++EDG  +C+SIEK+  L SL + ++ ED VL
Sbjct  688   VEANHGGINLIKALGKLRQLRRLGLKNLKSEDGGDLCASIEKMNHLESLEVSTLSEDEVL  747

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             D+  LS+PP  ++ LYL G + ++P WI  L+ LVK+   WS+L+D PL+ LQ+LP+L+ 
Sbjct  748   DLQSLSTPPKFIRFLYLKGPLEQLPSWIPQLQQLVKLRIFWSRLRDSPLKALQNLPHLLE  807

Query  1957  LEF-LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLAS  2133
             L F    Y G  +HF  G F+ LR+L L  L+ L +++I  G MP L++L I    QL  
Sbjct  808   LGFSYKAYDGVQLHFEGG-FEKLRVLKLKDLKGLSSLIIDNGVMPDLQELQIGPSPQLKE  866

Query  2134  VPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYW---KDGCWEV  2304
             VP+GI  L NL  L F DM  +F     P+  G+ Y  V HI  V ++Y    + G +E 
Sbjct  867   VPSGIHHLRNLTTLRFVDMPKEFPRNMDPND-GQHYWVVEHIKYVLFSYKFGPRCGVFET  925

Query  2305  NSVQETS  2325
             ++++++S
Sbjct  926   HTLRDSS  932



>emb|CAN60255.1| hypothetical protein VITISV_025806 [Vitis vinifera]
Length=891

 Score =   494 bits (1271),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 310/763 (41%), Positives = 458/763 (60%), Gaps = 49/763 (6%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L +++ EIVGIE+ + EL S L++  P   VISVVGMGG GKTTL   +Y++ 
Sbjct  156   HDPRVTSLFIDDAEIVGIESQKIELTSRLVEGTPKRTVISVVGMGGLGKTTLANKIYENK  215

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              +  HF   AWITVSQ+FK+EE+L++M  + +   K+PVPE                   
Sbjct  216   XLVGHFDCSAWITVSQSFKMEELLRNMSMKFYEARKEPVPEDF-----------------  258

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
                             W  IK+VLP+ K G R +I+TR  +VASS    +  YI+++ PL
Sbjct  259   ----------------WGFIKYVLPENKKGSRIIITTRNDEVASSCKESSFDYIHKLQPL  302

Query  538   SEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
               + SW L C+KAF    CP  L ++   I++RCGGLPLAIVAIGG+L+ K K  ++EW 
Sbjct  303   PPKSSWELFCKKAFQGG-CPPELEKLSHDIVRRCGGLPLAIVAIGGLLSRKEKL-VSEWQ  360

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
                 ++G + + N   ES+  IL LS++DLP YLK CF+YL+I+PED+ I    L   W 
Sbjct  361   KFNDTIGCELQSNSHLESINTILFLSYHDLPYYLKSCFLYLAIFPEDYTIRCGPLTRLWI  420

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
              EGFVK K G T+EEVAE +L EL +RSL+   K++ DG +K   +HDL REIIL+K+ +
Sbjct  421   AEGFVKTKRGVTLEEVAEEFLTELRHRSLVQVSKVSADGRIKHCHVHDLMREIILTKAEE  480

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGN-AQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
              +F   +   T+++  + R LSVH +  N A +  + + +RS+  +   DSQ +  + + 
Sbjct  481   LSFCCVMTGGTSSFDGRFRRLSVHNSPNNVANITGKKSYIRSIFLY---DSQ-TFFLEKW  536

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
              S   ++KVLD+  + L+ VPE +  LLHLRYLSLR+TKV++LPRSI KL+ L+ LDL++
Sbjct  537   ASRFNLLKVLDIDDSGLDSVPENLGNLLHLRYLSLRNTKVRMLPRSIGKLQNLQTLDLRF  596

Query  1435  TFVTELPVEILKLQHLRHLIVYSH---VSFAYLPYNCSPGFKAPkglgklgsleklVYVE  1605
             T V +LPVEI +L+ L +++V+++   V   + P+    G    +G+G L  L+KL  VE
Sbjct  597   TLVEDLPVEINRLKKLHNILVHNYDLGVDLGWFPFK---GVHVKEGIGCLEELQKLSCVE  653

Query  1606  ANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             AN G G I+E+GKL +L++L I KL  E+GK + +SI  + +L SL + S+ ED +LD+ 
Sbjct  654   ANHGVGVIKELGKLRQLRKLSITKLTRENGKHLXASITNMNRLESLLISSLSEDEILDLQ  713

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
             ++S PP  L  L L G + K+P WI  L+NL  +    S L +DP++ LQ LP+L  L+ 
Sbjct  714   HVSYPPSCLTXLXLIGPLEKLPDWISELQNLSIVXLCGSNLMNDPVQVLQALPSLQLLQL  773

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
             +     E + F A  FQ L+ L +  L  ++ V I  GA+P LEKL++    QL  +P G
Sbjct  774   VRASAVEELCFEATGFQKLKRLVVLNLMGVKRVKIENGALPLLEKLLVGPFPQLEELPPG  833

Query  2146  IECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYY  2274
             I  L  L  LEF ++ ++   + +P  RG +Y  V HI  V +
Sbjct  834   IRHLTRLTTLEFINLQEELKLSMIPS-RGRNYKIVEHIPNVLF  875



>ref|XP_007010980.1| Cc-nbs-lrr resistance protein, putative [Theobroma cacao]
 gb|EOY19790.1| Cc-nbs-lrr resistance protein, putative [Theobroma cacao]
Length=920

 Score =   494 bits (1273),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 306/759 (40%), Positives = 449/759 (59%), Gaps = 16/759 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             +D R     +E D +VGI++ + EL+S L+  +    VIS+VGMGG GKTTL K V D+ 
Sbjct  153   HDPRMGLHFVENDALVGIDSLKTELVSKLMHGESHRTVISLVGMGGVGKTTLAKKVLDEQ  212

Query  184   --KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
                 HF  HAWITVSQ++KVEE+LK MI++ +   K+  P  + +M+ N+L    +E+L 
Sbjct  213   IDTGHFDCHAWITVSQSYKVEELLKTMIRRFYESRKESYPSEVNAMDGNELISKSREYLR  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++Y +VFDD+W    W  +++ L       R M++TR  + A      +   + E+ PL
Sbjct  273   DKRYFVVFDDIWKEDFWGDVEYALFGNDRSSRIMLTTRSRNAADFCKRSSLVDVLELRPL  332

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
               E++  LLCR AF       CP  L E+   I KRC GLPLAIVAIGG+L++K + ++ 
Sbjct  333   PLELAQELLCRIAFQFDEDKQCPLELKELSFDIAKRCEGLPLAIVAIGGLLSSKGR-DVG  391

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  L+ SL    E N     ++ IL  S++DLP +LK CF+YL ++PED+++    L+ 
Sbjct  392   EWQGLHDSLQSQLESNIHLTRIKKILSFSYHDLPYHLKSCFLYLGMFPEDYVVNCARLVR  451

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVKQ+ G T+E+ A  YL ELI R+L+    ++ DG ++  R+HDL  E+ILSK
Sbjct  452   LWIAEGFVKQRDGATLEDAAREYLTELIRRNLVQAEWVDFDGVVRDCRVHDLMHEVILSK  511

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
             S + + + T  +      + ARHLS+     N       +K  S++ F V +    S + 
Sbjct  512   SDELSLIQTSAKNLQCPNQTARHLSIRDESNNLSRSSGCSKTHSIIFFEVNEFP-KSLLS  570

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              + ++  ++K LD +   L  +PEE+  LLHL+YLS+R TKVK+LP+S+ KLR L  LDL
Sbjct  571   SLFANFILLKELDFEGVPLNYLPEELGNLLHLKYLSVRDTKVKMLPKSLAKLRNLGTLDL  630

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
             K + V ELPVEI KL +L+HL+ YS        Y+   G K    L  L SLEKL YV+ 
Sbjct  631   KRSLVRELPVEINKLSNLQHLLAYSE------DYDTRQGVKIRGTLRSLNSLEKLYYVDM  684

Query  1609  NPGN--GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
             N  N  G I E+G L  L++L I  L++E G A+C++IE +  L SL++ S++E+ +L +
Sbjct  685   NAQNNFGFIRELGSLKHLRKLGITNLKSEAGNALCNAIEHMSYLESLHVISVKENELLQL  744

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
               +SSPP LL  L L G + K+P WI  L+ LV+I   WS+L D PL+ L  LP L+ L 
Sbjct  745   QSMSSPPLLLNCLRLQGRLEKLPDWISELKCLVRIRLFWSQLSDIPLKMLGGLPKLLELA  804

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
                GY GE +HF  G F  L+ L L+ ++    ++I E A+  +E L I+ C +L  +P+
Sbjct  805   LYKGYNGEQLHFEDGYFPVLKELTLEGMDRFNRLIIDEKALCLVEMLWIESCPRLEELPS  864

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHI  2259
             GI  +  L+YLE  DM+ +F    LPD  G+D+ KV HI
Sbjct  865   GICHMKCLKYLEISDMSKEFARRMLPDV-GQDHWKVQHI  902



>ref|XP_009346947.1| PREDICTED: disease resistance protein RPM1-like [Pyrus x bretschneideri]
Length=930

 Score =   494 bits (1272),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 316/764 (41%), Positives = 459/764 (60%), Gaps = 30/764 (4%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L++ EDE+VGI++ RKEL  LL+  +P  +VISVVGMGG GKTTL K VYD  
Sbjct  159   HDPRVASLVIGEDEVVGIDSARKELTDLLVGGEPRREVISVVGMGGLGKTTLAKKVYDSQ  218

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V  HF  +AW +VSQ++K E++L+ ++++  +  K P PEG+ +M+   L     E+L 
Sbjct  219   TVMDHFDCYAWFSVSQSYKEEDLLRTVVKKFCSSRKDPFPEGIDTMDEESLIRKSGEYLQ  278

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YV+VFDDVW    W AI+H LP  K G R MI+TR  DVA         +++ + PL
Sbjct  279   QKRYVVVFDDVWREDFWGAIEHALPGNKGG-RIMITTRNQDVADFCKKSCFVHVHHLQPL  337

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
               E +W L CRKAF       CP  L ++ ++I+K+C GLPLAIV IGG+L+ K K  ++
Sbjct  338   PPEKAWELFCRKAFQFELEGKCPPELEDMSREIVKKCEGLPLAIVCIGGLLSRKEKV-VD  396

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  L +SL  + E N    SL  IL LS+  LP +LK C +Y  I+PED+ I    LI 
Sbjct  397   EWRKLSNSLSSELESNPHLTSLTRILSLSYYHLPYHLKSCVLYFGIFPEDYSINCVRLIR  456

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFV+ K GKT+EEV + YL EL +RSL+   +   D   +  R+HDL+RE++L K
Sbjct  457   LWIAEGFVEFKKGKTLEEVGKEYLTELNHRSLVQVSEAYIDKKARSCRVHDLWREVLLKK  516

Query  1069  STDHNFVTTIDE-ETAAWP-EKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSH  1242
               D +F   + E E  + P  + R LS+  +  +A    + +++RS+  FN  +    S 
Sbjct  517   GVDSSFCHFLSEFELTSKPTTRTRRLSIDSSPSDALGSIRESQIRSVFAFN-QEEWPESF  575

Query  1243  VVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEIL  1422
             +  +  + +++KVLD     +  +P+ +  L  L YLSLR+TKV++LP SI  L+ LE L
Sbjct  576   LNTLRGNFKLLKVLDFMDAPINQLPKYVGDLYLLTYLSLRNTKVELLPNSIGNLQNLETL  635

Query  1423  DLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             DLK + V E+P +I KL  LR   V  H     L                  +L+KL +V
Sbjct  636   DLKQSLVYEIPTKIKKLVKLRERGVKMHEGIGCL-----------------QALQKLYHV  678

Query  1603  EANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             EAN G    I+E+GKL +L++L + KL+ EDG+A+C+SIEK+  L +L+L +I ED VLD
Sbjct  679   EANHGGIKLIKELGKLRQLRKLGLKKLKREDGRALCASIEKMELLETLDLSAISEDEVLD  738

Query  1780  VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHL  1959
             +  +S+PP  ++ LYL G + ++P WI +L++LVK+  +WS+L+D PL+ LQ+LPNL  L
Sbjct  739   LESISTPPQFIRSLYLKGRLEQLPSWISNLQHLVKLGIQWSRLRDSPLQALQNLPNLSEL  798

Query  1960  EF-LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
                 +GY G  +HF  G FQ L+ L L ++E L +++I  G MP L+   I RC QL  V
Sbjct  799   RVGKMGYDGVQLHFEGGGFQRLKELVLGEMEVLNSLIIDNGVMPCLQVFYIGRCPQLKEV  858

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEV  2268
             P+GI  L  LR L F+ MT +F     P+  G  Y  V HI +V
Sbjct  859   PSGIHHLRQLRDLTFYGMTKEFARQMDPNN-GPHYWTVKHIRQV  901



>ref|XP_009345017.1| PREDICTED: disease resistance protein RPM1-like [Pyrus x bretschneideri]
Length=930

 Score =   494 bits (1271),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 315/764 (41%), Positives = 460/764 (60%), Gaps = 30/764 (4%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L++ EDE+VGI++ RKEL  LL+  +P  +VISVVGMGG GKTTL K VYD  
Sbjct  159   HDPRVASLVIGEDEVVGIDSARKELTDLLVGGEPRREVISVVGMGGLGKTTLAKKVYDSQ  218

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V  HF  +AW +VSQ++K E++L+ ++++  +  K P PEG+ +M+   L   + E+L 
Sbjct  219   TVMDHFDCYAWFSVSQSYKEEDLLRTVVKKFCSSRKDPFPEGIDTMDEESLIRKLGEYLQ  278

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YV+VFDDVW    W AI+H LP  K G R MI+TR  DVA         +++ + PL
Sbjct  279   QKRYVVVFDDVWREDFWGAIEHALPGNKGG-RIMITTRNQDVADFCKKSCFVHVHHLQPL  337

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
               E +W L CRKAF       CP  L ++ ++I+K+C GLPLAIV IGG+L+ K+K  ++
Sbjct  338   PPEKAWELFCRKAFQFELEGKCPPELEDMSREIVKKCEGLPLAIVCIGGLLSRKDKV-VD  396

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  L +SL  + E N    SL  IL LS+  LP +LK C +Y  I+PED+ I    LI 
Sbjct  397   EWRKLSNSLSSELESNPHLTSLTRILSLSYYHLPYHLKSCVLYFGIFPEDYSINCVRLIR  456

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFV+ K GKT+EEV + YL EL +RSL+   +   D   +  R+HDL+RE++L K
Sbjct  457   LWIAEGFVEFKKGKTLEEVGKEYLTELNHRSLVQVSEAYIDKKARSCRVHDLWREVLLKK  516

Query  1069  STDHNFVTTIDE-ETAAWP-EKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSH  1242
               D +F   + E E  + P  + R LS+  +  +A    + +++RS+  FN  +    S 
Sbjct  517   GVDSSFCHFLSEFELTSKPTTRTRRLSIDSSPSDALGSIRESQIRSVFAFN-QEEWPESF  575

Query  1243  VVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEIL  1422
             +  +  + +++KVLD     +  +P+ +  L  L YLSLR+TKV++LP SI  L+ LE L
Sbjct  576   LNTLRGNFKLLKVLDFMDAPINQLPKYVGDLYLLTYLSLRNTKVELLPNSIGNLQNLETL  635

Query  1423  DLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             DLK + V E+P +I KL  LR   V  H     L                  +L+KL +V
Sbjct  636   DLKQSLVYEIPTKIKKLVKLRERGVKMHEGIGCL-----------------QALQKLYHV  678

Query  1603  EANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             EAN G    I+E+G L +L++L + KL+ EDG+A+C+SIEK+  L +L+L +I ED VLD
Sbjct  679   EANHGGIKLIKELGNLRQLRKLGLKKLKREDGRALCASIEKMELLETLDLSAISEDEVLD  738

Query  1780  VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHL  1959
             +  +S+PP  ++ LYL G + ++P WI +L++LVK+  +WS+L+D PL+ LQ+LPNL  L
Sbjct  739   LESISTPPQFIRSLYLKGRLEQLPSWISNLQHLVKLGIQWSRLRDSPLQALQNLPNLSEL  798

Query  1960  EF-LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
                 +GY G  +HF  G FQ L+ L L ++E L +++I  G MP L+   I RC QL  V
Sbjct  799   RVGKMGYDGVQLHFEGGGFQRLKELVLGEMEVLNSLIIDNGVMPCLQVFYIGRCPQLKEV  858

