BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82929_g1_i1 len=1165 path=[1143:0-1164]

Length=1165
                                                                      Score     E

ref|XP_006343841.1|  PREDICTED: probable inactive receptor kinase...    421   4e-143   
ref|XP_004246095.1|  PREDICTED: probable inactive receptor kinase...    416   4e-141   
ref|XP_009601180.1|  PREDICTED: probable inactive receptor kinase...    315   1e-101   
emb|CDP00834.1|  unnamed protein product                                314   3e-101   
ref|XP_009804003.1|  PREDICTED: probable inactive receptor kinase...    309   3e-99    
emb|CDP00833.1|  unnamed protein product                                300   2e-95    
gb|EYU34505.1|  hypothetical protein MIMGU_mgv11b016165mg               281   2e-88    
ref|XP_011099906.1|  PREDICTED: probable inactive receptor kinase...    293   4e-88    
ref|XP_009617419.1|  PREDICTED: probable inactive receptor kinase...    291   8e-88    
gb|AGO98727.1|  ovary receptor kinase 11                                289   3e-87    
gb|AGO98729.1|  ovary receptor kinase 27                                289   3e-87    
ref|XP_006341503.1|  PREDICTED: probable inactive receptor kinase...    289   5e-87    
ref|XP_004250172.1|  PREDICTED: probable inactive receptor kinase...    288   5e-87    
ref|XP_009592532.1|  PREDICTED: probable inactive receptor kinase...    288   5e-87    
ref|XP_006364614.1|  PREDICTED: probable inactive receptor kinase...    288   7e-87    
ref|XP_009759771.1|  PREDICTED: probable inactive receptor kinase...    288   1e-86    
gb|AGL74765.1|  ovary receptor kinase 11                                286   3e-86    
ref|XP_002322122.2|  hypothetical protein POPTR_0015s04920g             286   3e-86    Populus trichocarpa [western balsam poplar]
ref|XP_009797253.1|  PREDICTED: probable inactive receptor kinase...    285   8e-86    
ref|XP_002317861.2|  hypothetical protein POPTR_0012s04170g             285   9e-86    Populus trichocarpa [western balsam poplar]
ref|XP_010069429.1|  PREDICTED: probable inactive receptor kinase...    285   1e-85    
ref|XP_004235768.1|  PREDICTED: probable inactive receptor kinase...    285   1e-85    
ref|XP_010671388.1|  PREDICTED: probable inactive receptor kinase...    284   2e-85    
ref|XP_002279127.2|  PREDICTED: probable inactive receptor kinase...    284   4e-85    Vitis vinifera
gb|KHN10529.1|  Putative inactive receptor kinase                       279   4e-85    
ref|XP_011035563.1|  PREDICTED: probable inactive receptor kinase...    283   5e-85    
ref|XP_009360057.1|  PREDICTED: probable inactive receptor kinase...    283   5e-85    
ref|XP_008466324.1|  PREDICTED: probable inactive receptor kinase...    283   8e-85    
ref|XP_002531014.1|  ATP binding protein, putative                      282   1e-84    Ricinus communis
emb|CDO98323.1|  unnamed protein product                                281   1e-84    
ref|XP_008393435.1|  PREDICTED: probable inactive receptor kinase...    282   1e-84    
ref|XP_010087022.1|  putative inactive receptor kinase                  281   2e-84    
gb|KDP24390.1|  hypothetical protein JCGZ_26596                         281   2e-84    
ref|XP_004137511.1|  PREDICTED: probable inactive receptor kinase...    281   2e-84    
ref|XP_004292489.1|  PREDICTED: probable inactive receptor kinase...    280   2e-84    
gb|KHN00136.1|  Putative inactive receptor kinase                       280   2e-84    
gb|KHN43642.1|  Putative inactive receptor kinase                       275   3e-84    
ref|XP_008240124.1|  PREDICTED: probable inactive receptor kinase...    281   3e-84    
ref|XP_009356011.1|  PREDICTED: probable inactive receptor kinase...    281   3e-84    
gb|EPS58567.1|  hypothetical protein M569_16246                         281   4e-84    
ref|XP_007211289.1|  hypothetical protein PRUPE_ppa002536mg             281   4e-84    
ref|XP_008374868.1|  PREDICTED: probable inactive receptor kinase...    280   6e-84    
ref|XP_003530966.1|  PREDICTED: probable inactive receptor kinase...    280   9e-84    
ref|XP_004163815.1|  PREDICTED: probable inactive receptor kinase...    280   1e-83    
ref|XP_006365414.1|  PREDICTED: probable inactive receptor kinase...    279   1e-83    
gb|KHG20222.1|  putative inactive receptor kinase -like protein         278   1e-83    
emb|CDP01639.1|  unnamed protein product                                279   2e-83    
ref|XP_011012967.1|  PREDICTED: probable inactive receptor kinase...    279   2e-83    
ref|XP_002533427.1|  ATP binding protein, putative                      279   2e-83    Ricinus communis
gb|KHN45250.1|  Putative inactive receptor kinase                       274   2e-83    
ref|XP_004490822.1|  PREDICTED: probable inactive receptor kinase...    277   4e-83    
ref|XP_004241646.1|  PREDICTED: probable inactive receptor kinase...    278   4e-83    
ref|XP_007036910.1|  Receptor-like kinase 1                             278   5e-83    
gb|KHG20593.1|  putative inactive receptor kinase -like protein         276   5e-83    
ref|XP_003525182.1|  PREDICTED: probable inactive receptor kinase...    278   7e-83    
ref|XP_009778793.1|  PREDICTED: probable inactive receptor kinase...    278   7e-83    
ref|XP_007032119.1|  Receptor-like kinase 1                             277   7e-83    
gb|AET05610.2|  LRR receptor-like kinase                                278   7e-83    
ref|XP_006451587.1|  hypothetical protein CICLE_v10007673mg             275   1e-82    
ref|XP_004299514.1|  PREDICTED: probable inactive receptor kinase...    277   1e-82    
ref|XP_003631134.1|  Atypical receptor-like kinase MARK                 278   1e-82    
ref|XP_011085845.1|  PREDICTED: probable inactive receptor kinase...    277   1e-82    
gb|KDO62795.1|  hypothetical protein CISIN_1g006055mg                   277   1e-82    
gb|KDP25788.1|  hypothetical protein JCGZ_22510                         276   2e-82    
ref|XP_007160555.1|  hypothetical protein PHAVU_002G331400g             276   2e-82    
gb|KDO50809.1|  hypothetical protein CISIN_1g037905mg                   275   2e-82    
ref|XP_006826909.1|  hypothetical protein AMTR_s00010p00158940          276   2e-82    
ref|XP_006482115.1|  PREDICTED: probable inactive receptor kinase...    275   3e-82    
ref|XP_006430596.1|  hypothetical protein CICLE_v10011289mg             275   3e-82    
ref|XP_008343258.1|  PREDICTED: probable inactive receptor kinase...    275   3e-82    
gb|EYU24506.1|  hypothetical protein MIMGU_mgv1a0087053mg               265   4e-82    
ref|XP_010105639.1|  putative inactive receptor kinase                  275   4e-82    
ref|XP_008353859.1|  PREDICTED: probable inactive receptor kinase...    275   4e-82    
ref|XP_006451586.1|  hypothetical protein CICLE_v10007673mg             275   5e-82    
gb|EPS69043.1|  hypothetical protein M569_05720                         274   5e-82    
ref|XP_004503256.1|  PREDICTED: probable inactive receptor kinase...    277   6e-82    
ref|XP_010268752.1|  PREDICTED: probable inactive receptor kinase...    275   7e-82    
ref|XP_010036979.1|  PREDICTED: probable inactive receptor kinase...    273   4e-81    
emb|CBI33513.3|  unnamed protein product                                272   4e-81    
ref|XP_002276147.1|  PREDICTED: probable inactive receptor kinase...    272   4e-81    Vitis vinifera
ref|XP_006372561.1|  hypothetical protein POPTR_0017s02820g             270   4e-81    
ref|XP_007152668.1|  hypothetical protein PHAVU_004G149100g             273   5e-81    
emb|CAN82203.1|  hypothetical protein VITISV_018964                     272   6e-81    Vitis vinifera
ref|XP_009370052.1|  PREDICTED: probable inactive receptor kinase...    271   7e-81    
ref|XP_003530064.1|  PREDICTED: probable inactive receptor kinase...    273   7e-81    
ref|XP_007214953.1|  hypothetical protein PRUPE_ppa003172mg             270   1e-80    
gb|EPS62777.1|  hypothetical protein M569_12011                         270   2e-80    
ref|XP_008348609.1|  PREDICTED: probable inactive receptor kinase...    269   4e-80    
gb|KHG17549.1|  putative inactive receptor kinase -like protein         269   5e-80    
ref|XP_010271320.1|  PREDICTED: probable inactive receptor kinase...    269   1e-79    
gb|ACR38562.1|  unknown                                                 258   2e-79    Zea mays [maize]
ref|XP_008227929.1|  PREDICTED: probable inactive receptor kinase...    268   2e-79    
ref|XP_002305880.1|  hypothetical protein POPTR_0004s08450g             267   2e-79    Populus trichocarpa [western balsam poplar]
ref|XP_011001561.1|  PREDICTED: probable inactive receptor kinase...    267   3e-79    
ref|XP_010926113.1|  PREDICTED: probable inactive receptor kinase...    267   5e-79    
ref|XP_003616273.1|  Leucine-rich repeat transmembrane protein          266   6e-79    
gb|EEC74787.1|  hypothetical protein OsI_10572                          259   7e-79    Oryza sativa Indica Group [Indian rice]
dbj|BAH20271.1|  AT1G48480                                              259   8e-79    Arabidopsis thaliana [mouse-ear cress]
gb|KEH26683.1|  LRR receptor-like kinase family protein                 267   8e-79    
gb|KHG00875.1|  putative inactive receptor kinase -like protein         266   1e-78    
ref|XP_009607528.1|  PREDICTED: probable inactive receptor kinase...    267   1e-78    
gb|KHN41064.1|  Putative inactive receptor kinase                       264   1e-78    
ref|XP_007141918.1|  hypothetical protein PHAVU_008G236900g             265   2e-78    
ref|XP_011073169.1|  PREDICTED: probable inactive receptor kinase...    265   3e-78    
ref|XP_011007233.1|  PREDICTED: probable inactive receptor kinase...    264   4e-78    
ref|XP_011002185.1|  PREDICTED: probable inactive receptor kinase...    263   6e-78    
gb|EYU30898.1|  hypothetical protein MIMGU_mgv1a003238mg                263   8e-78    
gb|EEE59802.1|  hypothetical protein OsJ_12326                          256   1e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006575485.1|  PREDICTED: probable inactive receptor kinase...    263   2e-77    
ref|XP_010916205.1|  PREDICTED: probable inactive receptor kinase...    263   3e-77    
ref|XP_009370559.1|  PREDICTED: probable inactive receptor kinase...    262   3e-77    
gb|KHN39461.1|  Putative inactive receptor kinase                       261   5e-77    
ref|XP_006299778.1|  hypothetical protein CARUB_v10015974mg             261   7e-77    
ref|XP_004512763.1|  PREDICTED: probable inactive receptor kinase...    262   8e-77    
ref|XP_008781294.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    261   1e-76    
gb|EYU45791.1|  hypothetical protein MIMGU_mgv1a002921mg                260   2e-76    
gb|ACU19868.1|  unknown                                                 249   3e-76    Glycine max [soybeans]
ref|XP_008775508.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    260   3e-76    
gb|ACR34746.1|  unknown                                                 255   3e-76    Zea mays [maize]
ref|XP_010500379.1|  PREDICTED: probable inactive receptor kinase...    259   4e-76    
ref|XP_006393400.1|  hypothetical protein EUTSA_v10011300mg             259   4e-76    
gb|AAC95351.1|  receptor-like protein kinase                            258   1e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465843.1|  PREDICTED: probable inactive receptor kinase...    258   2e-75    
ref|XP_006306949.1|  hypothetical protein CARUB_v10008516mg             258   2e-75    
ref|NP_566589.1|  receptor-like kinase 902                              257   2e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479274.1|  PREDICTED: probable inactive receptor kinase...    257   3e-75    
ref|XP_008457025.1|  PREDICTED: probable inactive receptor kinase...    257   3e-75    
ref|XP_011083189.1|  PREDICTED: probable inactive receptor kinase...    257   3e-75    
gb|AAM64268.1|  receptor kinase, putative                               257   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145847.1|  PREDICTED: probable inactive receptor kinase...    257   3e-75    
ref|NP_564528.1|  receptor-like kinase 1                                257   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461669.1|  PREDICTED: probable inactive receptor kinase...    257   3e-75    
gb|KFK36089.1|  hypothetical protein AALP_AA4G076000                    256   4e-75    
ref|XP_009409092.1|  PREDICTED: probable inactive receptor kinase...    257   5e-75    
ref|XP_002883091.1|  hypothetical protein ARALYDRAFT_479268             256   5e-75    
emb|CDY67567.1|  BnaCnng55470D                                          254   7e-75    
ref|XP_010505998.1|  PREDICTED: probable inactive receptor kinase...    256   1e-74    
ref|XP_002891438.1|  hypothetical protein ARALYDRAFT_891670             256   1e-74    
ref|XP_004162958.1|  PREDICTED: probable inactive receptor kinase...    255   1e-74    
emb|CDX92167.1|  BnaA05g22400D                                          255   1e-74    
ref|XP_004985160.1|  PREDICTED: probable inactive receptor kinase...    256   1e-74    
gb|AAN05336.1|  Putative leucine-rich repeat transmembrane protei...    256   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010487681.1|  PREDICTED: probable inactive receptor kinase...    255   2e-74    
ref|XP_009113711.1|  PREDICTED: probable inactive receptor kinase...    255   2e-74    
emb|CDX95816.1|  BnaC05g35670D                                          254   2e-74    
gb|KGN63945.1|  hypothetical protein Csa_1G031200                       254   2e-74    
ref|XP_002468249.1|  hypothetical protein SORBIDRAFT_01g042480          255   2e-74    Sorghum bicolor [broomcorn]
ref|XP_010670123.1|  PREDICTED: probable inactive receptor kinase...    255   3e-74    
ref|XP_003558467.1|  PREDICTED: probable inactive receptor kinase...    255   3e-74    
gb|AFW89165.1|  putative leucine-rich repeat receptor-like protei...    255   3e-74    
ref|NP_001152341.1|  LOC100285980 precursor                             255   3e-74    Zea mays [maize]
gb|KCW52164.1|  hypothetical protein EUGRSUZ_J01604                     254   4e-74    
emb|CDY61284.1|  BnaA01g36890D                                          254   4e-74    
ref|NP_001049422.1|  Os03g0223000                                       255   4e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008660393.1|  PREDICTED: probable inactive receptor kinase...    254   8e-74    
ref|XP_009390851.1|  PREDICTED: probable inactive receptor kinase...    253   8e-74    
ref|XP_010032718.1|  PREDICTED: probable inactive receptor kinase...    253   8e-74    
gb|AAK18840.1|AC082645_10  putative receptor kinase                     254   8e-74    Oryza sativa [red rice]
ref|XP_006651742.1|  PREDICTED: probable inactive receptor kinase...    252   1e-73    
ref|XP_006406685.1|  hypothetical protein EUTSA_v10020262mg             253   1e-73    
gb|KFK39109.1|  hypothetical protein AALP_AA3G202300                    253   2e-73    
dbj|BAJ89911.1|  predicted protein                                      252   6e-73    
ref|XP_009390354.1|  PREDICTED: probable inactive receptor kinase...    251   8e-73    
ref|XP_009145968.1|  PREDICTED: probable inactive receptor kinase...    250   1e-72    
ref|XP_010551132.1|  PREDICTED: probable inactive receptor kinase...    250   1e-72    
ref|XP_004981996.1|  PREDICTED: probable inactive receptor kinase...    251   1e-72    
ref|XP_010558597.1|  PREDICTED: probable inactive receptor kinase...    247   1e-71    
emb|CDX77309.1|  BnaC08g03540D                                          248   1e-71    
ref|XP_009403541.1|  PREDICTED: probable inactive receptor kinase...    246   7e-71    
ref|XP_010910915.1|  PREDICTED: probable inactive receptor kinase...    245   7e-71    
ref|NP_197162.1|  leucine-rich repeat protein 1                         244   9e-71    Arabidopsis thaliana [mouse-ear cress]
emb|CDY49655.1|  BnaC09g41330D                                          244   1e-70    
emb|CDY41827.1|  BnaA08g03220D                                          244   1e-70    
ref|XP_009107354.1|  PREDICTED: probable inactive receptor kinase...    245   1e-70    
ref|NP_001105207.1|  atypical receptor-like kinase MARK precursor       246   1e-70    Zea mays [maize]
tpg|DAA50992.1|  TPA: putative leucine-rich repeat receptor-like ...    245   2e-70    
ref|XP_009147309.1|  PREDICTED: probable inactive receptor kinase...    244   2e-70    
emb|CDY51524.1|  BnaA05g33240D                                          244   2e-70    
ref|XP_010525076.1|  PREDICTED: probable inactive receptor kinase...    244   2e-70    
ref|XP_001778286.1|  predicted protein                                  245   2e-70    
gb|AGT16430.1|  kinase                                                  244   3e-70    
ref|XP_010420358.1|  PREDICTED: probable inactive receptor kinase...    243   3e-70    
ref|XP_006287270.1|  hypothetical protein CARUB_v10000461mg             243   4e-70    
emb|CDX69441.1|  BnaA10g17900D                                          243   4e-70    
ref|XP_010932563.1|  PREDICTED: probable inactive receptor kinase...    244   4e-70    
ref|XP_006400197.1|  hypothetical protein EUTSA_v10012966mg             243   4e-70    
ref|XP_009381014.1|  PREDICTED: probable inactive receptor kinase...    243   5e-70    
ref|XP_002463998.1|  hypothetical protein SORBIDRAFT_01g010290          244   5e-70    Sorghum bicolor [broomcorn]
ref|XP_010495229.1|  PREDICTED: probable inactive receptor kinase...    243   6e-70    
ref|XP_009118618.1|  PREDICTED: probable inactive receptor kinase...    242   7e-70    
ref|XP_010453822.1|  PREDICTED: probable inactive receptor kinase...    242   9e-70    
emb|CDY28719.1|  BnaCnng06050D                                          241   9e-70    
ref|NP_001151626.1|  atypical receptor-like kinase MARK precursor       243   1e-69    Zea mays [maize]
ref|XP_009121473.1|  PREDICTED: probable inactive receptor kinase...    241   2e-69    
gb|AFW67828.1|  putative leucine-rich repeat receptor-like protei...    242   5e-69    
ref|XP_009126125.1|  PREDICTED: probable inactive receptor kinase...    239   6e-69    
ref|XP_006408370.1|  hypothetical protein EUTSA_v10020304mg             239   7e-69    
gb|KFK37686.1|  hypothetical protein AALP_AA3G015500                    239   9e-69    
gb|KFK25876.1|  hypothetical protein AALP_AA8G173700                    239   9e-69    
emb|CDY38103.1|  BnaC02g06700D                                          238   2e-68    
gb|ABR17070.1|  unknown                                                 231   2e-68    Picea sitchensis
ref|XP_003559525.1|  PREDICTED: probable inactive receptor kinase...    238   5e-68    
ref|NP_186938.1|  leucine-rich repeat protein kinase family protein     237   7e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001774015.1|  predicted protein                                  236   1e-67    
ref|XP_002882256.1|  hypothetical protein ARALYDRAFT_896266             235   3e-67    
gb|EYU45792.1|  hypothetical protein MIMGU_mgv1a020384mg                234   7e-67    
ref|XP_006297231.1|  hypothetical protein CARUB_v10013240mg             234   7e-67    
ref|XP_010485618.1|  PREDICTED: probable inactive receptor kinase...    234   9e-67    
ref|XP_002960794.1|  hypothetical protein SELMODRAFT_74002              234   1e-66    
ref|XP_010502431.1|  PREDICTED: probable inactive receptor kinase...    234   1e-66    
ref|XP_008381374.1|  PREDICTED: probable inactive receptor kinase...    223   1e-66    
ref|XP_010549038.1|  PREDICTED: probable inactive receptor kinase...    234   1e-66    
ref|XP_008812474.1|  PREDICTED: probable inactive receptor kinase...    233   3e-66    
ref|XP_010463719.1|  PREDICTED: probable inactive receptor kinase...    232   4e-66    
ref|XP_004975871.1|  PREDICTED: probable inactive receptor kinase...    231   4e-65    
dbj|BAJ89083.1|  predicted protein                                      231   4e-65    
dbj|BAJ95574.1|  predicted protein                                      229   8e-65    
gb|AGT16967.1|  hypothetical protein SHCRBa_121_P14_R_290               229   1e-64    
ref|XP_004508557.1|  PREDICTED: probable inactive receptor kinase...    228   1e-64    
gb|EYU34504.1|  hypothetical protein MIMGU_mgv1a003961mg                226   3e-64    
gb|EPS60479.1|  hypothetical protein M569_14322                         226   4e-64    
ref|XP_009601083.1|  PREDICTED: probable inactive receptor kinase...    215   6e-64    
ref|XP_001778285.1|  predicted protein                                  227   8e-64    
ref|XP_010921194.1|  PREDICTED: probable inactive receptor kinase...    219   1e-63    
ref|XP_002447974.1|  hypothetical protein SORBIDRAFT_06g019120          226   1e-63    Sorghum bicolor [broomcorn]
ref|XP_007154939.1|  hypothetical protein PHAVU_003G159700g             226   1e-63    
ref|XP_007204237.1|  hypothetical protein PRUPE_ppa002548mg             226   1e-63    
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...    226   2e-63    
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...    225   3e-63    
ref|XP_009391414.1|  PREDICTED: probable inactive receptor kinase...    225   3e-63    
ref|XP_004139332.1|  PREDICTED: probable inactive receptor kinase...    224   5e-63    
ref|XP_003609204.1|  hypothetical protein MTR_4g113100                  224   5e-63    
ref|XP_002529343.1|  Nodulation receptor kinase precursor, putative     224   7e-63    Ricinus communis
ref|XP_002281635.1|  PREDICTED: probable inactive receptor kinase...    224   7e-63    Vitis vinifera
ref|XP_008463153.1|  PREDICTED: probable inactive receptor kinase...    224   7e-63    
ref|XP_002868800.1|  hypothetical protein ARALYDRAFT_356181             223   8e-63    
ref|XP_008458016.1|  PREDICTED: probable inactive receptor kinase...    224   8e-63    
tpg|DAA37428.1|  TPA: putative leucine-rich repeat receptor-like ...    224   1e-62    
ref|XP_008386031.1|  PREDICTED: probable inactive receptor kinase...    224   1e-62    
gb|EYU30110.1|  hypothetical protein MIMGU_mgv1a020518mg                223   1e-62    
ref|XP_007013302.1|  Leucine-rich repeat protein kinase family pr...    224   1e-62    
gb|ACZ98536.1|  protein kinase                                          224   1e-62    
emb|CBI26846.3|  unnamed protein product                                222   1e-62    
ref|XP_008343962.1|  PREDICTED: probable inactive receptor kinase...    224   1e-62    
gb|KCW69386.1|  hypothetical protein EUGRSUZ_F02867                     222   1e-62    
ref|XP_009414081.1|  PREDICTED: probable inactive receptor kinase...    223   1e-62    
tpg|DAA57078.1|  TPA: putative leucine-rich repeat receptor-like ...    223   2e-62    
gb|EMT33198.1|  hypothetical protein F775_43654                         216   2e-62    
ref|XP_010062272.1|  PREDICTED: probable inactive receptor kinase...    223   2e-62    
ref|XP_008669312.1|  PREDICTED: probable inactive receptor kinase...    224   2e-62    
ref|XP_002281181.1|  PREDICTED: probable inactive receptor kinase...    222   3e-62    Vitis vinifera
ref|XP_003527143.1|  PREDICTED: probable inactive receptor kinase...    223   3e-62    
ref|XP_008669311.1|  PREDICTED: probable inactive receptor kinase...    224   3e-62    
ref|XP_010094441.1|  putative inactive receptor kinase                  222   4e-62    
ref|XP_009371417.1|  PREDICTED: probable inactive receptor kinase...    222   4e-62    
ref|NP_001053007.1|  Os04g0463000                                       222   4e-62    Oryza sativa Japonica Group [Japonica rice]
gb|ABK93951.1|  unknown                                                 214   6e-62    Populus trichocarpa [western balsam poplar]
emb|CDP00835.1|  unnamed protein product                                223   6e-62    
ref|XP_010047774.1|  PREDICTED: probable inactive receptor kinase...    222   7e-62    
ref|XP_003579913.1|  PREDICTED: probable inactive receptor kinase...    222   7e-62    
ref|XP_004167200.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    221   8e-62    
gb|EYU28629.1|  hypothetical protein MIMGU_mgv1a021954mg                220   1e-61    
gb|KHG18372.1|  hypothetical protein F383_03411                         220   2e-61    
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...    220   2e-61    
gb|EMT17815.1|  Putative inactive receptor kinase                       219   4e-61    
ref|XP_006475765.1|  PREDICTED: probable inactive receptor kinase...    219   5e-61    
ref|XP_006451034.1|  hypothetical protein CICLE_v10007694mg             219   5e-61    
ref|XP_009374078.1|  PREDICTED: probable inactive receptor kinase...    218   6e-61    
gb|KHN25793.1|  Putative inactive receptor kinase                       218   7e-61    
ref|XP_006351444.1|  PREDICTED: probable inactive receptor kinase...    219   9e-61    
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...    218   9e-61    
emb|CBI15804.3|  unnamed protein product                                218   9e-61    
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...    219   9e-61    Vitis vinifera
gb|KDP32336.1|  hypothetical protein JCGZ_13261                         218   1e-60    
ref|XP_010688116.1|  PREDICTED: probable inactive receptor kinase...    218   1e-60    
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...    218   1e-60    
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...    218   1e-60    Populus trichocarpa [western balsam poplar]
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...    218   1e-60    
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...    218   1e-60    
ref|XP_010249925.1|  PREDICTED: probable inactive receptor kinase...    218   2e-60    
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...    218   2e-60    
gb|KHG24076.1|  hypothetical protein F383_10304                         218   2e-60    
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...    217   2e-60    
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...    217   2e-60    
ref|XP_004140352.1|  PREDICTED: probable inactive receptor kinase...    217   2e-60    
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...    217   2e-60    
ref|XP_004236305.1|  PREDICTED: probable inactive receptor kinase...    217   3e-60    
gb|KDP45679.1|  hypothetical protein JCGZ_17286                         217   3e-60    
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...    217   3e-60    
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...    216   3e-60    
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                   216   4e-60    
ref|XP_001774014.1|  predicted protein                                  216   4e-60    
ref|XP_001752185.1|  predicted protein                                  216   4e-60    
gb|KHN24722.1|  Putative inactive receptor kinase                       209   4e-60    
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...    216   4e-60    
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...    216   5e-60    
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative     216   5e-60    
ref|XP_011009200.1|  PREDICTED: probable inactive receptor kinase...    216   5e-60    
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...    216   5e-60    
dbj|BAB62593.1|  putative receptor-like protein kinase                  216   6e-60    
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg             216   6e-60    
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                   216   7e-60    
gb|KHN37771.1|  Putative inactive receptor kinase                       207   7e-60    
ref|XP_011041763.1|  PREDICTED: probable inactive receptor kinase...    213   7e-60    
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...    216   8e-60    
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...    216   8e-60    
ref|NP_001234580.1|  atypical receptor-like kinase 1 precursor          215   8e-60    
gb|KEH34523.1|  LRR receptor-like kinase                                216   8e-60    
ref|XP_011084098.1|  PREDICTED: probable inactive receptor kinase...    216   8e-60    
ref|XP_006829650.1|  hypothetical protein AMTR_s00122p00112840          215   1e-59    
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                   216   1e-59    
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...    216   1e-59    
emb|CDP03386.1|  unnamed protein product                                216   1e-59    
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...    215   1e-59    
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...    215   1e-59    
ref|XP_001770138.1|  predicted protein                                  214   1e-59    
gb|KHG17719.1|  hypothetical protein F383_03334                         214   2e-59    
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...    214   2e-59    
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg             214   2e-59    
ref|XP_010254253.1|  PREDICTED: probable inactive receptor kinase...    215   2e-59    
emb|CAN80590.1|  hypothetical protein VITISV_040789                     214   2e-59    
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...    214   2e-59    
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...    214   3e-59    
ref|XP_001752184.1|  predicted protein                                  214   3e-59    
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...    214   3e-59    
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...    214   3e-59    
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110          214   3e-59    
ref|XP_010098956.1|  putative inactive receptor kinase                  214   3e-59    
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...    214   4e-59    
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...    214   4e-59    
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...    214   4e-59    
gb|EYU23030.1|  hypothetical protein MIMGU_mgv1a002522mg                214   4e-59    
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...    214   4e-59    
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...    214   4e-59    
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...    213   4e-59    
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg             213   5e-59    
gb|EEC75189.1|  hypothetical protein OsI_11426                          211   5e-59    
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg             214   5e-59    
ref|XP_010533192.1|  PREDICTED: probable inactive receptor kinase...    214   6e-59    
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...    213   7e-59    
ref|XP_006371315.1|  putative plant disease resistance family pro...    213   8e-59    
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...    213   8e-59    
ref|XP_003544853.1|  PREDICTED: probable inactive receptor kinase...    213   9e-59    
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...    213   9e-59    
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...    213   1e-58    
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...    212   1e-58    
gb|EYU41553.1|  hypothetical protein MIMGU_mgv1a002603mg                213   1e-58    
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g             213   1e-58    
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...    213   1e-58    
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    212   1e-58    
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...    212   1e-58    
ref|XP_002319979.1|  putative plant disease resistance family pro...    212   1e-58    
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...    212   1e-58    
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg             212   1e-58    
ref|XP_002325632.1|  putative plant disease resistance family pro...    212   1e-58    
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                   212   1e-58    
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...    212   2e-58    
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...    212   2e-58    
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...    212   2e-58    
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...    212   2e-58    
gb|EAZ05160.1|  hypothetical protein OsI_27356                          212   2e-58    
gb|KHF99691.1|  hypothetical protein F383_18108                         211   2e-58    
ref|XP_009597502.1|  PREDICTED: probable inactive receptor kinase...    212   2e-58    
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...    212   2e-58    
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...    212   2e-58    
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...    212   3e-58    
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...    211   3e-58    
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...    211   3e-58    
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg             211   3e-58    
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...    211   3e-58    
ref|NP_001060650.1|  Os07g0681100                                       211   3e-58    
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...    211   3e-58    
ref|XP_002992978.1|  hypothetical protein SELMODRAFT_270002             211   4e-58    
ref|NP_001050019.1|  Os03g0332900                                       211   4e-58    
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...    211   4e-58    
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...    211   4e-58    
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g             211   4e-58    
ref|XP_010109178.1|  putative inactive receptor kinase                  211   4e-58    
gb|KDP21848.1|  hypothetical protein JCGZ_00635                         211   4e-58    
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...    211   4e-58    
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...    211   5e-58    
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...    211   5e-58    
ref|XP_009363779.1|  PREDICTED: probable inactive receptor kinase...    211   5e-58    
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...    211   5e-58    
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...    211   5e-58    
ref|XP_008244615.1|  PREDICTED: probable inactive receptor kinase...    209   5e-58    
ref|XP_010473057.1|  PREDICTED: probable inactive receptor kinase...    211   6e-58    
ref|XP_009767272.1|  PREDICTED: probable inactive receptor kinase...    211   6e-58    
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg             210   6e-58    
ref|XP_010417819.1|  PREDICTED: probable inactive receptor kinase...    211   6e-58    
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g             211   6e-58    
gb|EPS63924.1|  hypothetical protein M569_10855                         210   7e-58    
ref|XP_010557581.1|  PREDICTED: probable inactive receptor kinase...    211   7e-58    
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...    210   7e-58    
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g             211   7e-58    
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...    210   8e-58    
ref|XP_009395807.1|  PREDICTED: probable inactive receptor kinase...    210   1e-57    
emb|CDP12117.1|  unnamed protein product                                210   1e-57    
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor             209   1e-57    
ref|XP_010243347.1|  PREDICTED: probable leucine-rich repeat rece...    210   1e-57    
ref|XP_002441272.1|  hypothetical protein SORBIDRAFT_09g023570          209   1e-57    
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...    209   1e-57    
ref|XP_006422104.1|  hypothetical protein CICLE_v10004549mg             209   1e-57    
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...    209   1e-57    
gb|KHG05843.1|  hypothetical protein F383_32232                         209   2e-57    
ref|XP_007141331.1|  hypothetical protein PHAVU_008G186900g             209   2e-57    
gb|KHN18649.1|  Putative inactive receptor kinase                       208   2e-57    
gb|KDP21623.1|  hypothetical protein JCGZ_03294                         209   2e-57    
emb|CBI22555.3|  unnamed protein product                                209   2e-57    
ref|XP_008234182.1|  PREDICTED: probable inactive receptor kinase...    208   2e-57    
ref|XP_011084477.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    209   2e-57    
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...    209   2e-57    
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...    209   2e-57    
gb|KFK32479.1|  hypothetical protein AALP_AA6G247800                    209   2e-57    
ref|XP_001770783.1|  predicted protein                                  209   2e-57    
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...    209   3e-57    
ref|XP_010098027.1|  putative inactive receptor kinase                  209   3e-57    
gb|KEH35517.1|  receptor-like kinase                                    208   3e-57    
ref|NP_180241.1|  leucine-rich repeat protein kinase family protein     209   4e-57    
ref|XP_006397367.1|  hypothetical protein EUTSA_v10022498mg             209   4e-57    
ref|XP_009417661.1|  PREDICTED: probable inactive receptor kinase...    208   4e-57    
ref|XP_008649769.1|  PREDICTED: probable inactive receptor kinase...    208   4e-57    
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...    208   4e-57    
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...    208   4e-57    
ref|XP_009123870.1|  PREDICTED: probable inactive receptor kinase...    207   5e-57    
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg             208   5e-57    
ref|XP_002879005.1|  hypothetical protein ARALYDRAFT_481544             208   5e-57    
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...    208   5e-57    
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...    208   5e-57    
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...    208   5e-57    
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...    208   5e-57    
emb|CDY48185.1|  BnaA04g15490D                                          208   5e-57    
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...    208   5e-57    
emb|CDY22164.1|  BnaC01g39370D                                          206   6e-57    
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...    208   6e-57    
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...    208   6e-57    
gb|EMT10528.1|  Putative inactive receptor kinase                       207   6e-57    
ref|XP_009393622.1|  PREDICTED: probable inactive receptor kinase...    208   6e-57    
ref|XP_009140749.1|  PREDICTED: probable inactive receptor kinase...    208   6e-57    
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...    207   6e-57    
ref|XP_008376328.1|  PREDICTED: probable inactive receptor kinase...    207   7e-57    
gb|KHN16761.1|  Putative inactive receptor kinase                       201   8e-57    
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...    207   8e-57    
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                   207   9e-57    
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...    207   9e-57    
emb|CDY04464.1|  BnaA07g12900D                                          207   9e-57    
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...    207   9e-57    
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...    207   9e-57    
ref|XP_009103556.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    207   9e-57    
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg             207   1e-56    
emb|CDY58565.1|  BnaC03g12450D                                          207   1e-56    
ref|XP_006293818.1|  hypothetical protein CARUB_v10022800mg             207   1e-56    
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...    207   1e-56    
gb|EMT12910.1|  Putative inactive receptor kinase                       207   1e-56    
ref|XP_008794990.1|  PREDICTED: probable inactive receptor kinase...    207   1e-56    
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...    207   1e-56    
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...    207   1e-56    
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090          207   1e-56    
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...    206   1e-56    
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...    206   1e-56    
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...    207   2e-56    
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...    207   2e-56    
ref|XP_008803916.1|  PREDICTED: uncharacterized protein LOC103717354    211   2e-56    
ref|XP_010433865.1|  PREDICTED: probable inactive receptor kinase...    206   2e-56    
emb|CDX94213.1|  BnaC07g38470D                                          206   2e-56    
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein     206   2e-56    
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...    206   2e-56    
emb|CDY47625.1|  BnaA01g13400D                                          206   2e-56    
ref|XP_010448663.1|  PREDICTED: probable inactive receptor kinase...    206   2e-56    
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...    206   3e-56    
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...    206   3e-56    
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223             206   3e-56    
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...    206   3e-56    
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...    206   3e-56    
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...    206   3e-56    
ref|XP_006283316.1|  hypothetical protein CARUB_v10004355mg             205   4e-56    
ref|XP_006600766.1|  PREDICTED: probable inactive receptor kinase...    205   5e-56    
ref|XP_008463343.1|  PREDICTED: probable inactive receptor kinase...    206   5e-56    
gb|AAK92807.1|  putative receptor protein kinase                        206   5e-56    
ref|XP_010049947.1|  PREDICTED: probable inactive receptor kinase...    205   6e-56    
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein     205   6e-56    
ref|XP_002991819.1|  hypothetical protein SELMODRAFT_42017              204   6e-56    
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...    205   6e-56    
gb|EPS74415.1|  hypothetical protein M569_00340                         205   6e-56    
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg             205   6e-56    
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...    205   7e-56    
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170             205   7e-56    
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative     205   7e-56    
gb|EYU23390.1|  hypothetical protein MIMGU_mgv1a003016mg                204   7e-56    
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...    206   7e-56    
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...    205   7e-56    
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...    205   7e-56    
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...    205   8e-56    
gb|KHN09234.1|  Putative inactive receptor kinase                       198   8e-56    
ref|XP_010445167.1|  PREDICTED: probable inactive receptor kinase...    206   8e-56    
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                   204   9e-56    
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...    204   1e-55    
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg             204   1e-55    
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...    204   1e-55    
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg             204   1e-55    