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEV  2268
             P+GI  L  LR L F+ MT +F     P+  G  Y  V HI +V
Sbjct  859   PSGIHHLRQLRDLTFYGMTKEFARQMDPNN-GPHYWTVKHIRQV  901



>ref|XP_006382354.1| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
 gb|ERP60151.1| NBS-LRR resistance gene-like protein ARGH35 [Populus trichocarpa]
Length=881

 Score =   491 bits (1263),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 315/770 (41%), Positives = 450/770 (58%), Gaps = 37/770 (5%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  AL L+E +IVGIENP+  L+S L + +  L  ISVVGMGG GKTTLVK VYD  
Sbjct  134   HDPRLAALYLDEADIVGIENPKHLLVSWLEEGEEKLSSISVVGMGGLGKTTLVKKVYDSH  193

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              +++ F +H+W+TVS++F   ++L+  +Q       +PVP+ +                 
Sbjct  194   PIRRSFDTHSWVTVSKSFASTDLLRVALQGFLVTANEPVPDNL-----------------  236

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
               +YVIV DD+W    WE IK+  P    G R + +TRL ++A S   +   ++YE+  L
Sbjct  237   --RYVIVLDDIWNVNAWETIKYAFPDCNCGSRIIFTTRLSNLAES--IENTRHVYELQAL  292

Query  538   SEEVSWALLCRKAF---HASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
              E  +W L C KAF   H + CP  L E+ + ILK+C GLPLAIVAIGG+L+ K    + 
Sbjct  293   PENEAWTLFCMKAFRGEHKAVCPPELEEMSRNILKKCEGLPLAIVAIGGLLSKKKNRGL-  351

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  ++  L  + + N+   SLR IL LS+++LP YLK C++YLS++PED+LI+   LI 
Sbjct  352   EWKKVHDCLATELKSNNDLGSLRRILQLSYDNLPYYLKQCYLYLSVFPEDYLIKRRKLIR  411

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W +E FV++K G T+EEVAE YL EL+NRSLI  V++N    +K  R+HDL REII  K
Sbjct  412   LWIVERFVEEKQGFTMEEVAEEYLNELVNRSLIQVVEMNYFNRVKTCRVHDLMREIIQMK  471

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
             S + +FV   +    +  EK R LS+H    N++  +   + R L +     S  S    
Sbjct  472   SREESFVMIANGTRISKNEKVRRLSIH---ENSEEVQSDMRFRYLWSLLSFSSHHSFEYG  528

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
                 + ++++VL+L    L     E+ +L+HLRYLSLR T +  LP SI+KL+ LEILDL
Sbjct  529   --FRNYKLLRVLNLDRAPLSTFLPELAELIHLRYLSLRWTMISELPESIRKLKCLEILDL  586

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHV--SFAYLPYNCSPGFKAPkglgklgsleklVYV  1602
             K + V+ LP  I +L  L  L  Y ++  S ++ P   + G + P G+G+L SL+KL  V
Sbjct  587   KRSPVSSLPAGITQLTCLCQLRNYRYIFQSSSFFPD--THGMRVPSGIGRLTSLQKLGSV  644

Query  1603  EANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
             E N     + E+GKL +L+RL ILKLR E G  +C ++++L  L +L L S+     L  
Sbjct  645   EVNEDYELVRELGKLTQLRRLGILKLREEQGMDLCYTLDRLKHLTALYLVSLNNTEFLQF  704

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
             + LSSPP  LQRL L   +  +P WI SL+ + K+  ++S LK DPL+ LQ LP+LV LE
Sbjct  705   DSLSSPPKYLQRLNLKCSLPALPGWIASLQYISKLVLQYSNLKSDPLKVLQKLPSLVMLE  764

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
                 Y GE +  +   F  L+ L L +LE LR + I +G+MP LE+L I  C  L +VP 
Sbjct  765   LCQAYAGEELCCDPSGFSKLKRLGLHELERLRRIRIAKGSMPGLERLDITACTVLETVPD  824

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDG  2292
             GIE L N+  L  + M   FI T +   RGED+ +V HI+ +   Y   G
Sbjct  825   GIENLKNIEDLVLWYMPSTFIKT-IERHRGEDFWRVQHITTITRIYESQG  873



>ref|XP_010683684.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010683685.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=961

 Score =   492 bits (1266),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 321/788 (41%), Positives = 463/788 (59%), Gaps = 31/788 (4%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +DRR+ +L +EE E+VGIE  R+ L+  L+  +    V S+VGMGG GKTTL + VYD  
Sbjct  164   HDRRASSLFIEEAEVVGIEGDREHLVDWLVNGETKRAVFSIVGMGGLGKTTLARKVYDSQ  223

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V  HF + AW+TVSQ++KVEE+LK  ++  + + K+  P  + +M+   L   ++E+L 
Sbjct  224   IVINHFSNQAWVTVSQSYKVEELLKKTLKHFYKKRKESPPPQIENMDETLLMFELREYLK  283

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEK-HGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
             ++KY++VFDDVW+   WE I+H LP +   G R +I+TR  +VA S  T +   IY++  
Sbjct  284   QKKYMVVFDDVWSVEFWEFIRHALPDDNSQGSRVLITTRYKEVAHSCKTSSYDRIYKLNR  343

Query  535   LSEEVSWALLCRKAFHASS--------CPSHLTEILKQILKRCGGLPLAIVAIGGVLATK  690
             L EE +  L C+K F+ +          P  L E+   I++RC GLPLAIVAI G+L+TK
Sbjct  344   LPEEKALELFCKKVFYYAGSSSNDVIQVPPELKELANNIVRRCEGLPLAIVAIAGLLSTK  403

Query  691   NKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIE  870
              K  I EW  L  +LG +   N    S+  IL LS+ +LP YLKLC +Y  + PED+ I 
Sbjct  404   RKEVI-EWQELEKNLGSELLTNLHLSSMTRILSLSYYELPYYLKLCLLYFGMLPEDYSIR  462

Query  871   HNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYR  1050
             H  LI  W  EGFVK   GK+VE+VA+ YL ELINRSL+   +L+ D  ++  R+HDL R
Sbjct  463   HARLIRLWIAEGFVKGVRGKSVEQVAKEYLVELINRSLVQVSRLDVDEKIRTIRVHDLMR  522

Query  1051  EIILSKSTD--HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQ------------GT  1188
             EIILSKS +  +  V T +  ++ +   AR LS+HG+  N    +             GT
Sbjct  523   EIILSKSEELRYGHVWTDENSSSCFDHLARRLSIHGSCTNDNFLKNTGNGNGNGNGKCGT  582

Query  1189  KLRSLLTFNVTDSQFSSHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRST  1368
               RSLL F+V D    S +   +   +++KVLDL    +  +PE++  L HLRYLSLR+T
Sbjct  583   --RSLLIFDV-DKLPDSVLRSYMKMFKLLKVLDLLDAPISFLPEQVGDLYHLRYLSLRNT  639

Query  1369  KVKVLPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGF  1548
               K LP SI +L  L+ LDLK + V  LP E+ +L +L +LI Y +        +   G 
Sbjct  640   NTKQLPNSIGRLHNLQTLDLKCSCVHALPAEVKRLHNLLYLIGYCYDYETDFSISAQRGL  699

Query  1549  KAPkglgklgsleklVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkll  1728
             K  KG G+L +L+KL  VEAN G   ++E+ KL +L++L I KL T++GK +C SI  + 
Sbjct  700   KLKKGFGRLQNLQKLYLVEANHGITVLKELRKLKQLRKLGITKLPTQNGKILCESIASMT  759

Query  1729  klrslnlksIEEDVVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKL  1908
              L+SL + S  E+  LD+ ++SS P  LQRLYL G + K+P WI  L NLV +   WS L
Sbjct  760   HLQSLEVCSEGENETLDLQFMSS-PQFLQRLYLKGRLQKIPDWIPKLNNLVTLSIMWSGL  818

Query  1909  KDDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMP  2088
               DPL  LQ LP L  L F   + G+ + F A  FQ L++L L  +  L N+ I +GA+P
Sbjct  819   MIDPLHILQHLPILSELVFQDTFLGQQLVFEAHGFQKLKILKLYDMNTLTNLTIEKGALP  878

Query  2089  HLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEV  2268
              ++ L I    +L SVP GI+ L +L  L F+D++ +F    LP + G+D+  V H+  +
Sbjct  879   SVQLLKIGPIPKLNSVPTGIQYLTDLASLRFYDVSKEFALRLLPHQ-GQDFWVVQHVQTL  937

Query  2269  YYTYWKDG  2292
              + +   G
Sbjct  938   LFHFQIHG  945



>ref|XP_002532244.1| Disease resistance protein RPM1, putative [Ricinus communis]
 gb|EEF30138.1| Disease resistance protein RPM1, putative [Ricinus communis]
Length=935

 Score =   491 bits (1263),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 295/763 (39%), Positives = 458/763 (60%), Gaps = 8/763 (1%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D R  +L ++E E+VGIE+P+ ELIS L++      VISVVGMGG GKTTL K V+D  
Sbjct  151   HDPRVHSLFIDEAELVGIESPKAELISKLVEGASENVVISVVGMGGLGKTTLAKKVFDSE  210

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V  +F   AWITV+Q++K+ ++L+ MI+QL  E   P  EG  +M+   L   ++E+L+
Sbjct  211   RVTVYFDCKAWITVTQSYKMAKLLRIMIRQLHQENVLPAFEGTDTMSELSLIEKLREYLI  270

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++Y+++FDDVW   +W  I   LP    G R +I+TR   VA S +     Y++++  L
Sbjct  271   EKRYLVIFDDVWDIFLWGYIMTALPNNGKGNRIIITTRNEGVAPSPNESPFYYVFKLQLL  330

Query  538   SEEVSWALLCRKAFHAS--SCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
              +  ++ L C+K F ++  +CPS L E+   I+++C GLPLAIV IGGVLATK K  + E
Sbjct  331   PKREAYELFCKKVFQSNGGNCPSQLQELSHAIVEKCEGLPLAIVTIGGVLATKEKL-VTE  389

Query  712   WGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQ  891
             W   Y  L      + +  ++  IL LS+ DLP YLK CF+Y +++PE+  I    LI  
Sbjct  390   WKKFYDDLTSSLASDQRLSNIIKILSLSYQDLPYYLKSCFLYFNLFPENCSINCWRLIRL  449

Query  892   WTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKS  1071
             W  +G +K++ G+ VEEVAE YL EL++R L+   +++ D   ++ R+HDL REIIL +S
Sbjct  450   WIADGLIKERQGRIVEEVAEEYLIELVHRRLVQVERVSFDSKARECRVHDLMREIILFQS  509

Query  1072  TDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQ  1251
              + +F     ++      ++RHLS++  + N       ++  S++ F  ++    S +  
Sbjct  510   RELSFHQVSSKDYQNLKGRSRHLSINDKVKNILESNCNSQTHSIILFE-SNELPKSFITS  568

Query  1252  ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             ++   ++++ LDL+   L+ +P+E+  L HL+YL L+ T VKVLP+SI KL  LE LDL+
Sbjct  569   VIDDFKLLRSLDLEGAPLDYIPDEVGNLWHLKYLCLKDTNVKVLPKSIGKLCNLETLDLR  628

Query  1432  YTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEAN  1611
              + V +LP+EI +L  LRHL+ Y          N     K    +G L +L+KL Y+EA+
Sbjct  629   QSLVLDLPIEINRLLKLRHLLAYFFNYDNEFYINSLRAVKMHGNIGSLKALQKLSYIEAD  688

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              G   I +I +L +L++L I KL+ E+G  +C ++EK+  L++L + S   +  LD+  +
Sbjct  689   HGVDLIRQIERLTQLRKLGITKLKKENGLDLCYALEKMSCLQTLKVSSGSVEEFLDLRSI  748

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             S  PPLLQ LYLSG + ++P WI  L  LVK+ F WS+L +D ++ LQ LPNL  L F  
Sbjct  749   SG-PPLLQYLYLSGPLVELPPWISKLSCLVKLVFNWSRLGNDAIQVLQALPNLQMLRFYE  807

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
             G   + +HF  G F +L++L+L  L  L  ++I EG +P +E+L I  C +L  +P+GI 
Sbjct  808   GCNAKQLHFTKGCFSNLKMLHLLHLTRLNKLIIDEGGLPVIEELSIGPCPKLKELPSGIH  867

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
              L NL+ LEF+D+  +F     P   G +YCKV +I  + + Y
Sbjct  868   YLRNLKRLEFYDIQREFAIGMQP-LGGHEYCKVQNIPLILFYY  909



>ref|XP_010101799.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXB89763.1| Disease resistance protein RPM1 [Morus notabilis]
Length=915

 Score =   489 bits (1259),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 306/774 (40%), Positives = 451/774 (58%), Gaps = 27/774 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             ND R  A  L E ++VGIE+PR ELI +L    P   VIS+VG+GGSGKTTL K VY+ V
Sbjct  156   NDPRRAAYFLREADVVGIESPRNELIEILKTHSPERIVISIVGIGGSGKTTLAKQVYNYV  215

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             K+ F  HAWITVS+ +  +E+L+++I++++   +   P  + +M+   L   + ++L  +
Sbjct  216   KRDFDCHAWITVSEPYSAKELLRNLIRKVYEATEASAPVTIDTMDEQSLTEQLIKYLQNK  275

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGY-IYEMTPLS  540
             KY IVFDDVW    W  +   LP  ++G R +I+TR  +VA+      +   ++   P  
Sbjct  276   KYFIVFDDVWYKEFWGDVNFALP--ENGGRMVITTRKKEVANFCKRSVSSVQVHSTEP--  331

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
                              CP++L    ++I+  C GLPLAIVAI G+L+TKNK    EW  
Sbjct  332   --------------GRCCPANLEYWSREIVASCHGLPLAIVAIAGLLSTKNKVPY-EWQK  376

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
              Y +L  +   +   +S   IL LS+ DLP YLK C +Y  I+P+ + I    LI QW  
Sbjct  377   FYETLRSELVNHSDLKSTTKILSLSYTDLPYYLKCCILYFGIFPKGYSIRRGRLIRQWIA  436

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFVK +  K++E VA+ YLFELI++ L+   K ND+G  K  R+HDL   +I  K  + 
Sbjct  437   EGFVKPQTNKSLEVVAKEYLFELIDKGLVEISKANDEGQAKSCRVHDLLHVVISQKMKES  496

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
              F   + +++  +   AR LS+  +      + + + +R L  FN  +   +S V  + +
Sbjct  497   RFCRVLSDKSPPFEGVARRLSIIFSSDKNLQETEISGVRCLFMFNGNNEMLNSTVNALAT  556

Query  1261  SCRVIKVLDLQ-STSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
             S +++KVLD + +  L+ +PE+I  L HLRYLS+R TKVK+LP SI KL  LE LDLK +
Sbjct  557   SVKLLKVLDFEDAPCLDHLPEDIGDLFHLRYLSVRDTKVKLLPNSIGKLVNLETLDLKRS  616

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYL-PYNCSPGFKAPkglgklgsleklVYVEAN-  1611
              V E+P  I +L  LRHL  +S V+   L  ++   G K  + +     L+KL  +EAN 
Sbjct  617   LVYEIPASINRLSKLRHLFGWSFVNNTELFSFDRIRGIKI-QKIECFKHLQKLYSIEANI  675

Query  1612  PGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              G  TIEE+G L +L+ L I K+R  DGK++C  IEK+  L SL ++SI ED  LD++ +
Sbjct  676   DGACTIEELGTLTQLRTLGIWKVRNRDGKSLCGCIEKMKYLESLIVRSIGEDETLDLDSI  735

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFL-  1968
             S PP  L+RLYL G +  +P WI  L+NL KI  R+SK  DDPL+ L +L  LV LE + 
Sbjct  736   SHPPEFLRRLYLLGPLMTLPRWIMKLQNLAKIVIRFSKFGDDPLKVLGNLHELVQLEIVD  795

Query  1969  VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGI  2148
               + GE +HF  G F  L++L L  L+ L +++I EGA+  LEKLV+    Q+  VP GI
Sbjct  796   DAFVGEQLHFREGVFPKLKVLRLHGLKWLSSLIIEEGALRALEKLVLGPSPQMKEVPTGI  855

Query  2149  ECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISE-VYYTYWKDGCWEVN  2307
             + L NL+ L+FFDM D+F+++  P+  G  Y  V H+   V++ Y  D  + ++
Sbjct  856   KHLRNLKLLQFFDMADEFVASVNPNG-GHSYHIVQHVVPFVFFRYADDQVYRLH  908



>ref|XP_010683682.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010683683.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1028

 Score =   492 bits (1266),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 321/788 (41%), Positives = 463/788 (59%), Gaps = 31/788 (4%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +DRR+ +L +EE E+VGIE  R+ L+  L+  +    V S+VGMGG GKTTL + VYD  
Sbjct  231   HDRRASSLFIEEAEVVGIEGDREHLVDWLVNGETKRAVFSIVGMGGLGKTTLARKVYDSQ  290

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V  HF + AW+TVSQ++KVEE+LK  ++  + + K+  P  + +M+   L   ++E+L 
Sbjct  291   IVINHFSNQAWVTVSQSYKVEELLKKTLKHFYKKRKESPPPQIENMDETLLMFELREYLK  350

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEK-HGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
             ++KY++VFDDVW+   WE I+H LP +   G R +I+TR  +VA S  T +   IY++  
Sbjct  351   QKKYMVVFDDVWSVEFWEFIRHALPDDNSQGSRVLITTRYKEVAHSCKTSSYDRIYKLNR  410

Query  535   LSEEVSWALLCRKAFHASS--------CPSHLTEILKQILKRCGGLPLAIVAIGGVLATK  690
             L EE +  L C+K F+ +          P  L E+   I++RC GLPLAIVAI G+L+TK
Sbjct  411   LPEEKALELFCKKVFYYAGSSSNDVIQVPPELKELANNIVRRCEGLPLAIVAIAGLLSTK  470

Query  691   NKTNINEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIE  870
              K  I EW  L  +LG +   N    S+  IL LS+ +LP YLKLC +Y  + PED+ I 
Sbjct  471   RKEVI-EWQELEKNLGSELLTNLHLSSMTRILSLSYYELPYYLKLCLLYFGMLPEDYSIR  529

Query  871   HNSLIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYR  1050
             H  LI  W  EGFVK   GK+VE+VA+ YL ELINRSL+   +L+ D  ++  R+HDL R
Sbjct  530   HARLIRLWIAEGFVKGVRGKSVEQVAKEYLVELINRSLVQVSRLDVDEKIRTIRVHDLMR  589

Query  1051  EIILSKSTD--HNFVTTIDEETAAWPEKARHLSVHGTLGNAQM------------KRQGT  1188
             EIILSKS +  +  V T +  ++ +   AR LS+HG+  N                + GT
Sbjct  590   EIILSKSEELRYGHVWTDENSSSCFDHLARRLSIHGSCTNDNFLKNTGNGNGNGNGKCGT  649

Query  1189  KLRSLLTFNVTDSQFSSHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRST  1368
               RSLL F+V D    S +   +   +++KVLDL    +  +PE++  L HLRYLSLR+T
Sbjct  650   --RSLLIFDV-DKLPDSVLRSYMKMFKLLKVLDLLDAPISFLPEQVGDLYHLRYLSLRNT  706

Query  1369  KVKVLPRSIKKLRMLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGF  1548
               K LP SI +L  L+ LDLK + V  LP E+ +L +L +LI Y +        +   G 
Sbjct  707   NTKQLPNSIGRLHNLQTLDLKCSCVHALPAEVKRLHNLLYLIGYCYDYETDFSISAQRGL  766

Query  1549  KAPkglgklgsleklVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkll  1728
             K  KG G+L +L+KL  VEAN G   ++E+ KL +L++L I KL T++GK +C SI  + 
Sbjct  767   KLKKGFGRLQNLQKLYLVEANHGITVLKELRKLKQLRKLGITKLPTQNGKILCESIASMT  826

Query  1729  klrslnlksIEEDVVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKL  1908
              L+SL + S  E+  LD+ ++SS P  LQRLYL G + K+P WI  L NLV +   WS L
Sbjct  827   HLQSLEVCSEGENETLDLQFMSS-PQFLQRLYLKGRLQKIPDWIPKLNNLVTLSIMWSGL  885

Query  1909  KDDPLEHLQDLPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMP  2088
               DPL  LQ LP L  L F   + G+ + F A  FQ L++L L  +  L N+ I +GA+P
Sbjct  886   MIDPLHILQHLPILSELVFQDTFLGQQLVFEAHGFQKLKILKLYDMNTLTNLTIEKGALP  945

Query  2089  HLEKLVIQRCNQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEV  2268
              ++ L I    +L SVP GI+ L +L  L F+D++ +F    LP + G+D+  V H+  +
Sbjct  946   SVQLLKIGPIPKLNSVPTGIQYLTDLASLRFYDVSKEFALRLLPHQ-GQDFWVVQHVQTL  1004

Query  2269  YYTYWKDG  2292
              + +   G
Sbjct  1005  LFHFQIHG  1012



>ref|XP_003633333.1| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]
Length=914

 Score =   488 bits (1256),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 293/765 (38%), Positives = 450/765 (59%), Gaps = 14/765 (2%)
 Frame = +1

Query  34    EEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDVKKHFQSHAWI  213
             +EDE+VG+E   ++++  L +D+P   + S+VGMGG GKTTLV  VY+ VK+ F   AWI
Sbjct  159   DEDELVGMEENTQKMLEWLEEDEPHRTIFSIVGMGGLGKTTLVTKVYEKVKRDFDCWAWI  218

Query  214   TVSQTFKVEEVLKDMIQQLFAELKQP-VPEGMGSMNANKLKVIVKEFLLRRKYVIVFDDV  390
             +VSQT    E+L+ MI++ F E+KQ  VP  +GSMN  +L  ++ ++L  ++YV+V DDV
Sbjct  219   SVSQTNGSGELLRSMIKE-FLEIKQVMVPSNLGSMNYMRLVRMLIDYLHPKRYVVVLDDV  277

Query  391   WTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSWALLCR  570
             W+  +W  I+ V P  ++G R +++TR  +VA  +S      I+ + PL +  +WAL C+
Sbjct  278   WSIDLWSQIRGVFPNNRNGSRIILTTRNENVA--ASVGIGNQIHRLQPLQDTDAWALFCK  335

Query  571   KAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSLGP  741
             KAF      SCP  L  + + I+K+C GLPLAIVA+GG++ ++NKT + EW  +Y S+  
Sbjct  336   KAFWNDLGRSCPKELEPLARAIMKKCEGLPLAIVAVGGLMCSRNKT-VAEWKKVYESINW  394

Query  742   DFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVKQK  921
                 N   E ++ ILLLSFNDLP YLK CF+Y  I+P+ + I+   LI  W  EGF+ ++
Sbjct  395   QLSHNPMLEQVKSILLLSFNDLPFYLKHCFLYCCIFPDGYPIKRKKLIRLWVAEGFITER  454

Query  922   AGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTTID  1101
              G T+EE+AE YL ELI RS++   + ND+G +K  R+HDL RE+ ++ S   +F T  D
Sbjct  455   KGMTMEEIAEEYLTELIFRSMVQVTETNDEGRVKTCRVHDLMRELAMTTSEKEDFCTASD  514

Query  1102  EETAAWPEKARHLSVHGTLGNAQMK-RQGTKLRSLLTFNVTDSQFSSHVVQILSSCRVIK  1278
                     K   LSV+    N ++  R    LRS   F  TD      + ++L+  ++++
Sbjct  515   GRETRLERKIHRLSVYNRGENIRLSGRMSRGLRSFFVFE-TDVSSPFSLNEVLAKFKLLR  573

Query  1279  VLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTELPV  1458
             VLDLQ  S+E VP  +  L +LRYL+LR TKV+ LP+ +++L+ L+ LD++ T +  LP 
Sbjct  574   VLDLQGVSIETVPSSLLGLFNLRYLNLRETKVRELPKPLERLKNLQTLDVRNTNMERLPN  633

Query  1459  EILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIEEI  1638
              + KL  LRHL +Y +   +    +     +AP G+    SL+ LV +EA      I++I
Sbjct  634   GVSKLLKLRHLYMYHNNEGSSRTPSLLRSMQAPAGIWNARSLQTLVCIEAE--EQLIKQI  691

Query  1639  GKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLLQR  1818
               L EL+RL I  LR  DG  +C+S++K+  L  L + + + +  L +  LS PP +LQ+
Sbjct  692   QNLTELRRLEITNLRAVDGPRLCASVQKMTSLIRLGVMAADGE-ELQLAALSLPPLVLQK  750

Query  1819  LYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHMHF  1998
             L L G +  +PHW+ SL NL  ++   S L+ + +  L  L NLV L+    Y GE + F
Sbjct  751   LTLVGRLDGLPHWLGSLANLTHLHLGLSHLQQEIISSLNALYNLVFLQLKKAYDGEVLDF  810

Query  1999  NAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRYLE  2178
               G F  L  LNL +L  L +V + EGA+P +++L + RC  L  +P GIE L  L+ L 
Sbjct  811   RIGWFPRLNKLNLLELRRLDSVRVEEGALPSIQELYLIRCPALKVLPEGIEYLTGLQKLH  870

Query  2179  FFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSV  2313
               +M ++F+     D   ED  KV HI  + + + +D  W + ++
Sbjct  871   LEEMPEEFVRRLRSDI-SEDQSKVQHIPTINHVFMEDQSWVIETL  914



>ref|XP_010263181.1| PREDICTED: disease resistance protein RPM1-like [Nelumbo nucifera]
Length=926

 Score =   488 bits (1255),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 301/768 (39%), Positives = 455/768 (59%), Gaps = 26/768 (3%)
 Frame = +1

Query  22    ALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKHF  195
             +L ++ ++IVGIE  R  L+  L   +P   VISVVGMGG GKTTLV   ++   V++HF
Sbjct  159   SLFVQNEDIVGIEKNRDLLVGWLTDGEPRRTVISVVGMGGLGKTTLVAKSFNSQIVRRHF  218

Query  196   QSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVI  375
               +AW++VSQ +K+E++L+  I +  A+ +      + + +  KL   +  +L  ++YVI
Sbjct  219   DCYAWVSVSQNYKIEQLLRRTIVEFDAKQELLPNNYLEAFDYKKLVETLINYLQEKRYVI  278

Query  376   VFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSW  555
             V DDVW   VW +I    P+   G R +++TR  DVASS    +  +++ + PL +  +W
Sbjct  279   VLDDVWRIDVWTSISVAFPENLCGSRILVTTRQQDVASSFGFGS--HVHHLLPLQQSEAW  336

Query  556   ALLCRKAFHA---SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
             AL C+K F     +SCP  L  + + I+K+C GLPLAIVA+GG+L+ K+ T + EW  + 
Sbjct  337   ALFCKKTFSDDPFNSCPPELEPLARTIVKKCEGLPLAIVAVGGLLSLKDHTEL-EWKKVK  395

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SL  +   N   ES++ IL LSFNDLP YL+ CF+Y S++PED++++   L+  W   G
Sbjct  396   DSLNWELRDNPMLESVQSILSLSFNDLPYYLRHCFLYCSLFPEDYIMKRQRLVRLWIAAG  455

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             F++++ G   + VAE YL ELI R+++     +D G ++  R+HDL RE+ LS S + NF
Sbjct  456   FIQERRGIPKDVVAEAYLSELIRRNMLQVAVKDDVGMVEACRMHDLMRELALSASEEENF  515

Query  1087  VTTID--EETAAWPEKARHLS-------VHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSS  1239
              T  D  E       KARHLS       +  +L  A M R    LRSL  F +T +   S
Sbjct  516   CTVHDGREAREDGNGKARHLSILNNDNTIQSSLSTASMPR----LRSLFMF-LTATVSPS  570

Query  1240  HVVQILSSCRVIKVLDLQSTSLEIVPEEIF-QLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
              +  +LSS R+++VLDL    +E VP+++F +L +LRYLS R T +K +PRS+ KL+ LE
Sbjct  571   WLPTLLSSFRLLRVLDLTGVPIETVPDDLFDELFNLRYLSFRETNIKKVPRSLGKLQRLE  630

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              LD+++T V  LP  + KL +L++L++Y  +   Y  +N     +AP G+ KL +L  L 
Sbjct  631   TLDVRHTNVKSLPNGLAKLLNLQYLLMYQFIDRNYKTFNSISSIRAPTGIWKLANLRTLA  690

Query  1597  YVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
              +EAN  +  I  +G L +LKR  I KLR  DG  +C SI+K+  L +LN+ ++ E+  L
Sbjct  691   SIEAN--SKIIRLVGNLTQLKRFEITKLRAVDGAELCQSIQKMSHLLNLNMVALNENEPL  748

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
              +  LS  PPLLQ L LSGY+ K+P  + +LRNL ++  RWS+L++DPL  LQ LPNL  
Sbjct  749   QLEALSPAPPLLQTLRLSGYLEKVPRCLGTLRNLTRLCLRWSRLREDPLPSLQALPNLAF  808

Query  1957  LEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
             L+ +  Y G  + F  G F  L+ L L +L +L  V+I +GAMP ++KL +  C +L S+
Sbjct  809   LQLVKAYNGPLLCFRGGWFLKLKGLTLWELSQLNCVIIEKGAMPCIQKLELTACAELKSL  868

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
             P GIE L  L  L   ++ D+ +   L    G D   V H+  + + Y
Sbjct  869   PQGIEYLQGLSQLYLQEVADELLWR-LRGPEGLDRPLVDHVPHIRHYY  915



>ref|XP_003588998.1| NBS-containing resistance-like protein [Medicago truncatula]
 gb|AES59249.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=945

 Score =   488 bits (1255),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 301/763 (39%), Positives = 468/763 (61%), Gaps = 17/763 (2%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLL-KDDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R  +L +EE EIVG E PR E++  L+ +++ T  VISVVGMGG GKTTL K V+D+  +
Sbjct  165   RLASLFVEEGEIVGFEKPRDEIVDWLVDEEERTRSVISVVGMGGLGKTTLAKNVFDNQQL  224

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             K +F   A++ VSQ++ VE +L+ M+ Q   E K+P+P+G+ +M+   L    + +L  +
Sbjct  225   KGYFDCRAFLVVSQSYSVEALLRSMMMQFSEETKEPLPQGINTMDKTSLINFARSYLKNK  284

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +YV+ FDDVW    W+ I+   P  K G R MI+TR +DVA+    D+   ++++ PLS 
Sbjct  285   RYVVYFDDVWKVDFWDEIQLATPDNKLGSRIMITTRNLDVANYCRKDSVVQVHKLQPLSP  344

Query  544   EVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
               SW L+C KAF    + +CP  L ++ K+I+++C GLPLAIVAIGG+L+TK+KT ++EW
Sbjct  345   NKSWELICNKAFRFGFSGNCPPELEDMSKEIVQKCEGLPLAIVAIGGLLSTKDKT-VSEW  403

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               L  +L  + + N    ++  IL +S++DLP YLK C +Y  IYPED+ I  + LI QW
Sbjct  404   KKLCQNLSSELDRNPHLANITRILGMSYDDLPHYLKSCVLYFGIYPEDYSIRSSRLIRQW  463

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFVK + GK++EEV E YL ELI+RSL+   +++ DG     RIHDL RE+I+ K  
Sbjct  464   IAEGFVKHEVGKSLEEVGEEYLTELIHRSLVHVSRVHYDGKATSCRIHDLLREMIMRKMK  523

Query  1075  DHNFVTTIDEETAAWPEKA---RHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHV  1245
             D +F   +DE+       A   R L+++ +  N     +   +RSL  F+          
Sbjct  524   DLSFCHVMDEDGHEQISDAMIIRRLAINTSSKNVLRSIENFPIRSLYIFDALIKLSDYFG  583

Query  1246  VQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILD  1425
              +  +  +++KVLDL+ T L+ +P+++  + HL+YLSLR T VK LP+SI KL  LE LD
Sbjct  584   SRFFAKSKLLKVLDLEGTWLDYIPDDLGNMFHLKYLSLRYTNVKNLPKSIGKLHNLETLD  643

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVE  1605
             LK T + +LP+EI KL  LRHL+VY+    A+L  +   G +  +G+G +  L+KL +VE
Sbjct  644   LKGTLIHDLPIEINKLTKLRHLLVYNRR--AHLRISGESGVRIIQGVGSMTVLQKLYHVE  701

Query  1606  ANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDV  1782
              + G    I E+ KL +L++L +  ++ E G A+C SIE++  L SL++ +I E+ V+D+
Sbjct  702   VDHGGLELIAELKKLKQLRKLGLKNVKREYGNALCESIEEMKCLESLHISAINENEVIDL  761

Query  1783  NYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLE  1962
              ++SS P L Q L+L G + K+P+W+  L  LV++  R+SKLKDDPL+ L+DLPNL+ L 
Sbjct  762   QFISSLPQLRQ-LHLFGRLEKLPNWVPRLEQLVRLSIRFSKLKDDPLKLLKDLPNLLRLA  820