>ref|XP_006343841.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Solanum 
tuberosum]
Length=304

 Score =   421 bits (1083),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 212/301 (70%), Positives = 255/301 (85%), Gaps = 2/301 (1%)
 Frame = +2

Query  158   MAWSPDAIVKSKLVFFgdgdgyelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLK  337
             M WSP  IV ++LVFF D  GY LD+LLRSTAGVLGKG FGTSYKSELP K AVAVKRLK
Sbjct  1     MPWSPTDIVGTQLVFFDDHGGYGLDELLRSTAGVLGKGVFGTSYKSELPGKNAVAVKRLK  60

Query  338   IGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKN  517
             +GCLA +EF +++ E+GKM HENLLPLR YCW+ +EILLVYD++ MGSLAFRLHGNEG++
Sbjct  61    VGCLAEEEFRDKIGEVGKMVHENLLPLRGYCWHQNEILLVYDYVRMGSLAFRLHGNEGRS  120

Query  518   KASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLE-VRVSEFCLGQLL  694
             KASL WEVR+SIAYGVA AI+ LH++GS  CHGNIRSSNVFLT+ L  VR+SEF + ++L
Sbjct  121   KASLTWEVRSSIAYGVARAIEFLHSRGSDFCHGNIRSSNVFLTDSLSGVRLSEFSIARIL  180

Query  695   SPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNW  874
             S D+KL+LV+GYRAPEVT+ H+VS +SDVYSFGVLLLELLTGKAPL+AF K KGVDLP W
Sbjct  181   SSDTKLELVAGYRAPEVTNAHEVSQKSDVYSFGVLLLELLTGKAPLDAFTKNKGVDLPKW  240

Query  875   VRAMFREKPICDVFDSTLAKAEQNveqlvq-llqvAICCTFQYPNKRPSMAAVADQIKKT  1051
             +R+MF+EKP+ DVFD+ L K +Q+  + +  LLQ+A+CCTFQYPNKRPSMAAV  QI+ T
Sbjct  241   IRSMFQEKPVIDVFDTLLPKHDQSSAEQMVLLLQLAVCCTFQYPNKRPSMAAVTKQIRGT  300

Query  1052  C  1054
             C
Sbjct  301   C  301



>ref|XP_004246095.1| PREDICTED: probable inactive receptor kinase At1g48480 [Solanum 
lycopersicum]
Length=304

 Score =   416 bits (1069),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 253/301 (84%), Gaps = 2/301 (1%)
 Frame = +2

Query  158   MAWSPDAIVKSKLVFFgdgdgyelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLK  337
             M WSP  IV ++LVFFGD  GY L++LLRSTAGVL KG FGTSYKSELPEK AVAVKRLK
Sbjct  1     MPWSPTDIVGTQLVFFGDHGGYGLEELLRSTAGVLDKGVFGTSYKSELPEKNAVAVKRLK  60

Query  338   IGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKN  517
             +GCLA +EF E++ E+G M HENLL LRAYCW+ +EILLVYD++ MGSLAFRLHGNEG++
Sbjct  61    VGCLAEEEFIEKIGEVGMMVHENLLTLRAYCWHQNEILLVYDYVRMGSLAFRLHGNEGRS  120

Query  518   KASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLE-VRVSEFCLGQLL  694
             KASL WEVR+SIAYGVA AI+ LH++GS  CHGNIRSSNVFLT+ L  VR+SEF + ++L
Sbjct  121   KASLTWEVRSSIAYGVARAIEFLHSRGSDFCHGNIRSSNVFLTDSLSGVRLSEFSIARIL  180

Query  695   SPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNW  874
             S D+KL+LV+GYRAPEV + H+VS +SDVYSFGVLLLELLTGKAPL+AF K KGVDLP W
Sbjct  181   SSDTKLELVAGYRAPEVINAHEVSQKSDVYSFGVLLLELLTGKAPLDAFTKNKGVDLPKW  240

Query  875   VRAMFREKPICDVFDSTLAKAEQNveqlvq-llqvAICCTFQYPNKRPSMAAVADQIKKT  1051
              R+MF+EKP+ DVFD+ L K +Q+  + +  LLQ+A+CCTFQYPNKRPSMAAV  QI+ T
Sbjct  241   TRSMFQEKPVIDVFDTLLPKHDQSSAEQMVLLLQLAVCCTFQYPNKRPSMAAVTKQIRGT  300

Query  1052  C  1054
             C
Sbjct  301   C  301



>ref|XP_009601180.1| PREDICTED: probable inactive receptor kinase RLK902 [Nicotiana 
tomentosiformis]
Length=307

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/276 (61%), Positives = 207/276 (75%), Gaps = 3/276 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMT-HENLLPL  418
             RS A +LGKGTFG SYK+EL     VAVKRLK  CL  +EF +++ EL K++ H++LLPL
Sbjct  30    RSEAELLGKGTFGFSYKAELGNGKTVAVKRLKDCCLPEEEFKQKIQELAKLSDHQSLLPL  89

Query  419   RAYCWNPSEILLVYDHMSMGSLA-FRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQ  595
             RAY ++  E LL++D+M M SLA   LH N    KASL WE+RT IAYGVA A++ LHAQ
Sbjct  90    RAYYYSKDEKLLIFDYMPMSSLASLLLHDNGMAKKASLTWEIRTRIAYGVARALEFLHAQ  149

Query  596   GSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQS  775
             G  +CHGNIRSSNV LTN  +VR+SE  + +L  P+SK  L+ GY+APEV + + VS +S
Sbjct  150   GPGVCHGNIRSSNVLLTNCFDVRLSENGIFRLFVPNSKFVLIPGYQAPEVENAYDVSVKS  209

Query  776   DVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNv-e  952
             DVYSFGVLLLELLTGKAPLEA  K  GVDLP+WVR MF+EKPI DVFDS L    QN  E
Sbjct  210   DVYSFGVLLLELLTGKAPLEAIGKNSGVDLPSWVRDMFQEKPIIDVFDSMLLHNYQNFGE  269

Query  953   qlvqllqvAICCTFQYPNKRPSMAAVADQIKKTCSL  1060
             Q+VQLLQ+AICCTF+ P+KRPSM AV ++I +TCS 
Sbjct  270   QMVQLLQLAICCTFKNPSKRPSMVAVTNRINRTCSF  305



>emb|CDP00834.1| unnamed protein product [Coffea canephora]
Length=305

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 179/305 (59%), Positives = 221/305 (72%), Gaps = 5/305 (2%)
 Frame = +2

Query  158   MAWSPDAIVKSKLVFFgdgd-gyelddllRSTAGVLGKGTFGTSYKS--ELPEKTAVAVK  328
             MA S D I   KLVF G+    YEL+DLL S   +LGKGT G SYK+  EL ++  +AVK
Sbjct  1     MALSAD-ISGVKLVFLGNVVGEYELEDLLHSDFSMLGKGTLGMSYKARLELEDEYTLAVK  59

Query  329   RLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNE  508
             R+ +G L+  EF E++ ELGKM HENLLP+RAYC    + +LVYD++ MGSLA+ LHGN 
Sbjct  60    RVNVGRLSEMEFKEKIEELGKMDHENLLPIRAYCCIQEKRILVYDYIHMGSLAYLLHGNG  119

Query  509   GKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQ  688
               NK  LNW++R  IAYGV   I  +H QGS ICHGN+RSSNVF  +  +VRVSEF L Q
Sbjct  120   DANKTPLNWDIRCRIAYGVTRGIAYIHTQGSNICHGNLRSSNVFFNSPFDVRVSEFGLAQ  179

Query  689   LLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLP  868
             L+  +SKL L  GYRAPEVTS H+VS +SDVYSFGVLLLELLTGKAPL A  + +G+DL 
Sbjct  180   LVPVESKLILNEGYRAPEVTSNHEVSQKSDVYSFGVLLLELLTGKAPLRAVRELEGIDLV  239

Query  869   NWVRAMFREKPICDVFDSTLA-KAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              WVR MF+EKPI DVFD  L      + EQ+VQLLQ+A+CCTFQ P+KRPSMAA A++I+
Sbjct  240   KWVRQMFQEKPILDVFDDDLVLNYGSDEEQMVQLLQLAVCCTFQNPSKRPSMAAAANRIE  299

Query  1046  KTCSL  1060
             + C +
Sbjct  300   EICRI  304



>ref|XP_009804003.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X2 
[Nicotiana sylvestris]
 ref|XP_009804005.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X2 
[Nicotiana sylvestris]
 ref|XP_009804006.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X2 
[Nicotiana sylvestris]
 ref|XP_009804007.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X2 
[Nicotiana sylvestris]
Length=302

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/275 (60%), Positives = 204/275 (74%), Gaps = 2/275 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMT-HENLLPL  418
             RS A +LGKGTFG SYK+EL     VAVKRLK  CL  +EF +++ EL K++ H++LLPL
Sbjct  26    RSEAVLLGKGTFGFSYKAELENGKTVAVKRLKDCCLREEEFNQKIQELAKLSDHQSLLPL  85

Query  419   RAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQG  598
             RAY ++  E LL++D+M   SLA  LH NE   KA L WEVRT IA GVA A++ LHAQG
Sbjct  86    RAYYYSKDEKLLIFDYMPTSSLASLLHDNEVAKKAPLTWEVRTRIANGVACALEFLHAQG  145

Query  599   STICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSD  778
               +CHGNIRSSNV LTN  +VR+SE  + +L  P+SK  L+ GY+APEV + + VS +SD
Sbjct  146   PGVCHGNIRSSNVLLTNTFDVRLSENGIFRLFVPNSKFVLIPGYQAPEVENAYDVSPKSD  205

Query  779   VYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNv-eq  955
             VYSFGVLLLELLTGKAPLEA  K  GVDLP+WVR  F+EKPI D+FDS L    QN  EQ
Sbjct  206   VYSFGVLLLELLTGKAPLEASGKNTGVDLPSWVRDTFQEKPIIDIFDSMLLHNYQNFGEQ  265

Query  956   lvqllqvAICCTFQYPNKRPSMAAVADQIKKTCSL  1060
             +VQLLQ+AICCTF+ P+KRPSM AV ++I +TCS 
Sbjct  266   MVQLLQLAICCTFKNPSKRPSMVAVTNRINRTCSF  300



>emb|CDP00833.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 211/294 (72%), Gaps = 3/294 (1%)
 Frame = +2

Query  188   SKLVFFgdgdg-yelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEF  364
             SKLVFFG+GDG Y + +L+ S + VL KGTFGTS+K+EL    AV VKRLK  C +  EF
Sbjct  12    SKLVFFGNGDGGYSVKELMHSASKVLWKGTFGTSFKTELKGGNAVMVKRLKGSCSSETEF  71

Query  365   TERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVR  544
              ERV E+G + HENLLPLRAYC   +E  LVYD M MGSLA  LHG      + L W+VR
Sbjct  72    RERVLEIGILLHENLLPLRAYCCYQNENFLVYDCMRMGSLAKHLHGKTSPKDSPLTWQVR  131

Query  545   TSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVS  724
               IA+GVA AI  LH  GS ICHGNIRSSNV LT+ L+ R+SEF + +L+SP+ K DL++
Sbjct  132   CKIAFGVARAIHYLHTTGSNICHGNIRSSNVLLTDTLDARLSEFGIVRLISPEHKPDLIN  191

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEV + H+VS +SDVYSFGVLLLELLTG  P+   +   GV L  WVR M REKPI
Sbjct  192   GYRAPEVRNAHEVSQKSDVYSFGVLLLELLTGIKPVGTISPTTGVYLAEWVRTMIREKPI  251

Query  905   CDVFDSTLAKAEQN--veqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTCSL  1060
              +VFD+ L    Q     Q+V+LL++AICCTF+YP++RP M+AV  ++++TCSL
Sbjct  252   LEVFDNELLLEYQADFEGQMVKLLELAICCTFEYPDRRPLMSAVLKRMRETCSL  305



>gb|EYU34505.1| hypothetical protein MIMGU_mgv11b016165mg [Erythranthe guttata]
Length=298

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 207/279 (74%), Gaps = 14/279 (5%)
 Frame = +2

Query  245   STAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMT--HENLLPL  418
             S A VLG+GTFGT++K++LP K  VAVKRLK  CL   +F  +V EL KM   HENLLPL
Sbjct  25    SNAHVLGRGTFGTTFKAQLPGKAFVAVKRLKGVCLPEIDFAAKVKELAKMAAGHENLLPL  84

Query  419   RAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQG  598
             +AYC + +E LL++D +S  SLA  LHG+    K  L+WE R++IAYG+A  I  LH+Q 
Sbjct  85    KAYCCHMNERLLLHDFLS--SLASALHGS--AIKIPLSWEARSNIAYGIARGISYLHSQP  140

Query  599   STICHGNIRSSNVFLTNFLE---VRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSH  769
             S ICHGNIRSSN+F++ + +   V++SE+C+ QL + DSK  +  GYRAPEVT+ + VSH
Sbjct  141   SNICHGNIRSSNIFISYYNDRHSVQISEYCMAQLATLDSKTAIAQGYRAPEVTNLNSVSH  200

Query  770   QSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQN-  946
             +SDVY+FGV+LLELLTGKAPL      KG DLP WVR++F+EKPI +VFDS L + +++ 
Sbjct  201   KSDVYAFGVVLLELLTGKAPL---VNDKGTDLPKWVRSIFQEKPIIEVFDSALHEYKESW  257

Query  947   -veqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTCSL  1060
               EQ+V+LLQ+A+CCTF+Y   RPSMAAV ++I++TC+ 
Sbjct  258   VGEQMVRLLQIAVCCTFEYQCNRPSMAAVTNRIRETCNF  296



>ref|XP_011099906.1| PREDICTED: probable inactive receptor kinase At1g48480 [Sesamum 
indicum]
Length=735

 Score =   293 bits (750),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 193/271 (71%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    AVAVKRL+   +   EF E++ E+G+M HENL+PLR
Sbjct  440   RASAEVLGKGTFGTAYKAVLESGLAVAVKRLRDVNMGEKEFREKMEEIGRMDHENLVPLR  499

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY +N  E LLVYD++ MGSL+  LHGN+G  +  LNWE R +IA G A  I  LH QGS
Sbjct  500   AYHYNREEKLLVYDYLPMGSLSALLHGNKGAGRTPLNWETRAAIALGAAKGISYLHLQGS  559

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             TI HGNI+SSN+ LT   E RVS+F L QL  P S  + V+GYRAPEVT P +VS ++DV
Sbjct  560   TISHGNIKSSNILLTKSYEARVSDFGLAQLAGPASTPNRVAGYRAPEVTDPRKVSQKADV  619

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  620   YSFGVLLLELLTGKAPTHSLMNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEEDMV  679

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+A+ CT QYP+KRPSM  V  +I++ C
Sbjct  680   QLLQLAVDCTAQYPDKRPSMVEVVGKIEELC  710



>ref|XP_009617419.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nicotiana 
tomentosiformis]
Length=671

 Score =   291 bits (744),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 159/290 (55%), Positives = 210/290 (72%), Gaps = 1/290 (0%)
 Frame = +2

Query  182   VKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVD  358
             V  KL+FFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  
Sbjct  362   VVKKLIFFGNSATVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLKDVTISEM  421

Query  359   EFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWE  538
             EF E++  +G M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE
Sbjct  422   EFREKIDTVGAMNHENLVPLRAYYYSREEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWE  481

Query  539   VRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL  718
             VR+ IA G A  I+ LH+QGS++ HGNI+SSNV LT   + RVS+F L QL+ P +    
Sbjct  482   VRSGIALGTARGIEYLHSQGSSVSHGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTTPTR  541

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             V+GYRAPEVT P +VSH++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+
Sbjct  542   VAGYRAPEVTDPRRVSHKADVYSFGVLLLELLTGKAPTHAILNEEGVDLPRWVQSIVREQ  601

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
                +VFD  L + +   E++VQLLQ+AI C  QYP+ RPSM+ V ++I++
Sbjct  602   WTSEVFDLELLRYQSVEEEMVQLLQLAIDCAAQYPDNRPSMSEVCERIQE  651



>gb|AGO98727.1| ovary receptor kinase 11 [Solanum chacoense]
Length=644

 Score =   289 bits (739),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 195/273 (71%), Gaps = 0/273 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFGT+YK+ L     + VKRL+   +   EF E++ ++GKM HENL+PLR
Sbjct  355   KASAEVLGKGTFGTAYKAALESGITLVVKRLRDVTVPEKEFREKIEDVGKMNHENLVPLR  414

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD++SMGSL+  LHGN+G  +  LNWE R  IA G A+ I  LHAQG 
Sbjct  415   AYYYSRDEKLLVYDYISMGSLSALLHGNKGAGRTPLNWETRAGIALGAAHGIAYLHAQGP  474

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   E RVS+F L QL+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  475   SVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  534

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  535   YSFGVLLLELLTGKAPTHSIMNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEEDMV  594

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCSL  1060
             QLLQVA+ CT QYP++RPSMA V  ++++ C +
Sbjct  595   QLLQVAVDCTAQYPDRRPSMAEVTSRVEELCRM  627



>gb|AGO98729.1| ovary receptor kinase 27 [Solanum chacoense]
Length=661

 Score =   289 bits (739),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 211/288 (73%), Gaps = 1/288 (0%)
 Frame = +2

Query  191   KLVFFgdgdgyelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTE  370
             KL+FFG    ++L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF E
Sbjct  357   KLIFFGSDRSFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLKDVTISDMEFRE  416

Query  371   RVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTS  550
             ++ ++G+M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  K  L+W+VR+ 
Sbjct  417   KIDKVGQMNHENLVPLRAYYYSREEKLLVYDYMPMGSLSALLHGNKGAGKTPLDWQVRSG  476

Query  551   IAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGY  730
             IA G A  I+ LH+QGS + HGNI+SSNV LT   + RVS+F L QL+ P +    V+GY
Sbjct  477   IALGTARGIEYLHSQGSNV-HGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTSPTRVAGY  535

Query  731   RAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICD  910
             RAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ +++    
Sbjct  536   RAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVQDQWTSQ  595

Query  911   VFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             VFD  L + +   E++VQLLQ+AI C+ QYP+ RPSM+AV ++I++ C
Sbjct  596   VFDIELLRYQSVEEEMVQLLQLAIDCSTQYPDHRPSMSAVVERIQELC  643



>ref|XP_006341503.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Solanum 
tuberosum]
Length=666

 Score =   289 bits (739),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 211/288 (73%), Gaps = 1/288 (0%)
 Frame = +2

Query  191   KLVFFgdgdgyelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTE  370
             KL+FFG    ++L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF E
Sbjct  362   KLIFFGSDRSFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLKDVTISDMEFRE  421

Query  371   RVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTS  550
             ++ ++G+M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  K  L+W+VR+ 
Sbjct  422   KIDKVGQMNHENLVPLRAYYYSREEKLLVYDYMPMGSLSALLHGNKGGGKTPLDWQVRSG  481

Query  551   IAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGY  730
             IA G A  I+ LH+QGS + HGNI+SSNV LT   + RVS+F L QL+ P +    V+GY
Sbjct  482   IALGTARGIEYLHSQGSNV-HGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTSPTRVAGY  540

Query  731   RAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICD  910
             RAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ +++    
Sbjct  541   RAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVQDQWTSQ  600

Query  911   VFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             VFD  L + +   E++VQLLQ+AI C+ QYP+ RPSM+AV ++I++ C
Sbjct  601   VFDIELLRYQSVEEEMVQLLQLAIDCSTQYPDHRPSMSAVVERIQELC  648



>ref|XP_004250172.1| PREDICTED: probable inactive receptor kinase At1g48480 [Solanum 
lycopersicum]
Length=642

 Score =   288 bits (737),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 195/273 (71%), Gaps = 0/273 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFGT+YK+ L     + VKRL+   +   EF E++ ++GKM HENL+PLR
Sbjct  354   KASAEVLGKGTFGTAYKAALESGITLVVKRLRDVTVPEKEFREKIEDVGKMNHENLVPLR  413

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD++SMGSL+  LHGN+G  +  LNWE R  IA G A+ I  LHAQG 
Sbjct  414   AYYYSRDEKLLVYDYISMGSLSALLHGNKGAGRTPLNWETRAGIALGAAHGIAYLHAQGP  473

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   E RVS+F L QL+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  474   SVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  533

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  534   YSFGVLLLELLTGKAPTHSVMNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEEDMV  593

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCSL  1060
             QLLQVA+ CT QYP++RPSMA V  ++++ C +
Sbjct  594   QLLQVAVDCTAQYPDRRPSMAEVTSRVEELCRM  626



>ref|XP_009592532.1| PREDICTED: probable inactive receptor kinase RLK902 [Nicotiana 
tomentosiformis]
Length=646

 Score =   288 bits (737),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 145/275 (53%), Positives = 195/275 (71%), Gaps = 0/275 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFGT+YK+ L     + VKRL+   +   EF E++ E+GK+ HENL+PLR
Sbjct  356   KASAEVLGKGTFGTAYKAALESGITLVVKRLRDVTVPEKEFREKIEEVGKLNHENLVPLR  415

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD++SMGSL+  LHGN+G  +  LNWE R  IA G A+ I  LHAQG 
Sbjct  416   AYYYSGDEKLLVYDYISMGSLSALLHGNKGAGRTPLNWETRAGIALGAAHGIAYLHAQGP  475

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   E RVS+F L QL+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  476   SVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  535

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  536   YSFGVLLLELLTGKAPTHSLMNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEEDMV  595

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCSLWF  1066
             QLLQ+A+ CT QYP++RPSMA V  ++++ C   F
Sbjct  596   QLLQLAVDCTAQYPDRRPSMAEVTSRVEELCRSSF  630



>ref|XP_006364614.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Solanum 
tuberosum]
Length=647

 Score =   288 bits (736),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 195/273 (71%), Gaps = 0/273 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFGT+YK+ L     + VKRL+   +   EF E++ ++GKM HENL+PLR
Sbjct  358   KASAEVLGKGTFGTAYKAALESGITLVVKRLRDVTVPEKEFREKIEDVGKMNHENLVPLR  417

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD++SMGSL+  LHGN+G  +  LNWE R  IA G A+ I  LHAQG 
Sbjct  418   AYYYSRDEKLLVYDYISMGSLSALLHGNKGAGRTPLNWETRAGIALGAAHGIAYLHAQGP  477

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   E RVS+F L QL+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  478   SVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  537

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  538   YSFGVLLLELLTGKAPTHSVLNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEEDMV  597

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCSL  1060
             QLLQVA+ CT QYP++RPSMA V  ++++ C +
Sbjct  598   QLLQVAVDCTAQYPDRRPSMAEVTTRVEELCRM  630



>ref|XP_009759771.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nicotiana 
sylvestris]
Length=671

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 210/290 (72%), Gaps = 1/290 (0%)
 Frame = +2

Query  182   VKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVD  358
             V  KL+FFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  
Sbjct  362   VVKKLIFFGNSARVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLKDVTISEM  421

Query  359   EFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWE  538
             EF E++  +G M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE
Sbjct  422   EFREKIDTVGAMNHENLVPLRAYYYSREEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWE  481

Query  539   VRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL  718
             VR++IA G A  I+ LH+QGS++ HGNI+SSNV LT   + RVS+F L QL+ P +    
Sbjct  482   VRSAIALGTARGIEYLHSQGSSVSHGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTTPTR  541

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             V+GYRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+
Sbjct  542   VAGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHAILNEEGVDLPRWVQSIVREQ  601

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
                +VFD  L + +   E++VQLLQ+AI C  QYP+ RPSM+ V ++I++
Sbjct  602   WTSEVFDLELLRYQSVEEEMVQLLQLAIDCAAQYPDHRPSMSEVCERIEE  651



>gb|AGL74765.1| ovary receptor kinase 11 [Solanum chacoense]
Length=644

 Score =   286 bits (732),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 194/273 (71%), Gaps = 0/273 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFGT+YK+ L     + VKRL+   +   EF E++ ++GKM HENL+PLR
Sbjct  355   KASAEVLGKGTFGTAYKAALESGITLVVKRLRDVTVPEKEFREKIEDVGKMNHENLVPLR  414

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD++SMGSL+  LHGN+G  +  LNWE R  IA G A+ I  LHAQG 
Sbjct  415   AYYYSRDEKLLVYDYISMGSLSALLHGNKGAGRTPLNWETRAGIALGAAHGIAYLHAQGP  474

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   E  VS+F L QL+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  475   SVSHGNIKSSNILLTKSYEAHVSDFGLAQLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  534

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  535   YSFGVLLLELLTGKAPTHSIMNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEEDMV  594

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCSL  1060
             QLLQVA+ CT QYP++RPSMA V  ++++ C +
Sbjct  595   QLLQVAVDCTAQYPDRRPSMAEVTTRVEELCRM  627



>ref|XP_002322122.2| hypothetical protein POPTR_0015s04920g [Populus trichocarpa]
 gb|EEF06249.2| hypothetical protein POPTR_0015s04920g [Populus trichocarpa]
Length=652

 Score =   286 bits (732),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 206/289 (71%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG      +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRL+   ++  EF 
Sbjct  340   KLVFFGKAPRVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFR  399

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+MSMGSL+  LHGN+G  +A LNWE+R+
Sbjct  400   EKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRS  459

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA   A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+G
Sbjct  460   GIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAG  519

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  520   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTS  579

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++VQLLQ+ I C  QYP+ RPSM+AV  +I++ C
Sbjct  580   EVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEELC  628



>ref|XP_009797253.1| PREDICTED: probable inactive receptor kinase RLK902 [Nicotiana 
sylvestris]
Length=645

 Score =   285 bits (729),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/275 (52%), Positives = 195/275 (71%), Gaps = 0/275 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFGT+YK+ L     + VKRL+   +   EF E++ E+GK+ HENL+PLR
Sbjct  355   KASAEVLGKGTFGTAYKAALESGITLVVKRLRDVTVPEKEFREKIEEVGKLNHENLVPLR  414

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD++SMGSL+  LHGN+G  +  LNWE R  IA G A+ I  LHAQG 
Sbjct  415   AYYYSGDEKLLVYDYISMGSLSALLHGNKGAGRTPLNWETRAGIALGAAHGIAYLHAQGP  474

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT     RVS+F L QL+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  475   SVSHGNIKSSNILLTKSYAARVSDFGLAQLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  534

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  535   YSFGVLLLELLTGKAPTHSLMNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEEDMV  594

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCSLWF  1066
             QLLQ+A+ CT QYP++RPSMA V +++++ C   F
Sbjct  595   QLLQLAVDCTAQYPDRRPSMAEVTNRVEELCRSSF  629



>ref|XP_002317861.2| hypothetical protein POPTR_0012s04170g [Populus trichocarpa]
 gb|EEE96081.2| hypothetical protein POPTR_0012s04170g [Populus trichocarpa]
Length=675

 Score =   285 bits (730),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 204/289 (71%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG      +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  339   KLVFFGKASRVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLKDVTISEREFR  398

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+MSMGSL+  LHGN G  +  LNWE+R+
Sbjct  399   EKIETVGAMDHENLVPLRAYYYSGDEKLLVYDYMSMGSLSALLHGNRGAGRTPLNWEIRS  458

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L +L+ P S  + V+G
Sbjct  459   GIALGAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLARLVGPPSTPNRVAG  518

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  519   YRAPEVTDPGKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVREEWTS  578

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++VQLLQ+ I C  QYP+ RPSM+ V  +I + C
Sbjct  579   EVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSEVTRRIDELC  627



>ref|XP_010069429.1| PREDICTED: probable inactive receptor kinase At1g48480 [Eucalyptus 
grandis]
 gb|KCW57783.1| hypothetical protein EUGRSUZ_H00539 [Eucalyptus grandis]
Length=659

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/289 (53%), Positives = 208/289 (72%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KL+FFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   +A  EF 
Sbjct  346   KLIFFGNSARAFDLEDLLRASAEVLGKGTFGTAYKAVLEAGITVAVKRLKDVNVAAKEFK  405

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M H++L+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  406   EKIEAVGAMDHQSLVPLRAYYYSNDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRS  465

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
             +IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+G
Sbjct  466   AIALGAARGIEYLHSQGPIVSHGNIKSSNILLTTSYDARVSDFGLAHLVGPSSTPNHVAG  525

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP+ +    +GVDLP WV+++ RE+   
Sbjct  526   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPIHSQLNEEGVDLPRWVQSIVREEWTS  585

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++VQLLQ+AI C  QYP+KRPSM+ V  QI++ C
Sbjct  586   EVFDLELLRYQNIEEEMVQLLQLAIDCAAQYPDKRPSMSEVRSQIEELC  634



>ref|XP_004235768.1| PREDICTED: probable inactive receptor kinase At1g48480 [Solanum 
lycopersicum]
Length=661

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 154/286 (54%), Positives = 211/286 (74%), Gaps = 1/286 (0%)
 Frame = +2

Query  191   KLVFFgdgdgyelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTE  370
             KL+FFG    ++L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF E
Sbjct  357   KLIFFGSDRPFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLKDVTISDMEFRE  416

Query  371   RVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTS  550
             ++ ++G+M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G +K  L+W+VR+ 
Sbjct  417   KIDQVGQMNHENLVPLRAYYYSREEKLLVYDYMPMGSLSALLHGNKGASKTPLDWKVRSG  476

Query  551   IAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGY  730
             IA G A  I+ LH+QGST+ HGNI+SSNV LT   + RVS+F L QL+ P +    V+GY
Sbjct  477   IALGTARGIEYLHSQGSTV-HGNIKSSNVLLTKSYDARVSDFGLAQLVGPPTSPTRVAGY  535

Query  731   RAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICD  910
             RAPEVT P +V+ ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ +++    
Sbjct  536   RAPEVTDPRRVTQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVQDQWTSQ  595

Query  911   VFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             VFD  L + +   E++VQLLQ+AI C+ QYP+ RPSM+ V ++I++
Sbjct  596   VFDIELLRYQSVEEEMVQLLQLAIDCSTQYPDNRPSMSDVVERIQE  641



>ref|XP_010671388.1| PREDICTED: probable inactive receptor kinase At1g48480 [Beta 
vulgaris subsp. vulgaris]
Length=659

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 162/295 (55%), Positives = 207/295 (70%), Gaps = 3/295 (1%)
 Frame = +2

Query  182   VKSKLVFFgdgdgyel---ddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLA  352
             V  KLVFFG+G G +L   ++LLR++A VLGKGTFGT+YK+ L   T VAVKRLK   L 
Sbjct  342   VSKKLVFFGNGIGGKLFDLEELLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLKDVILG  401

Query  353   VDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLN  532
               EF E++  +G M HE L+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LN
Sbjct  402   DVEFKEKIEVVGGMEHEFLVPLRAYYYSRDEKLLVYDYMPMGSLSAFLHGNKGAGRTPLN  461

Query  533   WEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL  712
             WE+R+SIA GVA  I  LH+QGS + HGNI+SSNV LT   E RVS+F L QL+ P S  
Sbjct  462   WELRSSIALGVARGISYLHSQGSDVSHGNIKSSNVLLTKSYEPRVSDFGLAQLVGPSSTP  521

Query  713   DLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFR  892
               V+GYRAPEVT P + S ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ +
Sbjct  522   TRVNGYRAPEVTEPRKTSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVK  581

Query  893   EKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
             +    +VFD  L + +   E++VQLLQ+A+ C  QYP+ RPSM  V  QI++ CS
Sbjct  582   DDWASEVFDLELLRYQHAEEEMVQLLQIAVDCAAQYPDTRPSMIDVTKQIEELCS  636



>ref|XP_002279127.2| PREDICTED: probable inactive receptor kinase At1g48480 [Vitis 
vinifera]
Length=672

 Score =   284 bits (726),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 153/289 (53%), Positives = 209/289 (72%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             +LVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++ +EF 
Sbjct  360   RLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAILEMGTVVAVKRLKDVTISENEFR  419

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HE+L+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  420   EKIEGVGAMDHEHLVPLRAYYYSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRS  479

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG ++ HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+G
Sbjct  480   GIALGAARGIEYLHSQGPSVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSSTPNRVAG  539

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVL+LELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  540   YRAPEVTDPRKVSQKADVYSFGVLILELLTGKAPTHAILNEEGVDLPRWVQSIVREEWTS  599

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++VQLLQ+AI CT QYP+KRP ++ V  +I++ C
Sbjct  600   EVFDLELLRYQNVEEEMVQLLQLAIDCTAQYPDKRPPISEVTKRIEELC  648



>gb|KHN10529.1| Putative inactive receptor kinase [Glycine soja]
Length=506

 Score =   279 bits (714),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 203/287 (71%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF 
Sbjct  199   KLVFFGNAARAFDLEDLLRASAEVLGKGTFGTAYKAVLEAGPVVAVKRLKDVTISEKEFK  258

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HE+L+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWEVR+
Sbjct  259   EKIEAVGAMDHESLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEVRS  318

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH++G  + HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+G
Sbjct  319   GIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSSTPNRVAG  378

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS  +DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  379   YRAPEVTDPRKVSQMADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTS  438

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+A+ C  QYP+KRPSM+ V   I++
Sbjct  439   EVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIQE  485



>ref|XP_011035563.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=652

 Score =   283 bits (724),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 154/289 (53%), Positives = 205/289 (71%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG      +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRL+   ++  EF 
Sbjct  340   KLVFFGKAPRVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFR  399

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+MSMGSL+  LHGN+G  +  LNW++R+
Sbjct  400   EKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRTPLNWKIRS  459

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA   A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+G
Sbjct  460   GIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAG  519

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  520   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTS  579

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++VQLLQ+ I C  QYP+ RPSM+AV  +I++ C
Sbjct  580   EVFDLELVRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEELC  628



>ref|XP_009360057.1| PREDICTED: probable inactive receptor kinase At1g48480 [Pyrus 
x bretschneideri]
Length=647

 Score =   283 bits (723),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 156/292 (53%), Positives = 210/292 (72%), Gaps = 1/292 (0%)
 Frame = +2

Query  176   AIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLA  352
             A+   KLVFFG+G    +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRL+   ++
Sbjct  333   AVGAKKLVFFGNGARVFDLEDLLRASAEVLGKGTFGTAYKAVLEAGTVVAVKRLRDVTIS  392

Query  353   VDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLN  532
               EF E++  +G   HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LN
Sbjct  393   ESEFKEKIEAVGVKDHENLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLN  452

Query  533   WEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL  712
             WE+R+ IA G A  I+ LH+QG T+ HGNI+SSN+ LT   E RVS+F L  L+ P S  
Sbjct  453   WEIRSRIALGAARGIEYLHSQGQTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTP  512

Query  713   DLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFR  892
             + VSGYRAPEVT P +VS ++DVYSFGVLLLELLTGK P +A    +GVDLP WV+++ +
Sbjct  513   NRVSGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTQALLNEEGVDLPRWVQSIVK  572

Query  893   EKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             E+   +VFD  L + +   E++VQLLQ+AI C+ QYP+KRPS++ V  +I++
Sbjct  573   EEWTSEVFDVELLRYQNVEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEE  624



>ref|XP_008466324.1| PREDICTED: probable inactive receptor kinase RLK902 [Cucumis 
melo]
Length=662

 Score =   283 bits (723),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 206/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   + VAVKRLK   +   EF 
Sbjct  350   KLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEVGSVVAVKRLKDVTITEREFR  409

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+M+MGSL+  LHGN+G  +  LNWE+R+
Sbjct  410   EKIEAVGSMDHENLVPLRAYYFSRDEKLLVYDYMAMGSLSALLHGNKGAGRTPLNWEIRS  469

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L  L+ P S    V+G
Sbjct  470   GIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPPSTPTRVAG  529

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VSH++DVYSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   
Sbjct  530   YRAPEVTDPRKVSHKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVVREEWTS  589

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+A+ C  QYP+KRP+M+ V  +I++
Sbjct  590   EVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDKRPTMSEVTKRIEE  636



>ref|XP_002531014.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF31374.1| ATP binding protein, putative [Ricinus communis]
Length=651

 Score =   282 bits (722),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 189/271 (70%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    AVAVKRLK   ++  EF E++  +GK+ HENL+PLR
Sbjct  350   RASAEVLGKGTFGTTYKATLEMGVAVAVKRLKDVTVSEREFREKIEAVGKINHENLVPLR  409

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
              Y +N  E LLVYD+M MGSL+  LHGN G  +  LNWE R+SIA G A A+  LH+QG 
Sbjct  410   GYYYNKDEKLLVYDYMPMGSLSALLHGNRGAGRTPLNWETRSSIALGAARAVAHLHSQGQ  469

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
                HGNI+SSN+ LT   E RVS+F L  L  P    + + GYRAPEVT   +VS ++DV
Sbjct  470   ATSHGNIKSSNILLTTSFEARVSDFGLAHLAGPTPTPNRIDGYRAPEVTDARKVSQKADV  529

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG+LLLELLTGKAP  +    +GVDLP WV+++ +++   +VFD  L + +   +++V
Sbjct  530   YSFGILLLELLTGKAPTHSHLNEEGVDLPRWVQSVVKDEWTSEVFDLELLRYQNVEDEMV  589

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+AI CT QYP+ RPSMA V +QI++ C
Sbjct  590   QLLQLAINCTAQYPDNRPSMAEVKNQIEELC  620



>emb|CDO98323.1| unnamed protein product [Coffea canephora]
Length=618

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 155/287 (54%), Positives = 205/287 (71%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRL+   ++ +EF 
Sbjct  312   KLVFFGNSSRVFDLEDLLRASAEVLGKGTFGTAYKAVLEFGTVVAVKRLRDVTISENEFR  371

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M  ENL+PLRAY ++  E LLVYD+M  GSL+  LHGN+G  +  LNWEVR+
Sbjct  372   EKIEAVGAMEQENLVPLRAYYYSREEKLLVYDYMPTGSLSALLHGNKGAGRTPLNWEVRS  431

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG  + HGNI+SSN+ LT   E RVS+F L  L+ P S    V+G
Sbjct  432   GIALGAARGIEYLHSQGPDVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPPSSPTRVAG  491

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  492   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVREEWTS  551

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI C  QYP+ RPSM+ VA++I++
Sbjct  552   EVFDLELLRYQNLEEEMVQLLQLAIDCAAQYPDNRPSMSEVANRIQE  598



>ref|XP_008393435.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=651

 Score =   282 bits (721),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 155/287 (54%), Positives = 207/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+G    +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRL+   ++  EF 
Sbjct  342   KLVFFGNGARVFDLEDLLRASAEVLGKGTFGTAYKAVLEAGTVVAVKRLRDVTISESEFK  401

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G   HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  402   EKIEAVGVKDHENLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRS  461

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG T+ HGNI+SSN+ LT   E RVS+F L  L+ P S  + VSG
Sbjct  462   GIALGAARGIEYLHSQGQTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVSG  521

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGK P  A    +GVDLP WV+++ +E+   
Sbjct  522   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIVKEEWTS  581

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI C+ QYP+KRPS++ V  +I++
Sbjct  582   EVFDVELLRYQNVEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEE  628



>ref|XP_010087022.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB25608.1| putative inactive receptor kinase [Morus notabilis]
Length=658

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/289 (53%), Positives = 205/289 (71%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  353   KLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEVGTVVAVKRLKDVTISDKEFK  412

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M H+NL+PLRA+ ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  413   EKIEAVGAMDHQNLVPLRAFYYSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRS  472

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  IQ LH+QG  + HGNI+SSN+ LT     RVS+F L  L+ P S  + V+G
Sbjct  473   GIALGAARGIQYLHSQGPNVSHGNIKSSNILLTKSYTSRVSDFGLAHLVGPSSTPNRVAG  532

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGK P  A    +GVDLP WV+++ +E+   
Sbjct  533   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIVKEEWTS  592

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++VQ+LQ+AI C  QYP+KRP+M+ V  +I++ C
Sbjct  593   EVFDLELLRYQNVEEEMVQMLQLAIDCAAQYPDKRPTMSEVTSRIEELC  641



>gb|KDP24390.1| hypothetical protein JCGZ_26596 [Jatropha curcas]
Length=655

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/289 (53%), Positives = 202/289 (70%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG      +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  344   KLVFFGKASRVFDLEDLLRASAEVLGKGTFGTAYKAVLEVGTIVAVKRLKDVTISDREFK  403

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G +  ENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  404   EKIEMVGAVDQENLVPLRAYYYSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRS  463

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  IQ LH+QG  + HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+G
Sbjct  464   GIALGAARGIQYLHSQGPNVSHGNIKSSNILLTQNYEARVSDFGLAHLVGPSSTPNRVAG  523

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGK P  A    +GVDLP WV+++ RE+   
Sbjct  524   YRAPEVTDPRRVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIVREEWTS  583

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++VQLLQ+ I C  QYP+ RPSM+ V  +I++ C
Sbjct  584   EVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSEVTSRIEELC  632



>ref|XP_004137511.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cucumis 
sativus]
 gb|KGN64187.1| hypothetical protein Csa_1G042930 [Cucumis sativus]
Length=663

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 206/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   + VAVKRLK   +   EF 
Sbjct  351   KLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEVGSVVAVKRLKDVTITEREFR  410

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HE+L+PLRAY ++  E LLVYD+M+MGSL+  LHGN+G  +  LNWE+R+
Sbjct  411   EKIEAVGSMDHESLVPLRAYYFSRDEKLLVYDYMAMGSLSALLHGNKGAGRTPLNWEIRS  470

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L  L+ P S    V+G
Sbjct  471   GIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPPSTPTRVAG  530

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VSH++DVYSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   
Sbjct  531   YRAPEVTDPRKVSHKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVVREEWTS  590

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+A+ C  QYP+KRPSM+ V  +I++
Sbjct  591   EVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDKRPSMSEVTKRIEE  637



>ref|XP_004292489.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Fragaria 
vesca subsp. vesca]
Length=617

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/272 (54%), Positives = 193/272 (71%), Gaps = 0/272 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    ++AVKRLK   ++  EF +++ E+G M H NL+PLR
Sbjct  336   RASAEVLGKGTFGTAYKAALEMGVSMAVKRLKEVIVSEKEFKDKMDEIGHMEHVNLVPLR  395

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN G  +  LNWE R+ IA G A AI  LH+ G 
Sbjct  396   AYYYSRDEKLLVYDYMPMGSLSALLHGNRGSGRTPLNWETRSGIAVGAARAITYLHSHGP  455

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             TI HGNI+SSN+ LT+  E  VS+FCL    SP S  + VSGYRAPEVT  ++++ ++DV
Sbjct  456   TISHGNIKSSNILLTSSYEACVSDFCLAHFASPASTPNRVSGYRAPEVTDTNKITQKADV  515

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGK P +A    +GVDLP WV ++ RE+   +VFD  L + +   +++V
Sbjct  516   YSFGVLLLELLTGKPPTQALMTEEGVDLPRWVHSVVREEWTVEVFDLELLRYQNVEDEMV  575

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
             QLLQ+A+ CT QYP+KRPSMA VA QI++  S
Sbjct  576   QLLQIALECTVQYPDKRPSMAEVASQIEELYS  607



>gb|KHN00136.1| Putative inactive receptor kinase [Glycine soja]
Length=602

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 205/287 (71%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF 
Sbjct  294   KLVFFGNAARAFDLEDLLRASAEVLGKGTFGTAYKAVLEAGPVVAVKRLKDVTISEKEFR  353

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HE+L+PLRAY ++  E LLVYD+MSMGSL+  LHGN+G  +  LNWEVR+
Sbjct  354   EKIEAVGAMDHESLVPLRAYYFSRDEKLLVYDYMSMGSLSALLHGNKGAGRTPLNWEVRS  413

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH++G  + HGNI+SSN+ LT   + RVS+F L  L+SP S  + V+G
Sbjct  414   GIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVSPSSTPNRVAG  473

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS + DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  474   YRAPEVTDPRKVSQKVDVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTS  533

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+A+ C  QYP+ RPSM+ V  +I++
Sbjct  534   EVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDMRPSMSEVVRRIQE  580



>gb|KHN43642.1| Putative inactive receptor kinase [Glycine soja]
Length=440

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 193/269 (72%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ + +   VAVKRLK   ++  EF E++  +G M HENL+PLR
Sbjct  143   RASAEVLGKGTFGTTYKAVMEDGPVVAVKRLKDVTVSEKEFKEKIDVVGVMDHENLVPLR  202

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+D+M MGSL+  LHGN+G  +  LNWE+R+SIA G A  IQ LH+QG 
Sbjct  203   AYYYSRDEKLLVHDYMPMGSLSAILHGNKGAGRTPLNWEMRSSIALGAACGIQYLHSQGP  262

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+GYRAPEV  P +VS ++DV
Sbjct  263   SVSHGNIKSSNILLTKSYDARVSDFGLTHLVGPSSTPNRVAGYRAPEVIDPRKVSQKADV  322

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + + + E++V
Sbjct  323   YSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWSSEVFDIELLRYQNSEEEMV  382

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+A+ C   YP+ RPSM+ V  +I++
Sbjct  383   QLLQLAVDCVVPYPDNRPSMSQVIQRIQE  411



>ref|XP_008240124.1| PREDICTED: probable inactive receptor kinase At1g48480 [Prunus 
mume]
Length=660

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 206/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  347   KLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEVGTVVAVKRLKDVTISESEFK  406

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G   HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  407   EKIEAVGVKDHENLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRS  466

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG T+ HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+G
Sbjct  467   GIALGAARGIEYLHSQGQTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVAG  526

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGK P  A    +GVDLP WV+++ +E+   
Sbjct  527   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIVKEEWTS  586

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI C+ QYP+KRPS++ V  +I++
Sbjct  587   EVFDLELLRYQNVEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEE  633



>ref|XP_009356011.1| PREDICTED: probable inactive receptor kinase At1g48480 [Pyrus 
x bretschneideri]
Length=655

 Score =   281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 193/269 (72%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF E++  +G   HENL+PLR
Sbjct  364   RASAEVLGKGTFGTAYKAVLEAGTVVAVKRLKDVTISESEFKEKIEAVGAKDHENLVPLR  423

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+ IA G A  I+ LH+QG 
Sbjct  424   AYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRSGIALGAARGIEYLHSQGH  483

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T+ HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  484   TVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  543

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGK P  A    +GVDLP WV+++ +E+   +VFD  L + +   E++V
Sbjct  544   YSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIVKEEWTSEVFDLELLRYQNVEEEMV  603

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+AI C+ QYP+KRPS++ V  +I++
Sbjct  604   QLLQLAIDCSAQYPDKRPSISEVTRRIEE  632



>gb|EPS58567.1| hypothetical protein M569_16246, partial [Genlisea aurea]
Length=646

 Score =   281 bits (718),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 155/288 (54%), Positives = 208/288 (72%), Gaps = 2/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L++LLR++A VLGKGTFGT+YK+ L   T VAVKRLK   L+  EF 
Sbjct  357   KLVFFGNTSRVFDLEELLRASAEVLGKGTFGTAYKAILEVGTVVAVKRLKDVTLSEREFK  416

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M H+NL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  L+W +RT
Sbjct  417   EKIENVGAMDHQNLVPLRAYYFSREEKLLVYDYMQMGSLSALLHGNKGAGRTPLSWNIRT  476

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
             SIA G A  I+ LH QG+TI HGNI+SSN+ LTN  E R+S+F L  L  SP S    V+
Sbjct  477   SIALGAARGIEYLHFQGTTISHGNIKSSNILLTNSCEARLSDFGLNHLAGSPSSSPIRVA  536

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+  
Sbjct  537   GYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVVREEWT  596

Query  905   CDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFD  L + +   +++VQ+LQ+ + CT QYP+KRPS++ VA +I++
Sbjct  597   SEVFDLELLRYQSVEDEMVQMLQLGMDCTAQYPDKRPSISEVAKRIEE  644



>ref|XP_007211289.1| hypothetical protein PRUPE_ppa002536mg [Prunus persica]
 gb|EMJ12488.1| hypothetical protein PRUPE_ppa002536mg [Prunus persica]
Length=661

 Score =   281 bits (718),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 206/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  347   KLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEVGTVVAVKRLKDVTISESEFK  406

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G   HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  407   EKIEAVGVKDHENLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRS  466

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG T+ HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+G
Sbjct  467   GIALGAARGIEYLHSQGQTVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVAG  526

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGK P  A    +GVDLP WV+++ +E+   
Sbjct  527   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIVKEEWTS  586

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI C+ QYP+KRPS++ V  +I++
Sbjct  587   EVFDLELLRYQNVEEEMVQLLQLAIDCSAQYPDKRPSISEVTRRIEE  633



>ref|XP_008374868.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=655

 Score =   280 bits (717),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 193/269 (72%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF E++  +G   HENL+PLR
Sbjct  364   RASAEVLGKGTFGTAYKAVLEAGTVVAVKRLKDVTISESEFKEKIEAVGAKDHENLVPLR  423

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+ IA G A  I+ LH+QG 
Sbjct  424   AYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRSGIALGAARGIEYLHSQGH  483

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T+ HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  484   TVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  543

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGK P  A    +GVDLP WV+++ +E+   +VFD  L + +   E++V
Sbjct  544   YSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIVKEEWTSEVFDLELLRYQNVEEEMV  603

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+AI C+ QYP+KRPS++ V  +I++
Sbjct  604   QLLQLAIDCSAQYPDKRPSISEVTRRIEE  632



>ref|XP_003530966.1| PREDICTED: probable inactive receptor kinase At1g48480-like isoform 
1 [Glycine max]
Length=649

 Score =   280 bits (715),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 154/287 (54%), Positives = 205/287 (71%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF 
Sbjct  341   KLVFFGNAARAFDLEDLLRASAEVLGKGTFGTAYKAVLEAGPVVAVKRLKDVTISEKEFR  400

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HE+L+PLRAY ++  E LLVYD+MSMGSL+  LHGN+G  +  LNWEVR+
Sbjct  401   EKIEAVGAMDHESLVPLRAYYFSRDEKLLVYDYMSMGSLSALLHGNKGAGRTPLNWEVRS  460

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH++G  + HGNI+SSN+ LT   + RVS+F L  L+SP S  + V+G
Sbjct  461   GIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVSPSSTPNRVAG  520

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS + DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  521   YRAPEVTDPRKVSQKVDVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTS  580

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+A+ C  QYP+ RPSM+ V  +I++
Sbjct  581   EVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDMRPSMSEVVRRIQE  627



>ref|XP_004163815.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cucumis 
sativus]
Length=694