Query  1963  FLV-GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVP  2139
              +   Y GE +HF  G F+ L  L L +L  L +++I  G +P L+ + +    +L+ +P
Sbjct  821   IVCDAYDGEMLHFQVG-FKKLNKLYLVQLNNLNSILIDNGTLPALKLIEMVSIPKLSEIP  879

Query  2140  AGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEV  2268
             +    L +L  L   +M  +F  +  P+   +++  + H+  V
Sbjct  880   SDFHLLKSLETLRLVNMPYEFNQSIDPNGGPKNWV-IEHVKMV  921



>ref|XP_006388340.1| hypothetical protein POPTR_0221s00220g [Populus trichocarpa]
 gb|ERP47254.1| hypothetical protein POPTR_0221s00220g [Populus trichocarpa]
Length=928

 Score =   487 bits (1253),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 306/783 (39%), Positives = 455/783 (58%), Gaps = 24/783 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D +S +L +E+ E+VGIE+ + ELISLL+  +    VI+VVGMGG GKTTL K VYD  
Sbjct  155   HDPQSGSLFIEDSELVGIESTKDELISLLVSGECQRTVIAVVGMGGVGKTTLAKKVYDSY  214

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK+HFQ HAWITVSQ++   E+L+  +++LF   K+P PE   +M+A  L   ++++L 
Sbjct  215   VVKQHFQGHAWITVSQSYDRVELLRSTLKKLFEAKKEPFPEAFVTMDALSLIDELRQYLQ  274

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             + +Y++VFDDVW  R W  ++H L   K G + +++TR  DVA+     +  ++Y+M  L
Sbjct  275   QERYLVVFDDVWEIRFWGDVEHALVDNKKGSKILVTTRNEDVANFCRRSSLVHVYQMKSL  334

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
              +  +W L C+KAF      +CP  L E+ + I++RCGGLPLAIVA+GG+LATK +  I 
Sbjct  335   PQREAWDLFCKKAFKFDFEGNCPKDLEELSQDIVRRCGGLPLAIVAVGGLLATKERV-IP  393

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  L +SL      +   E++  IL LSF+DLP YLK CF+   + PED  I+   +I 
Sbjct  394   EWQKLVNSLDSTMASDPHVENVTKILSLSFHDLPYYLKACFLSFGMLPEDFSIKRTRIIR  453

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  +GFV++K G T+EE AE  L  LI RSL+   + +  G     R+HDL R++ILS+
Sbjct  454   LWVAQGFVQEKRGLTLEEAAEECLNGLIRRSLVQVDEASMKGIPTTCRVHDLVRDVILSR  513

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
             S + +F   +   ++A    ARH+S+     +       ++ RS++ F     Q    + 
Sbjct  514   SEELSF-GHVSWNSSALEGIARHMSISKGGSDNPKGSTRSQTRSVMVFCGAKLQ-KPIID  571

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              I   C+++  LD +   ++ +P+E+  LLHL+YLSLR T V  LP+SI KL+ LE LDL
Sbjct  572   AIFEKCKLLTTLDFEKCPIDEIPKELGNLLHLKYLSLRDTLVSNLPKSIGKLQNLEFLDL  631

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
               + V  LPVE+ +   LR+L+      + ++        +   G  +L     LV    
Sbjct  632   SDSLVERLPVEVNRFPKLRYLLGEPKQGYGFV-------VRGSLGQLELLQTLCLVNAGF  684

Query  1609  NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDV-VLDVN  1785
             +     I EIG L +L++L I+ ++TE G+ +C ++E +  LRSL + S    V +LD+ 
Sbjct  685   HHEWKLINEIGMLKQLRKLGIMNMKTEYGRDLCVALENMPHLRSLWVASEGYGVAILDLQ  744

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKD-DPLEHLQDLPNLVHLE  1962
              +SSPP  LQ L L G + ++P WI  L +L K+    + L D D ++ LQ LPNL  L 
Sbjct  745   AMSSPPLHLQSLILRGKLERLPEWISRLHHLAKLRLTDTMLMDGDSIKVLQALPNLRFLR  804

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
             FL GY GE MHF  G FQ L+ L L  L EL  ++I +GA+P LEKL I  C  L  VP+
Sbjct  805   FLRGYNGERMHFEGGGFQKLKSLRLAGLTELNTMIIDQGAIPLLEKLEIGFCRSLKEVPS  864

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNSVQET  2322
             GI+ L NL+ L    M+D+F     P+  G+DY  V H+  + Y    DG ++ +   E+
Sbjct  865   GIQHLKNLKQLSLAKMSDEFNERLSPNN-GQDYWIVKHVPVLQY----DGTYDPDD--ES  917

Query  2323  SSG  2331
             S G
Sbjct  918   SYG  920



>ref|XP_009374542.1| PREDICTED: disease resistance protein RPM1-like isoform X3 [Pyrus 
x bretschneideri]
Length=834

 Score =   481 bits (1239),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 281/673 (42%), Positives = 421/673 (63%), Gaps = 14/673 (2%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             ND R  +L +EE EIVGIE+ R EL  LL++  P  +VIS VGMGG GKTTL K VYD  
Sbjct  160   NDPRVASLFIEEAEIVGIESTRDELTLLLVEGAPRREVISTVGMGGLGKTTLAKKVYDQK  219

Query  184   K--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             K   HF  +AWITVSQ+++VE++L+ +I++ ++  K+  PE + +M+   L    +E+L 
Sbjct  220   KVVAHFDCYAWITVSQSYRVEDLLRTVIKKFYSSRKERFPEEIDTMDEESLISTSREYLQ  279

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             +++YV+VFDDVW    W AI+H LP + +G R +I+TR+ DVA         +++ + PL
Sbjct  280   QKRYVVVFDDVWKVDFWGAIEHALP-DNNGGRIIITTRIQDVADFCKRSCFVHVHHLQPL  338

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
                 +  L CRKAF       CP  L E+   I++RC GLPLAIV+IGG+L+TK K  ++
Sbjct  339   PPNKALELFCRKAFQFELEGKCPEELEELSLSIVERCKGLPLAIVSIGGLLSTKAKV-VS  397

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  LY+SL  + E N    S+  IL LS++ LP YLKLC +Y  I+PED+ +    L+ 
Sbjct  398   EWQKLYNSLSSELESNPHLTSVTRILSLSYHHLPYYLKLCVLYFGIFPEDYSVSCIRLVR  457

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  EGFVK K GKT+EEV E YL ELI+RSL+   ++ +DG  +  R+HDL  +++L K
Sbjct  458   LWIAEGFVKLKRGKTLEEVGEEYLMELIHRSLVQVSEVYNDGKARACRVHDLLHDVLLKK  517

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
               D +F   + ++ + +    R LS+  +   A+     + +RS+  FN+ +    S + 
Sbjct  518   GLDSSFCHVLSKDESTFKPTTRRLSIDISPSEARGSITQSHIRSVFIFNLEECP-ESFLN  576

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
             ++  + +++KVLD     +  +P+ +  L  L YLSLR+TKVK+LP S+  L+ LE LDL
Sbjct  577   KLSGNFKLLKVLDFSDAPINQLPKYVGDLYLLTYLSLRNTKVKLLPDSVGNLQNLETLDL  636

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSF---AYLPYNCSPGFKAPkglgklgsleklVY  1599
             K + V E+P +I  L  LRHL+ Y H  +     L +N   G K  +G+G L +L+KL Y
Sbjct  637   KQSLVYEIPAKINNLVKLRHLLAY-HRDYNCEVGLFWNMEKGVKIHEGIGCLQALQKLSY  695

Query  1600  VEANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             V+AN G    I+E+GKL +L++L +  L++EDG+AVC+SIEK+  L SL L +I ED VL
Sbjct  696   VDANHGGIRLIKELGKLRQLRKLSLTNLKSEDGRAVCASIEKMNHLESLLLTAINEDEVL  755

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             D+  +S+PP  ++ L L G + ++P WI +L++LV++   WS+L+D PL+ LQ+LPNL  
Sbjct  756   DLESISTPPQFIRSLGLIGRLEQLPGWISNLQHLVRLVIFWSRLRDSPLKALQNLPNLSE  815

Query  1957  LEFLV-GYTGEHM  1992
             L   +  Y G ++
Sbjct  816   LVLEINAYDGSYV  828



>ref|XP_003526348.1| PREDICTED: disease resistance protein RPM1-like [Glycine max]
 gb|KHN26406.1| Disease resistance protein RPM1 [Glycine soja]
Length=943

 Score =   485 bits (1248),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 298/773 (39%), Positives = 450/773 (58%), Gaps = 20/773 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYD--  177
             +D R  +L +EE EIVG E PR EL++ LLK      VISVVGMGG GKTTL K V+D  
Sbjct  159   HDPRMSSLFIEETEIVGFELPRDELVAWLLKGTEERTVISVVGMGGLGKTTLCKHVFDSE  218

Query  178   DVKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
             +VK HF   A ITVSQ++ V  +  DMI+Q   E K P+P+ +  M+   L   ++++L 
Sbjct  219   NVKSHFDCRACITVSQSYTVRGLFIDMIKQFCRETKDPLPQMLHEMDEKSLISELRQYLE  278

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              ++Y+I FDDVW     + ++  +P      R +I+TRLM VA         +++ +  L
Sbjct  279   HKRYLIFFDDVWHEDFCDQVEFSMPNNNKRSRIIITTRLMHVAEFFKKSFPVHVHSLQLL  338

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
               + +W L C+KAF       CP+ L  +  +I+++C GLPLAIVAIGG+L+TK+KT + 
Sbjct  339   PPDKAWELFCKKAFRFELGGKCPAELQGMSNKIVRKCKGLPLAIVAIGGLLSTKSKT-VF  397

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  +  +L  + + N    SL  IL LS+++LP +LK C +YL IYPED+ I H SL  
Sbjct  398   EWQKVIQNLNLELQRNPHLTSLTKILSLSYDNLPYHLKPCLLYLGIYPEDYSINHTSLTR  457

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
             QW  EGFVK    +T+E+VA+ YL ELI RSLI    +  +G +K  ++HDL  E+I+ K
Sbjct  458   QWIAEGFVKSDGRRTIEQVADEYLSELIYRSLIQVSSIGFEGKVKNCQVHDLLHEVIVRK  517

Query  1069  STDHNFVTTI---DEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSS  1239
               D +F   +   D+E+A      R LS+  +            +R++  F         
Sbjct  518   MEDLSFCHFLYEGDDESATLG-TIRRLSIDTSSNKVLKSTNNAHIRAIHAFK--KGGLLD  574

Query  1240  HVVQILSS-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
               + +LSS  R +KVLDL+ T L  VP  +  L HLRYL+LR+TKV+VLP+S+ KL+ LE
Sbjct  575   IFMGLLSSKSRPLKVLDLEGTLLSYVPSNLGNLFHLRYLNLRNTKVQVLPKSVGKLKNLE  634

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSH---VSFAYLPYNCSPGFKAPkglgklgsle  1587
              LD++ T V E P EI KL+ LRHL+ +       ++ L +      K            
Sbjct  635   TLDIRDTLVHEFPSEINKLKQLRHLLAFHRNYEAEYSLLGFTTGVVMKKGIKNLTSLQNL  694

Query  1588  klVYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED  1767
               V VE + G   I+E+  L +L++L +  +R E G A+C+S+E++ +L SLN+ +I +D
Sbjct  695   CYVEVE-HAGIDLIQEMRFLRQLRKLGLRCVRREYGNAICASVEEMKQLESLNITAIAQD  753

Query  1768  VVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPN  1947
              ++D+N +SS P  L+RL+L   + KMP+WI +L  LVKI    S LKDDPL  L+ LP+
Sbjct  754   EIIDLNSISSLPQ-LRRLHLKARLEKMPNWISTLEFLVKIRLALSNLKDDPLRSLEKLPS  812

Query  1948  LVHLEFL-VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQ  2124
             L+ +      Y G+ +HF +G F  L+ L L +L  + +++I +GA+  LE   + +   
Sbjct  813   LLKVSIWDNAYDGQILHFRSGGFPKLKELYLARLNRVNSILIDKGALLSLENFKLNKMPH  872

Query  2125  LASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYW  2283
             L  VP+GI+ L NL+ L+F DM  +F+ +  P + G++Y  ++H+  V+  +W
Sbjct  873   LKEVPSGIKALDNLKALDFLDMPTEFVESIDP-QNGQNYWIINHVPLVFIRHW  924



>ref|XP_004499780.1| PREDICTED: disease resistance protein RPM1-like [Cicer arietinum]
Length=942

 Score =   484 bits (1247),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 303/762 (40%), Positives = 453/762 (59%), Gaps = 13/762 (2%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--  180
             D R  +  ++E ++VG E+PR EL+S L+ +     V+SVVGMGG GK+TL K V+D+  
Sbjct  162   DPRMASFFIDETQVVGFESPRDELVSYLVNETNECMVVSVVGMGGLGKSTLAKHVFDNKL  221

Query  181   VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR  360
             VKKHF   +++TVSQ++ V E+L DMI++      +  P+G+  M+   L   V+++L  
Sbjct  222   VKKHFDCRSFVTVSQSYTVRELLIDMIKKFCENNNEAFPKGLQDMDDKTLITHVRQYLES  281

Query  361   RKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
             ++Y+++FDDVW     + I+H +   K G R +++TR+M VA         +++ + PLS
Sbjct  282   KRYLVLFDDVWKENFCDEIEHAIIDNKRGSRIIVTTRMMHVAEYFKKSFYVHVHNLQPLS  341

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              + +W L C K F    CP+ L E+  +++++CGGLPLAIVAIGG+L+TK+KT I EW  
Sbjct  342   PKKAWELFCNKVFRDGKCPTELEEMSNEMVQKCGGLPLAIVAIGGLLSTKSKTMI-EWRK  400

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  +L  + E N    SL  IL LS++DLP +LK C +Y  IYPED+ I    L  QW  
Sbjct  401   VSQNLRMELERNAHLTSLVRILSLSYDDLPYHLKSCMLYFGIYPEDYTINRKRLTRQWMA  460

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFVK    +T+EEVAE YL ELI RSL+   K+  DG +K  ++HDL RE+I+ K  D 
Sbjct  461   EGFVKNVERRTLEEVAEEYLTELIYRSLVQVSKVGFDGKVKSCQVHDLLREVIVRKMKDL  520

Query  1081  NFVTTI--DEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             +F   +  D+E   +    R  S+     N         +R++L F+    +     ++ 
Sbjct  521   SFCHLMHEDDEQVTFG-ITRRFSIAAISSNVLRSASNKGIRAILVFD--KGELPKPFMKR  577

Query  1255  LSS-CRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             LSS  +++KVLD Q++ L  +P+ +  L HLRYL+L  TKVK+LP SI  L  LE LDL+
Sbjct  578   LSSKYKLLKVLDFQNSLLNSIPDNLGNLFHLRYLNLSHTKVKILPSSIGNLINLETLDLR  637

Query  1432  YTFVTELPVEILKLQHLRHL-IVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
              T V ELP EI KL  LR L + Y      Y   N + G    +G+G L SL+KL ++EA
Sbjct  638   QTKVHELPKEINKLTKLRLLPVYYRKYEEHYSMLNFTRGVHMQEGIGTLKSLQKLYFLEA  697

Query  1609  NPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVN  1785
             + G    I+E+  L +L++L I  +R E G A+CS+I+++ +L SLN+  I +D +LD++
Sbjct  698   DHGGIELIQELKMLRQLRKLGIKHVRREYGNALCSAIQEMNQLESLNIGVIAKDEILDLD  757

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
             ++S+PP  L+ L L G + K P+WI  L  LVK+    S  +DDPL  L+ LPNL+ L  
Sbjct  758   FVSAPPH-LRVLNLKGRLTKFPNWIPKLNYLVKLRLGLSNFEDDPLNSLKSLPNLLRLNL  816

Query  1966  L-VGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
                 + GE +HF  G F  L+ L+L +L +L ++ I +GA+  LE        QL  VP 
Sbjct  817   WDDAFCGESLHFQVGGFPKLKELDLTRLNKLSSITIDKGALLCLEHFRFNNNPQLKVVPQ  876

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEV  2268
              ++ L NL++L F DM D+ + +  P+KRGE +  V HI  V
Sbjct  877   DLQHLKNLQFLGFADMPDELVESIDPEKRGECHWIVKHIQLV  918



>emb|CAN80288.1| hypothetical protein VITISV_006820 [Vitis vinifera]
Length=1894

 Score =   503 bits (1296),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 309/762 (41%), Positives = 447/762 (59%), Gaps = 48/762 (6%)
 Frame = +1

Query  22    ALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDVK--KHF  195
             +L +E+ EIVGIE+ + ELI  L++  P   VISVVGMGG GKTTL K VYD+ +  +HF
Sbjct  147   SLFIEDAEIVGIESHKGELIKWLVEGAPERTVISVVGMGGLGKTTLAKKVYDNKRMVEHF  206

Query  196   QSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVI  375
                AWITVSQ+FK+EEVL+++I+Q +   K+ +P+G  +M+   L   ++E+L  ++YV+
Sbjct  207   DCRAWITVSQSFKMEEVLRNVIKQFYLARKESIPDGTDAMDEMSLITRLREYLEDKRYVV  266

Query  376   VFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSW  555
             VF DVW    W  IK++LP+ K G R +I+TR ++V S+    +  YI+ +  L  E SW
Sbjct  267   VFXDVWKLEFWRFIKYILPENKRGSRIVITTRNVEVGSAVKESSFHYIHNLQALPPESSW  326

Query  556   ALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYHSL  735
              L C+KAF    CP  L +I   I+KRC GLPLAIVA+GG L+TK K  + EW     SL
Sbjct  327   ELFCKKAFQGCFCPPELEKISLDIVKRCEGLPLAIVAMGGALSTKEKNEL-EWQKFNDSL  385

Query  736   GPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGFVK  915
             G   E N   E++  IL LS++DLP YLK CF+Y +I+PED+ I    LI  W  EG   
Sbjct  386   GSQLESNPHLENITKILSLSYDDLPHYLKSCFLYFAIFPEDYPINCGRLIRLWIAEG---  442

Query  916   QKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFVTT  1095
                                             G ++  R+HDL REIIL K+ + +F  +
Sbjct  443   --------------------------------GKIRSCRVHDLMREIILRKAEELSFCRS  470

Query  1096  IDEETAAWPEKARHLSVHGTLGN-AQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSCRV  1272
               EE +++  K R  SV  +  N  +   +  ++RS+L F++ D+         L++  +
Sbjct  471   FGEEDSSFDGKFRCGSVQKSTDNVVEAINRNPQIRSILLFDI-DAVPMLFTGTSLTNFNL  529

Query  1273  IKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVTEL  1452
             +K+LD +   L  VPE++  L HLRYLSL  TKVK+LP+SI KL+ L+ LDLK++ V  L
Sbjct  530   LKILDFEKAPLYSVPEDLGNLFHLRYLSLSRTKVKMLPKSIGKLQNLQTLDLKHSLVDAL  589

Query  1453  PVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGTIE  1632
             PVEI KL+ LRH++ Y++       +  + G    +G+G +  L+KL YVEAN G G IE
Sbjct  590   PVEIKKLRKLRHILAYAYKVCPEWDFYTTRGIHIGEGIGSMLDLQKLCYVEANHGMGLIE  649

Query  1633  EIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSPPPLL  1812
             E+GKL +L+RL I  L  +DG  +C+SI  +  L SL + S ++D +L +  +S PP  L
Sbjct  650   ELGKLRQLRRLGITNLVEDDGLRLCASISNMKHLESLCICSKDDD-ILKLETISVPPRYL  708

Query  1813  QRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYTGEHM  1992
             + LYL G + K+P W+ +LR+LV++  R S L  DP+E LQ LPNL+ +E    Y GE +
Sbjct  709   RNLYLQGCLSKLPEWLPTLRSLVRVCLRRSGLSYDPVEVLQALPNLLEVELHTAYDGECL  768

Query  1993  HFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLFNLRY  2172
              F+   FQ L+ L L  ++ L+ + I +GA+P LE L I    QL  V  GI  L  L  
Sbjct  769   CFSELGFQKLKRLRLRGMKGLKTLKIHDGALPLLEHLEIGPSPQLEEVXPGIRLLKTLTS  828

Query  2173  LEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCW  2298
             +EF+ M+D F+ + LP+  GE+Y  V H+         D CW
Sbjct  829   IEFWGMSDKFLLSMLPE-HGENYQIVEHVVI------GDNCW  863



>ref|XP_008377937.1| PREDICTED: disease resistance protein RPM1-like [Malus domestica]
Length=912

 Score =   482 bits (1241),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 288/687 (42%), Positives = 421/687 (61%), Gaps = 24/687 (3%)
 Frame = +1

Query  1     ANDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD  180
             +ND R  +L +EE EIVGIE+ R EL  LL++  P  +VISVVGMGG GKTTL K VYD 
Sbjct  224   SNDPRVASLFIEEAEIVGIESARDELTRLLVEGAPRREVISVVGMGGLGKTTLAKKVYDQ  283

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               V  HF  +AWITVSQ+++VE++L+ +I++ ++  K+  PE + +M+   L    +E+L
Sbjct  284   PKVMAHFDCYAWITVSQSYRVEDLLRTVIKKFYSSRKERFPEEIDTMDEESLISTSREYL  343

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
              +++Y++VFDDVW    W AI+H LP +  G R +I+TR+  VA+        +++ +  
Sbjct  344   QQKRYIVVFDDVWKVDFWGAIEHALP-DXXGGRIIITTRIQXVANFCXRSCFVHVHHLQH  402

Query  535   LSEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNI  705
             L    +W L CRKAF       CP  L E+   I+KRC GLPLAIV+  G+L+TK K  +
Sbjct  403   LPPNKAWELFCRKAFQFELEGKCPEXLEELSLNIVKRCEGLPLAIVSXXGLLSTKAKV-V  461

Query  706   NEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLI  885
             +EW  LY+SL  + E N    SL  IL LS++ LP YLK C +Y  I+PED+ +    L+
Sbjct  462   SEWQKLYNSLSSELERNPHLTSLTRILSLSYHHLPYYLKSCVLYFGIFPEDYSVNCIRLV  521

Query  886   YQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILS  1065
               W  EGFVK + GKT+EEV E YL ELI+RSL+   ++  DG  +  R+HDL  +++L 
Sbjct  522   RLWIAEGFVKPRRGKTLEEVGEEYLMELIHRSLVQVSEVYIDGKARACRVHDLLHDVLLK  581

Query  1066  KSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHV  1245
             K  D +F   + ++ + +    R LS++ +   A      + +RS+ TFN+ +    S +
Sbjct  582   KGLDSSFCHVLSKDESTFKPTTRRLSLNISPSWALGSITQSHIRSVFTFNLEEWP-ESFL  640

Query  1246  VQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILD  1425
               +  + +++KVLD     +  +P+ +  L  L YLSLR+TKVK+LP SI  L+ LE LD
Sbjct  641   DTLSGNIKLVKVLDFTDAPINQLPKYVGDLYLLTYLSLRNTKVKLLPDSIGNLQNLETLD  700

Query  1426  LKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCS--------PGFKAPkglgklgs  1581
             LK + V E+P +I KL  LRHL+ Y      +  YNC            K  +G+G L +
Sbjct  701   LKQSLVYEIPTKINKLVKLRHLLAY------HRDYNCDVRLFLNMEKEVKIHEGIGCLQA  754

Query  1582  leklVYVEANPGN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksI  1758
             L+KL YVEAN G    I+E+GKL +L++L +  L++EDG+AVC+SIEK+  L SL L +I
Sbjct  755   LQKLSYVEANHGGIRLIKELGKLRQLRKLGLKNLKSEDGRAVCASIEKMNHLESLLLTAI  814

Query  1759  EEDVVLDVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQD  1938
              ED VLD+  +S+PP  L+ L L G + ++P WI +L+++VKI   WS+L+D PL+ LQ+
Sbjct  815   NEDEVLDLESISTPPEFLRSLCLIGRLEQLPGWISNLQHIVKITIYWSRLRDSPLKALQN  874

Query  1939  LPNLVHLEF-LVGYTGEHMHFNAGKFQ  2016
             LPNL+ L      Y G  +HF  G FQ
Sbjct  875   LPNLLKLTLGRNAYDGVQLHFEEGGFQ  901



>ref|XP_010107827.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXC17139.1| Disease resistance protein RPM1 [Morus notabilis]
Length=922

 Score =   480 bits (1236),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 302/769 (39%), Positives = 452/769 (59%), Gaps = 21/769 (3%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             R  +L +E+DE + + + R EL++ L++  PT  VIS++GMGG GKTTL +  YD   VK
Sbjct  160   RLGSLFIEDDEFLDLHSTRDELMTRLVEGAPTRTVISLLGMGGIGKTTLARKAYDAKVVK  219

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
              HF   AWITVSQ++ +E++L  M   L  E K  V E        +L   ++ FL  ++
Sbjct  220   AHFDCCAWITVSQSYNLEKLLGTMAMHLCPEFKIDVIE--------ELIGRLRNFLETKR  271

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IVFDDVW    W  IKH LP    G R +++TR   V ++   D+   + +++PLS E
Sbjct  272   YLIVFDDVWQVDFWGVIKHALPSNSRGSRIIVTTRNDMVTAACQEDSCHLVKKLSPLSHE  331

Query  547   VSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
             ++W L C+ AF       CP  L  +  +I+++C GLPL I ++ G+L+TK K N++EW 
Sbjct  332   IAWQLFCKNAFRFKLEGQCPQELETLSLEIVRKCQGLPLVISSVAGLLSTKEK-NVSEWQ  390

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              L  +L   FE N    S+  IL LS+N+LP YLK CF+Y  I+P   LI   +L   W 
Sbjct  391   KLNKTLNRQFETNPNLPSISKILSLSYNNLPSYLKPCFLYFGIFPRCRLITETTLYRHWI  450

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLI-LPVKLNDDGSMKQGRIHDLYREIILSKST  1074
              EGF+K+K  KT+E+VAE YL ELI R+L+ +   L   GS +  ++HDL R IILS++ 
Sbjct  451   AEGFIKEKTDKTLEQVAEEYLNELILRNLVQVQDVLCGGGSDRLCQVHDLMRVIILSRAD  510

Query  1075  DHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
             +  F   +DE+ +    K+R LSV+  + +       + +RS+L FN+     +  +   
Sbjct  511   ELGFYQIVDEKKSTVRGKSRRLSVYNYMKDRMKIDDISGVRSVLLFNIDGQLANVFMDNW  570

Query  1255  LSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKY  1434
             L  C+++KVLD  +  ++ +P+ +  L HLR+L+LR+TKVK LP+SI KL+ L++LDL  
Sbjct  571   LEKCKLLKVLDFTNVPIDRLPKGLGDLFHLRHLNLRNTKVKALPKSIGKLQNLQVLDLIN  630

Query  1435  TFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANP  1614
             T + +LP+EI  LQ+LRH+  + +       ++   G K  +G+G LG L+ L +VE N 
Sbjct  631   TSLRKLPIEINMLQNLRHINGFYYDQRLGFCFDAFQGLKIHEGIGCLGELQTLWHVEVNE  690

Query  1615  GN-GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYL  1791
              + G I+E+  L +L+ L ILKL  E G A+C+SI K+  L  L L S  E  ++D+  +
Sbjct  691   NSIGLIKELEMLTQLRVLGILKLPAELGDALCASIAKMNHLERLLLVSNSEAEIIDLQAI  750

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLV  1971
             SSPP  L  L   G + K+ +WI  L NL  + F +++  DDPL+ LQ+LPNL +L    
Sbjct  751   SSPPLSLGILSFMGRLPKISNWILKLSNLHSLAFSFTRFSDDPLKRLQNLPNLEYLYLYK  810

Query  1972  GYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIE  2151
              Y G+ +H   G FQ L+LL L  L E+R + IG G++P LE+L I  C QL   P+ I+
Sbjct  811   AYDGDEIHIEEGGFQKLKLLELCDLNEVRVIKIGRGSLPLLEELRIGACPQLKEAPSNIQ  870

Query  2152  CLFNLRYLEFFDMTDDFISTFLPDKRGEDYC-KVSHISEV--YYTYWKD  2289
              L NLR +E  +M  +F+    PD  G+  C KV H+  V  YY + +D
Sbjct  871   HLRNLRVVEVSEMPMEFVLAMQPD--GDQCCWKVKHVPNVWSYYKFGRD  917



>emb|CDP18957.1| unnamed protein product [Coffea canephora]
Length=910

 Score =   480 bits (1235),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 293/756 (39%), Positives = 454/756 (60%), Gaps = 15/756 (2%)
 Frame = +1

Query  22    ALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKHF  195
             ++  +ED+IVGI+  +  L   L  ++    V+S+VGMGG GKTTLV  V++D  +K+HF
Sbjct  159   SVFADEDDIVGIDENKARLYHWLTGNEQRRTVVSIVGMGGLGKTTLVTKVFNDQVIKRHF  218

Query  196   QSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYVI  375
              S AWI+VSQ  ++E +L+ M+++     +  +P  +GSMN  +L  ++ E+L  R+Y++
Sbjct  219   DSLAWISVSQAHQIEGLLRSMVKEFLKTEQAMIPRNLGSMNYRQLMEMLIEYLHNRRYLV  278

Query  376   VFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEVSW  555
             V DDVW+  +W  I+   P    G R +++TR  +VA S    +   ++ + PL E  +W
Sbjct  279   VLDDVWSIDLWSRIRGAFPVNLCGSRIVLTTRDENVAMSVGPGSR--VHRLEPLQEHDAW  336

Query  556   ALLCRKAFHAS---SCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              L C KAF       CP  L  + K IL++C GLPLAIVAIGG++ +K+KT I EW  ++
Sbjct  337   TLFCTKAFWNGCDHQCPPELEALAKAILRKCEGLPLAIVAIGGLMCSKSKTAI-EWKKVH  395

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SL   F  N   E ++ IL++SFNDLP YLK CF+Y  I+P+ +LI+   LI  W  EG
Sbjct  396   DSLNWQFSYNPLLERVKGILMMSFNDLPFYLKYCFLYCCIFPDGYLIKRKKLIRLWIAEG  455

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             F+ ++ G T+EEVAE +L ELI RS+I   ++ND+G +K  R+HD+ RE+ ++ S   NF
Sbjct  456   FILERKGMTMEEVAEDHLMELILRSMIQVKQINDNGRVKTFRVHDVMRELAMTTSERENF  515

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTK-LRSLLTFNV-TDSQFSSHVVQILS  1260
                 D + +      + LSV+    N ++ +  ++ LRSL  F   T S FS + V   S
Sbjct  516   CRLHDSQESKISRNVQRLSVYNRGKNLRLNKTTSRQLRSLFVFGTDTCSSFSLNAVS--S  573

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
             + + ++VL L++  +E +P E+  L +LRYL+LR+TKVK LP++I KL+ LE LD+++T 
Sbjct  574   NFKFLRVLALENIPIEKLPNELVDLFNLRYLNLRNTKVKDLPKAIDKLKNLETLDVRHTN  633

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             +  LP  ILKL+ LRHL V  +       +  S G +   G+G L SL+ L YVEA    
Sbjct  634   LERLPKRILKLEKLRHLFVCKNCVNRPKNFKFSQGLRVAAGIGTLLSLQSLSYVEAE--E  691

Query  1621  GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSP  1800
             G I+++G L  LKRL I K++T DG  +CSSI+ +  L  L++ +  E+  L +  L   
Sbjct  692   GIIKQVGYLTNLKRLDITKVKTCDGPKLCSSIQMMTSLHRLSVTASAEEEELLLEDLVFV  751

Query  1801  PPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYT  1980
             PP LQ+L L G + ++P W +S  NL  +   +S L++D L  LQ LP+LV L+    Y+
Sbjct  752   PPFLQKLELIGRLKRLPQWFESATNLTHLCLEFSHLQEDFLPSLQKLPSLVFLQIKKAYS  811

Query  1981  GEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLF  2160
             G+H+ F  G F  L  L+L++L +L  V +  G++P L++L + RC  L  +P GIE + 
Sbjct  812   GKHLKFIKGGFPKLSKLHLEELLQLDCVEVEVGSLPSLKELALIRCLALKLLPQGIEHIT  871

Query  2161  NLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEV  2268
             +L+ L+  +M ++ + +   D   E++ KV HI  V
Sbjct  872   SLQNLQLEEMAEELVESVQIDG-SENHKKVQHIHTV  906



>ref|XP_002531395.1| Disease resistance protein RPM1, putative [Ricinus communis]
 gb|EEF30979.1| Disease resistance protein RPM1, putative [Ricinus communis]
Length=831

 Score =   478 bits (1229),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 288/699 (41%), Positives = 432/699 (62%), Gaps = 23/699 (3%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VK  186
             R  +L ++E ++VGIE P+ +L++ L++ +  L  ISVVGMG  GKTTLVK VYD   ++
Sbjct  151   RLASLYIDEADLVGIETPKSQLVAWLIEGEEKLTSISVVGMGVLGKTTLVKKVYDSQLIE  210