 Score =   280 bits (717),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 206/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   + VAVKRLK   +   EF 
Sbjct  382   KLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEVGSVVAVKRLKDVTITEREFR  441

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HE+L+PLRAY ++  E LLVYD+M+MGSL+  LHGN+G  +  LNWE+R+
Sbjct  442   EKIEAVGSMDHESLVPLRAYYFSRDEKLLVYDYMAMGSLSALLHGNKGAGRTPLNWEIRS  501

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L  L+ P S    V+G
Sbjct  502   GIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPPSTPTRVAG  561

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VSH++DVYSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   
Sbjct  562   YRAPEVTDPRKVSHKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVVREEWTS  621

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+A+ C  QYP+KRPSM+ V  +I++
Sbjct  622   EVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDKRPSMSEVTKRIEE  668



>ref|XP_006365414.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Solanum 
tuberosum]
Length=648

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 159/296 (54%), Positives = 210/296 (71%), Gaps = 2/296 (1%)
 Frame = +2

Query  164   WSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKI  340
             W  +  V+ KLVFFGD     EL+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK 
Sbjct  334   WGENG-VRKKLVFFGDYYKAFELEDLLRASAEVLGKGTFGTAYKAVLEIGTIVAVKRLKD  392

Query  341   GCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNK  520
               ++  E  E++  +G M HENL+PLRAY ++  E LLV+D+M MGSL+  LHG++G  +
Sbjct  393   VAISERECKEKIEAVGAMNHENLVPLRAYYFSREEKLLVFDYMPMGSLSALLHGSKGAGR  452

Query  521   ASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSP  700
               LNWE+R++IA G+A  I+ LH+QG  + HGNI+SSNV LT   E RVS+F L  L+  
Sbjct  453   TPLNWEIRSNIALGIARGIEYLHSQGPDVSHGNIKSSNVLLTKSYEARVSDFGLANLVGS  512

Query  701   DSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVR  880
              S    V GYRAPEVT P +VS ++DVY+FGVLLLELLTGKAP  A    +GVDLP WV+
Sbjct  513   PSSPTRVVGYRAPEVTDPRKVSQKADVYNFGVLLLELLTGKAPSHALLNEEGVDLPRWVQ  572

Query  881   AMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++ RE+   +VFD  L + +   E++VQLLQ+AI CT QYP+KRPSMA ++ QI++
Sbjct  573   SVVREEWPSEVFDIELLRYQTAEEEMVQLLQLAINCTAQYPDKRPSMAEISKQIEE  628



>gb|KHG20222.1| putative inactive receptor kinase -like protein [Gossypium arboreum]
Length=611

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 187/271 (69%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF E++  +G M H+NL+PLR
Sbjct  332   RASAEVLGKGTFGTTYKATLEMGVVVAVKRLKDVTVSEKEFKEKMEVVGSMDHQNLVPLR  391

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M +GSL+  LHGN G  +  LNW+ R+ IA G A  I  LH++G 
Sbjct  392   AYYFSADEKLLVYDYMPVGSLSSLLHGNRGSGRTPLNWDTRSGIALGAARGIAYLHSKGP  451

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              I HGNI+SSNV LT   E RVS+  L QL  P S  + V GYRAPEVT  ++VS ++DV
Sbjct  452   GISHGNIKSSNVLLTTSYEARVSDLGLAQLAGPTSTPNRVDGYRAPEVTDTNKVSQKADV  511

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG+LLLELLTGKAP  A    +G+DLP WV+++ RE    +VFD  L + +   + +V
Sbjct  512   YSFGILLLELLTGKAPTHALLNEEGIDLPRWVQSIVREDWTSEVFDLELLRYQNVEDDMV  571

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+AI CT QYP+KRPSMA V +QI+  C
Sbjct  572   QLLQLAINCTAQYPDKRPSMAEVMNQIEDLC  602



>emb|CDP01639.1| unnamed protein product [Coffea canephora]
Length=645

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 192/269 (71%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFGT+YK+ L     VAVKRL+   ++  EF E++  +GKM H NL+PL 
Sbjct  355   KASAEVLGKGTFGTAYKAALETGITVAVKRLRDVSVSEKEFREKIEVIGKMNHVNLVPLL  414

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD++ MGSL+  LHGN+G  +  LNWE R +IA G A  I  LH+QG 
Sbjct  415   AYYYSRDEKLLVYDYLPMGSLSALLHGNKGAGRTPLNWETRAAIALGAARGITYLHSQGP  474

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             +I HGNI+SSN+ LT   E RVS+F L QL+SP+   + V+GYRAPEVT P ++S ++DV
Sbjct  475   SISHGNIKSSNILLTTTYEARVSDFGLAQLVSPNPTPNRVAGYRAPEVTDPRKISQKADV  534

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  535   YSFGVLLLELLTGKAPTHSLMNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQSVEEDMV  594

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+A+ CT QYP+KRPSM  V+ +I++
Sbjct  595   QLLQLAVDCTAQYPDKRPSMVEVSSRIEE  623



>ref|XP_011012967.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=653

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 154/289 (53%), Positives = 203/289 (70%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG      +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  343   KLVFFGKSSRVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLKDVTISEREFR  402

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+ LRAY ++  E LLVYD+MSMGSL+  LHGN+G  +  LNWE+R+
Sbjct  403   EKIGTVGAMDHENLVLLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRTPLNWEIRS  462

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+G
Sbjct  463   GIALGAARGIEYLHSQGPDVSHGNIKSSNILLTQSYDARVSDFGLACLVGPPSTPNRVAG  522

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  523   YRAPEVTDPGKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVREEWTS  582

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++V+LLQ+ I C  QYP+ RPSM+ V  +I + C
Sbjct  583   EVFDLELLRYQNVEEEMVELLQLGIDCAAQYPDNRPSMSEVTRRIDELC  631



>ref|XP_002533427.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF28958.1| ATP binding protein, putative [Ricinus communis]
Length=661

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 202/287 (70%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG      +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +   EF 
Sbjct  350   KLVFFGKAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLKDVTITEREFK  409

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G + HE+L+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  410   EKIETVGALDHESLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNKGGGRTPLNWEIRS  469

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  IQ +H+QG  + HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+G
Sbjct  470   GIALGAARGIQYIHSQGPNVSHGNIKSSNILLTQSYEARVSDFGLAHLVGPSSTPNRVAG  529

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGK P  A    +GVDLP WV+++ RE+   
Sbjct  530   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIVREEWTS  589

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+ I C  QYP+ RPSM+ V ++I++
Sbjct  590   EVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSEVTNRIEE  636



>gb|KHN45250.1| Putative inactive receptor kinase [Glycine soja]
Length=485

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 193/269 (72%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ + +   VAVKRLK   ++  EF E++  +G M HENL+PLR
Sbjct  188   RASAEVLGKGTFGTTYKAVMEDGPVVAVKRLKDVTVSEKEFKEKIDVVGVMDHENLVPLR  247

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+D+M MGSL+  LHGN+G  +  LNWE+R+SIA G A  I+ LH+QG 
Sbjct  248   AYYYSRDEKLLVHDYMPMGSLSAILHGNKGAGRTPLNWEMRSSIALGAARGIEYLHSQGP  307

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   + RVS+F L  L+   S  + V+GYRAPEVT P +VS ++DV
Sbjct  308   SVSHGNIKSSNILLTKSYDARVSDFGLTHLVGSSSTPNRVAGYRAPEVTDPRKVSQKADV  367

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + + + E++V
Sbjct  368   YSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWSSEVFDIELLRYQNSEEEMV  427

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+A+ C   YP+ RPSM+ V  +I++
Sbjct  428   QLLQLAVDCVVPYPDNRPSMSQVRQRIEE  456



>ref|XP_004490822.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cicer 
arietinum]
Length=620

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 190/271 (70%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    +VAVKRLK       EF E++ E+GK+ HENL+PLR
Sbjct  343   RASAEVLGKGTFGTTYKATLEMGMSVAVKRLKDVTAMEREFREKIEEVGKLVHENLVPLR  402

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
              Y +N  E L+VYD+M MGSL+  LH N G  +  LNWE R+SIA G A+ I  LH+QG 
Sbjct  403   GYYFNKDEKLIVYDYMPMGSLSALLHANNGTGRTPLNWETRSSIALGAAHGIAYLHSQGP  462

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E RVS+F L  L  P +  + VSGYRAPEVT   +VS ++DV
Sbjct  463   TSSHGNIKSSNILLTKSFEPRVSDFGLAYLALPTATPNRVSGYRAPEVTDARKVSQKADV  522

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG++LLELLTGKAP  +    +GVDLP WV+++ +++   +VFD  L + +   E++V
Sbjct  523   YSFGIMLLELLTGKAPTHSSLNEEGVDLPRWVQSVVQDEWNTEVFDMELLRYQNVEEEMV  582

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
              LLQ+A+ CT QYP+KRPSM  VA++I+K C
Sbjct  583   NLLQLALECTAQYPDKRPSMDVVANRIEKIC  613



>ref|XP_004241646.1| PREDICTED: probable inactive receptor kinase At1g48480 [Solanum 
lycopersicum]
Length=634

 Score =   278 bits (710),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 159/289 (55%), Positives = 205/289 (71%), Gaps = 1/289 (0%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             K KLVFFGD     EL+DLLR++A VLGKGT GT+YK+ L   T VAVKRLK   ++  E
Sbjct  339   KKKLVFFGDYYKAFELEDLLRASAEVLGKGTLGTAYKAVLEIGTIVAVKRLKDVSISESE  398

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
               E++  +G M HENL+ LRAY ++  E LLV+D+M MGSL+  LHG++G  +  LNWE+
Sbjct  399   CKEKIETVGAMNHENLVHLRAYYFSREEKLLVFDYMPMGSLSALLHGSKGAGRTPLNWEI  458

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA G+A  I+ LH+QG  + HGNI+SSNV LT   E RVS+F L  L+ P S    V
Sbjct  459   RSSIALGIARGIEYLHSQGPDVSHGNIKSSNVLLTKSYEARVSDFGLANLVGPPSSPTRV  518

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
              GYRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+ 
Sbjct  519   VGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPSHALLNEEGVDLPRWVQSVVREEW  578

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
               +VFD  L + +   EQ+VQLLQ+A+ CT QYPN RPSMA ++ QI++
Sbjct  579   PSEVFDIELLRYQTAEEQMVQLLQLAMNCTVQYPNNRPSMAEISKQIEE  627



>ref|XP_007036910.1| Receptor-like kinase 1 [Theobroma cacao]
 gb|EOY21411.1| Receptor-like kinase 1 [Theobroma cacao]
Length=659

 Score =   278 bits (711),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 206/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L    AVAVKRLK   ++  EF 
Sbjct  349   KLVFFGNAGRVFDLEDLLRASAEVLGKGTFGTAYKAVLEGGNAVAVKRLKDVTISEREFK  408

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             +R+  +G M H+NL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNW++R+
Sbjct  409   DRIEGVGAMDHQNLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWDIRS  468

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+G
Sbjct  469   GIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSSTPNRVAG  528

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  +    +G+DLP WV+++ RE+   
Sbjct  529   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHSVLNEEGIDLPRWVQSVVREEWTS  588

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+A+ C  QYP++RPSM+ V  +I++
Sbjct  589   EVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDRRPSMSQVTMRIEE  635



>gb|KHG20593.1| putative inactive receptor kinase -like protein [Gossypium arboreum]
Length=606

 Score =   276 bits (707),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 222/338 (66%), Gaps = 10/338 (3%)
 Frame = +2

Query  71    KEIYSKENRPACRNQEQIKAKKSC-ELYNIMAWSPDAIVKS--------KLVFFgdg-dg  220
             K+  ++E  PA   + +I A K+  E  N    +   +VK+        KLVFFG+    
Sbjct  262   KKTETREIAPAKLAEIEIPADKAAGESDNRNGGALSGVVKNDAKSSGNKKLVFFGNAPRV  321

Query  221   yelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTH  400
             ++L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF E++  +G M H
Sbjct  322   FDLEDLLRASAEVLGKGTFGTAYKATLDMGVVVAVKRLKDVVVSEKEFKEKMEVVGAMDH  381

Query  401   ENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQ  580
             +NL+PLRA+ ++  E LLVYD+MS GSL+  LHGN+G  +  LNW+ R+SIA G A  I 
Sbjct  382   QNLVPLRAHYFSADEKLLVYDYMSTGSLSALLHGNKGAGRTPLNWDTRSSIALGAAKGIA  441

Query  581   SLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQ  760
              LH++G  I HGNI+SSN+ LT   E RVS+F L QL  P S  + V GYRAP+VT   +
Sbjct  442   YLHSKGPGISHGNIKSSNILLTTSYEARVSDFGLAQLSGPTSTPNRVDGYRAPDVTDARK  501

Query  761   VSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE  940
             VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + +
Sbjct  502   VSQKADVYSFGVLLLELLTGKAPTHALTNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQ  561

Query  941   QNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
                E +VQLLQ+A  CT QYP+KRP+M  V  QI++ C
Sbjct  562   NVEEDMVQLLQLANNCTAQYPDKRPAMDEVTRQIEELC  599



>ref|XP_003525182.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Glycine 
max]
Length=656

 Score =   278 bits (710),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 203/287 (71%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF 
Sbjct  349   KLVFFGNAARAFDLEDLLRASAEVLGKGTFGTAYKAVLEAGPVVAVKRLKDVTISEKEFK  408

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HE+L+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWEVR+
Sbjct  409   EKIEAVGAMDHESLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEVRS  468

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH++G  + HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+G
Sbjct  469   GIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSSTPNRVAG  528

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS  +DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  529   YRAPEVTDPRKVSQMADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTS  588

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+A+ C  QYP+KRPSM+ V   I++
Sbjct  589   EVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIQE  635



>ref|XP_009778793.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nicotiana 
sylvestris]
Length=686

 Score =   278 bits (711),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 156/287 (54%), Positives = 204/287 (71%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFGD     +L+DLL+++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  380   KLVFFGDYYKTFDLEDLLKASAEVLGKGTFGTAYKAVLEMGTIVAVKRLKDVAISEKEFR  439

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+M MGSL+  LHG++G  +  LNWE+R+
Sbjct  440   EKIETVGAMNHENLVPLRAYYYSGEEKLLVYDYMPMGSLSALLHGSKGAGRTPLNWEIRS  499

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
             SIA  +A  I  LH+QG  + H NI+SSNV LT   E RVS+F L  L+ P S    V+G
Sbjct  500   SIALQIAQGIDYLHSQGPNVSHANIKSSNVLLTKSYEARVSDFGLANLVGPPSSPTRVAG  559

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV ++ RE+   
Sbjct  560   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVESVVREEWPS  619

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI CT QYP+ RPSM+ V+ +I++
Sbjct  620   EVFDIELLRYQTAEEEMVQLLQLAIDCTAQYPDNRPSMSEVSKRIEE  666



>ref|XP_007032119.1| Receptor-like kinase 1 [Theobroma cacao]
 gb|EOY03045.1| Receptor-like kinase 1 [Theobroma cacao]
Length=642

 Score =   277 bits (709),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 187/271 (69%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF E++  +G M H+NL+ LR
Sbjct  337   RASAEVLGKGTFGTAYKATLEMGMIVAVKRLKDVTVSEKEFKEKMEVVGAMDHQNLVSLR  396

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN G  +  LNW+ R+ IA G A  I  LH++G+
Sbjct  397   AYYFSGDEKLLVYDYMPMGSLSALLHGNRGAGRTPLNWDTRSGIALGAARGIAYLHSKGT  456

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              I HGNI+SSN+ LT   E RVS+F L  L  P S  + V GYRAPEVT   +VS ++DV
Sbjct  457   GISHGNIKSSNILLTTSYEARVSDFGLAHLAGPMSTPNRVDGYRAPEVTDARKVSQKADV  516

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG+LLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  517   YSFGILLLELLTGKAPTHALLNEEGVDLPRWVQSIVREEWTAEVFDLELLRYQNVEEDMV  576

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+AI CT QYP+KRPSMA V  QI++ C
Sbjct  577   QLLQLAINCTAQYPDKRPSMAEVTSQIEELC  607



>gb|AET05610.2| LRR receptor-like kinase [Medicago truncatula]
Length=666

 Score =   278 bits (710),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 153/292 (52%), Positives = 206/292 (71%), Gaps = 1/292 (0%)
 Frame = +2

Query  176   AIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLA  352
             A+   KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   + 
Sbjct  353   AVGAKKLVFFGNAARAFDLEDLLRASAEVLGKGTFGTAYKAVLESGPVVAVKRLKDVTIT  412

Query  353   VDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLN  532
               EF E++  +G + H++L+PLRAY ++  E LLVYD+MSMGSL+  LHGN+G  +  LN
Sbjct  413   EKEFREKIEAVGAIDHQSLVPLRAYYFSRDEKLLVYDYMSMGSLSALLHGNKGAGRTPLN  472

Query  533   WEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL  712
             WE+R+ IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L QL+ P S  
Sbjct  473   WEMRSGIALGAAKGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAQLVGPSSTP  532

Query  713   DLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFR  892
             + V+GYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ R
Sbjct  533   NRVAGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVR  592

Query  893   EKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             E+   +VFD  L + +   E++VQLLQ+A+ C  QYP+KRPSM+ V   I++
Sbjct  593   EEWTSEVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIEE  644



>ref|XP_006451587.1| hypothetical protein CICLE_v10007673mg [Citrus clementina]
 gb|ESR64827.1| hypothetical protein CICLE_v10007673mg [Citrus clementina]
Length=591

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 206/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  282   KLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTIVAVKRLKDVTISEREFK  341

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             +++  +G + HENL+PLRAY ++  E LLVYD+++MGSL+  LHGN+G  +  LNWE+R+
Sbjct  342   DKIEGVGAVNHENLVPLRAYYYSMDEKLLVYDYLTMGSLSALLHGNKGAGRTPLNWEMRS  401

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH QG  + HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+G
Sbjct  402   LIALGAARGIEYLHTQGPNVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVAG  461

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ +++   
Sbjct  462   YRAPEVTDPCKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVKDEWTS  521

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI C+ QYP+ RPSM+ V  +I++
Sbjct  522   EVFDLELLRYQNVEEEMVQLLQLAIDCSAQYPDNRPSMSEVIKRIEE  568



>ref|XP_004299514.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Fragaria 
vesca subsp. vesca]
Length=653

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 192/269 (71%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L   T VAVKRLK   +   EF E++  +G M HE+L+PLR
Sbjct  362   RASAEVLGKGTFGTAYKAVLEAGTVVAVKRLKDVTITEKEFKEKIESVGAMDHESLVPLR  421

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+ IA G A  I+ LH+QG 
Sbjct  422   AYYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRSGIALGAARGIEYLHSQGP  481

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              + HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  482   NVSHGNIKSSNILLTKSYEGRVSDFGLAHLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  541

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGK P  A    +GVDLP WV+++ +E+   +VFD  L + +   E++V
Sbjct  542   YSFGVLLLELLTGKPPTHALLNEEGVDLPRWVQSIVKEEWTSEVFDLELLRYQNVEEEMV  601

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+AI C+ QYP+KRPS++ V  +I++
Sbjct  602   QLLQLAIDCSEQYPDKRPSISEVTRRIEE  630



>ref|XP_003631134.1| Atypical receptor-like kinase MARK [Medicago truncatula]
Length=706

 Score =   278 bits (711),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/292 (52%), Positives = 206/292 (71%), Gaps = 1/292 (0%)
 Frame = +2

Query  176   AIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLA  352
             A+   KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   + 
Sbjct  393   AVGAKKLVFFGNAARAFDLEDLLRASAEVLGKGTFGTAYKAVLESGPVVAVKRLKDVTIT  452

Query  353   VDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLN  532
               EF E++  +G + H++L+PLRAY ++  E LLVYD+MSMGSL+  LHGN+G  +  LN
Sbjct  453   EKEFREKIEAVGAIDHQSLVPLRAYYFSRDEKLLVYDYMSMGSLSALLHGNKGAGRTPLN  512

Query  533   WEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL  712
             WE+R+ IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L QL+ P S  
Sbjct  513   WEMRSGIALGAAKGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAQLVGPSSTP  572

Query  713   DLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFR  892
             + V+GYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ R
Sbjct  573   NRVAGYRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVR  632

Query  893   EKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             E+   +VFD  L + +   E++VQLLQ+A+ C  QYP+KRPSM+ V   I++
Sbjct  633   EEWTSEVFDLELLRYQNVEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIEE  684



>ref|XP_011085845.1| PREDICTED: probable inactive receptor kinase At1g48480 [Sesamum 
indicum]
Length=651

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 192/271 (71%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    AVAVKRL+   L   E  E+V E+GKM HENL+PLR
Sbjct  353   RASAEVLGKGTFGTTYKAVLETGLAVAVKRLRDVNLGEKELREKVEEIGKMNHENLVPLR  412

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             A+  N  E LLVYD++ MGSL+  LHGN G  +  LNWE R +IA G A  I  LH+QGS
Sbjct  413   AHHCNRDEKLLVYDYLPMGSLSALLHGNNGVGRTPLNWETRATIALGAARGITYLHSQGS  472

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   E RVS+F L +L    +    ++GY+APEVT+PH+VS ++DV
Sbjct  473   SVSHGNIKSSNILLTRSYEARVSDFGLARLAGTAATPTRLAGYQAPEVTNPHKVSQKADV  532

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLE+LTGKAP  + +  +GVDLP WV+++  ++   +VFD  L + +   E +V
Sbjct  533   YSFGVLLLEMLTGKAPTHSLSNEEGVDLPRWVKSVVGDEWTSEVFDLELLRYQNVEEDMV  592

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+A+ CT QYP+KRPSMA V  +I++ C
Sbjct  593   QLLQLAVDCTEQYPDKRPSMAQVTTKIEELC  623



>gb|KDO62795.1| hypothetical protein CISIN_1g006055mg [Citrus sinensis]
Length=663

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 207/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  354   KLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTIVAVKRLKDVTISEREFK  413

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             +++  +G + HENL+PLRAY ++  E LLVYD+++MGSL+  LHGN+G  +  LNWE+R+
Sbjct  414   DKIEGVGAVNHENLVPLRAYYYSMDEKLLVYDYLTMGSLSALLHGNKGAGRTPLNWEMRS  473

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LHAQG  + HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+G
Sbjct  474   LIALGAARGIEYLHAQGPNVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVAG  533

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ +++   
Sbjct  534   YRAPEVTDPCKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVKDEWTS  593

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI C+ QYP+ RPSM+ V  +I++
Sbjct  594   EVFDLELLRYQNVEEEMVQLLQLAIDCSAQYPDNRPSMSEVIKRIEE  640



>gb|KDP25788.1| hypothetical protein JCGZ_22510 [Jatropha curcas]
Length=647

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 185/271 (68%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L     VAVKRLK   +   EF E++  +G + HENL+PLR
Sbjct  344   RASAEVLGKGTFGTTYKATLEMGIVVAVKRLKDVTVTEKEFREKIGSVGNINHENLVPLR  403

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY +N  E LLVYD+M MGSL+  LHGN G  +  LNWE R+ IA G A  I  LH+QG 
Sbjct  404   AYYYNKDEKLLVYDYMPMGSLSALLHGNRGAGRTPLNWETRSGIALGAARGIAHLHSQGF  463

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E RVS+F L  L  P    + V GYRAPEVT   +VS ++DV
Sbjct  464   TNSHGNIKSSNILLTTSFEARVSDFGLAHLAGPTPTPNRVDGYRAPEVTDARKVSPKADV  523

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG+LLLELLTGKAP  +    +GVDLP WV+++ +++   +VFD  L + +   E +V
Sbjct  524   YSFGILLLELLTGKAPTHSHLNEEGVDLPRWVQSVVKDEWTTEVFDLELLRYQNVEEDMV  583

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+AI CT QYP+ RPSMA V +QI++ C
Sbjct  584   QLLQLAINCTAQYPDNRPSMAEVRNQIEEIC  614



>ref|XP_007160555.1| hypothetical protein PHAVU_002G331400g [Phaseolus vulgaris]
 gb|ESW32549.1| hypothetical protein PHAVU_002G331400g [Phaseolus vulgaris]
Length=658

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 203/287 (71%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF 
Sbjct  347   KLVFFGNAAKAFDLEDLLRASAEVLGKGTFGTAYKAVLEAGPVVAVKRLKDVTISEKEFK  406

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HE+L+PLRA+ ++  E LLVYD+M MGSL+  LHGN+G  +  LNWEVR+
Sbjct  407   EKIEAVGAMDHESLVPLRAFYFSRDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEVRS  466

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH++G  + HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+G
Sbjct  467   GIALGAARGIEYLHSRGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSSTPNRVAG  526

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  527   YRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTS  586

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L +     E++VQLLQ+A+ C  QYP+KRPSM+ V   I++
Sbjct  587   EVFDLELLRYRNVEEEMVQLLQLAVDCAAQYPDKRPSMSEVVRSIEE  633



>gb|KDO50809.1| hypothetical protein CISIN_1g037905mg, partial [Citrus sinensis]
Length=606

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 189/271 (70%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF E++  +G M HENL+PLR
Sbjct  319   RASAEVLGKGTFGTAYKATLEMGIVVAVKRLKDVTVSEKEFREKMEVVGSMDHENLVPLR  378

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+D+M MGSL+  LHGN G  +  LNWE R+ +A G + AI  LH++G 
Sbjct  379   AYYYSRDEKLLVHDYMPMGSLSALLHGNRGAGRTPLNWETRSGLALGASRAIAYLHSKGP  438

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
                HGNI+SSN+ L+   E R+S+F L  L SP S  + + GYRAPEVT   +VS ++DV
Sbjct  439   ANSHGNIKSSNILLSKSYEARISDFGLAHLASPSSTPNRIDGYRAPEVTDARKVSQKADV  498

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP +A    +GVDLP WV+++ +E+   +VFD  L + +   E++V
Sbjct  499   YSFGVLLLELLTGKAPTQALLNEEGVDLPRWVQSVVKEEWTAEVFDLELLRYQNVEEEMV  558

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+AI CT QYP+ RPSMA V  QI++ C
Sbjct  559   QLLQLAINCTAQYPDNRPSMAEVTSQIEEIC  589



>ref|XP_006826909.1| hypothetical protein AMTR_s00010p00158940 [Amborella trichopoda]
 gb|ERM94146.1| hypothetical protein AMTR_s00010p00158940 [Amborella trichopoda]
Length=651

 Score =   276 bits (706),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 205/296 (69%), Gaps = 3/296 (1%)
 Frame = +2

Query  170   PDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGC  346
             P+     KLVFF       +L++LLR++A VLGKG+FGT+YK+ L   T VAVKRLK   
Sbjct  325   PEISGGKKLVFFPGAQRTFDLEELLRASAEVLGKGSFGTAYKAVLEMGTVVAVKRLKDVV  384

Query  347   LAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKAS  526
             +   E+ +++ ++G MTHENL+PLRAY ++  E LLVYD+M MGSL+  LHGN G  +  
Sbjct  385   IGHREYAQQIEKVGSMTHENLVPLRAYYFSKDEKLLVYDYMPMGSLSALLHGNRGAGRTP  444

Query  527   LNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDS  706
             LNWE R+ IA G A AI+ LH+QGST+ HGNI+SSN+ LT   E RVS+F L QL+S  +
Sbjct  445   LNWETRSGIALGAARAIEYLHSQGSTVSHGNIKSSNILLTKDYEARVSDFGLAQLVSSSA  504

Query  707   K--LDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVR  880
                 + V GYRAPEVT  H++S ++DVYSFGVLLLELLTGK P  +    +GVDLP WV+
Sbjct  505   SPTANRVIGYRAPEVTDAHKISQKADVYSFGVLLLELLTGKPPSHSLTNEEGVDLPRWVQ  564

Query  881   AMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++ RE+   +VFD  L + +   E +VQLLQ+A+ C  QYP++RPSM  V  +I++
Sbjct  565   SVVREEWTAEVFDLELLRYQNVEEDMVQLLQLAMDCAAQYPDQRPSMREVVQRIEE  620



>ref|XP_006482115.1| PREDICTED: probable inactive receptor kinase RLK902-like [Citrus 
sinensis]
Length=632

 Score =   275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 189/271 (70%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF E++  +G M HENL+PLR
Sbjct  345   RASAEVLGKGTFGTAYKATLEMGIVVAVKRLKDVTVSEKEFREKMEVVGSMDHENLVPLR  404

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+D+M MGSL+  LHGN G  +  LNWE R+ +A G + AI  LH++G 
Sbjct  405   AYYYSRDEKLLVHDYMPMGSLSALLHGNRGAGRTPLNWETRSGLALGASRAIAYLHSKGP  464

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
                HGNI+SSN+ L+   E R+S+F L  L SP S  + + GYRAPEVT   +VS ++DV
Sbjct  465   ANSHGNIKSSNILLSKSYEARISDFGLAHLASPSSTPNRIDGYRAPEVTDARKVSQKADV  524

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP +A    +GVDLP WV+++ +E+   +VFD  L + +   E++V
Sbjct  525   YSFGVLLLELLTGKAPTQALLNEEGVDLPRWVQSVVKEEWTAEVFDLELLRYQNVEEEMV  584

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+AI CT QYP+ RPSMA V  QI++ C
Sbjct  585   QLLQLAINCTAQYPDNRPSMAEVTSQIEEIC  615



>ref|XP_006430596.1| hypothetical protein CICLE_v10011289mg [Citrus clementina]
 gb|ESR43836.1| hypothetical protein CICLE_v10011289mg [Citrus clementina]
Length=628