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
             + F  + WITVS++F   E+L+  +Q      K+P PEGM  M   +L   ++  L +++
Sbjct  211   RSFDCYCWITVSKSFSHTELLRAALQGFLEATKEPAPEGMELMTDFQLVDAIRTLLQQKR  270

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IVFDDV +   W+AI +  P    G R + +TR  +VA+S   +    +Y +  L++ 
Sbjct  271   YIIVFDDVLSVDAWDAIMYAFPDCNSGSRIIFTTRSSNVAAS--LEITNRVYHLQLLTQS  328

Query  547   VSWALLCRKAF---HASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWG  717
              +W L CRKAF   H   CP  L E+ + IL+RC  LPLAIVAIGG+L+ K K   +EW 
Sbjct  329   EAWTLFCRKAFRAEHKGVCPVELEELSRGILRRCEELPLAIVAIGGMLSKKIKVG-SEWR  387

Query  718   ALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWT  897
              ++ SL  +F  ++   SL+ +LLLS+NDLP YLKLC++YLS++PED+LI   +L+  W 
Sbjct  388   KVHDSLAAEFRNDNNLGSLQRMLLLSYNDLPHYLKLCYLYLSVFPEDYLIRRTNLVRLWV  447

Query  898   MEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTD  1077
             +E  VK+K G T+EE AE Y  EL++RS+I  V+++    +K  R+HDL REII  KS +
Sbjct  448   VERIVKEKQGLTMEEAAEDYFNELVSRSMIQVVEVDFSYRVKTCRLHDLMREIIQLKSKE  507

Query  1078  HNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQIL  1257
              +FV   +E      +K   LS+H          +   LRSLL F  TDS  +     + 
Sbjct  508   ESFVVIANERGIRTNDKVHRLSIHDNPKELSSGIRFPYLRSLLLFTPTDS-VACFGHALF  566

Query  1258  SSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYT  1437
                ++++VL+L++  L   P E+  L+HLRYLSLR T + VLP SI+KL+ LEILDLK +
Sbjct  567   RDFKLLRVLELENLPLLSFPPELIGLIHLRYLSLRRTMITVLPESIRKLKNLEILDLKRS  626

Query  1438  FVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPG  1617
              V+ LP  IL+L++LR L V+              G + P G+G+L S++KL  +E N  
Sbjct  627   LVSSLPYGILELKNLRQLHVH--------------GMRVPPGIGRLTSIQKLGTIEVNDD  672

Query  1618  NGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSS  1797
                ++E+GKL +L+RL +  +R E GK +C S++++  L +L L S+  D +L ++ ++S
Sbjct  673   CELVKELGKLTQLRRLGVGSVRKEHGKDLCYSLDRMKHLTALFLVSMNRDELLCLDSVAS  732

Query  1798  PPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGY  1977
             PP  LQ LYL+G +  +P WI SLR L K+ F++SKL++DPL+ LQDLP+LV LE    Y
Sbjct  733   PPTNLQCLYLNGCLLTLPKWIASLRYLSKLVFQFSKLQNDPLKALQDLPSLVVLEIREAY  792

Query  1978  TGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHL  2094
              GE +  +A  F  L+ L L +L+ L+++ + EGAMP L
Sbjct  793   DGEELCCDARGFSRLKKLGLYQLKSLQSIKLAEGAMPGL  831



>gb|ABO15685.1| NBS-NBS-LRR type disease resistance protein [Ipomoea batatas]
Length=888

 Score =   478 bits (1230),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 311/770 (40%), Positives = 452/770 (59%), Gaps = 50/770 (6%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKD-DPTLKVISVVGMGGSGKTTLVKMVYDD  180
             +D R  A   E+ ++VG EN ++ LI LLL   D  L+V SVVGMGG GKTTLVK  YDD
Sbjct  144   HDVRVGAHFQEDSDLVGFENSKQSLIKLLLGAVDDDLRVHSVVGMGGFGKTTLVKKAYDD  203

Query  181   VK--KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
              +  +HFQ   W+TVS+TFK+EE+LKD+I++L        P G    +A++L   V++ L
Sbjct  204   AQIIRHFQHRVWVTVSETFKIEELLKDVIKKL-----GNTPNGD---SADELIQSVRDIL  255

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
               ++Y+IVFDDVW+  VW  IK+  P+++ G R +I+TR  ++   +  +T G +YE+  
Sbjct  256   SEQRYIIVFDDVWSFGVWRDIKYAFPRQRFGSRVVITTRNSEIGRDACHETQGDVYELKH  315

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             LSE+ SW L C+K F + SCP HL  I + I+ +CGGLPLAIV I G+LATK + +I EW
Sbjct  316   LSEKDSWELFCKKTFLSDSCPPHLVNIAEDIVNKCGGLPLAIVVIAGILATKGE-DIAEW  374

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
                        + +D+ ++L  +L LS+ DLP YLK CF+Y SI+PED +I    +I  W
Sbjct  375   KIF------QLKTDDRMKNLENLLSLSYYDLPYYLKYCFLYFSIFPEDAIIRKERVIQLW  428

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               EGFVK+K       +AE YL ELI+R+LI   K +  G +   R+HD+ REIILSK+ 
Sbjct  429   IGEGFVKEKG------LAEAYLNELIHRNLIQIAKKSHAGKIIGLRVHDILREIILSKAL  482

Query  1075  DHNFVTTIDEETAAWP--EKARHLSVHGTLGNAQMKRQGTK----LRSLLTFNVTDSQFS  1236
             + NF   +  +   W    K R L +HG   +  +  +GT     +RSL  ++      S
Sbjct  483   EQNFAVILTGQNKEWAPDNKCRRLIIHGFEFDDDI-LEGTSSKSHIRSLQLYHGASLGLS  541

Query  1237  SHVVQILSSCRVI--KVLDL-QSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLR  1407
                 ++LS    I  +VLD  + T LE +P+ +++L +L+YLSLR T +K + +SI  L+
Sbjct  542   FSASKLLSFDYYIPLEVLDFSRGTILEEIPKGVYKLFNLKYLSLRGTMLKKVSKSIGCLQ  601

Query  1408  MLEILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsle  1587
              LEILDLK T V  LPVEI KL  LR+L+V   +   Y P+             +L  L+
Sbjct  602   NLEILDLKKTLVYRLPVEIGKLHKLRYLVVDYPMEGVYFPFEIG----------RLLLLQ  651

Query  1588  klVYVEANPGNG--TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIE  1761
             KL YV A   N    + EIG L +L++L +  LR ED K + SSI+  L        ++E
Sbjct  652   KLSYVNATETNDVKVLSEIGNLTQLRKLGVTNLRQEDVKELFSSIK-KLTNLISLSLAVE  710

Query  1762  EDVVLDVNYLSSPPPL-LQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQD  1938
             ++ +LD+ +  SP PL L+ L L G + ++P W+ SL +L K+    S + +DPL  LQD
Sbjct  711   KNEILDIQHSPSPVPLCLRTLILYGRLERIPQWLSSLVSLTKLELWESCVLEDPLLILQD  770

Query  1939  LPNLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRC  2118
             LP L HL     Y GE + F AGKF  L+ L+++KL  L+ +++ EGAMP LE L +  C
Sbjct  771   LPMLAHLTLSEYYEGEGLCFKAGKFPKLKYLDIEKLRPLKWIMVEEGAMPLLEDLCLSGC  830

Query  2119  NQLASVPAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEV  2268
               L  VP GI+ L  L  ++F +M +  + +  P+  GE+Y K+SHI  +
Sbjct  831   RLLEQVPFGIQHLSKLNSIKFCNMNNTLMRSLKPN--GENYTKISHIPHI  878



>emb|CDP15677.1| unnamed protein product [Coffea canephora]
Length=880

 Score =   478 bits (1229),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 321/777 (41%), Positives = 455/777 (59%), Gaps = 44/777 (6%)
 Frame = +1

Query  22    ALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKH  192
             ALL+EE E+VGI+NP+++LIS LL+ DD  LKV+SVVGMGG GKTTL+K V++D  +K+H
Sbjct  130   ALLVEEAELVGIDNPKQQLISQLLEGDDSQLKVVSVVGMGGLGKTTLIKRVHEDLAIKRH  189

Query  193   FQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLR-RKY  369
             F   A++T+S        L    ++L + LKQ                 VK+FL +  +Y
Sbjct  190   FPVRAFVTLSTM-----QLPGATERLDSALKQ----------------CVKDFLQQAERY  228

Query  370   VIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEEV  549
              IVFDDVW    W AI+  LP+  +G R +++TR  DVAS+S   +  Y++ M PLS E 
Sbjct  229   AIVFDDVWDVEFWNAIRFALPENGYGNRVLLTTRKADVASASCNKSQDYVFRMAPLSFED  288

Query  550   SWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALYH  729
             SW L C K F  + CP+HLT++ K IL +C GLPLA++AI G+LA K+     EW  +  
Sbjct  289   SWTLFCNKIFKGNGCPAHLTDVAKGILGKCQGLPLAVLAISGLLAMKDLNIAEEWEMVRR  348

Query  730   SLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEGF  909
             SL  + EG+   + ++ IL LS+NDLP +LK C +YLSIYPED+ I    L+  W+ E F
Sbjct  349   SLVGELEGSGMLDRVKKILSLSYNDLPCHLKTCLLYLSIYPEDYEIRCQRLVQLWSAERF  408

Query  910   VKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNFV  1089
             V ++ G  +++V   YL EL+NRSLI   +   +G  +  RIHDL RE+ILSKS + N +
Sbjct  409   VGKREGMIMKDVGFNYLRELVNRSLIQVTESFYEGIPETCRIHDLVREVILSKSREQNMI  468

Query  1090  TTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV-QILSSC  1266
             T  +  T    +  R LS                LRS +T    +   S  ++ + L S 
Sbjct  469   TITNMITITTGQYTRWLS-----EKESQYYCFNHLRSFITIESMNPLISRALLSKALKSS  523

Query  1267  RVIKVLDLQS-TSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFV  1443
             R++KVLDL    +LE +P EIF L HLRYL+L  T VK +P+ I KLR LE LDL  T V
Sbjct  524   RLLKVLDLSDEETLEEIPNEIFNLYHLRYLNLYGTGVKAVPKFIGKLRNLEYLDLGETQV  583

Query  1444  TELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNG  1623
              ELP+EILKLQ L HL+V + V  +   Y    GFKAP  LG L +L+ L  ++A+ G+ 
Sbjct  584   KELPMEILKLQKLEHLMVRTKVDVSDEAYGYH-GFKAPSKLGGLLALQSLTSIDASSGSV  642

Query  1624  TIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEED----VVLDVNYL  1791
              ++EIG L +L+RL I  LR EDGK +CSS+  L  L+ L++ SI  D     VLD+N+ 
Sbjct  643   IVKEIGTLTQLRRLVISNLRREDGKELCSSLATLTSLQLLHIGSIRNDGGDYEVLDLNHH  702

Query  1792  SSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKD--DPLEHLQDLPNLVHLEF  1965
                           ++  +PH    L++LV+I   WS L+D  DPLE L  LPNLV ++F
Sbjct  703   HQQQHSRSSSMSFSFLQSLPH----LQSLVRIDLNWSSLRDEEDPLEPLHHLPNLVTIQF  758

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
                Y GE + F AG+F  L+ L L+KL++L+ + + EGA+P L +L +     L  +P G
Sbjct  759   CRSYQGEGLCFKAGRFPKLKDLYLEKLQKLKWLKVEEGALPSLHELSLDTLPLLEELPLG  818

Query  2146  IECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWKDGCWEVNSV  2313
             I+   NLR L   +++   +      ++  EDY K++HISEV    W D  W ++ +
Sbjct  819   IQHSRNLRKLYLSELSSQLMEKLENLNEETEDYRKIAHISEVVIQLWTDEGWRLHRL  875



>ref|XP_011000333.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Populus 
euphratica]
Length=926

 Score =   478 bits (1229),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 299/779 (38%), Positives = 448/779 (58%), Gaps = 25/779 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +D +S +L +E+ E+VGIE+ + ELISLL+  +    VISVVGMGG GKTTL K VYD  
Sbjct  153   HDPQSGSLFIEDSELVGIESTKDELISLLVSGECRRTVISVVGMGGVGKTTLAKKVYDSY  212

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              VK+HFQ HAWITVSQ++   E+L+  +++L+   K+P PE   +M+A  L   ++++L 
Sbjct  213   VVKQHFQCHAWITVSQSYDRVELLRSTLKKLYEAKKEPFPEAFVTMDALSLIDELRKYLQ  272

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
             + +Y++VFDDVW  R W  ++H L     G + + +TR  DVA+     +  ++Y+M  L
Sbjct  273   QERYLVVFDDVWEIRFWGDVEHALVDNNKGSKILATTRNEDVANFCRRSSLVHVYQMKSL  332

Query  538   SEEVSWALLCRKAFH---ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNIN  708
              +  +W L C+KAF      +CP  L E+ + I++RCGGLPLAIVA+GG+LATK +  + 
Sbjct  333   PQREAWELFCKKAFKFDFEGNCPKDLEELSQDIVRRCGGLPLAIVAVGGLLATKERV-VP  391

Query  709   EWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIY  888
             EW  L +SL      +   E++  IL LSF+DLP  LK CF+Y  + PED  I+   +I 
Sbjct  392   EWQKLVNSLDSTMASDPHVENVTKILSLSFHDLPYDLKACFLYFGMLPEDFSIKRTRIIR  451

Query  889   QWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSK  1068
              W  +GFV++K G T+EE AE  L  LI RSL+   + +  G     R+HDL R++ILS+
Sbjct  452   LWVAQGFVQEKRGLTLEEAAEECLNGLIRRSLVQVDEASMKGIPTTCRVHDLVRDVILSR  511

Query  1069  STDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVV  1248
             S + + +  +   ++A    ARH+S+     +       ++ RS++ F     Q    + 
Sbjct  512   SEELS-IGHVSWNSSALEGIARHMSISKGGSDNPKGSTRSQTRSVMFFCGAKLQ-KPIID  569

Query  1249  QILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDL  1428
              +   C+++  LD +   ++ +PEE+  LLHL+YLSLR T V  LP+SI KL+ LE LDL
Sbjct  570   AVFEKCKLLTTLDFEKCPIDEIPEELGNLLHLKYLSLRDTLVSNLPKSIGKLQNLEFLDL  629

Query  1429  KYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
               + V  LPVE+ +   LR+L+      F ++        +   G  +L     L+    
Sbjct  630   SDSLVERLPVEVNRFPKLRYLLGEPKQGFGFV-------VRGSLGQLELLQTLYLINAGF  682

Query  1609  NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDV-VLDVN  1785
             +     I EIG L  L++L I+ ++TE G+ +C ++E +  LRSL + S    V ++D+ 
Sbjct  683   HHERELINEIGMLKRLRKLGIMNMKTEYGRDLCVALENMPHLRSLWVASEGYGVAIIDLQ  742

Query  1786  YLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKL-KDDPLEHLQDLPNLVHLE  1962
              +SSPP  LQ L L G + ++P WI  L +L K+    ++L   D ++ LQ LPNL  L 
Sbjct  743   AMSSPPLHLQSLILWGKLERLPEWISRLHHLAKLRLTDTRLMGGDSIKVLQALPNLRFLR  802

Query  1963  FLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPA  2142
             F  GY GE MHF  G FQ L+ L L  + EL  ++I +GA+P LEKL I  C +L  VP+
Sbjct  803   FFRGYNGEKMHFEGGGFQKLKSLRLAGMTELNTMIIDQGAIPLLEKLEIGFCQRLKEVPS  862

Query  2143  GIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYY--TYWKD-----GCW  2298
             GI+ L NL+ L    M+D+F     P+  G+DY  V H+  + Y  TY  D     G W
Sbjct  863   GIQHLKNLKQLSLAKMSDEFNERLSPNS-GQDYWIVKHVPVLQYDGTYDPDDESFYGAW  920



>emb|CDP21579.1| unnamed protein product, partial [Coffea canephora]
Length=749

 Score =   471 bits (1213),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 271/581 (47%), Positives = 370/581 (64%), Gaps = 14/581 (2%)
 Frame = +1

Query  13    RSDALLLEEDEIVGIENPRKELISLLLK-DDPTLKVISVVGMGGSGKTTLVKMVYDD--V  183
             R DALL+EE ++VGI+ P+  LIS LL+ DD  LKV+SVVGMGG GKTTLVK V++D  V
Sbjct  68    RDDALLVEEAKLVGIDQPKNHLISELLEGDDHQLKVVSVVGMGGLGKTTLVKKVHEDPEV  127

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             ++HF   AW+TVS+T   + +LKD+I+QL  E K+P P  + SM   +LK  VK+FL + 
Sbjct  128   RRHFPVRAWVTVSETCDFQFLLKDLIRQLHEEGKKPDPRSIESMTTTELKKFVKDFLQQA  187