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 189/271 (70%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L     VAVKRLK   ++  EF E++  +G M HENL+PLR
Sbjct  341   RASAEVLGKGTFGTAYKATLEMGIVVAVKRLKDVTVSEKEFREKMEVVGSMDHENLVPLR  400

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+D+M MGSL+  LHGN G  +  LNWE R+ +A G + AI  LH++G 
Sbjct  401   AYYYSRDEKLLVHDYMPMGSLSALLHGNRGAGRTPLNWETRSGLALGASRAIAYLHSKGP  460

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
                HGNI+SSN+ L+   E RVS+F L  L SP S  + + GYRAPEVT   +VS ++DV
Sbjct  461   ANSHGNIKSSNILLSKSYEARVSDFGLAHLASPSSTPNRIDGYRAPEVTDARKVSQKADV  520

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP +A    +GVDLP WV+++ +E+   +VFD  L + +   E++V
Sbjct  521   YSFGVLLLELLTGKAPTQALLNEEGVDLPRWVQSVVKEEWTAEVFDLELLRYQNVEEEMV  580

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+AI CT QYP+ RPSMA V  QI++ C
Sbjct  581   QLLQLAINCTAQYPDNRPSMAEVTSQIEEIC  611



>ref|XP_008343258.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=625

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 207/303 (68%), Gaps = 6/303 (2%)
 Frame = +2

Query  167   SPDAIVKS-----KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVK  328
             +P   VKS      LVFFGD     +L+DLLR++A VLGKGTFGT+YK+ L  + ++AVK
Sbjct  301   APKGTVKSGDGNKSLVFFGDAVRVFDLEDLLRASAEVLGKGTFGTTYKAALDMRVSMAVK  360

Query  329   RLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNE  508
             RLK   ++  EF E++ E+G+M H NL+PLRAY ++  E LLVYD+M MGSL+  LHG  
Sbjct  361   RLKEVAVSEKEFREKIEEIGRMDHVNLVPLRAYYYSRDEKLLVYDYMPMGSLSALLHGAR  420

Query  509   GKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQ  688
             G  +  L WE R+ IA G A AI  LH+QG T  HGNI+SSN+ LT   E  VS+FCL  
Sbjct  421   GSGRTPLIWETRSGIAVGAARAITYLHSQGPTTSHGNIKSSNILLTRSYEACVSDFCLAH  480

Query  689   LLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLP  868
             L SP S  +L+SGYRAPE+    +V+ ++DVYSFGVLLLELLTGK P +A    +GVDLP
Sbjct  481   LASPTSTPNLISGYRAPELXDTSKVTQKADVYSFGVLLLELLTGKPPTQAIMNDEGVDLP  540

Query  869   NWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              WVR++ +E+   +VFDS L + +   E +VQLLQ+A+ CT  YP+ RPSM+ V  +I++
Sbjct  541   RWVRSVVQEEWTAEVFDSELLRYQNVEEDMVQLLQIALECTVTYPDSRPSMSEVTSRIQE  600

Query  1049  TCS  1057
               S
Sbjct  601   LYS  603



>gb|EYU24506.1| hypothetical protein MIMGU_mgv1a0087053mg, partial [Erythranthe 
guttata]
Length=315

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/287 (52%), Positives = 199/287 (69%), Gaps = 2/287 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L++LLR++A VLGKGTFGT+YK+ L     VAVKRLK   L+  +F 
Sbjct  21    KLVFFGNAPRVFDLEELLRASAEVLGKGTFGTAYKAVLEVGIVVAVKRLKDVALSDKDFK  80

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  81    EKIESVGAMDHENLVPLRAYYYSREEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWELRS  140

Query  548   SIAYGVANAIQSLHAQ-GSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVS  724
              IA G A  I+ LH Q G    HGNI+SSN+ LT     +VS+F L  L+ P S    V+
Sbjct  141   EIALGSARGIEYLHLQNGPHFSHGNIKSSNILLTKSNSPKVSDFGLNHLVGPPSSPTRVA  200

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+  
Sbjct  201   GYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHAILNEEGVDLPRWVQSVVREEWT  260

Query  905   CDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFD  L +     E++V++LQ+ I CT QYP++RP+++ V  +I+
Sbjct  261   AEVFDLELLRDPNMEEEMVEMLQLGIDCTAQYPDQRPTISDVVRRIE  307



>ref|XP_010105639.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC05427.1| putative inactive receptor kinase [Morus notabilis]
Length=639

 Score =   275 bits (703),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/272 (53%), Positives = 192/272 (71%), Gaps = 3/272 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    +VAVKRLK G     EF ER+ ++G+M HENL+PLR
Sbjct  331   RASAEVLGKGTFGTTYKASLEMGISVAVKRLKEGTAPEKEFRERMEQVGRMDHENLVPLR  390

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD++ MGSL+  LHG+ G  +  LNWE R+ IA G A  I  LH+ GS
Sbjct  391   AYYYSRDEKLLVYDYLPMGSLSALLHGSNGAGRTPLNWETRSGIALGAARGIAYLHSHGS  450

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLD-LVSGYRAPEVTSPHQVSHQSD  778
             +  HGNI+SSN+ LT   E RVS+F L  L +PD   +  V+GYRAPEVT PH+VS ++D
Sbjct  451   S--HGNIKSSNILLTRSYEARVSDFGLAHLANPDPTPNHRVAGYRAPEVTDPHKVSPKAD  508

Query  779   VYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveql  958
             VYSFGVLLLELLTGK P  +    +GVDLP WV+++ RE+   +VFD  L + +   +++
Sbjct  509   VYSFGVLLLELLTGKPPTHSQLNDEGVDLPRWVQSVVREEWTVEVFDLELLRYQNVEDEM  568

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             V+LLQ+A+ CT QYP+KRP MA V  +I++ C
Sbjct  569   VELLQLALDCTVQYPDKRPPMAVVTRRIEELC  600



>ref|XP_008353859.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=626

 Score =   275 bits (702),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 156/303 (51%), Positives = 207/303 (68%), Gaps = 6/303 (2%)
 Frame = +2

Query  167   SPDAIVKS-----KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVK  328
             +P   VKS      LVFFGD     +L+DLLR++A VLGKGTFGT+YK+ L  + ++AVK
Sbjct  302   APKGTVKSGDGNKSLVFFGDAVRVFDLEDLLRASAEVLGKGTFGTTYKAALDMRVSMAVK  361

Query  329   RLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNE  508
             RLK   ++  EF E++ E+G+M H NL+PLRAY ++  E LLVYD+M MGSL+  LHG  
Sbjct  362   RLKEVAVSEKEFREKIEEIGRMDHVNLVPLRAYYYSRDEKLLVYDYMPMGSLSALLHGAR  421

Query  509   GKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQ  688
             G  +  L WE R+ IA G A AI  LH+QG T  HGNI+SSN+ LT   E  VS+FCL  
Sbjct  422   GSGRTPLIWETRSGIAVGAARAITYLHSQGPTTSHGNIKSSNILLTRSYEACVSDFCLAH  481

Query  689   LLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLP  868
             L SP S  +L+SGYRAPE+    +V+ ++DVYSFGVLLLELLTGK P +A    +GVDLP
Sbjct  482   LASPTSTPNLISGYRAPELXDTSKVTQKADVYSFGVLLLELLTGKPPTQAIMNDEGVDLP  541

Query  869   NWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              WVR++ +E+   +VFDS L + +   E +VQLLQ+A+ CT  YP+ RPSM+ V  +I++
Sbjct  542   RWVRSVVQEEWTAEVFDSELLRYQNVEEDMVQLLQIALECTVTYPDSRPSMSEVTSRIQE  601

Query  1049  TCS  1057
               S
Sbjct  602   LYS  604



>ref|XP_006451586.1| hypothetical protein CICLE_v10007673mg [Citrus clementina]
 ref|XP_006490800.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Citrus 
sinensis]
 gb|ESR64826.1| hypothetical protein CICLE_v10007673mg [Citrus clementina]
Length=663

 Score =   275 bits (704),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 206/287 (72%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  354   KLVFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTIVAVKRLKDVTISEREFK  413

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             +++  +G + HENL+PLRAY ++  E LLVYD+++MGSL+  LHGN+G  +  LNWE+R+
Sbjct  414   DKIEGVGAVNHENLVPLRAYYYSMDEKLLVYDYLTMGSLSALLHGNKGAGRTPLNWEMRS  473

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH QG  + HGNI+SSN+ LT   E RVS+F L  L+ P S  + V+G
Sbjct  474   LIALGAARGIEYLHTQGPNVSHGNIKSSNILLTKSYEARVSDFGLAHLVGPSSTPNRVAG  533

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ +++   
Sbjct  534   YRAPEVTDPCKVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSIVKDEWTS  593

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI C+ QYP+ RPSM+ V  +I++
Sbjct  594   EVFDLELLRYQNVEEEMVQLLQLAIDCSAQYPDNRPSMSEVIKRIEE  640



>gb|EPS69043.1| hypothetical protein M569_05720, partial [Genlisea aurea]
Length=614

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 187/271 (69%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    +VAVKRLK       EF  R+ E+GK+ HENL+ LR
Sbjct  330   RASAEVLGKGTFGTTYKAVLETGFSVAVKRLKDVKHGEKEFKSRMEEIGKLHHENLVSLR  389

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY +N  E LLVYD++ +GSL+  LHGN+G  +  LNWE R +IA G A  I  LH+QGS
Sbjct  390   AYYYNNDEKLLVYDYLPLGSLSALLHGNKGAGRTPLNWETRAAIALGAARGISYLHSQGS  449

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   E RVS+F L QL +P +    V+GYRAPEVT P +VS  +DV
Sbjct  450   SVSHGNIKSSNILLTKSYEARVSDFGLAQLATPTTGTARVAGYRAPEVTDPQKVSQNADV  509

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLT KAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  510   YSFGVLLLELLTAKAPTNSVLNEEGVDLPRWVQSVVREEWAAEVFDVELLRYQSVEEDMV  569

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLL++A+ CT Q+P+ RPSM  V  +I+  C
Sbjct  570   QLLELAVDCTAQHPDNRPSMEVVTTKIEDLC  600



>ref|XP_004503256.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cicer 
arietinum]
Length=758

 Score =   277 bits (709),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 203/287 (71%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   +   EF 
Sbjct  450   KLVFFGNAARAFDLEDLLRASAEVLGKGTFGTAYKAVLESGPVVAVKRLKDVTITEKEFR  509

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G + H++L+PLRAY ++  E LLVYD+MSMGSL+  LHGN+G  +  LNWE+R+
Sbjct  510   EKIEAVGAIDHQSLVPLRAYYFSRDEKLLVYDYMSMGSLSALLHGNKGAGRTPLNWEMRS  569

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I  LH+QG  + HGNI+SSN+ LT   E RVS+F L QL+ P S  + V+G
Sbjct  570   GIALGAARGIDYLHSQGPNVSHGNIKSSNILLTKSYEARVSDFGLAQLVGPSSTPNRVAG  629

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   
Sbjct  630   YRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTS  689

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+A+ C   YP+KRPSM+ V   I++
Sbjct  690   EVFDLELLRYQNVEEEMVQLLQLAVDCAAPYPDKRPSMSDVVRNIEE  736



>ref|XP_010268752.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nelumbo 
nucifera]
Length=677

 Score =   275 bits (704),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 201/286 (70%), Gaps = 1/286 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KL+FFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  350   KLIFFGNAARVFDLEDLLRASAEVLGKGTFGTAYKAILEVGTTVAVKRLKDVTISEREFR  409

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M  GSL+  LHGN G  +  LNWE R+
Sbjct  410   EKIEAVGSMNHENLVPLRAYYYSRDEKLLVYDFMPNGSLSALLHGNRGAGRTPLNWETRS  469

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH+QGST+ HGNI+SSN+ LT   + RVS+F L QL+ P +  + V+G
Sbjct  470   GIALGAARGIEYLHSQGSTVSHGNIKSSNILLTKSYDARVSDFGLAQLVGPTATPNRVAG  529

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEV    +VS ++DVYSFGVLLLELLTGK P  A    +GVDLP WV+++ R++   
Sbjct  530   YRAPEVIDARKVSQKADVYSFGVLLLELLTGKPPTHAILNEEGVDLPRWVQSVVRDEWTS  589

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
             +VFD  L + +   E++VQLLQ+AI C  QYP+KRPSMA V  +I+
Sbjct  590   EVFDLELLRYQTVEEEMVQLLQLAIDCCAQYPDKRPSMAEVTRRIE  635



>ref|XP_010036979.1| PREDICTED: probable inactive receptor kinase At1g48480 [Eucalyptus 
grandis]
 gb|KCW48615.1| hypothetical protein EUGRSUZ_K02280 [Eucalyptus grandis]
Length=666

 Score =   273 bits (698),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 202/287 (70%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG      +L+DLLR++A VLGKGTFGTSYK+ L     VAVKRLK   +AV EF 
Sbjct  355   KLVFFGKMARAFDLEDLLRASAEVLGKGTFGTSYKAVLEMGNMVAVKRLKDVNIAVGEFK  414

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRA+ ++  E LLVYD+M MGSL+  LHGN G  +  LNWE+R+
Sbjct  415   EKIEAVGAMNHENLVPLRAFYYSNDEKLLVYDYMPMGSLSALLHGNRGAGRTPLNWELRS  474

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
             SIA GVA  I+ LH+QG  + HGNI+SSNV LT     R+S+F L  ++ P      ++G
Sbjct  475   SIALGVARGIEYLHSQGHHVSHGNIKSSNVLLTKSHNARLSDFGLAHIVGPSVVPTRLAG  534

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  +    +G+DLP WV+++ RE+   
Sbjct  535   YRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPANSVLNEEGIDLPRWVQSVVREEWSS  594

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++V+LLQ+A+ C  QYP++RPSM  V  +I++
Sbjct  595   EVFDLELLRYQNAEEEMVELLQLAMDCAAQYPDQRPSMPDVRRRIEE  641



>emb|CBI33513.3| unnamed protein product [Vitis vinifera]
Length=620

 Score =   272 bits (695),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/274 (52%), Positives = 189/274 (69%), Gaps = 3/274 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELP---EKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLL  412
             R++A VLGKGTFGT+YK+ L    E+  VAVKRLK   ++  EF E++   G M HENL+
Sbjct  315   RASAEVLGKGTFGTAYKASLDMEVERVVVAVKRLKDVSVSEKEFREKIEIAGAMDHENLV  374

Query  413   PLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHA  592
             PLRAY ++  E L+VYD+M MGSL+  LHGN G  +  LNWE R+ IA G A  I  +H+
Sbjct  375   PLRAYYYSKDEKLIVYDYMPMGSLSALLHGNRGAGRTPLNWEARSGIALGAARGIAYIHS  434

Query  593   QGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQ  772
             +GS   HGNI+SSN+ LT   E RVS+F L  L+ P +  + V+GYRAPEVT   +VS +
Sbjct  435   RGSASSHGNIKSSNILLTKSYEARVSDFGLAHLVGPTATPNRVAGYRAPEVTDARKVSQK  494

Query  773   SDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNve  952
             +DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + +   E
Sbjct  495   ADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEE  554

Query  953   qlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             ++VQLLQ+A+ C  QYP+KRPSM  V  +I++ C
Sbjct  555   EMVQLLQLALDCAAQYPDKRPSMLDVTSRIEELC  588



>ref|XP_002276147.1| PREDICTED: probable inactive receptor kinase At1g48480 [Vitis 
vinifera]
Length=639

 Score =   272 bits (696),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 143/274 (52%), Positives = 189/274 (69%), Gaps = 3/274 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELP---EKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLL  412
             R++A VLGKGTFGT+YK+ L    E+  VAVKRLK   ++  EF E++   G M HENL+
Sbjct  334   RASAEVLGKGTFGTAYKASLDMEVERVVVAVKRLKDVSVSEKEFREKIEIAGAMDHENLV  393

Query  413   PLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHA  592
             PLRAY ++  E L+VYD+M MGSL+  LHGN G  +  LNWE R+ IA G A  I  +H+
Sbjct  394   PLRAYYYSKDEKLIVYDYMPMGSLSALLHGNRGAGRTPLNWEARSGIALGAARGIAYIHS  453

Query  593   QGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQ  772
             +GS   HGNI+SSN+ LT   E RVS+F L  L+ P +  + V+GYRAPEVT   +VS +
Sbjct  454   RGSASSHGNIKSSNILLTKSYEARVSDFGLAHLVGPTATPNRVAGYRAPEVTDARKVSQK  513

Query  773   SDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNve  952
             +DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + +   E
Sbjct  514   ADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEE  573

Query  953   qlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             ++VQLLQ+A+ C  QYP+KRPSM  V  +I++ C
Sbjct  574   EMVQLLQLALDCAAQYPDKRPSMLDVTSRIEELC  607



>ref|XP_006372561.1| hypothetical protein POPTR_0017s02820g [Populus trichocarpa]
 gb|ERP50358.1| hypothetical protein POPTR_0017s02820g [Populus trichocarpa]
Length=547

 Score =   270 bits (690),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 206/318 (65%), Gaps = 9/318 (3%)
 Frame = +2

Query  128   AKKSCELYNIMAWSPDAIVKSK--------LVFFgdgdgy-elddllRSTAGVLGKGTFG  280
              K + E  N+ A    A+VKS+        LVFFG+      L+DLL+++A VLGKGTFG
Sbjct  215   GKAAGEGGNVSAGHAVAVVKSEAKSSGTKNLVFFGNTARAFGLEDLLKASAEVLGKGTFG  274

Query  281   TSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVY  460
             T+YK+ L     VAVKRLK   +   EF E++   GKM HENL+PLRAY ++  E LLV+
Sbjct  275   TAYKATLDVGLVVAVKRLKEVTVPEKEFREKIEGAGKMNHENLVPLRAYYYSQDEKLLVH  334

Query  461   DHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVF  640
             D+M MGSL+  LHGN+G  +  LNWE R+ IA G A  I  +H+QG    HGNI+SSN+ 
Sbjct  335   DYMPMGSLSALLHGNKGSGRTPLNWETRSGIALGAARGIAYIHSQGPASSHGNIKSSNIL  394

Query  641   LTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTG  820
             LT  LE RVS+F L  L       + + GYRAPEVT   +VS ++DVYSFG+LLLELLTG
Sbjct  395   LTTSLEARVSDFGLAHLAGLTPTPNRIDGYRAPEVTDARKVSQKADVYSFGILLLELLTG  454

Query  821   KAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQY  1000
             KAP  +    +GVDLP WV+++ +E+   +VFD  L + +   E +VQLLQ+AI CT QY
Sbjct  455   KAPTHSQLNDEGVDLPRWVQSVVKEEWTAEVFDLELLRYQTVEEDMVQLLQLAIDCTAQY  514

Query  1001  PNKRPSMAAVADQIKKTC  1054
             P+ RPSM+ V  QI+  C
Sbjct  515   PDNRPSMSKVRSQIEDLC  532



>ref|XP_007152668.1| hypothetical protein PHAVU_004G149100g [Phaseolus vulgaris]
 gb|ESW24662.1| hypothetical protein PHAVU_004G149100g [Phaseolus vulgaris]
Length=673

 Score =   273 bits (698),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 193/269 (72%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L +   VAVKRL+   ++  EF E++  +G M HENL+PLR
Sbjct  376   RASAEVLGKGTFGTTYKAVLEDGPVVAVKRLRDVTVSEKEFKEKIDAVGVMDHENLVPLR  435

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+D+M MGSL+  LHGN+G  +  LNWE+R+ IA G A  I+ LH+QG 
Sbjct  436   AYYYSRDEKLLVHDYMPMGSLSAILHGNKGAGRTPLNWEMRSEIAIGAARGIEYLHSQGP  495

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   + RVS+F L  L+ P S  + V+GYRAPEVT P +VS ++DV
Sbjct  496   SVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSSTPNRVAGYRAPEVTDPRKVSQKADV  555

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + + + E++V
Sbjct  556   YSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWSSEVFDIELLRYQNSEEEMV  615

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+A+ C   YP+ RPS++ V  +I++
Sbjct  616   QLLQLAVDCVVPYPDNRPSISQVRQRIEE  644



>emb|CAN82203.1| hypothetical protein VITISV_018964 [Vitis vinifera]
Length=639

 Score =   272 bits (695),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/274 (52%), Positives = 188/274 (69%), Gaps = 3/274 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELP---EKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLL  412
             R++A VLGKGTFGT+YK+ L    E+  VAVKRLK   ++  EF E++   G M HENL+
Sbjct  334   RASAEVLGKGTFGTAYKASLDMEVERVVVAVKRLKDVSVSEKEFREKIEIAGAMDHENLV  393

Query  413   PLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHA  592
             PLRAY ++  E L+VYD+M MGSL+  LHGN G  +  LNWE R+ IA G A  I  +H+
Sbjct  394   PLRAYYYSKDEKLIVYDYMPMGSLSALLHGNRGAGRTPLNWEARSGIALGAARGIAYIHS  453

Query  593   QGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQ  772
             +GS   HGNI+SSN+ LT   E RVS+F L  L+ P +  + V+GYRAPEVT   +VS +
Sbjct  454   RGSASSHGNIKSSNILLTKSYEARVSDFGLAHLVGPTATPNRVAGYRAPEVTDARKVSQK  513

Query  773   SDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNve  952
             +DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + +   E
Sbjct  514   ADVYSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEE  573

Query  953   qlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             ++ QLLQ+A+ C  QYP+KRPSM  V  +I++ C
Sbjct  574   EMXQLLQLALDCAAQYPDKRPSMLDVTSRIEELC  607



>ref|XP_009370052.1| PREDICTED: probable inactive receptor kinase At1g48480 [Pyrus 
x bretschneideri]
Length=618

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 184/272 (68%), Gaps = 0/272 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    +VAVKRLK   ++  EF E++ E+G+M H NL+PLR
Sbjct  333   RASAEVLGKGTFGTTYKATLEMGVSVAVKRLKEVAVSEKEFREKIEEIGRMDHSNLVPLR  392

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY +   E L VYD+M MGSL+  LHG  G  +  LNWE R+ IA G A AI  LH+ G 
Sbjct  393   AYYYGRDEKLFVYDYMPMGSLSALLHGTRGSGRTPLNWETRSGIAVGAARAITYLHSHGP  452

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E  VS+FCL  L SP S  + +SGYRAPE+T   +V+ ++DV
Sbjct  453   TTSHGNIKSSNILLTRSYEACVSDFCLAHLASPTSTPNRISGYRAPELTDTSKVTQKADV  512

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLE+LTGK+P +     +GVDLP WV ++ RE+   +VFD  L + +   E++V
Sbjct  513   YSFGVLLLEILTGKSPTQTIMNEEGVDLPRWVHSVVREEWTAEVFDFELLRYQNVEEEMV  572

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
             QLL +A+ CT QYP+ RPSM  V  +I +  S
Sbjct  573   QLLHIALECTVQYPDSRPSMGEVTSRIDELYS  604



>ref|XP_003530064.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Glycine 
max]
Length=684

 Score =   273 bits (697),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 193/269 (72%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ + +   VAVKRLK   ++  EF E++  +G M HENL+PLR
Sbjct  387   RASAEVLGKGTFGTTYKAVMEDGPVVAVKRLKDVTVSEKEFKEKIDVVGVMDHENLVPLR  446

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+D+M MGSL+  LHGN+G  +  LNWE+R+SIA G A  I+ LH+QG 
Sbjct  447   AYYYSRDEKLLVHDYMPMGSLSAILHGNKGAGRTPLNWEMRSSIALGAARGIEYLHSQGP  506

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   + RVS+F L  L+   S  + V+GYRAPEVT P +VS ++DV
Sbjct  507   SVSHGNIKSSNILLTKSYDARVSDFGLTHLVGSSSTPNRVAGYRAPEVTDPRKVSQKADV  566

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + + + E++V
Sbjct  567   YSFGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWSSEVFDIELLRYQNSEEEMV  626

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+A+ C   YP+ RPSM+ V  +I++
Sbjct  627   QLLQLAVDCVVPYPDNRPSMSQVRQRIEE  655



>ref|XP_007214953.1| hypothetical protein PRUPE_ppa003172mg [Prunus persica]
 gb|EMJ16152.1| hypothetical protein PRUPE_ppa003172mg [Prunus persica]
Length=596

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 186/272 (68%), Gaps = 0/272 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    ++AVKRLK   ++   F E + E+G M H NL+PLR
Sbjct  291   RASAEVLGKGTFGTTYKAALELGVSMAVKRLKEVTVSEKVFRENIEEIGGMDHVNLVPLR  350

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN G  +  LNWE R+ IA G A AI  LH+ G 
Sbjct  351   AYYYSRDEKLLVYDYMPMGSLSALLHGNRGAGRTPLNWETRSGIAVGAARAITYLHSHGP  410

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             TI HGNI+SSN+ LT   E  VS+FCL  L SP S  + +SGYRAPE+T   +V+ ++DV
Sbjct  411   TISHGNIKSSNILLTRSFEACVSDFCLAHLASPTSTPNRISGYRAPELTDASKVTQKADV  470

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP +A    +GVDLP WV ++ RE+   +VFD  L + +   E +V
Sbjct  471   YSFGVLLLELLTGKAPTQAIMNEEGVDLPRWVHSVVREEWTVEVFDLELLRYQNVEEDMV  530

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
             QLLQ+A+ CT Q+P+ RP M  V  +I++  S
Sbjct  531   QLLQIALECTVQHPDNRPLMGEVTSRIEELYS  562



>gb|EPS62777.1| hypothetical protein M569_12011, partial [Genlisea aurea]
Length=618

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 193/270 (71%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L E + VAVKRLK   L+  EF E++  +G M H+N++PLR
Sbjct  348   RASAEVLGKGTFGTAYKAVLEEGSVVAVKRLKEVNLSDREFKEKIENVGAMDHQNVVPLR  407

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN G     L+W++R +IA G A  I+ LH+QGS
Sbjct  408   AYYFSKEEKLLVYDYMQMGSLSALLHGNRGVGSTPLSWKIRKTIALGAARGIEYLHSQGS  467

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL-VSGYRAPEVTSPHQVSHQSD  778
                HGNI+SSN+ L N  + RVS+F L  L+ P +     V+GYRAPEVT P +VS Q+D
Sbjct  468   NTSHGNIKSSNILLNNSYQPRVSDFGLNHLVGPSTASPARVAGYRAPEVTDPRRVSQQAD  527

Query  779   VYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveql  958
             VYSFGV+LLELLTGKAP ++ A  +GVDLP WV+++ RE+   +VFD  L +     +++
Sbjct  528   VYSFGVILLELLTGKAPTQSLANEEGVDLPRWVQSVVREEWTSEVFDIELLRYNTVEDEM  587

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             VQLLQ+ I CT +YP++RP+++ VA +I++
Sbjct  588   VQLLQLGIDCTVRYPDQRPAISEVAKRIEE  617



>ref|XP_008348609.1| PREDICTED: probable inactive receptor kinase At1g48480 [Malus 
domestica]
Length=618

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 185/272 (68%), Gaps = 0/272 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    +VAVKRLK   ++  EF E++ E+G+M H NL+PLR
Sbjct  333   RASAEVLGKGTFGTTYKATLEMGVSVAVKRLKEVAVSEKEFREKIEEIGRMDHSNLVPLR  392

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L VYD+M MGSL+  LHG  G  +  LNWE R+ IA G A AI  +H+ G 
Sbjct  393   AYYYSRDEKLFVYDYMPMGSLSALLHGTRGSGRTPLNWETRSGIAVGXARAITYIHSHGP  452

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E  VS+FCL  L SP S  + +SGYRAPE+T   +V+ ++DV
Sbjct  453   TTSHGNIKSSNILLTRSYEACVSDFCLAHLASPTSTPNRISGYRAPELTDTSKVTQKADV  512

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLE+LTGK P +     +GVDLP WV ++ RE+   +VFD  L + +   E++V
Sbjct  513   YSFGVLLLEILTGKPPTQTIMNEEGVDLPRWVHSVVREEWTAEVFDFELLRYQNVEEEMV  572

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
             QLLQ+A+ CT QYP+ RPSM  V  +I+   S
Sbjct  573   QLLQIALECTVQYPDSRPSMGEVTSRIEDLYS  604



>gb|KHG17549.1| putative inactive receptor kinase -like protein [Gossypium arboreum]
Length=636

 Score =   269 bits (688),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 181/271 (67%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L     VAVKR+K   +   E   ++  +G M H NL+PLR
Sbjct  344   RASAEVLGKGTFGTTYKATLEMGLVVAVKRIKDVAVPEKELEAKMVAVGAMDHHNLVPLR  403

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN+G  +  LNW+ R+SIA G A  I  LH++G 
Sbjct  404   AYYFSGDEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWDTRSSIALGAARGITYLHSKGP  463

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              I HGNI+SSN+ LT   E RVS+F L Q   P S  + V GYRAPEVT   +VS ++DV
Sbjct  464   LISHGNIKSSNILLTTSYEARVSDFGLAQFAGPTSNPNRVDGYRAPEVTDTRKVSQKADV  523

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG+LLLELLTGKAP        GVDLP WV+++ RE+   +VFD  L +     E +V
Sbjct  524   YSFGILLLELLTGKAPTHTLLNEDGVDLPRWVQSVVREEWTAEVFDLELLRDPNVEEDMV  583

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+AI CT QYP+KRPSMA V   I++ C
Sbjct  584   QLLQLAIDCTAQYPDKRPSMANVTSTIEQLC  614