Query  364   -KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLS  540
              +Y IVFDDVW    W  IK  LP+  HG R M++TR  DVAS    ++ GYIY M PLS
Sbjct  188   GRYAIVFDDVWDVEFWNTIKFALPESGHGNRVMLTTRKADVASDCCIESRGYIYRMKPLS  247

Query  541   EEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
              E SW L C K F   +CP HL ++ K IL +C GLPLAI+AI G+LA K+     EW  
Sbjct  248   FEDSWTLFCNKIFMGGNCPGHLMDVAKGILGKCEGLPLAILAISGLLALKDVNRTEEWEM  307

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             +  SLG + EG  + + ++ IL LS++DLP +LK+C +Y SIYPED+ I   +L+  W  
Sbjct  308   VRRSLGGELEGAGKLDRVKKILSLSYSDLPWHLKICLLYTSIYPEDYKIACETLVNLWIA  367

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             E FV+ + G ++ +VA GYL EL++RSLI    +  +G     RIHDL RE+I+ KS + 
Sbjct  368   ERFVEWREGMSIADVAWGYLSELVSRSLIQVTNVFYEGMPGYCRIHDLLREVIVLKSREQ  427

Query  1081  NFVTTIDEETAAWP-EKARHLSVHGTLGNAQMKRQGTK------LRSLLTFNVTDSQFSS  1239
             N VT    +   WP EK R L VH +  N     Q  +      LRS +T   T+   S 
Sbjct  428   NMVTATTGQPMMWPSEKVRRLVVHISSSNNTQHHQQMQNYCFDHLRSFVTIGSTNPSLSR  487

Query  1240  HVVQILS-SCRVIKVLDLQST-SLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRML  1413
              ++  +S S +++KVLDL+   + E +P EIF++LHL++L L  T V+ +P++I KL+ L
Sbjct  488   KLLSKVSGSSKLLKVLDLRGQETQEEIPNEIFKMLHLKHLDLYGTGVERVPKAIGKLQHL  547

Query  1414  EILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgslekl  1593
             E L+L  T V ELP+EILKLQ+LR L VY  V  +   Y    GFKAP  +G L +L+ L
Sbjct  548   EYLNLGKTGVRELPMEILKLQNLRFLKVYQQVDPSDDDYGFH-GFKAPSNMGGLLALQTL  606

Query  1594  VYVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSI  1716
              Y++A+ G+  I+EIGKL EL+ L I KLR EDGK +CSS+
Sbjct  607   SYIDASSGSIIIKEIGKLTELRELGITKLRREDGKELCSSL  647



>ref|XP_002275317.3| PREDICTED: disease resistance protein RPM1-like [Vitis vinifera]
Length=901

 Score =   476 bits (1224),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 293/760 (39%), Positives = 465/760 (61%), Gaps = 23/760 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDV  183
             N R +  +L   +  +GI+ P+++L+S   K +  LKV+ +VGM G GKTTL   VY++V
Sbjct  155   NVRAAPLILGWGNNTMGIDEPKRKLVSWASKSNQKLKVMFLVGMAGLGKTTLAYRVYEEV  214

Query  184   KKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRR  363
             K+HF  HAWI  S+   ++E L+ ++++L +       EG G +    L   +  FL  +
Sbjct  215   KEHFDCHAWIIASKYQTIDETLRSLLEELGSS-----TEGSGIV---LLMQRLHNFLQHK  266

Query  364   KYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSE  543
             +YVIV D++    VWE+I+  LP + +  R +I+TR  D+A+S   D+   I+++ PLS 
Sbjct  267   RYVIVVDNLLVKDVWESIRLALP-DGNDNRIIITTRRGDIANSCRDDSID-IHKVQPLSL  324

Query  544   EVSWALLCRKAFHA-SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGA  720
             + +  L  +KAF    SCPS L E+ K IL++C GLPL I+ IG VL +K +    EW  
Sbjct  325   QWAEQLFYKKAFLGDGSCPSGLEEVSKSILQKCDGLPLGIIEIGRVLRSKPRQTKYEWKK  384

Query  721   LYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             L+ SL  +         +  +   S+ DLP +LK CF+Y+SI+PE++ ++   LI  W  
Sbjct  385   LHDSLESELRSGGALSDIMRVFSASYKDLPYHLKYCFLYMSIFPENNPVKRRRLIRLWIA  444

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EGFV ++ GKT+EEV E YL ELI RSLI   +++ DG      +H L   IILS S + 
Sbjct  445   EGFVTEERGKTLEEVGEEYLNELIGRSLIKANEMDFDGRPITVGVHSLMHRIILSVSQEE  504

Query  1081  NFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILS  1260
             NF T          +K R LS+    GN  + +  T +R+  +F       S+  + I S
Sbjct  505   NFCTVCAGPEGNLTDKPRRLSIQ--TGNFDVSQDLTCVRTFFSF-------STGRINIGS  555

Query  1261  SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTF  1440
             + +++KVLD+QST L   P  I  L+ LRYLSLR+T ++ +P+S++ LR LE LDLK T 
Sbjct  556   NFKLLKVLDIQSTPLGNFPSAITDLVLLRYLSLRNTNIRSIPKSLRNLRHLETLDLKQTL  615

Query  1441  VTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGN  1620
             VT++P  +L+L+ LRHL+VY + +    P++   GFKAPKG+  L +L+KL +V+A+  +
Sbjct  616   VTKVPKAVLQLEKLRHLLVYCY-NMESAPFDIVQGFKAPKGIDALKNLQKLSFVKASGQH  674

Query  1621  GTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNYLSSP  1800
               I+ +  L +L++L I++L  E G ++C SIEK+  L SLN+ S+ ++ +L+++ +++P
Sbjct  675   RMIQGLDNLTQLRKLGIVELAEEHGASLCLSIEKMPNLHSLNVTSLNKEELLELDAMTNP  734

Query  1801  PPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEFLVGYT  1980
             PPLLQRLYL G + + P W+ SL +L +I  +WS L ++P+  LQ+LPNL  L+ L  YT
Sbjct  735   PPLLQRLYLRGPLERFPRWVSSLHDLERIRLKWSSLTENPIGALQNLPNLTELQLLDAYT  794

Query  1981  GEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAGIECLF  2160
             G  + FN+GKFQ+L++L+L++L++LR +++ +G +P L+KL+I++CN+L  VP GI+ L 
Sbjct  795   GTQLDFNSGKFQNLKILDLEQLKQLRFIIMEDGTLPCLQKLIIRQCNELEHVPVGIDGLH  854

Query  2161  NLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTY  2280
             +L  L   DM +  ++     K G  +  + H     ++Y
Sbjct  855   HLNELHLCDMPEKLVAQL--KKNGGQFRHLVHHIPYIHSY  892



>ref|XP_010093226.1| Disease resistance protein RPM1 [Morus notabilis]
 gb|EXB53728.1| Disease resistance protein RPM1 [Morus notabilis]
Length=928

 Score =   476 bits (1226),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 299/778 (38%), Positives = 461/778 (59%), Gaps = 24/778 (3%)
 Frame = +1

Query  1     ANDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD  180
             A D R  +L LEEDEIV I+   KELI  L +      + S+VG GG GKTTL + VY+D
Sbjct  154   ARDPRLGSLFLEEDEIVCIDGASKELIRRLTEGPSMRSLTSLVGQGGIGKTTLARKVYND  213

Query  181   --VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFL  354
               VK HF   AWITVSQ++ ++++L+ + +Q+     + + E     +  +L  ++++ L
Sbjct  214   EVVKAHFDCRAWITVSQSYDMQKLLRILARQI-CTAGERIEE---DCSEEELIGLLRQHL  269

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
               ++Y+IVFDDVW    W+ +KH LP +  G R +I+TR   VAS    +    ++E+  
Sbjct  270   QTKRYMIVFDDVWQKDFWKDMKHALPNKDKGSRTIITTRNFTVASFCRENPCDLVHEVQT  329

Query  535   LSEEVSWALLCRKAFH----ASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTN  702
              S +++W L C+KAF     A  CP  L ++ ++I+ +C GLPL I  I G+L+TK + +
Sbjct  330   WSFKMAWQLFCKKAFRSDEFAGRCPQELEQLSREIVSKCLGLPLVISTIAGLLSTKERVD  389

Query  703   INEWGALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSL  882
              +EW  + +++  ++E  D    +  IL LS+ DLP +LK CF+Y SI+ EDH I  ++L
Sbjct  390   -SEWRKVLNNISSEYERTD----ITKILSLSYLDLPYHLKTCFLYFSIFDEDHKISESAL  444

Query  883   IYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLIL-PVKLNDDGSMKQGRIHDLYREII  1059
                W+ EGFVK +  KT+E+VAE YL ELI R+L+L  V+    G  +  ++HDL  +II
Sbjct  445   YKLWSAEGFVKARRDKTLEDVAEEYLNELIQRNLVLFEVEF---GVERVCKVHDLMHDII  501

Query  1060  LSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSS  1239
             L+++ +  F  TI +      E +  LS+H T  N   +  G+ +RS+  F V +    S
Sbjct  502   LTRAGELCFSQTIKKSNLNLAENSYRLSIHDTTENVLERVMGSSIRSVFLFGVKECT-RS  560

Query  1240  HVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEI  1419
              ++ ++ + ++++VLD     L+ +P+E+ +L HL+YL L  T+VKVLP+SI KL  L+ 
Sbjct  561   FMINLVENFKLLEVLDFDKAPLDDLPKEVGKLFHLKYLCLSGTRVKVLPKSIGKLHNLQT  620

Query  1420  LDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             LD + T VTELP+EI KL++LRHL +YS    ++   N   G +  KG+G L  L+ L  
Sbjct  621   LDARNTLVTELPIEITKLRNLRHLRIYSIAKNSHSGLNTYCGVRICKGIGMLEELQTLHK  680

Query  1600  VEANP-GNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             VEA P G G ++E+ KL +LKRL ILK+  E G+ +   +EK+  L  L L SI ED V+
Sbjct  681   VEAYPDGVGFVKELQKLRKLKRLDILKVTAEMGEPLGVVLEKMNHLERLILTSINEDEVI  740

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             ++  +SSPPP L+ L L+  + ++P+W+  L NL  +   +S+  DDP++ LQ LPNL +
Sbjct  741   NLKCISSPPPFLRYLQLNCRLDQLPNWVSELHNLQGLSLSYSRFIDDPMKCLQALPNLSY  800

Query  1957  LEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
             L   + Y GE +HF  G FQ L+ L  +KL  L+ V I  GA+P LE+    R   +  +
Sbjct  801   LR--MTYDGEELHFQKGGFQKLKQLKFNKLTGLKVVKIDVGALPLLEEFHFGRSALMKEM  858

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHISEVYYTYWKDGCWEVNS  2310
             P+ I+ L NL+ L   DM  +F+    PD  G DY K+ H+  V + Y+  G + + S
Sbjct  859   PSDIQHLSNLKSLAIHDMPREFVVCLQPDG-GIDYWKIQHVPSVTFHYYNRGYYRLGS  915



>ref|XP_006659408.1| PREDICTED: disease resistance protein RPM1-like [Oryza brachyantha]
Length=907

 Score =   476 bits (1224),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 280/761 (37%), Positives = 450/761 (59%), Gaps = 25/761 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +DR+ D L L+E +++GI+ P+ ++  LLL ++  L+VIS++G  G GKTTL + VY+D 
Sbjct  146   DDRQLDMLSLDEAKVIGIDFPKAKVTQLLLDEEKQLRVISIIGGAGVGKTTLARSVYNDK  205

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V+  F+ HAW+T+     + ++LK ++ Q+F E  + +P  +  M+  ++  ++  +L 
Sbjct  206   KVQGRFRCHAWVTIGAPISMVDLLKSIMVQIFVEKLEEIPTSLDFMDEIQIAEVIGRYLA  265

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              +K+++V DD+W + +W+ +K  LP    G R ++STR  ++       ++  I+E  PL
Sbjct  266   DKKFLVVLDDIWNSDMWDYLKLALPNNGQGSRIIVSTRAQEIGRDCRLASDIQIFEQKPL  325

Query  538   SEEVSWALLCRKAFHA--SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             +E+ +W L C KAF A  + CP+ L +  ++I++ C G+PL +V IGG+++ K +T +  
Sbjct  326   NEDDAWLLFCNKAFPAIQARCPTELKDTGRKIVRECHGVPLLVVTIGGLMSMKERT-VQV  384

Query  712   WGALYHSLG----PDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNS  879
             W  +  +L     P+F       +L  IL  +++DLP +LK CF+Y  + P  + I+  +
Sbjct  385   WKNVLDNLHKKYLPEF-------TLPSILWFAYSDLPHHLKCCFLYFIMIPRKYSIKRMT  437

Query  880   LIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREII  1059
             LI  W  EGF+K     T+E+ A  YL ELI+RS++      D G +K   +HD+ REII
Sbjct  438   LIRLWMAEGFIKNDQEGTLEDTAGRYLTELIDRSMVQVTDFYDYGRVKSCSVHDMLREII  497

Query  1060  LSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTD-SQFS  1236
             + KS++ NF   +           R LS+  T  +       T LR+L  F  +  S  S
Sbjct  498   ILKSSEDNFGIPVTRGVNKVRGNVRRLSIINTNDDFLEDNSCTNLRTLFVFGASSISTRS  557

Query  1237  SHVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLE  1416
              H    L   R++++LDL+   +E +P+E+  L +LRY+SLR+T++  LP+S+KK+  L+
Sbjct  558   LHA--FLVGFRLLRILDLEGAPVESLPDELPDLFYLRYMSLRNTRIDKLPKSLKKMMNLQ  615

Query  1417  ILDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklV  1596
              LDLK T+V++LP  I KL+ LRHL+ Y + S  + PY  + G   P+G+G L  L+KL 
Sbjct  616   TLDLKGTYVSQLPSGITKLESLRHLLAYRYYSGRHPPYYYTLGVILPQGIGNLKELQKLT  675

Query  1597  YVEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVL  1776
             YVEAN GNGTI+E+G L +L+RL I+KLR  D   +CSS+   +        S  +D +L
Sbjct  676   YVEANQGNGTIKELGSLTQLRRLGIVKLRENDCMHLCSSV-AKMTELLSLSASSLDDEIL  734

Query  1777  DVNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVH  1956
             D+  L+  P  L+RLYL G +  +P W+ SL+NLV+I  RWS+L ++ L+ LQ LP LV 
Sbjct  735   DLRSLNPAPRCLKRLYLRGPLPGIPSWLHSLKNLVRIRLRWSRLNEESLKELQGLP-LVE  793

Query  1957  LEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASV  2136
             L  +  Y G  + F  G F  L +L LD L  L ++ I E +MP L+K+ I+ C++L ++
Sbjct  794   LALIQAYDGAKLEFTQG-FAKLEILELDHLTNLEHINI-EKSMPGLQKISIRSCDKLLTI  851

Query  2137  PAGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHI  2259
             P GIE L NL+ L  F M   F+ + +  K G ++ +V HI
Sbjct  852   PDGIEGLENLKELYLFAMPRTFVDSLM--KGGVNHWRVEHI  890



>ref|XP_009605820.1| PREDICTED: disease resistance protein RPM1-like [Nicotiana tomentosiformis]
Length=910

 Score =   476 bits (1224),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 310/763 (41%), Positives = 446/763 (58%), Gaps = 26/763 (3%)
 Frame = +1

Query  19    DALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD--VKKH  192
             + +L++E ++VGIEN +  ++  LL DD    +  VVG  G GKTTL+K VYDD  VK H
Sbjct  159   EVVLVDEADLVGIENHKPVILDWLLSDDQEWNLHCVVGTRGIGKTTLIKKVYDDAAVKNH  218

Query  193   FQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRKYV  372
             F    WI + +   V+E++K+MI       ++ +     +M+AN L   +++     KY 
Sbjct  219   FNHTQWIEIPRFSDVKELMKNMITPKNDHSRRAIE----AMDANMLAEFIQQIFESSKYF  274

Query  373   IVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNG--YIYEMTPLSEE  546
             IV DDV     W A+K V P E  G R +I +R  ++  +   +T G  ++Y +TPLSEE
Sbjct  275   IVLDDVPDIATWRALKCVFPIENCGSRVIIISRFAEICHTICAETGGDSHVYSLTPLSEE  334

Query  547   VSWALLCRKAFHASS-CPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGAL  723
              SW L CRKAF  S  CPS L +I K I+++C GLPLAI+ I G LATK K     W   
Sbjct  335   ESWILFCRKAFSGSLLCPSSLMQISKDIIQKCRGLPLAILVIAGALATKGKRK-EAWELF  393

Query  724   YHSLGPDFEGN-DQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTM  900
             + SL    +G+  + E ++ IL L + DLP YLK CF YLSI PE H+I+   LI  W  
Sbjct  394   HGSLVDKLQGSYSEVEHMKRILNLCYQDLPFYLKSCFTYLSIIPEFHVIDKMRLIRLWAA  453

Query  901   EGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDH  1080
             EG V  + GK + +VA  YL EL NRSLI   +   DG +    IH+L+ EIILSK+ + 
Sbjct  454   EGLVLIREGKAIAQVAASYLNELANRSLIQIAERYCDGRLDSFTIHNLWYEIILSKTAER  513

Query  1081  NFVTTID-EETAAWPEKARHLSVHGTLG-NAQMKRQGTKLRSLLTFNVTDSQFSSHVVQI  1254
                T  D EE    P K RHL +   L  + Q   +   L SL+    +DS  +S ++++
Sbjct  514   VTETITDSEEITRRPHKVRHLVIADPLASDIQHIDRFKHLHSLIMLGSSDSVSNSFLLKL  573

Query  1255  LS-SCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLK  1431
             L+ S +++KVLDL    L  +PEE+F++ HL++L+LR TK+K LP SI KL  LE LDL+
Sbjct  574   LTGSFKLLKVLDLTGAPLVKIPEEVFEMFHLKFLNLRKTKIKHLPGSIGKLENLEFLDLR  633

Query  1432  YTFVTELPVEILKLQHLRHLIVYSH-VSFAYLPYNCSPGFKAPkglgklgsleklVYVEA  1608
              T +  LPVEILKLQHLRH+ ++     F +       GFKAPK +G L SLE +  +  
Sbjct  634   ETLIKRLPVEILKLQHLRHIFIHRRGAGFLH-------GFKAPKKIGTLVSLEMVNSI--  684

Query  1609  NPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLDVNY  1788
             N  + T+ E+GKL  L+ L I KLR + G+  CSS++KL+ L+ L++ S     ++D++Y
Sbjct  685   NATSSTVIELGKLTRLRMLYITKLRRKHGREFCSSLDKLINLQQLSISSYGVSDIIDLHY  744

Query  1789  -LSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHLEF  1965
              LSS    L+ L   G + + P WI SL+ L  ++ +WSKL D+ L+ LQDLP LV L  
Sbjct  745   PLSSTHSSLRTLVFEGRLERFPQWITSLQALTSVFLKWSKLMDNALDTLQDLPKLVRLVL  804

Query  1966  LVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVPAG  2145
                Y GE + F AG F+ L+ L +   E+LR + + EGAMP LE+L ++ C  +  +P G
Sbjct  805   DRAYEGEELRFRAGGFKKLKELCIWHSEKLRQIKVEEGAMPLLEELQLRNCRLMEQLPFG  864

Query  2146  IECLFNLRYLEFFDMTDDFISTF-LPDKRGEDYCKVSHISEVY  2271
             IE L  L+YL    +++  + T  L D +  DY K++HI  ++
Sbjct  865   IENLSKLQYLSLEKISEKLLVTVQLKDCQSGDYWKIAHIPRLH  907



>gb|EEE68711.1| hypothetical protein OsJ_27368 [Oryza sativa Japonica Group]
Length=854

 Score =   474 bits (1219),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 279/760 (37%), Positives = 445/760 (59%), Gaps = 23/760 (3%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             +DR+ D L L+E +++GI  P+ ++  LLL ++  L+VIS++G  G GKTTL + VY+D 
Sbjct  93    DDRQLDMLSLDEAKVIGIGYPKAKVTQLLLDEEKQLRVISIIGSAGVGKTTLARSVYNDK  152

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLL  357
              V+  F+ HAWIT+     + + LK ++ Q+F E  + +P  +  M+  ++  ++  +L 
Sbjct  153   KVQGRFRCHAWITIGAPIPMVDRLKSIMVQIFVEKLEEIPARLDFMDEIQIAEVIGRYLA  212

Query  358   RRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPL  537
              + +++V DD+W +  W+ +K  LP    G R ++STR  ++       ++  I+E  PL
Sbjct  213   DKSFLVVLDDIWNSDTWDYLKLALPNNGQGSRIIVSTRAQEIGRDCRLASDIQIFEKRPL  272

Query  538   SEEVSWALLCRKAFHA--SSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINE  711
             +E+ +W L C KAF A  + CP+ L E  ++I++ C G+PL +V IGG+++ K +T +  
Sbjct  273   NEDDAWLLFCNKAFPAIQARCPAELEETGRKIVRECHGVPLLVVTIGGLMSMKEQT-VQV  331

Query  712   WGALYHSLG----PDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNS  879
             W  +  +L     P+F       +L  IL  +++DLP +LK C +Y  ++P  + I+  +
Sbjct  332   WKNVLDNLHKKYLPEF-------TLPSILWFAYSDLPHHLKCCLLYFIMFPRKYSIKRMT  384

Query  880   LIYQWTMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREII  1059
             LI  W  EGF+K     T+E+ A  YL ELI+R ++      D G +K   +HD+ REII
Sbjct  385   LIRLWMAEGFIKNDQESTLEDTAGRYLTELIDRGMVQVADFYDYGRVKSCSVHDMLREII  444

Query  1060  LSKSTDHNFVTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSS  1239
             + KST+ NF   +           R LS+  T  +       T LR+L  F  + S  ++
Sbjct  445   ILKSTEDNFGIPVTRGVNKVRGNVRRLSIINTNDDFLEDNSCTNLRTLFVFGAS-SISTT  503

Query  1240  HVVQILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEI  1419
              +   L   R++++LDL+   +E +P+E+  L +LRYLSLR+T++  LP+S+KK+  L+ 
Sbjct  504   SLHAFLVGFRLLRILDLEGAPVESLPDELPDLFYLRYLSLRNTRIDKLPKSLKKMMNLQT  563

Query  1420  LDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             LDLK T+V++LP  I KL+ LRHL+ Y + S  + PY  + G   P+G+G L  L+KL Y
Sbjct  564   LDLKGTYVSQLPSGITKLESLRHLLAYRYYSGRHPPYYYTLGVTLPRGIGNLKELQKLTY  623

Query  1600  VEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             VEAN GNGTIEE+G L +L+RL I+KLR  D   +CSS+   +        S  +D +LD
Sbjct  624   VEANQGNGTIEELGSLTQLRRLGIVKLRERDCMHLCSSV-AKMTELLSLSASSLDDEILD  682

Query  1780  VNYLSSPPPLLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDPLEHLQDLPNLVHL  1959
             +  L+  P  L+RLYL G +  +P W+ SL+NLV+I  RWS+L +D L+ LQ LP LV L
Sbjct  683   LGSLNPAPQCLRRLYLRGPLPGIPSWLHSLKNLVRIRLRWSRLNEDSLKELQSLP-LVEL  741

Query  1960  EFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQLASVP  2139
               +  Y G  + F  G F  L +L LD L  L ++ + E +MP L+K+ I+ C++L ++P
Sbjct  742   ALIQAYDGTKLEFTQG-FARLEILELDHLTNLEHINL-EKSMPGLQKISIRSCDKLLTIP  799

Query  2140  AGIECLFNLRYLEFFDMTDDFISTFLPDKRGEDYCKVSHI  2259
              GIE L NL+ L  F M  +F+ + +    G  + +V HI
Sbjct  800   HGIEGLENLKELYLFAMPKNFVESLMTG--GVKHRRVEHI  837



>emb|CDP15857.1| unnamed protein product [Coffea canephora]
Length=837

 Score =   473 bits (1217),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 305/785 (39%), Positives = 467/785 (59%), Gaps = 46/785 (6%)
 Frame = +1

Query  4     NDRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDD-  180
             ND R  ++LLEED++VGI+ P++ELIS +L +D  LKVI+VVGMGG GKTTLV+ V++D 
Sbjct  81    NDIREISILLEEDKLVGIKTPKEELISRVLNNDSHLKVIAVVGMGGLGKTTLVRKVFEDT  140

Query  181   -VKKHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVP-EGMGSMNANKLKVIVKEFL  354
              VK  F+   W+T+S+TF +  +LK MI + F E+ +PVP + M S +  +L   VK+FL
Sbjct  141   AVKTQFKIRVWLTISRTFDIMVILKTMIHKFFYEINEPVPHQLMNSTDIIRLSAFVKDFL  200

Query  355   LRRKYVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTP  534
               R Y++V DDVW+ R+W+A+K+VLP      + +++TR++ VA ++   ++ Y + M P
Sbjct  201   QDRSYILVLDDVWSERLWDALKNVLPDGNFHGQVILTTRIIHVAKAARFGSHIYSHWMKP  260

Query  535   LSEEVSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEW  714
             LS + SW L C   F +  CP HL ++  +IL++C GLPLAI  IGGVLA K+K  IN+W
Sbjct  261   LSVKDSWTLFCHTTFQSDHCPPHLQQVSARILRKCEGLPLAIATIGGVLALKDKDRINDW  320

Query  715   GALYHSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQW  894
               +  +LG + + + + + ++ ILLLS+NDLPQ LK CF+YLSIYPED LI  + ++ +W
Sbjct  321   ETILRNLGDELDASGKLDPIKRILLLSYNDLPQNLKNCFLYLSIYPEDALIGVDDMLDKW  380

Query  895   TMEGFVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKST  1074
               +GFV++K G +  ++A     EL+NRSL+  +  N DG +K  R+HD  R++I+SKS 
Sbjct  381   ITQGFVEEKVGMSTFDIANRGFHELVNRSLVPVLTANCDG-IKCFRVHDFLRDMIVSKSR  439

Query  1075  DHNFVT-TIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSL--LTFNVTDSQFSSHV  1245
             + NF+T  +   +     K R L+++    N + +      +SL  L F   + + S  V
Sbjct  440   EQNFITIAVGNYSGQSSNKVRRLALYD-FDNPEPQELTHCFKSLRSLEFLRYNGRISGPV  498

Query  1246  VQ--ILSSCRVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEI  1419
             V   +    ++IKVLDL                         TKV+++P+SI KL+ LEI
Sbjct  499   VSKFLCGGSKLIKVLDL-------------------------TKVRIVPKSIGKLQNLEI  533

Query  1420  LDLKYTFVTELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVY  1599
             LDL YT VT++PVEILKL+   H++    +  +   Y+   GFK+P  +GKL SLE L  
Sbjct  534   LDLFYTNVTKIPVEILKLRK-HHVLHVGRIEISA-EYHGLRGFKSPDKIGKLLSLENLQA  591

Query  1600  VEANPGNGTIEEIGKLNELKRLCILKLRTEDGKAVCSSIEkllklrslnlksIEEDVVLD  1779
             +EA+     + EIGKL +L+ L I KLR EDG+    ++EKL  L++L ++SIE+D+ LD
Sbjct  592   IEAD-NEKILREIGKLTKLRSLSITKLRREDGQEFLCTLEKLTNLKTLVVQSIEDDMTLD  650

Query  1780  VNYLSSPPP-LLQRLYLSGYMGKMPHWIKSLRNLVKIYFRWSKLKDDP----LEHLQDLP  1944
             + +  SP P LL+ L L G+ G +  W+ SL++L  +    S L++D     +  LQDLP
Sbjct  651   LRHPISPTPRLLEILSLQGHKGNILQWVLSLQSLTNLVLDNSGLREDDGTKGIGSLQDLP  710

Query  1945  NLVHLEFLVGYTGEHMHFNAGKFQSlrllnldkleelrnVVIGEGAMPHLEKLVIQRCNQ  2124
             NL+ L     + GE + F AG F+ L  L++  LE L+ V +   ++P L++L +  C  
Sbjct  711   NLIELTLQHAFEGEMLPFRAGGFRKLEKLSITSLERLKWVKVENDSLPSLQRLSMTDCKL  770

Query  2125  LASVPAGIECLFNLRYLEFFDMTDDFISTFLP-DKRGEDYCKVSHISEVYYTYWKDGCWE  2301
             L  +P   E L  L  L   DM+D  +   +   ++ E Y  + +I  V  +  K  C E
Sbjct  771   LEELPLSAENLRKLESLFLVDMSDGLVEKVMNLAEQSELYQALKNIPIVRISRLK--CME  828

Query  2302  VNSVQ  2316
              + V+
Sbjct  829   NSRVR  833



>ref|XP_006368330.1| hypothetical protein POPTR_0001s01670g [Populus trichocarpa]
 gb|ERP64899.1| hypothetical protein POPTR_0001s01670g [Populus trichocarpa]
Length=686

 Score =   468 bits (1203),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 251/547 (46%), Positives = 346/547 (63%), Gaps = 36/547 (7%)
 Frame = +1

Query  7     DRRSDALLLEEDEIVGIENPRKELISLLLKDDPTLKVISVVGMGGSGKTTLVKMVYDDVK  186
             DRR DALLL+  ++VGIE  + +L+  L       +V+S+ GM                 
Sbjct  152   DRREDALLLDMTDLVGIEERKSKLVGWLAHGRSGREVVSLAGM-----------------  194

Query  187   KHFQSHAWITVSQTFKVEEVLKDMIQQLFAELKQPVPEGMGSMNANKLKVIVKEFLLRRK  366
                              EE+LKD++QQLFA  ++PVP+ + S N+++LK I+KE L +R+
Sbjct  195   -----------------EELLKDILQQLFAADRKPVPKNLESQNSSQLKSIIKEVLQKRR  237

Query  367   YVIVFDDVWTARVWEAIKHVLPKEKHGCRAMISTRLMDVASSSSTDTNGYIYEMTPLSEE  546
             Y+IV DDVW    W+A+K+ LP    G R M++TR  D+A +S  ++ G +Y + PL  E
Sbjct  238   YLIVLDDVWHVNEWDAVKYALPTNNCGSRVMLTTRNADLAFTSRIESEGKVYNLEPLLPE  297

Query  547   VSWALLCRKAFHASSCPSHLTEILKQILKRCGGLPLAIVAIGGVLATKNKTNINEWGALY  726
              SW L CRK F  +SCP HL +I K IL++C GLPLAIVAI GVLA K+K  I+EW  + 
Sbjct  298   ESWTLFCRKTFRGNSCPHHLEDICKNILRKCEGLPLAIVAISGVLAAKDKRRIDEWEMVR  357

Query  727   HSLGPDFEGNDQFESLRIILLLSFNDLPQYLKLCFMYLSIYPEDHLIEHNSLIYQWTMEG  906
              SLG + E N++  +L+ +L LSFNDLP YLK CF+Y+SI+PEDHLIEH  LI  W  EG
Sbjct  358   RSLGAEIEDNNKLLNLKKVLSLSFNDLPYYLKSCFLYVSIFPEDHLIEHTKLIRLWVAEG  417

Query  907   FVKQKAGKTVEEVAEGYLFELINRSLILPVKLNDDGSMKQGRIHDLYREIILSKSTDHNF  1086
             FV+ K GK +E+VAE Y  EL+NRSL+   +   DG +K  R HDL REII+SKS D NF
Sbjct  418   FVEAKYGKELEDVAEDYFNELLNRSLLQVAETASDGRVKTCRPHDLLREIIISKSRDQNF  477

Query  1087  VTTIDEETAAWPEKARHLSVHGTLGNAQMKRQGTKLRSLLTFNVTDSQFSSHVVQILSSC  1266
                  ++ A WP+K R LS+H T+ N Q+ R  ++LRSL  F V +   S       +  
Sbjct  478   AVIAKDQNAMWPDKIRRLSIHYTVRNVQLNRCVSQLRSLFMFGVVEK--SPLRTLFPNGF  535

Query  1267  RVIKVLDLQSTSLEIVPEEIFQLLHLRYLSLRSTKVKVLPRSIKKLRMLEILDLKYTFVT  1446
             R++ VLDLQ   +++ P ++  L +LRYLSL+ TKV ++P  I KL+ LE LDLK+T+VT
Sbjct  536   RLLHVLDLQGAPIKMFPVQVINLYYLRYLSLKETKVSIVPSYIGKLQHLETLDLKHTYVT  595

Query  1447  ELPVEILKLQHLRHLIVYSHVSFAYLPYNCSPGFKAPkglgklgsleklVYVEANPGNGT  1626
             ELP EILKLQ LRHL+VY +   +Y  ++   GFKA + +G+L SL+KL +VEAN GNG 
Sbjct  596   ELPDEILKLQRLRHLLVYRYKFESYAHFHSKNGFKALEKIGQLQSLQKLCFVEANHGNGN  655

Query  1627  IEEIGKL  1647
             I  + ++
Sbjct  656   IVNLSRV  662



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7818091027616