>ref|XP_010271320.1| PREDICTED: probable inactive receptor kinase RLK902 [Nelumbo 
nucifera]
Length=683

 Score =   269 bits (688),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 187/268 (70%), Gaps = 0/268 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF E++  +G M HENL+PLR
Sbjct  374   RASAEVLGKGTFGTAYKAVLEVGTVVAVKRLKDVSISEREFREKIDAVGSMDHENLVPLR  433

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M  GSL+  LHGN G  +  LNWE R+ IA G A  ++ LH++G 
Sbjct  434   AYYYSKDEKLLVYDYMPNGSLSALLHGNRGSGRTPLNWETRSGIALGAARGVEYLHSKGP  493

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              + HGNI+SSNV L    + RVS+F L Q++ P S  + ++GYRAPEVT   +VS ++DV
Sbjct  494   NVSHGNIKSSNVLLGKSYDARVSDFGLAQIVGPTSTPNRIAGYRAPEVTDGRKVSQKADV  553

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E++V
Sbjct  554   YSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVVREEWTSEVFDLELLRYQNVEEEMV  613

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIK  1045
             QLLQ+AI C  QYP+KRPSM  V  +I+
Sbjct  614   QLLQLAIDCCAQYPDKRPSMPEVTKRIE  641



>gb|ACR38562.1| unknown [Zea mays]
Length=304

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 187/274 (68%), Gaps = 3/274 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKG FGT+YK+ +   +AVAVKRLK   L   EF ER+  +G + HE ++PLR
Sbjct  14    RASAEVLGKGAFGTAYKAVMENGSAVAVKRLKDVDLPEPEFRERIAAIGAVQHELVVPLR  73

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE R++IA   A  +  +H+ G 
Sbjct  74    AYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWETRSAIALAAARGVAHIHSTGP  133

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSNV LT   E RVS+  L  L+ P      VSGYRAPEVT   +VS ++DV
Sbjct  134   TASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRVSGYRAPEVTDIRRVSQKADV  193

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+   +VFD  L + +   E++V
Sbjct  194   YSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEWTAEVFDQELLRYQNVEEEMV  253

Query  962   qllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
             QLLQ+AI C+ Q+P++RP+M+ VA   D+I+++ 
Sbjct  254   QLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSS  287



>ref|XP_008227929.1| PREDICTED: probable inactive receptor kinase At1g48480 [Prunus 
mume]
Length=644

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 185/272 (68%), Gaps = 0/272 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    ++AVKRLK   +    F E++ E+G M H NL+PLR
Sbjct  339   RASAEVLGKGTFGTTYKAALELGVSMAVKRLKEVTVPEKVFREKIEEIGGMDHVNLVPLR  398

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN G  +  LNWE R+ IA G A AI  LH+ G 
Sbjct  399   AYYYSRDEKLLVYDYMPMGSLSALLHGNRGAGRTPLNWETRSGIAVGAARAITYLHSHGP  458

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             TI HGNI+SSN+ LT   E  VS+FCL  L SP S  + +SGYRAPE+T   +V+ ++DV
Sbjct  459   TISHGNIKSSNILLTRSFEACVSDFCLAHLASPTSTPNRISGYRAPELTDASKVTQKADV  518

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP +A    +GVDLP WV ++ +E+   +VFD  L + +   E +V
Sbjct  519   YSFGVLLLELLTGKAPTQAIMNEEGVDLPRWVHSVVQEEWTVEVFDLELLRYQNVEEDMV  578

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
              LLQ+A+ CT Q+P+ RP M  V  +I++  S
Sbjct  579   LLLQIALECTVQHPDNRPLMGEVTSRIEELYS  610



>ref|XP_002305880.1| hypothetical protein POPTR_0004s08450g [Populus trichocarpa]
 gb|EEE86391.1| hypothetical protein POPTR_0004s08450g [Populus trichocarpa]
Length=623

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 215/338 (64%), Gaps = 10/338 (3%)
 Frame = +2

Query  71    KEIYSKENRPACRNQEQIKAKKSCELY-NIMAWSPDAIVKSK--------LVFFgdgdgy  223
             KE+ SK+      ++ +I  +K+     N+ A    A+VKS+        LVFFG+    
Sbjct  271   KEVGSKDVEQPRESEVEIPGEKAAGGSGNVSAGQTGAVVKSEAKSSGTKNLVFFGNAVRA  330

Query  224   -elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTH  400
              +L+DLL+++A VLGKGTFGT+YK+ L     VAVKRLK   +   EF E++  +G M H
Sbjct  331   FDLEDLLKASAEVLGKGTFGTAYKATLDVGMVVAVKRLKEVTVPEKEFREKIEVVGNMNH  390

Query  401   ENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQ  580
             ENL+PLRAY ++  E LLV+D+M MGSL+  LHGN+G  +  LNWE R+ IA G A  I 
Sbjct  391   ENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHGNKGSGRTPLNWETRSGIALGAARGIA  450

Query  581   SLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQ  760
              +H+QG    HGNI+SSN+ LT   E RVS+F L  L  P    + + GYRAPEVT   +
Sbjct  451   YIHSQGPANSHGNIKSSNILLTTSFEARVSDFGLAHLAGPTPTPNRIDGYRAPEVTDARK  510

Query  761   VSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE  940
             VS ++DVYSFG+LLLELLTGKAP       +GVDLP WV+++ RE+   +VFD  L + +
Sbjct  511   VSQKADVYSFGILLLELLTGKAPTHTQLNDEGVDLPRWVQSVVREEWSAEVFDPELLRYQ  570

Query  941   QNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
                E +VQLLQ+A  CT QYP+ RPSM+ V  +++  C
Sbjct  571   TVEEDMVQLLQLASDCTAQYPDNRPSMSEVRSRMEDLC  608



>ref|XP_011001561.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=625

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 205/318 (64%), Gaps = 9/318 (3%)
 Frame = +2

Query  128   AKKSCELYNIMAWSPDAIVKSK--------LVFFgdgdgy-elddllRSTAGVLGKGTFG  280
              K + E  N+ A    A+VKS+        LVFFG+      L+DLL+++A VLGKGTFG
Sbjct  293   GKAAGEGGNVSAGHAVAVVKSEAKSSGAKNLVFFGNTARAFGLEDLLKASAEVLGKGTFG  352

Query  281   TSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVY  460
             T+YK+ L     VAVKRLK   +   EF E++   GKM HENL+PLRAY ++  E  LV+
Sbjct  353   TAYKATLDVGLVVAVKRLKEVMVPEKEFREKIEGAGKMNHENLVPLRAYYYSQDEKFLVH  412

Query  461   DHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVF  640
             D+M MGSL+  LHGN+G  +  LNWE R+ IA G A  I  +H+QG    HGNI+SSN+ 
Sbjct  413   DYMPMGSLSALLHGNKGSGRTPLNWETRSGIALGAARGIAYIHSQGPASSHGNIKSSNIL  472

Query  641   LTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTG  820
             LT  LE RVS+F L  L       + + GYRAPEVT   +VS ++DVYSFG+LLLELLTG
Sbjct  473   LTTSLEARVSDFGLAHLAGLTPAPNRIDGYRAPEVTDARKVSQKADVYSFGILLLELLTG  532

Query  821   KAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQY  1000
             KAP  +    +GVDLP WV+++ +E+   +VFD  L + +   E +VQLLQ+AI CT QY
Sbjct  533   KAPTHSQLNDEGVDLPRWVQSVVKEEWTAEVFDLELLRYQTVEEDMVQLLQLAIDCTAQY  592

Query  1001  PNKRPSMAAVADQIKKTC  1054
             P+ RPSM+ V  QI+  C
Sbjct  593   PDNRPSMSKVRSQIEDLC  610



>ref|XP_010926113.1| PREDICTED: probable inactive receptor kinase At1g48480 [Elaeis 
guineensis]
Length=641

 Score =   267 bits (682),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 187/269 (70%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L   TAVAVKRLK   L   EF E++  +G M H NL+PLR
Sbjct  351   RASAEVLGKGTFGTAYKAVLEMGTAVAVKRLKDVNLPEKEFREKIEAVGAMDHPNLVPLR  410

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+VYD+M MGSL+  LHGN G  +  L+WE R+SIA   A  I+ +H+ G 
Sbjct  411   AYYYSKEEKLIVYDYMPMGSLSALLHGNRGSGRTPLDWETRSSIALAAARGIEYIHSTGP  470

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             +  HGNI+SSN+ LT   E RVS+  L  L+ P      ++GYRAPEVT   +VS ++DV
Sbjct  471   SASHGNIKSSNILLTKSYEARVSDHGLAHLVGPTLTTTRIAGYRAPEVTDAQKVSQKADV  530

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP +AF   +GVDLP WV+++ RE+   +VFD  L + +   EQ+V
Sbjct  531   YSFGVLLLELLTGKAPAQAFLNDEGVDLPRWVQSVVREEWTSEVFDLELLRYQNAEEQMV  590

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+AI C  QYP+KRP+++ V  +I++
Sbjct  591   QLLQLAIDCAAQYPDKRPTISEVVVRIEE  619



>ref|XP_003616273.1| Leucine-rich repeat transmembrane protein [Medicago truncatula]
 gb|AES99231.1| LRR receptor-like kinase [Medicago truncatula]
Length=632

 Score =   266 bits (681),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/271 (51%), Positives = 187/271 (69%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFGT+YK+ L    +VAVKRLK    +  EF E++ E+GK+ HE L+PLR
Sbjct  341   KASAEVLGKGTFGTTYKATLEMGISVAVKRLKDVTASEREFREKIEEVGKLVHEKLVPLR  400

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
              Y ++  E L+VYD+M MGSL+  LH N G  +  LNWE R++IA G A  I  LH+Q  
Sbjct  401   GYYFSKDEKLVVYDYMPMGSLSALLHANNGAGRTPLNWETRSTIALGAAQGIAYLHSQSP  460

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E RVS+F L  L  P +  + VSGYRAPEVT   +VS ++DV
Sbjct  461   TSSHGNIKSSNILLTKSFEPRVSDFGLAYLALPTATPNRVSGYRAPEVTDARKVSQKADV  520

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG++LLELLTGKAP  +    +GVDLP WV+++ +++   +VFD  L + +   E++V
Sbjct  521   YSFGIMLLELLTGKAPTHSSLNEEGVDLPRWVQSIVQDEWNTEVFDMELLRYQSVEEEMV  580

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
              LLQ+A+ CT QYP+KRPSM  VA +I+K C
Sbjct  581   NLLQLALECTTQYPDKRPSMDVVASKIEKIC  611



>gb|EEC74787.1| hypothetical protein OsI_10572 [Oryza sativa Indica Group]
Length=366

 Score =   259 bits (661),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 147/294 (50%), Positives = 199/294 (68%), Gaps = 6/294 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy---elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KL+FFG        +L+DLLR++A VLGKG FGT+YK+ +   +AVAVKRLK   L   E
Sbjct  55    KLIFFGPMAAAPPFDLEDLLRASAEVLGKGAFGTAYKAVMESGSAVAVKRLKDVDLPEPE  114

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+  +G + HE ++PLRAY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE 
Sbjct  115   FRERIAAIGAVQHELVVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWET  174

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R++IA   A  +  +H+ G T  HGNI+SSNV LT   E RVS+  L  L+ P      V
Sbjct  175   RSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRV  234

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             SGYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+ 
Sbjct  235   SGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEW  294

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
               +VFD  L + +   E++VQLLQ+AI C+ Q+P++RPSM+ VA   D+I+++ 
Sbjct  295   TAEVFDQELLRYQNVEEEMVQLLQLAIDCSAQHPDRRPSMSEVAARIDEIRRSS  348



>dbj|BAH20271.1| AT1G48480 [Arabidopsis thaliana]
Length=400

 Score =   259 bits (663),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 143/288 (50%), Positives = 201/288 (70%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  98    KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFK  157

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN G  ++ LNW+VR+
Sbjct  158   EKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHGNRGAGRSPLNWDVRS  217

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
              IA G A  +  LH+QG++  HGNI+SSN+ LT   + +VS+F L QL+ S  +  +  +
Sbjct  218   RIAIGAARGLDYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSATNPNRAT  277

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DVYSFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  278   GYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWR  337

Query  905   CDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS  L+ A    E + +++Q+ + CT Q+P++RP M+ V  +++
Sbjct  338   REVFDSELLSLATDEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKME  385



>gb|KEH26683.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=676

 Score =   267 bits (683),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 149/290 (51%), Positives = 204/290 (70%), Gaps = 2/290 (1%)
 Frame = +2

Query  185   KSKLVFFgd-gdgyelddllRSTAGVLGKGTFGTSYKSELPE-KTAVAVKRLKIGCLAVD  358
             + KLVFF + G  ++L+DLLR++A VLGKGTFGTSYK+ L     AVAVKRL+   ++  
Sbjct  358   EKKLVFFKNWGRVFDLEDLLRASAEVLGKGTFGTSYKAVLEAGPVAVAVKRLRDVTISER  417

Query  359   EFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWE  538
             EF E++ ++G M HENL PLRAY ++  E LLV+D++ MGSL+  LHGN+G  +  L WE
Sbjct  418   EFKEKIEKVGTMVHENLAPLRAYYYSRDEKLLVHDYLHMGSLSALLHGNKGGGRTPLTWE  477

Query  539   VRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL  718
             +R+ IA G A  I+ LH+QG  + HGNI+SSN+ LT   + RVS+F L  L+ P S  + 
Sbjct  478   MRSGIALGAARGIEYLHSQGPNVSHGNIKSSNILLTKSYDARVSDFGLAHLVGPSSTPNR  537

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             V+GYRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +GVDLP WV+++ +E+
Sbjct  538   VAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNDEGVDLPRWVQSVVKEE  597

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
                +VFD  L + +   E++VQLLQ+A+ C   YP+ RPSM+ V   I++
Sbjct  598   WTSEVFDLELLRYQNVEEEMVQLLQLAVDCAAPYPDNRPSMSQVRQHIEE  647



>gb|KHG00875.1| putative inactive receptor kinase -like protein [Gossypium arboreum]
Length=631

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/297 (52%), Positives = 201/297 (68%), Gaps = 5/297 (2%)
 Frame = +2

Query  173   DAIVKS----KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLK  337
             DAI KS    KLVFFG+      L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK
Sbjct  311   DAIAKSSGSKKLVFFGNRSRVFYLEDLLRASAEVLGKGTFGTAYKATLELGMVVAVKRLK  370

Query  338   IGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKN  517
                ++  EF E++  +G M H NL+P+RAY ++ +E LLVYD+M MGSL+  LHGN G  
Sbjct  371   DVTVSEKEFKEKMEVVGAMDHPNLVPVRAYYFSRNEKLLVYDYMPMGSLSALLHGNRGAG  430

Query  518   KASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLS  697
             +  LNWE R  IA G A  I  LH++G  I HGNI+SSN+ LT   E R+S+F L QL  
Sbjct  431   RIPLNWETRCGIALGAARGIAYLHSKGPEISHGNIKSSNILLTTSYEARISDFGLAQLAG  490

Query  698   PDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWV  877
             P S  D V+GYRAPEVT   +VS ++DVYSFG+LLLELLTGKAP  A     GVDL  WV
Sbjct  491   PTSAPDRVNGYRAPEVTDVRRVSQKADVYSFGILLLELLTGKAPRHALLNEDGVDLSRWV  550

Query  878   RAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +++  E+   +VFD  L + +   E +V+LLQ+AI CT QYP+KRPS++ +  +I++
Sbjct  551   QSVVPEEWTTEVFDLELLRHQNVEEDMVKLLQLAIDCTAQYPDKRPSLSEMTTRIEE  607



>ref|XP_009607528.1| PREDICTED: probable inactive receptor kinase At1g48480 [Nicotiana 
tomentosiformis]
Length=668

 Score =   267 bits (682),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 202/287 (70%), Gaps = 4/287 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFGD     +L+DLL+++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF 
Sbjct  368   KLVFFGDYYKAFDLEDLLKASAEVLGKGTFGTAYKAVLEIGTIVAVKRLKDVAISEKEFR  427

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             +++  +G M HENL+PLRAY ++  E LLVYD+M MGSL+  LHG++G  +  LNWE+R+
Sbjct  428   DKIETVGAMNHENLVPLRAYYYSGEEKLLVYDYMPMGSLSAFLHGSKGTGRTPLNWEIRS  487

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
             SIA G+A+ I  LH+QG  + H NI+S NV LT   E RVS+F L  L+ P S    V+G
Sbjct  488   SIALGIAHGIDYLHSQGPNVSHANIKSCNVLLTKSYEARVSDFGLANLVGPPSSPTRVAG  547

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT   +VS ++DVYSFGVLLLELLTGKAP       +GVDLP WV ++ RE+   
Sbjct  548   YRAPEVTDSRKVSQKADVYSFGVLLLELLTGKAPT---MNEEGVDLPRWVESVVREEWPS  604

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L +     E++VQLLQ+AI CT QYP+ RPSM+ V+ +I++
Sbjct  605   EVFDIELLRYHTAEEEMVQLLQLAIDCTAQYPDNRPSMSEVSKRIEE  651



>gb|KHN41064.1| Putative inactive receptor kinase [Glycine soja]
Length=566

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 187/271 (69%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ +    +VAVKRLK       EF+E++ ++GKM H NL+ LR
Sbjct  261   RASAEVLGKGTFGTTYKATMEMGASVAVKRLKDVTATEKEFSEKIEQVGKMVHHNLVSLR  320

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
              Y ++  E L+VYD+M MGSL+  LH N G  +  LNWE R++IA G A  I  +H+ G 
Sbjct  321   GYYFSRDEKLVVYDYMPMGSLSALLHANGGVGRTPLNWETRSAIALGAARGIAYIHSHGP  380

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E RVS+F L  L  P S  + VSGYRAPEVT   ++S ++DV
Sbjct  381   TSSHGNIKSSNILLTKTFEARVSDFGLAYLALPTSTPNRVSGYRAPEVTDARKISQKADV  440

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG++LLELLTGKAP  +    +GVDLP WV+++ +++   +VFD  L + +   E++V
Sbjct  441   YSFGIMLLELLTGKAPTHSSLTEEGVDLPRWVQSVVQDEWNTEVFDMELLRYQNVEEEMV  500

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +LLQ+A+ CT QYP+KRPSM  VA +I++ C
Sbjct  501   KLLQLALECTAQYPDKRPSMDVVASKIEEIC  531



>ref|XP_007141918.1| hypothetical protein PHAVU_008G236900g [Phaseolus vulgaris]
 gb|ESW13912.1| hypothetical protein PHAVU_008G236900g [Phaseolus vulgaris]
Length=644

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 185/271 (68%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    +VAVKRLK       EF E++ ++GKM H NL+PLR
Sbjct  335   RASAEVLGKGTFGTTYKATLEMGVSVAVKRLKDVTATEREFREKIEQVGKMVHHNLVPLR  394

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
              Y ++  E L+VYD+M MGSL+  LH N G  +  LNWE R++IA G A  I  +H+ G 
Sbjct  395   GYFFSRDEKLVVYDYMPMGSLSALLHANGGVGRTPLNWETRSAIALGAARGIAYIHSHGP  454

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E RVS+F L  L  P S  + VSGYRAPE+T   +VS ++DV
Sbjct  455   TSSHGNIKSSNILLTKSFEARVSDFGLAYLALPTSTPNRVSGYRAPEITDARKVSQKADV  514

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG++LLELLTGKAP  +    +GVDLP WV+++ + +   DVFD  L + +   E++V
Sbjct  515   YSFGIMLLELLTGKAPAHSSLNDEGVDLPRWVQSVVQGEWNTDVFDMELLRYQSVEEEMV  574

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +LLQ+A+ CT QYP+KRPSM  V  +I++ C
Sbjct  575   KLLQLALECTAQYPDKRPSMDVVESKIEEIC  605



>ref|XP_011073169.1| PREDICTED: probable inactive receptor kinase At1g48480 [Sesamum 
indicum]
Length=655

 Score =   265 bits (678),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 196/287 (68%), Gaps = 6/287 (2%)
 Frame = +2

Query  191   KLVFFgdgdgyelddllRS-TAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFF D       + L S +A VLGKG+ GTSYK+ L   T V VKRLK   ++  EF 
Sbjct  354   KLVFFWDVTRVFDLEDLLSASAEVLGKGSLGTSYKAVLEVGTVVTVKRLKDVMISEWEFK  413

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M +ENL+PLRAY ++  E LLVYD+M MGSL+  LHGN G  +  LNWE+R+
Sbjct  414   EKIEGVGAMDNENLVPLRAYYYSREEKLLVYDYMQMGSLSAFLHGNRGAGRTPLNWEIRS  473

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA G A  I+ LH QGS+  HGNI+SSNV LT   + R+S+F L QL+ P S    V+G
Sbjct  474   RIALGAARGIEYLHCQGSSTAHGNIKSSNVLLTKSYDARISDFGLNQLVGPPSSPTRVTG  533

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGK PLE      G+DLP WV+++ RE+   
Sbjct  534   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKPPLE-----DGLDLPRWVQSVVREEWTS  588

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+ I CT QYP++RP ++ VA +I++
Sbjct  589   EVFDLELLRYQNVEEEMVQLLQIGIDCTAQYPDQRPLISQVAKRIEE  635



>ref|XP_011007233.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=624

 Score =   264 bits (675),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 213/338 (63%), Gaps = 10/338 (3%)
 Frame = +2

Query  71    KEIYSKE-NRPACRNQEQIKAKKSCELYNIMAWSPDAIVKSK--------LVFFgdgdgy  223
             KE+ SK+  +P  R  E    K +    ++ A    A+VKS+        LVFFG+    
Sbjct  272   KEVGSKDAEQPREREVEIPGEKAAGGSVSVSAGQSGAVVKSEAKSRGTKNLVFFGNAVRA  331

Query  224   -elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTH  400
              +L+DLL+++A VLGKGTFGT+YK+ L     VAVKRLK   +   EF E++  +G M H
Sbjct  332   FDLEDLLKASAEVLGKGTFGTAYKATLDVGLVVAVKRLKEVTVPEKEFREKIEGVGNMNH  391

Query  401   ENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQ  580
             ENL+PLRAY ++  E LLV+D+M MGSL+  LHGN+G  +  LNWE R+ IA G A  I 
Sbjct  392   ENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHGNKGSGRTPLNWETRSGIALGAARGIA  451

Query  581   SLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQ  760
              +H+QG    HGNI+SSN+ LT     RVS+F L  L  P    + + GYRAPEVT   +
Sbjct  452   YIHSQGPANSHGNIKSSNILLTTSFGARVSDFGLAHLAGPTPTPNRIDGYRAPEVTDARK  511

Query  761   VSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE  940
             VS ++DVYSFG+LLLELLTGKAP       +GVDLP WV+++ RE+   +VFD  L + +
Sbjct  512   VSQKADVYSFGILLLELLTGKAPTHTQLNDEGVDLPRWVQSVVREEWSAEVFDPELLRYQ  571

Query  941   QNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
                E +VQLLQ+A  CT QYP+ RPSM+ V  +++  C
Sbjct  572   TVEEDMVQLLQLASDCTAQYPDNRPSMSEVRSRMEDLC  609



>ref|XP_011002185.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=624

 Score =   263 bits (673),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 213/338 (63%), Gaps = 10/338 (3%)
 Frame = +2

Query  71    KEIYSKE-NRPACRNQEQIKAKKSCELYNIMAWSPDAIVKSK--------LVFFgdgdgy  223
             KE+ SK+  +P  R  E    K +    ++ A    A+VKS+        LVFFG+    
Sbjct  272   KEVGSKDVEQPREREVEIPGEKAAGGSGSVSAGQSGAVVKSEAKSRGTKNLVFFGNAVRA  331

Query  224   -elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTH  400
              +L+DLL+++A VLGKGTFGT+YK+ L     VAVKRLK   +   EF E++  +G M H
Sbjct  332   FDLEDLLKASAEVLGKGTFGTAYKATLDVGLVVAVKRLKEVTVPEKEFREKIEGVGNMNH  391

Query  401   ENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQ  580
             ENL+PLRAY ++  E LLV+D+M MGSL+  LHGN+G  +  LNWE R+ IA G A  I 
Sbjct  392   ENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHGNKGSGRTPLNWETRSGIALGAARGIA  451

Query  581   SLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQ  760
              +H+QG    HGNI+SSN+ LT     RVS+F L  L  P    + + GYRAPEVT   +
Sbjct  452   YIHSQGPANSHGNIKSSNILLTTSFGARVSDFGLAHLAGPTPTPNRIDGYRAPEVTDARK  511

Query  761   VSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE  940
             VS ++DVYSFG+LLLELLTGKAP       +GVDLP WV+++ RE+   +VFD  L + +
Sbjct  512   VSQKADVYSFGILLLELLTGKAPTHTQLNDEGVDLPRWVQSVVREEWSAEVFDPELLRYQ  571

Query  941   QNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
                E +VQLLQ+A  CT QYP+ RPSM+ V  +++  C
Sbjct  572   TVEEDMVQLLQLASDCTAQYPDNRPSMSEVRSRMEDLC  609



>gb|EYU30898.1| hypothetical protein MIMGU_mgv1a003238mg [Erythranthe guttata]
Length=597

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 190/272 (70%), Gaps = 1/272 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKG++GT+YK+ +    AVAVKR++   +   EF E++ E+G++ HENL+ LR
Sbjct  306   KASAEVLGKGSYGTAYKAVMENGLAVAVKRIRDVNMGEKEFGEKMEEIGRIEHENLVCLR  365

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY +N  E LLV+D++ MGSL+  LHGN+G ++  LNWE R +IA G A  I  LH+Q  
Sbjct  366   AYYFNKDEKLLVFDYLPMGSLSALLHGNKGASRTPLNWETRATIALGAARGISHLHSQSP  425

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLS-PDSKLDLVSGYRAPEVTSPHQVSHQSD  778
             T  HGNI+SSN+ LT   E RV +F L QL S P +  + V+GYRAPEVT   + SH++D
Sbjct  426   TTAHGNIKSSNILLTKTYEARVCDFGLAQLASGPAASPNRVAGYRAPEVTDARKASHKAD  485

Query  779   VYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveql  958
             VYSFGVLLLELLTGKAP  +    +GVDLP WV+++ RE+   +VFD  L + +   E +
Sbjct  486   VYSFGVLLLELLTGKAPTHSSTNEEGVDLPRWVQSVVREEWTAEVFDLELLRYQTVEEDM  545

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             VQ+LQ+AI CT QYP+KRP ++ V  +I++ C
Sbjct  546   VQMLQLAIDCTAQYPDKRPVISEVVARIEELC  577



>gb|EEE59802.1| hypothetical protein OsJ_12326 [Oryza sativa Japonica Group]
Length=379

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/294 (50%), Positives = 193/294 (66%), Gaps = 6/294 (2%)
 Frame = +2

Query  191   KLVFFgdgdgye---lddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KL+FFG         L+DLLR++A VLGKG FGT+YK+ L     VAVKRLK   L   E
Sbjct  50    KLIFFGSAAAVAPFDLEDLLRASAEVLGKGAFGTTYKAVLESGATVAVKRLKDVTLTEPE  109

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F +R+ ++G++ HE ++PLRAY ++  E LLVYD M MGSL+  LHGN G  +  LNWE 
Sbjct  110   FRDRIADIGELQHEFIVPLRAYYYSKDEKLLVYDFMPMGSLSAVLHGNRGSGRTPLNWET  169

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA   A  ++ +H+  S+  HGNI+SSNV L    + R+S+  L  L+ P S     
Sbjct  170   RSSIALAAARGVEYIHSTSSSASHGNIKSSNVLLNKSYQARLSDNGLSALVGPSSAPSRA  229

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             SGYRAPEVT P +VS ++DVYSFGVLLLELLTGKAP +A    +GVDLP WV+++ R + 
Sbjct  230   SGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVVRSEW  289

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
               +VFD  L + +   EQ+VQLLQ+AI C  Q P+ RPSM  V    ++IKK+ 
Sbjct  290   TAEVFDMELLRYQNVEEQMVQLLQLAIDCVAQVPDARPSMPHVVLRIEEIKKSS  343



>ref|XP_006575485.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Glycine 
max]
Length=643

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 186/271 (69%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ +    +VAVKRLK       EF E++ ++GKM H NL+ LR
Sbjct  338   RASAEVLGKGTFGTTYKATMEMGASVAVKRLKDVTATEKEFREKIEQVGKMVHHNLVSLR  397

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
              Y ++  E L+VYD+M MGSL+  LH N G  +  LNWE R++IA G A  I  +H+ G 
Sbjct  398   GYYFSRDEKLVVYDYMPMGSLSALLHANGGVGRTPLNWETRSAIALGAARGIAYIHSHGP  457

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E RVS+F L  L  P S  + VSGYRAPEVT   ++S ++DV
Sbjct  458   TSSHGNIKSSNILLTKTFEARVSDFGLAYLALPTSTPNRVSGYRAPEVTDARKISQKADV  517

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG++LLELLTGKAP  +    +GVDLP WV+++ +++   +VFD  L + +   E++V
Sbjct  518   YSFGIMLLELLTGKAPTHSSLTEEGVDLPRWVQSVVQDEWNTEVFDMELLRYQNVEEEMV  577

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +LLQ+A+ CT QYP+KRPSM  VA +I++ C
Sbjct  578   KLLQLALECTAQYPDKRPSMDVVASKIEEIC  608



>ref|XP_010916205.1| PREDICTED: probable inactive receptor kinase At1g48480 [Elaeis 
guineensis]
Length=667

 Score =   263 bits (672),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 199/287 (69%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG G G  +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +   EF 
Sbjct  337   KLVFFGSGGGPFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTTVAVKRLKDVNIPDKEFR  396

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M H NL+PLRAY ++  E LLVYD+M MGSL+  LHGN G  +  LNWE R+
Sbjct  397   EKIEAVGAMDHPNLVPLRAYYYSKDEKLLVYDYMPMGSLSALLHGNRGSGRTPLNWETRS  456

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA   A+ I+ +H+ G +  HGNI+SSN+ LT   E RVS+  L  L+   S    V+G
Sbjct  457   GIALAAAHGIEYIHSTGPSASHGNIKSSNILLTKTYEARVSDHGLAHLVGQTSTPTRVAG  516

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT   +VS ++DVYSFGVLLLELLTGKAP +A    +GVDLP WV+++ RE+   
Sbjct  517   YRAPEVTDARKVSQKADVYSFGVLLLELLTGKAPAQALLNDEGVDLPRWVQSVVREEWTA  576

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI C  QYP+KRP+++ V  +I++
Sbjct  577   EVFDLELLRYQNVEEEMVQLLQLAIDCAAQYPDKRPTISEVVVRIEE  623



>ref|XP_009370559.1| PREDICTED: probable inactive receptor kinase At1g48480 [Pyrus 
x bretschneideri]
Length=626

 Score =   262 bits (669),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 187/272 (69%), Gaps = 0/272 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L    ++AVKRLK   ++  EF E++ E+G+M H NL+PLR
Sbjct  333   RASAEVLGKGTFGTTYKAALDMGVSMAVKRLKEVAVSEKEFKEKIEEIGRMDHVNLVPLR  392

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHG  G  +  L WE R+ IA G A AI  LH+QG 
Sbjct  393   AYYYSRDEKLLVYDYMPMGSLSALLHGARGSGRTPLIWETRSGIAVGAARAITYLHSQGP  452

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E  VS+FCL  L SP S  + +SGYRAPE+T   +V+ ++DV
Sbjct  453   TTSHGNIKSSNILLTRTYEACVSDFCLAHLASPTSTPNRISGYRAPELTDTSKVTQKADV  512

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGK P +A    +GVDLP WV ++ RE+   +VFDS L + +   E +V
Sbjct  513   YSFGVLLLELLTGKPPTQAIMNDEGVDLPRWVHSVVREEWTAEVFDSELLRYQNVEEDMV  572

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
             QLL +A+ CT  YP+ RPSM  V  +I++ CS
Sbjct  573   QLLHIALECTVTYPDSRPSMGEVTSRIQELCS  604



>gb|KHN39461.1| Putative inactive receptor kinase [Glycine soja]
Length=642

 Score =   261 bits (668),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 186/271 (69%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ +    +VAVKRLK       EF E++ ++GKM H NL+PLR
Sbjct  337   RASAEVLGKGTFGTTYKATMEMGASVAVKRLKDVTATEKEFREKIEQVGKMVHHNLVPLR  396

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
              Y ++  E L+VYD+M MGSL+  LH N G  +  LNWE R++IA G A  I  +H+ G 
Sbjct  397   GYFFSRDEKLVVYDYMPMGSLSALLHANGGVGRTPLNWETRSAIALGAARGIAYIHSLGP  456

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ LT   E RVS+F L  L  P S  + VSGY APEVT   ++S ++DV
Sbjct  457   TSSHGNIKSSNILLTKTFEARVSDFGLAYLALPTSTPNRVSGYCAPEVTDARKISQKADV  516

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG++LLELLTGKAP  +    +GVDLP WV+++ +++   +VFD  L + +   E++V
Sbjct  517   YSFGIMLLELLTGKAPTHSSLNDEGVDLPRWVQSVIQDEWNTEVFDMELLRYQSVEEEMV  576

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +LLQ+A+ CT QYP+KRPSM  VA +I++ C
Sbjct  577   KLLQLALECTAQYPDKRPSMDVVASKIEEIC  607



>ref|XP_006299778.1| hypothetical protein CARUB_v10015974mg [Capsella rubella]
 gb|EOA32676.1| hypothetical protein CARUB_v10015974mg [Capsella rubella]
Length=648

 Score =   261 bits (668),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 148/288 (51%), Positives = 198/288 (69%), Gaps = 2/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  351   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFK  410

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  411   EKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEIRS  470

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+S  S   +  +
Sbjct  471   RIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRAT  530

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  531   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWR  590

Query  905   CDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E   E++ ++LQ+ I CT Q+P+KRP M  V  +I++
Sbjct  591   NEVFDSELMSIETVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQE  638



>ref|XP_004512763.1| PREDICTED: probable inactive receptor kinase RLK902-like [Cicer 
arietinum]
Length=681

 Score =   262 bits (669),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 189/270 (70%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELP-EKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPL  418
             R++A VLGKGTFGTSYK+ L      VAVKRL+   ++  EF E++  +G M HENL PL
Sbjct  384   RASAEVLGKGTFGTSYKAVLEVGPLMVAVKRLRDVSISEREFKEKIERVGAMVHENLAPL  443

Query  419   RAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQG  598
             RAY ++  E LLV+D++SMGSL+  LHGN+G  +  LNWE+R+SIA G +  I+ LH+QG
Sbjct  444   RAYYYSRDEKLLVHDYLSMGSLSALLHGNKGGGRTPLNWEMRSSIALGASRGIEYLHSQG  503

Query  599   STICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSD  778
               + HGNI+SSN+ LT   + +VS+F L  L+ P    + VSGYRAPEVT P +VS ++D
Sbjct  504   PNVSHGNIKSSNILLTKTYDAKVSDFGLAHLVGPSPTPNRVSGYRAPEVTDPRKVSQKAD  563

Query  779   VYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveql  958
             VYSFGVLLLELLTGKAP  A    +GVDLP WV+++ +++   +VFD  L + +   +++
Sbjct  564   VYSFGVLLLELLTGKAPTHAVLNEEGVDLPRWVQSVVKDEWTSEVFDLELLRYQNVEDEM  623

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             VQLLQ+A+ C   YP+ RPS++ V   I++
Sbjct  624   VQLLQLAVDCAATYPDNRPSISQVRHHIEE  653



>ref|XP_008781294.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g48480 [Phoenix dactylifera]
Length=668

 Score =   261 bits (667),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 199/287 (69%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG G+   +L+DLLR++A VLGKGT GT+YK+ L   T VAVKRLK   LA  EF 
Sbjct  339   KLVFFGSGERPFDLEDLLRASAEVLGKGTSGTAYKAVLEMGTTVAVKRLKDVNLAEKEFR  398

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             ER+  +G M H NL+PLRAY ++  E LLVYD+M MGSL+  LHGN G  +  LNW+ R+
Sbjct  399   ERIEAVGAMNHPNLVPLRAYYYSKDEKLLVYDYMPMGSLSALLHGNRGSGRTPLNWDTRS  458

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
             SIA   A  I+ +H+ G +  H NI+SSN+ LT   E RVS+  L  L+ P S    V+G
Sbjct  459   SIALAAARGIEYIHSTGPSASHANIKSSNILLTKSYEARVSDHGLALLVGPASAPTRVAG  518

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT   +VS ++DVYSFGVLLLELLTGKAP +A    +GVDLP WV+++ +E+   
Sbjct  519   YRAPEVTDAQKVSQKADVYSFGVLLLELLTGKAPAQALLNDEGVDLPRWVQSVVQEEWTS  578

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E++VQLLQ+AI C  QYP++RP+++ V  +I++
Sbjct  579   EVFDLELLRYQNVEEEMVQLLQLAIDCAAQYPDRRPTISEVVVRIEE  625



>gb|EYU45791.1| hypothetical protein MIMGU_mgv1a002921mg [Erythranthe guttata]
Length=625

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/295 (49%), Positives = 202/295 (68%), Gaps = 6/295 (2%)
 Frame = +2

Query  191   KLVFFgdgd-gyelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             +LVFFG     + L+DLL+++A VLG+GTFGT+YK+ L    AV VKRL+   +A  EF 
Sbjct  328   RLVFFGKTKWEFTLEDLLKASAEVLGRGTFGTTYKAALDAGLAVVVKRLRDVNMAEMEFR  387

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
              ++ E+G+M H+NL+PL+AY +N  E LLVYD++ MGSL+  LHGN+G+ +  LNWE R 
Sbjct  388   AKMDEIGRMDHQNLVPLKAYYYNRDEKLLVYDYLPMGSLSALLHGNKGERRTPLNWETRA  447

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL--DLV  721
             SIA G A  I  LH+ G +I HGNI+SSN+ LT   E RVS+F L ++  P S L    V
Sbjct  448   SIALGAAQGISYLHSHGPSISHGNIKSSNILLTKKYEPRVSDFLLARMARPGSALGPSRV  507

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
              GYRAPEVT P +VS ++DVYSFGVL+LE+LTGK+P+       G DLP WVR++ ++  
Sbjct  508   EGYRAPEVTDPQRVSQKADVYSFGVLVLEMLTGKSPV---VGEDGFDLPLWVRSVVKDAW  564

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTCSLWF  1066
               +VFD+ L + +   E +V+LLQ+ + CT  YP+KRPSM+ VA +I++ C   F
Sbjct  565   TSEVFDAELLRYQNVEEDMVRLLQIGVDCTESYPDKRPSMSEVATKIEELCRWSF  619



>gb|ACU19868.1| unknown [Glycine max]
Length=279

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 174/245 (71%), Gaps = 0/245 (0%)
 Frame = +2

Query  314   AVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFR  493
              VAVKRLK   ++  EF E++  +G M HENL+PLRAY ++  E LLV+D+M MGSL+  
Sbjct  6     VVAVKRLKDVTVSEKEFKEKIDVVGVMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSAI  65

Query  494   LHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSE  673
             LHGN+G  +  LNWE+R+SIA G A  I+ LH+QG ++ HGNI+SSN+ LT   + RVS+
Sbjct  66    LHGNKGAGRTPLNWEMRSSIALGAARGIEYLHSQGPSVSHGNIKSSNILLTKSYDARVSD  125

Query  674   FCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGK  853
             F L  L+   S  + V+GYRAPEVT P +VS ++DVYSFGVLLLELLTGKAP  A    +
Sbjct  126   FGLTHLVGSSSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPTHALLNEE  185

Query  854   GVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA  1033
             GVDLP WV+++ RE+   +VFD  L + + + E++VQLLQ+A+ C   YP+ RPSM+ V 
Sbjct  186   GVDLPRWVQSVVREEWSSEVFDIELLRYQNSEEEMVQLLQLAVDCVVPYPDNRPSMSQVR  245

Query  1034  DQIKK  1048
              +I++
Sbjct  246   QRIEE  250



>ref|XP_008775508.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At1g48480 [Phoenix dactylifera]
Length=663

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 183/269 (68%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L   T VAVKRLK   L   EF E++  +G M H NL+PLR
Sbjct  351   RASAEVLGKGTFGTAYKAVLEMGTTVAVKRLKDVNLPEKEFREKIEAVGAMDHPNLVPLR  410

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN G  +  L+WE R+ IA   A  I+ +H+ G 
Sbjct  411   AYYYSKDEKLLVYDYMPMGSLSALLHGNRGSGRTPLDWETRSGIALAAARGIEYIHSTGP  470

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             +  HGNI+SSN+ LT   E RVS+  L  L+ P S    V+GYRAPEVT   +VS ++DV
Sbjct  471   SASHGNIKSSNILLTKSYEARVSDHGLAHLVGPTSTPARVAGYRAPEVTDARKVSQKADV  530

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YS GVLLLELLTGKAP +A     GVDLP WV+++ RE+   +VFD  L + +   E++V
Sbjct  531   YSXGVLLLELLTGKAPAQALLNDDGVDLPRWVQSVVREEWTAEVFDLELLRYQNVEEEMV  590

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+AI C  QYP++RP+++ V  +I++
Sbjct  591   QLLQLAIDCAAQYPDRRPTISEVVVRIEE  619



>gb|ACR34746.1| unknown [Zea mays]
Length=462

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/274 (50%), Positives = 187/274 (68%), Gaps = 3/274 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKG FGT+YK+ +   +AVAVKRLK   L   EF ER+  +G + HE ++PLR
Sbjct  172   RASAEVLGKGAFGTAYKAVMENGSAVAVKRLKDVDLPEPEFRERIAAIGAVQHELVVPLR  231

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE R+++A   A  +  +H+ G 
Sbjct  232   AYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWETRSAVALAAARGVAHIHSTGP  291

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSNV LT   E RVS+  L  L+ P      VSGYRAPEVT   +VS ++DV
Sbjct  292   TASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRVSGYRAPEVTDIRRVSQKADV  351

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+   +VFD  L + +   E++V
Sbjct  352   YSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEWTAEVFDQELLRYQNVEEEMV  411

Query  962   qllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
             QLLQ+AI C+ Q+P++RP+M+ VA   D+I+++ 
Sbjct  412   QLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSS  445



>ref|XP_010500379.1| PREDICTED: probable inactive receptor kinase At1g48480 [Camelina 
sativa]
Length=651

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 202/288 (70%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  351   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFR  410

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN G  ++ LNW+VR+
Sbjct  411   EKIELVGAMDHENLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNRGAGRSPLNWDVRS  470

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
              IA G A  +  LH+QG+T  HGN++SSN+ LT     ++S+F L QL+ S  +  +  +
Sbjct  471   RIAIGAARGLDYLHSQGTTTSHGNVKSSNILLTKSHHAKISDFDLAQLVGSSSTNPNRAT  530

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DVYSFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  531   GYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWR  590

Query  905   CDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS  L+ A +  E + +++Q+ + CT Q+P++RP M+ V  +++
Sbjct  591   REVFDSELLSLATKEEEMMAEMVQLGLDCTSQHPDQRPEMSEVVRKME  638



>ref|XP_006393400.1| hypothetical protein EUTSA_v10011300mg [Eutrema salsugineum]
 gb|ESQ30686.1| hypothetical protein EUTSA_v10011300mg [Eutrema salsugineum]
Length=656

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 146/302 (48%), Positives = 204/302 (68%), Gaps = 4/302 (1%)
 Frame = +2

Query  152   NIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVK  328
             N  +   +  V  KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVK
Sbjct  341   NTKSGEANGPVAKKLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVK  400

Query  329   RLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNE  508
             RLK   +   EF E++  +G M HENL+PLRAY ++  E LLVYD MSMGSL+  LHGN 
Sbjct  401   RLKDVMMPDKEFREKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMSMGSLSALLHGNR  460

Query  509   GKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQ  688
             G  +  LNW+VR+ IA G A  +  LH+QG++  HGNI+SSN+ LT   + +VS+F L Q
Sbjct  461   GAGRTPLNWDVRSRIALGAARGLDYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLSQ  520

Query  689   LLSPDSKL--DLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVD  862
             L+   S    +  +GYRAPEVT P +VS + DVYS+GV+LLEL+TGKAP  +    +GVD
Sbjct  521   LVGASSTTTPNRATGYRAPEVTDPKRVSQKGDVYSYGVVLLELITGKAPSNSVMNEEGVD  580

Query  863   LPNWVRAMFREKPICDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQ  1039
             L  WV+++ R++   +VFDS  L+ A ++ E + +++Q+ + CT Q+P+KRP MA V  +
Sbjct  581   LARWVKSVVRDEWRREVFDSELLSLATEDEEMMAEMVQLGLECTSQHPDKRPEMAEVVRK  640

Query  1040  IK  1045
             I+
Sbjct  641   IE  642



>gb|AAC95351.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=645

 Score =   258 bits (659),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/288 (50%), Positives = 201/288 (70%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  343   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFK  402

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN G  ++ LNW+VR+
Sbjct  403   EKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHGNRGAGRSPLNWDVRS  462

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
              IA G A  +  LH+QG++  HGNI+SSN+ LT   + +VS+F L QL+ S  +  +  +
Sbjct  463   RIAIGAARGLNYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSATNPNRAT  522

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DVYSFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  523   GYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWR  582

Query  905   CDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS  L+ A    E + +++Q+ + CT Q+P++RP M+ V  +++
Sbjct  583   REVFDSELLSLATDEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKME  630



>ref|XP_010465843.1| PREDICTED: probable inactive receptor kinase RLK902 [Camelina 
sativa]
Length=643

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 197/288 (68%), Gaps = 6/288 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  350   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFK  409

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  +  LNWE+R+
Sbjct  410   EKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEIRS  469

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+S  S   +  +
Sbjct  470   RIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRAT  529

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  530   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWR  589

Query  905   CDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E+    + ++LQ+ I CT Q+P+KRP M  V  +I++
Sbjct  590   NEVFDSELMVEEE----MAEMLQLGIDCTEQHPDKRPVMVEVVRRIQE  633



>ref|XP_006306949.1| hypothetical protein CARUB_v10008516mg, partial [Capsella rubella]
 gb|EOA39847.1| hypothetical protein CARUB_v10008516mg, partial [Capsella rubella]
Length=666

 Score =   258 bits (659),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/288 (50%), Positives = 200/288 (69%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  364   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFR  423

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN G  ++ LNW+VR+
Sbjct  424   EKIELVGAMDHENLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNRGAGRSPLNWDVRS  483

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL-VS  724
              IA G A  +  LH+QG+   HGN++SSN+ LT     +VS+F L QL+   +   +  +
Sbjct  484   RIAIGAARGLDYLHSQGTMTSHGNVKSSNILLTKSHGAKVSDFGLAQLVGSSATTPIRTT  543

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DVYSFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  544   GYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWR  603

Query  905   CDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS  L+ A +  E + +++Q+ I CT Q+P+KRP M+ V  +I+
Sbjct  604   REVFDSELLSLATEEEEMMAEMVQLGIECTSQHPDKRPEMSEVVRKIE  651



>ref|NP_566589.1| receptor-like kinase 902 [Arabidopsis thaliana]
 sp|Q9LVI6.1|RLK90_ARATH RecName: Full=Probable inactive receptor kinase RLK902; AltName: 
Full=Receptor-like kinase 902; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB02707.1| probable receptor-like protein kinase protein [Arabidopsis thaliana]
 gb|AAM19950.1| AT3g17840/MEB5_6 [Arabidopsis thaliana]
 gb|AAN72294.1| At3g17840/MEB5_6 [Arabidopsis thaliana]
 gb|ACN59318.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE76013.1| receptor-like kinase 902 [Arabidopsis thaliana]
Length=647

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 195/291 (67%), Gaps = 5/291 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  347   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFK  406

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  +  LNWEVR+
Sbjct  407   EKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEVRS  466

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+S  S   +  +
Sbjct  467   GIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRAT  526

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  527   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWR  586

Query  905   CDVFDSTLAKAEQNveqlvqllqv---AICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E  V    ++ ++    I CT Q+P+KRP M  V  +I++
Sbjct  587   NEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQE  637



>ref|XP_010479274.1| PREDICTED: probable inactive receptor kinase At1g48480 [Camelina 
sativa]
Length=652

 Score =   257 bits (657),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 202/288 (70%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  352   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFR  411

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN G  ++ LNW+VR+
Sbjct  412   EKIELVGAMDHENLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNRGAGRSPLNWDVRS  471

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
              IA G A  +  LH+QG+T  HGN++SSN+ LT     ++S+F L QL+ S  +  +  +
Sbjct  472   RIAIGAARGLDYLHSQGTTTSHGNVKSSNILLTKSHHAKISDFGLAQLVGSSATNPNRAT  531

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DV+SFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  532   GYRAPEVTDPKRVSQKGDVFSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWR  591

Query  905   CDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS  L+ A +  E + +++Q+ + CT Q+P++RP M+ V  +++
Sbjct  592   REVFDSELLSLATKEEEMMAEMVQLGLDCTSQHPDQRPEMSEVVRKME  639



>ref|XP_008457025.1| PREDICTED: probable inactive receptor kinase RLK902 [Cucumis 
melo]
Length=643

 Score =   257 bits (657),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 194/289 (67%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK    A  EF 
Sbjct  320   KLVFFGNVGNVFDLEDLLRASAEVLGKGTFGTAYKATLETGMVVAVKRLKEMTAAEKEFR  379

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++ E G+M +ENL+P RAY ++  E LLVYD+M MGSL+  LHG+    +  LNWE R 
Sbjct  380   EKMEEAGRMKNENLVPFRAYYYSREEKLLVYDYMPMGSLSALLHGSRESGRTPLNWEARC  439

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA GV   I  LH+QG TI HGNI+SSN+ LT   E  VS++ L QL    S    V+G
Sbjct  440   GIALGVGRGIHYLHSQGPTISHGNIKSSNILLTRSYEACVSDYGLAQLAMAPSTPSRVAG  499

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT   +VSH++DVYSFGVLLLE+LTGK+P  +    + VDLP WV+++ +E+   
Sbjct  500   YRAPEVTDSRKVSHKADVYSFGVLLLEMLTGKSPTHSIFHEEAVDLPRWVQSVVQEEWTA  559

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++VQLL++A+ CT  YP+ RP M  +  +I++ C
Sbjct  560   EVFDEQLLRYQNVEEEMVQLLELALQCTVPYPDNRPGMDEIVGRIEELC  608



>ref|XP_011083189.1| PREDICTED: probable inactive receptor kinase At1g48480 [Sesamum 
indicum]
Length=654

 Score =   257 bits (657),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 191/269 (71%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGTFGT+YK+ L   T VAVKRLK   ++  EF E++  +G M +ENL+PLR
Sbjct  366   RASAEVLGKGTFGTAYKAVLEVGTVVAVKRLKDVTISEREFKEKIEGVGAMDNENLVPLR  425

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+M MGSL+  LHGN+G  +  LNWE+RT IA G A  I+ LH QG 
Sbjct  426   AYYYSREEKLLVYDYMPMGSLSALLHGNKGAGRTPLNWEIRTRIALGAARGIEYLHFQGH  485

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGNI+SSN+ LT   + RVS+F L  L+ P S    V+GYRAPEVT P +VS ++DV
Sbjct  486   SVSHGNIKSSNILLTKSYDARVSDFGLNHLVGPPSSPTRVAGYRAPEVTDPRKVSQKADV  545

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YS GVLLLELLTGKAP  A    +GVDLP WV+++ RE+   +VFD  L + +   +++V
Sbjct  546   YSLGVLLLELLTGKAPTHALLNEEGVDLPRWVQSVVREEWTSEVFDLELLRYQNVEDEMV  605

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+ I CT QYP+ RPS++ VA +I++
Sbjct  606   QLLQLGIDCTAQYPDNRPSISEVARRIEE  634



>gb|AAM64268.1| receptor kinase, putative [Arabidopsis thaliana]
Length=639

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 195/291 (67%), Gaps = 5/291 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  339   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFK  398

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  +  LNWEVR+
Sbjct  399   EKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEVRS  458

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+S  S   +  +
Sbjct  459   GIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRAT  518

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  519   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWR  578

Query  905   CDVFDSTLAKAEQNveqlvqllqv---AICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E  V    ++ ++    I CT Q+P+KRP M  V  +I++
Sbjct  579   NEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQE  629



>ref|XP_004145847.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cucumis 
sativus]
 ref|XP_004170469.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cucumis 
sativus]
 gb|KGN57791.1| hypothetical protein Csa_3G303640 [Cucumis sativus]
Length=643

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 192/289 (66%), Gaps = 1/289 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK    A  EF 
Sbjct  320   KLVFFGNVGNVFDLEDLLRASAEVLGKGTFGTAYKATLETGMVVAVKRLKEMTAAEKEFR  379

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++ E G+M HENL+P RAY ++  E LLVYD+M MGSL+  LHG+    +  LNWE R 
Sbjct  380   EKMEEAGRMKHENLVPFRAYYYSREEKLLVYDYMPMGSLSALLHGSRESGRTPLNWEARC  439

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA GV   I  LH+QG TI HGNI+SSN+ LT   E  VS++ L QL    S    V+G
Sbjct  440   GIALGVGRGIHYLHSQGPTISHGNIKSSNILLTRSYEACVSDYGLAQLAMSPSTPSRVAG  499

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT   +VS ++DVYSFGVLLLE+LTGK+P  +    + VDLP WV+++ +E+   
Sbjct  500   YRAPEVTDSRKVSQKADVYSFGVLLLEMLTGKSPTHSIFNEEAVDLPRWVQSVVQEEWTA  559

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +VFD  L + +   E++VQLL++A+ CT  YP+ RP M  +  +I + C
Sbjct  560   EVFDEQLLRYQNVEEEMVQLLELALQCTVPYPDNRPGMDEIVRRIDELC  608



>ref|NP_564528.1| receptor-like kinase 1 [Arabidopsis thaliana]
 sp|Q9LP77.1|Y1848_ARATH RecName: Full=Probable inactive receptor kinase At1g48480; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF79696.1|AC020889_4 T1N15.9 [Arabidopsis thaliana]
 gb|ACI49789.1| At1g48480 [Arabidopsis thaliana]
 gb|ACN59244.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32298.1| receptor-like kinase 1 [Arabidopsis thaliana]
Length=655

 Score =   257 bits (657),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/288 (50%), Positives = 201/288 (70%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  353   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFK  412

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN G  ++ LNW+VR+
Sbjct  413   EKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHGNRGAGRSPLNWDVRS  472

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
              IA G A  +  LH+QG++  HGNI+SSN+ LT   + +VS+F L QL+ S  +  +  +
Sbjct  473   RIAIGAARGLDYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSATNPNRAT  532

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DVYSFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  533   GYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWR  592

Query  905   CDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS  L+ A    E + +++Q+ + CT Q+P++RP M+ V  +++
Sbjct  593   REVFDSELLSLATDEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKME  640



>ref|XP_010461669.1| PREDICTED: probable inactive receptor kinase At1g48480 [Camelina 
sativa]
Length=652

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 202/288 (70%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  352   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFR  411

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD+M MGSL+  LHGN G  ++ LNW+VR+
Sbjct  412   EKIELVGAMDHENLVPLRAYYFSRDEKLLVYDYMPMGSLSALLHGNRGAGRSPLNWDVRS  471

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
              IA G A  +  LH+QG+T  HGN++SSN+ LT     ++S+F L QL+ S  +  +  +
Sbjct  472   RIAIGAARGLDYLHSQGTTTSHGNVKSSNILLTKSHHAKISDFGLSQLVGSSATNPNRAT  531

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DV+SFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  532   GYRAPEVTDPKRVSQKGDVFSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWR  591

Query  905   CDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS  L+ A +  E + +++Q+ + CT Q+P++RP M+ V  +++
Sbjct  592   REVFDSELLSLATKEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKME  639



>gb|KFK36089.1| hypothetical protein AALP_AA4G076000 [Arabis alpina]
Length=639

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 200/295 (68%), Gaps = 4/295 (1%)
 Frame = +2

Query  173   DAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCL  349
             D     KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +
Sbjct  329   DGPASKKLVFFGNASRVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVLM  388

Query  350   AVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASL  529
                +F E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN G  ++ L
Sbjct  389   PDKDFKEKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHGNRGGGRSPL  448

Query  530   NWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDS  706
             NWEVR+ IA G A  +  LH+QG T  HGN++SSN+ LT   + +VS+F L QL+ SP S
Sbjct  449   NWEVRSRIALGAARGLDYLHSQGVTTSHGNVKSSNILLTKSHDAKVSDFGLSQLVASPSS  508

Query  707   KL-DLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRA  883
                +  +GYRAPEVT P +VS + DVYSFGV++LEL+TGKAP  +    +GVDLP WV++
Sbjct  509   TTPNRATGYRAPEVTDPKRVSQKGDVYSFGVVVLELITGKAPSNSVMNEEGVDLPRWVKS  568

Query  884   MFREKPICDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
             + RE+   +VFDS  L+ A +    + +++++ I CT  +P+KRP M+ V  +I+
Sbjct  569   VVREEWRREVFDSELLSLATEEEVMMEEMVELGIECTSMHPDKRPEMSQVVRKIE  623



>ref|XP_009409092.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=674

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 152/287 (53%), Positives = 192/287 (67%), Gaps = 1/287 (0%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG G    +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   L   EF 
Sbjct  346   KLVFFGGGPRAFDLEDLLRASAEVLGKGTFGTAYKAVLETGVTVAVKRLKDVNLEEREFK  405

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M H NL+PL AY +N  E LLVYD+M MGSL+  LHGN G  +  LNWE RT
Sbjct  406   EKIETIGAMDHPNLVPLVAYYFNKDEKLLVYDYMPMGSLSALLHGNRGSGRTPLNWETRT  465

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSG  727
              IA   A  IQ +H+ G +  HGNI+SSN+ LT   + RVS+  L  L    S    V+G
Sbjct  466   GIALAAAQGIQYIHSTGPSASHGNIKSSNILLTKSYDARVSDHGLALLAGAASAPTRVAG  525

Query  728   YRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPIC  907
             YRAPEVT P +VS ++DVYSFGVLLLELLTGKAP +A    +GVDLP WV+++ +E+   
Sbjct  526   YRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAQALLNEEGVDLPRWVQSVVKEEWTA  585

Query  908   DVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +VFD  L + +   E +VQLLQ+AI C  QYP+KRPSM  V  +I +
Sbjct  586   EVFDVELLRYQNVEEDMVQLLQLAIDCVAQYPDKRPSMPEVVVRIDE  632



>ref|XP_002883091.1| hypothetical protein ARALYDRAFT_479268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59350.1| hypothetical protein ARALYDRAFT_479268 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   256 bits (654),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 197/291 (68%), Gaps = 5/291 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  339   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFK  398

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  +  LNWEVR+
Sbjct  399   EKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEVRS  458

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+S  S   +  +
Sbjct  459   GIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRAT  518

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  519   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVPREEWR  578

Query  905   CDVFDSTLAKAEQNveq---lvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E  V     + ++LQ+ I CT Q+P+KRP M  V  +I++
Sbjct  579   NEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQE  629



>emb|CDY67567.1| BnaCnng55470D [Brassica napus]
Length=583

 Score =   254 bits (650),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 198/291 (68%), Gaps = 5/291 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     EL+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  283   KLVFFGNATKVFELEDLLRASAEVLGKGTFGTAYKAVLDAATLVAVKRLKDVTMADREFK  342

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY  +  E LLVYD M MGSL+  LHGN+G  ++ L+WEVR 
Sbjct  343   EKIEVVGAMDHENLVPLRAYYCSGDEKLLVYDFMPMGSLSALLHGNKGAGRSPLDWEVRA  402

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+   S   + V+
Sbjct  403   RIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSSTTPNRVT  462

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  463   GYRAPEVTDPSRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVEREEWR  522

Query  905   CDVFDS---TLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS   +L + +    ++ ++LQ+ I CT Q+P+KRP M  V  +I++
Sbjct  523   REVFDSELMSLERVDSVEGEMEEMLQLGIECTEQHPDKRPVMVEVVRRIQE  573



>ref|XP_010505998.1| PREDICTED: probable inactive receptor kinase RLK902 [Camelina 
sativa]
Length=643

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/288 (52%), Positives = 200/288 (69%), Gaps = 6/288 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  350   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFK  409

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  ++ LNWE+R+
Sbjct  410   EKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRSPLNWEIRS  469

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+S  S   + V+
Sbjct  470   RIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRVT  529

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  530   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWR  589

Query  905   CDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E+    +V++LQ+ I CT Q+P+KRP M  V  +I++
Sbjct  590   NEVFDSELMVEEE----MVEMLQLGIDCTEQHPDKRPVMVEVVSRIQE  633



>ref|XP_002891438.1| hypothetical protein ARALYDRAFT_891670 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67697.1| hypothetical protein ARALYDRAFT_891670 [Arabidopsis lyrata subsp. 
lyrata]
Length=654

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/288 (50%), Positives = 201/288 (70%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  352   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFK  411

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN G  ++ LNW+VR+
Sbjct  412   EKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHGNRGAGRSPLNWDVRS  471

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
              IA G    +  LH+QG++  HGNI+SSN+ LT   + +VS+F L QL+ S  +  +  +
Sbjct  472   RIAIGAGRGLAYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSATNPNRAT  531

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DVYSFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  532   GYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWR  591

Query  905   CDVFDST-LAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS  L+ A +  E + +++Q+ + CT Q+P+KRP M+ V  +++
Sbjct  592   REVFDSELLSLAREEEEMMAEMVQLGLECTSQHPDKRPEMSEVVRKME  639



>ref|XP_004162958.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Cucumis 
sativus]
Length=628

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/290 (49%), Positives = 202/290 (70%), Gaps = 1/290 (0%)
 Frame = +2

Query  182   VKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVD  358
             V  KLVFF +     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRL    ++  
Sbjct  330   VVKKLVFFDNTARVFDLEDLLRASAEVLGKGTFGTAYKAVLEIGHVVAVKRLMDVTISER  389

Query  359   EFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWE  538
             EF E++  +G M H+NL+PL+AY ++  E LLV+D+M+MGSL+  LHGN+   +  LNWE
Sbjct  390   EFKEKIEAVGAMDHKNLVPLKAYYFSVDEKLLVFDYMAMGSLSALLHGNKRCGRTPLNWE  449

Query  539   VRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL  718
             +R  IA GVA  I+ LH+QG  + HGNI+SSN+ L +  + RVS+F L QL+ P S  + 
Sbjct  450   MRRGIASGVARGIKYLHSQGPNVSHGNIKSSNILLADPYDARVSDFGLAQLVGPASSPNR  509

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             V+GYRAP+V    +VS ++DVYSFGVLLLELLTGKAP       +GVDLP WV+++ +E+
Sbjct  510   VAGYRAPDVIDTRKVSQKADVYSFGVLLLELLTGKAPSHGVLNEEGVDLPRWVQSVVQEE  569

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
                +VFD  L + E   E++VQ+L++A+ C  Q+P++RPSM  V+ +I++
Sbjct  570   WKLEVFDVELLRYESIEEEMVQMLELALDCATQHPDRRPSMFEVSSRIEE  619



>emb|CDX92167.1| BnaA05g22400D [Brassica napus]
Length=624

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 200/291 (69%), Gaps = 3/291 (1%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             + KLVFFG+     EL+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  E
Sbjct  324   RRKLVFFGNATKVFELEDLLRASAEVLGKGTFGTAYKAVLDAATMVAVKRLKDVTMADRE  383

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  ++ L+WEV
Sbjct  384   FKEKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRSPLDWEV  443

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDL  718
             R+ IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+ S  +  + 
Sbjct  444   RSRIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSTATTNR  503

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             V+GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE 
Sbjct  504   VTGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVGREA  563

Query  899   PICDVFDSTLAKAEQNve-qlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
                +VFDS L   E  VE ++ ++LQ+ I CT  +P+KRP M  V  +I++
Sbjct  564   WRSEVFDSELMSLETVVEGEMEEMLQLGIECTEPHPDKRPVMVEVVRRIQE  614



>ref|XP_004985160.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Setaria 
italica]
Length=675

 Score =   256 bits (654),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/289 (51%), Positives = 196/289 (68%), Gaps = 3/289 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy---elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KL+FFG        +L+DLLR++A VLGKG FGT+YK+ +   +AVAVKRLK   L   E
Sbjct  362   KLIFFGPMAAAPPFDLEDLLRASAEVLGKGAFGTAYKAVMENGSAVAVKRLKDVDLPEPE  421

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+  +G + HE ++PLRAY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE 
Sbjct  422   FRERIAAIGAVQHELVVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWET  481

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R++IA   A  +  +H+ G T  HGNI+SSNV LT   E RVS+  L  L+ P      V
Sbjct  482   RSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRV  541

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             SGYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+ 
Sbjct  542   SGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEW  601

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
               +VFD  L + +   E++VQLLQ+AI C+ Q+P++RP+MA VA +I +
Sbjct  602   TAEVFDQELLRYQNVEEEMVQLLQLAIDCSAQHPDRRPTMAEVATRIDE  650



>gb|AAN05336.1| Putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABF94713.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ26109.1| hypothetical protein OsJ_09969 [Oryza sativa Japonica Group]
 dbj|BAG89413.1| unnamed protein product [Oryza sativa Japonica Group]
Length=675

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 199/293 (68%), Gaps = 6/293 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy---elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KL+FFG        +L+DLLR++A VLGKG FGT+YK+ +   +AVAVKRLK   L   E
Sbjct  364   KLIFFGPMAAAPPFDLEDLLRASAEVLGKGAFGTAYKAVMESGSAVAVKRLKDVDLPEPE  423

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+  +G + HE ++PLRAY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE 
Sbjct  424   FRERIAAIGAVQHELVVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWET  483

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R++IA   A  +  +H+ G T  HGNI+SSNV LT   E RVS+  L  L+ P      V
Sbjct  484   RSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRV  543

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             SGYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+ 
Sbjct  544   SGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEW  603

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKT  1051
               +VFD  L + +   E++VQLLQ+AI C+ Q+P++RPSM+ VA   D+I+++
Sbjct  604   TAEVFDQELLRYQNVEEEMVQLLQLAIDCSAQHPDRRPSMSEVAARIDEIRRS  656



>ref|XP_010487681.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X1 
[Camelina sativa]
 ref|XP_010487682.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X2 
[Camelina sativa]
Length=647

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/288 (51%), Positives = 198/288 (69%), Gaps = 2/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  350   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFK  409

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  +  LNW++R+
Sbjct  410   EKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWQIRS  469

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LT+  + RVS+F L QL+S  S   +  +
Sbjct  470   RIALGAARGLDYLHSQDPLSSHGNVKSSNILLTSSHDARVSDFGLAQLVSTSSTTPNRAT  529

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  530   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNDEGMDLARWVHSVAREEWR  589

Query  905   CDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E   E++ ++LQ+ I CT Q+P+KRP M  V  +I++
Sbjct  590   NEVFDSELMSIEMVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQE  637



>ref|XP_009113711.1| PREDICTED: probable inactive receptor kinase RLK902 [Brassica 
rapa]
Length=632

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/291 (51%), Positives = 199/291 (68%), Gaps = 5/291 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     EL+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  332   KLVFFGNATKVFELEDLLRASAEVLGKGTFGTAYKAVLDAATMVAVKRLKDVTMADREFM  391

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY  +  E LLVYD MSMGSL+  LHGN+G  ++ L+WEVR 
Sbjct  392   EKIAVVGAMDHENLVPLRAYYCSGDEKLLVYDFMSMGSLSALLHGNKGAGRSPLDWEVRA  451

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+   S   + V+
Sbjct  452   RIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSSATPNRVT  511

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  512   GYRAPEVTDPSRVSQKADVYSFGVVLLELLTGKAPSNSAMNEEGMDLARWVHSVEREEWR  571

Query  905   CDVFDS---TLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS   +L + +    ++ ++LQ+ I CT Q+P+KRP M  V  +I++
Sbjct  572   REVFDSELMSLERVDSVEGEMEEMLQLGIDCTEQHPDKRPVMVEVVRRIQE  622



>emb|CDX95816.1| BnaC05g35670D [Brassica napus]
Length=590

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/289 (51%), Positives = 198/289 (69%), Gaps = 3/289 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     EL+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  292   KLVFFGNATKVFELEDLLRASAEVLGKGTFGTAYKAVLDAATMVAVKRLKDVTMADREFK  351

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M +GSL+  LHGN+G  ++ L+WEVR+
Sbjct  352   EKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPIGSLSALLHGNKGAGRSPLDWEVRS  411

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + R+S+F L QL+ S  +  + V+
Sbjct  412   RIALGAARGLDYLHSQDPLTSHGNVKSSNILLTNSHDARLSDFGLAQLVGSSTTTTNRVT  471

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ +E   
Sbjct  472   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVGKEAWR  531

Query  905   CDVFDSTLAKAEQNveqlvqll-qvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E  VE  ++ + Q+ I CT Q+P+KRP M  V  +I++
Sbjct  532   SEVFDSELMSLETVVEGEMEEMLQLGIECTEQHPDKRPVMVEVVRRIQE  580



>gb|KGN63945.1| hypothetical protein Csa_1G031200 [Cucumis sativus]
Length=628

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/290 (49%), Positives = 202/290 (70%), Gaps = 1/290 (0%)
 Frame = +2

Query  182   VKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVD  358
             V  KLVFF +     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRL    ++  
Sbjct  330   VVKKLVFFDNTARVFDLEDLLRASAEVLGKGTFGTAYKAVLEIGHVVAVKRLMDVTISER  389

Query  359   EFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWE  538
             EF E++  +G M H+NL+PL+AY ++  E LLV+D+M+MGSL+  LHGN+   +  LNWE
Sbjct  390   EFKEKIEAVGAMDHKNLVPLKAYYFSVDEKLLVFDYMAMGSLSALLHGNKRCGRTPLNWE  449

Query  539   VRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL  718
             +R  IA GVA  I+ LH+QG  + HGNI+SSN+ L +  + RVS+F L QL+ P S  + 
Sbjct  450   MRRGIASGVARGIKYLHSQGPNVSHGNIKSSNILLADPYDARVSDFGLAQLVGPASSPNR  509

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             V+GYRAP+V    +VS ++DVYSFGVLLLELLTGKAP       +GVDLP WV+++ +E+
Sbjct  510   VAGYRAPDVIDTRKVSQKADVYSFGVLLLELLTGKAPSHGVLNEEGVDLPRWVQSVVQEE  569

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
                +VFD  L + E   E++VQ+L++A+ C  Q+P++RPSM  V+ +I++
Sbjct  570   WKLEVFDVELLRYEGIEEEMVQMLELALDCATQHPDRRPSMFEVSSRIEE  619



>ref|XP_002468249.1| hypothetical protein SORBIDRAFT_01g042480 [Sorghum bicolor]
 gb|EER95247.1| hypothetical protein SORBIDRAFT_01g042480 [Sorghum bicolor]
Length=674

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/287 (51%), Positives = 195/287 (68%), Gaps = 3/287 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy---elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KL+FFG        +L+DLLR++A VLGKG FGT+YK+ +   +AVAVKRLK   L   E
Sbjct  362   KLIFFGPMAAAPPFDLEDLLRASAEVLGKGAFGTAYKAVMENGSAVAVKRLKDVDLPEPE  421

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+  +G + HE ++PLRAY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE 
Sbjct  422   FRERIAAIGAVQHELVVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWET  481

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R++IA   A  +  +H+ G T  HGNI+SSNV LT   E RVS+  L  L+ P      V
Sbjct  482   RSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRV  541

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             SGYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+ 
Sbjct  542   SGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEW  601

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQI  1042
               +VFD  L + +   E++VQLLQ+AI C+ Q+P++RP+M+ VA +I
Sbjct  602   TAEVFDQELLRYQNVEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRI  648



>ref|XP_010670123.1| PREDICTED: probable inactive receptor kinase At5g16590 [Beta 
vulgaris subsp. vulgaris]
Length=662

 Score =   255 bits (651),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 138/271 (51%), Positives = 186/271 (69%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKG +GT+YK+ L    AVAVKRLK   +   EF E++ E+GK+ HENL+ LR
Sbjct  366   RASAEVLGKGNYGTTYKAALDNGVAVAVKRLKEVTVTEKEFKEKLEEIGKLEHENLVGLR  425

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY  + +E LLVYD+  MGSL+  LHGN G  +  LNWE R++IA G A  I  +H+Q S
Sbjct  426   AYHCSANEKLLVYDYFPMGSLSALLHGNRGGGRTPLNWETRSAIALGAARGITYIHSQNS  485

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
                HGNI+SSN+ L+N  E RVS+  L QL +P +  + V+GYRAPE+T   +VS ++DV
Sbjct  486   KASHGNIKSSNILLSNSYEARVSDCGLAQLANPSTTPNRVAGYRAPEITDARKVSQKADV  545

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGV LLELLTGKAP       +GVDLP WV+++ RE+   +VFD  L + +   E +V
Sbjct  546   YSFGVFLLELLTGKAPTHTLLNEEGVDLPRWVQSVVREEWASEVFDMELLRYQNVEEDMV  605

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +LLQ+AI CT QYP+ RPSM+ V  +I++ C
Sbjct  606   KLLQLAIDCTVQYPDSRPSMSEVTSRIEEIC  636



>ref|XP_003558467.1| PREDICTED: probable inactive receptor kinase At1g48480 [Brachypodium 
distachyon]
 ref|XP_010228954.1| PREDICTED: probable inactive receptor kinase At1g48480 [Brachypodium 
distachyon]
Length=676

 Score =   255 bits (651),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 186/275 (68%), Gaps = 3/275 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKG FGT+YK+ +    AVAVKRLK   L   EF ER+  +G + HE ++PLR
Sbjct  383   RASAEVLGKGAFGTAYKAVMESGAAVAVKRLKDVDLPEPEFRERIAAIGAVQHELVVPLR  442

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE R++IA   A  +  +H+ G 
Sbjct  443   AYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWETRSAIALAAARGVAHIHSTGP  502

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSNV LT   E RVS+  L  L+ P      VSGYRAPEVT   +VS ++DV
Sbjct  503   TASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRVSGYRAPEVTDIRRVSQKADV  562

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+   +VFD  L + +   E++V
Sbjct  563   YSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEWTAEVFDQELLRYQSVEEEMV  622

Query  962   qllqvAICCTFQYPNKRPSM---AAVADQIKKTCS  1057
             QLLQ+AI C+ Q+P++RP+M   AA  D+I+++ S
Sbjct  623   QLLQLAIDCSAQHPDRRPTMSDAAARIDEIRRSSS  657



>gb|AFW89165.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=669

 Score =   255 bits (651),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 196/289 (68%), Gaps = 3/289 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy---elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KL+FFG        +L+DLLR++A VLGKG FGT+YK+ +   +AVAVKRLK   L   E
Sbjct  359   KLIFFGPMAAAPPFDLEDLLRASAEVLGKGAFGTAYKAVMENGSAVAVKRLKDVDLPEPE  418

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+  +G + HE ++PLRAY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE 
Sbjct  419   FRERIAAIGAVQHELVVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWET  478

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R++IA   A  +  +H+ G T  HGNI+SSNV LT   E RVS+  L  L+ P      V
Sbjct  479   RSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRV  538

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             SGYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+ 
Sbjct  539   SGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEW  598

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
               +VFD  L + +   E++VQLLQ+AI C+ Q+P++RP+M+ VA +I +
Sbjct  599   TAEVFDQELLRYQNVEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDE  647



>ref|NP_001152341.1| LOC100285980 precursor [Zea mays]
 gb|ACG47114.1| atypical receptor-like kinase MARK [Zea mays]
Length=669

 Score =   255 bits (651),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 146/294 (50%), Positives = 199/294 (68%), Gaps = 6/294 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy---elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KL+FFG        +L+DLLR++A VLGKG FGT+YK+ +   +AVAVKRLK   L   E
Sbjct  359   KLIFFGPMAAAPPFDLEDLLRASAEVLGKGAFGTAYKAVMENGSAVAVKRLKDVDLPEPE  418

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+  +G + HE ++PLRAY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE 
Sbjct  419   FRERIAAIGAVQHELVVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWET  478

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R++IA   A  +  +H+ G T  HGNI+SSNV LT   E RVS+  L  L+ P      V
Sbjct  479   RSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRV  538

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             SGYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+ 
Sbjct  539   SGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEW  598

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
               +VFD  L + +   E++VQLLQ+AI C+ Q+P++RP+M+ VA   D+I+++ 
Sbjct  599   TAEVFDQELLRYQNVEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSS  652



>gb|KCW52164.1| hypothetical protein EUGRSUZ_J01604 [Eucalyptus grandis]
Length=629

 Score =   254 bits (648),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 155/345 (45%), Positives = 213/345 (62%), Gaps = 9/345 (3%)
 Frame = +2

Query  38    ARPGLNRPGIIKEIYSKENRPACRNQEQIKAKKSC---ELYNIMAWSPDAIVKSKLVFFg  208
             +R G  +P   K + S+  R A     Q +  KS    +  +    S D  V   LVFFG
Sbjct  258   SRGGGEKP---KSLESQAARGAEAEIAQTREAKSVGEPKASSAAVISGDKSVNKSLVFFG  314

Query  209   dgdgyel---ddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVH  379
              GD       +DLLR++A VLG+GTFGT+YK+ L     VAVKRLK   +   EF ER+ 
Sbjct  315   KGDAVAAFDLEDLLRASAEVLGRGTFGTTYKATLETGITVAVKRLKDLSVGEAEFRERMR  374

Query  380   ELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAY  559
             + G + HENL+ LRAY +N  E LLVY+++ +GSL+  LHGN    +  LNW+ R  IA 
Sbjct  375   QTGAVEHENLVGLRAYYYNKDERLLVYEYLPIGSLSALLHGNSVVGRTPLNWDTRCDIAL  434

Query  560   GVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAP  739
             G A  I  LH+Q +   HGNI+SSNV LT   + RVS+F L  + +  +  + + GYRAP
Sbjct  435   GAARGIAHLHSQDAVTSHGNIKSSNVLLTKSYKARVSDFSLAPIANLIAAPNRIDGYRAP  494

Query  740   EVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFD  919
             EVT  H+VS ++DVYSFGVLLLELLTGKAP  +    +GVDLP WV+++ +E+   +VFD
Sbjct  495   EVTDYHKVSQKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWVQSVVKEEWTAEVFD  554

Query  920   STLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
               L + +   E +V+LLQ+A+ C  QYP+KRP MA V ++I++ C
Sbjct  555   DELLRYQDVEEDMVELLQLAMHCAAQYPDKRPPMAQVVNKIEEIC  599



>emb|CDY61284.1| BnaA01g36890D [Brassica napus]
Length=632

 Score =   254 bits (648),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 147/291 (51%), Positives = 198/291 (68%), Gaps = 5/291 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     EL+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  332   KLVFFGNATKVFELEDLLRASAEVLGKGTFGTAYKAVLDAATMVAVKRLKDVTMADREFK  391

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY  +  E LLVYD M MGSL+  LHGN+G  ++ L+WEVR 
Sbjct  392   EKIEVVGAMDHENLVPLRAYYCSGDEKLLVYDFMPMGSLSALLHGNKGAGRSPLDWEVRA  451

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+   S   + V+
Sbjct  452   RIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSSATPNRVT  511

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  512   GYRAPEVTDPSRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVEREEWR  571

Query  905   CDVFDS---TLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS   +L + +    ++ ++LQ+ I CT Q+P+KRP M  V  +I++
Sbjct  572   REVFDSELMSLERVDSVEGEMEEMLQLGIDCTEQHPDKRPVMVEVVRRIQE  622



>ref|NP_001049422.1| Os03g0223000 [Oryza sativa Japonica Group]
 dbj|BAF11336.1| Os03g0223000, partial [Oryza sativa Japonica Group]
Length=713

 Score =   255 bits (652),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 199/293 (68%), Gaps = 6/293 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy---elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KL+FFG        +L+DLLR++A VLGKG FGT+YK+ +   +AVAVKRLK   L   E
Sbjct  402   KLIFFGPMAAAPPFDLEDLLRASAEVLGKGAFGTAYKAVMESGSAVAVKRLKDVDLPEPE  461

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+  +G + HE ++PLRAY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE 
Sbjct  462   FRERIAAIGAVQHELVVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWET  521

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R++IA   A  +  +H+ G T  HGNI+SSNV LT   E RVS+  L  L+ P      V
Sbjct  522   RSAIALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRV  581

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             SGYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+ 
Sbjct  582   SGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEW  641

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKT  1051
               +VFD  L + +   E++VQLLQ+AI C+ Q+P++RPSM+ VA   D+I+++
Sbjct  642   TAEVFDQELLRYQNVEEEMVQLLQLAIDCSAQHPDRRPSMSEVAARIDEIRRS  694



>ref|XP_008660393.1| PREDICTED: probable inactive receptor kinase At1g48480 [Zea mays]
 gb|AFW89168.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=672

 Score =   254 bits (648),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 145/294 (49%), Positives = 199/294 (68%), Gaps = 6/294 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy---elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KL+FFG        +L+DLLR++A VLGKG FGT+YK+ +   +AVAVKRLK   L   E
Sbjct  362   KLIFFGPMAAAPPFDLEDLLRASAEVLGKGAFGTAYKAVMENGSAVAVKRLKDVDLPEPE  421

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+  +G + HE ++PLRAY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE 
Sbjct  422   FRERIAVIGAVQHELVVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRASGRTPLDWET  481

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+++A   A  +  +H+ G T  HGNI+SSNV LT   E RVS+  L  L+ P      V
Sbjct  482   RSAVALAAARGVAHIHSTGPTASHGNIKSSNVLLTKNYEARVSDHGLPTLVGPSFSPTRV  541

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             SGYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+ 
Sbjct  542   SGYRAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEW  601

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
               +VFD  L + +   E++VQLLQ+AI C+ Q+P++RP+M+ VA   D+I+++ 
Sbjct  602   TAEVFDQELLRYQNVEEEMVQLLQLAIDCSAQHPDRRPAMSEVATRIDEIRRSS  655



>ref|XP_009390851.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=654

 Score =   253 bits (647),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 144/296 (49%), Positives = 193/296 (65%), Gaps = 5/296 (2%)
 Frame = +2

Query  185   KSKLVFFgdgdgye--lddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVD  358
             + KLVFF         L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRL+       
Sbjct  335   EKKLVFFVGSGAPRFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTTVAVKRLRDVAFTET  394

Query  359   EFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWE  538
             EF E+V  +G M H NL+PLRAY ++  E LLVYD++ +GSL+  LHGN G  +  L+WE
Sbjct  395   EFREKVELIGAMNHPNLVPLRAYYYSKDEKLLVYDYLPLGSLSALLHGNRGSTRTPLDWE  454

Query  539   VRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL  718
              RT IA   A  I+ +H+   +  HGNI+SSN+ L    E RVS+  L  L  P S    
Sbjct  455   TRTGIALAAARGIEYIHSTSPSAAHGNIKSSNILLAATREARVSDHGLALLAGPQSSPAR  514

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAK---GKGVDLPNWVRAMF  889
              +GYRAPEVT   +VS ++DVYSFGVLLLELLTGK+P +A +    G GVDLP WV+++ 
Sbjct  515   AAGYRAPEVTDTRRVSQKADVYSFGVLLLELLTGKSPGQALSNDDDGGGVDLPRWVQSVV  574

Query  890   REKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
             +E+   +VFD  L + +   E++V+LLQ+A+ C  QYP+KRPSMA V  +I++  S
Sbjct  575   QEEWTAEVFDVELLRQQDAEEEMVRLLQLAVDCAAQYPDKRPSMAEVVARIQEIRS  630



>ref|XP_010032718.1| PREDICTED: probable inactive receptor kinase At3g02880 [Eucalyptus 
grandis]
Length=662

 Score =   253 bits (647),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 196/299 (66%), Gaps = 3/299 (1%)
 Frame = +2

Query  167   SPDAIVKSKLVFFgdgdgyel---ddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLK  337
             S D  V   LVFFG GD       +DLLR++A VLG+GTFGT+YK+ L     VAVKRLK
Sbjct  334   SGDKSVNKSLVFFGKGDAVAAFDLEDLLRASAEVLGRGTFGTTYKATLETGITVAVKRLK  393

Query  338   IGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKN  517
                +   EF ER+ + G + HENL+ LRAY +N  E LLVY+++ +GSL+  LHGN    
Sbjct  394   DLSVGEAEFRERMRQTGAVEHENLVGLRAYYYNKDERLLVYEYLPIGSLSALLHGNSVVG  453

Query  518   KASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLS  697
             +  LNW+ R  IA G A  I  LH+Q +   HGNI+SSNV LT   + RVS+F L  + +
Sbjct  454   RTPLNWDTRCDIALGAARGIAHLHSQDAVTSHGNIKSSNVLLTKSYKARVSDFSLAPIAN  513

Query  698   PDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWV  877
               +  + + GYRAPEVT  H+VS ++DVYSFGVLLLELLTGKAP  +    +GVDLP WV
Sbjct  514   LIAAPNRIDGYRAPEVTDYHKVSQKADVYSFGVLLLELLTGKAPTHSLLNEEGVDLPRWV  573

Query  878   RAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +++ +E+   +VFD  L + +   E +V+LLQ+A+ C  QYP+KRP MA V ++I++ C
Sbjct  574   QSVVKEEWTAEVFDDELLRYQDVEEDMVELLQLAMHCAAQYPDKRPPMAQVVNKIEEIC  632



>gb|AAK18840.1|AC082645_10 putative receptor kinase [Oryza sativa Japonica Group]
 gb|ABF98524.1| atypical receptor-like kinase MARK, putative, expressed [Oryza 
sativa Japonica Group]
Length=686

 Score =   254 bits (649),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 203/327 (62%), Gaps = 18/327 (6%)
 Frame = +2

Query  128   AKKSCELYNIMAWSPDAIVKS------------KLVFFgdgdgyel---ddllRSTAGVL  262
              +K  E+ +  A +P A V +            KL+FFG          +DLLR++A VL
Sbjct  324   GRKPPEMTSAAAVAPMATVGNPHAPLGQSTSGKKLIFFGSAAAVAPFDLEDLLRASAEVL  383

Query  263   GKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPS  442
             GKG FGT+YK+ L     VAVKRLK   L   EF +R+ ++G++ HE ++PLRAY ++  
Sbjct  384   GKGAFGTTYKAVLESGATVAVKRLKDVTLTEPEFRDRIADIGELQHEFIVPLRAYYYSKD  443

Query  443   EILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNI  622
             E LLVYD M MGSL+  LHGN G  +  LNWE R+SIA   A  ++ +H+  S+  HGNI
Sbjct  444   EKLLVYDFMPMGSLSAVLHGNRGSGRTPLNWETRSSIALAAARGVEYIHSTSSSASHGNI  503

Query  623   RSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLL  802
             +SSNV L    + R+S+  L  L+ P S     SGYRAPEVT P +VS ++DVYSFGVLL
Sbjct  504   KSSNVLLNKSYQARLSDNGLSALVGPSSAPSRASGYRAPEVTDPRRVSQKADVYSFGVLL  563

Query  803   LELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAI  982
             LELLTGKAP +A    +GVDLP WV+++ R +   +VFD  L + +   EQ+VQLLQ+AI
Sbjct  564   LELLTGKAPSQAALNDEGVDLPRWVQSVVRSEWTAEVFDMELLRYQNVEEQMVQLLQLAI  623

Query  983   CCTFQYPNKRPSMAAVA---DQIKKTC  1054
              C  Q P+ RPSM  V    ++IKK+ 
Sbjct  624   DCVAQVPDARPSMPHVVLRIEEIKKSS  650



>ref|XP_006651742.1| PREDICTED: probable inactive receptor kinase At1g48480-like, 
partial [Oryza brachyantha]
Length=608

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/322 (46%), Positives = 200/322 (62%), Gaps = 15/322 (5%)
 Frame = +2

Query  128   AKKSCELYNIMAWSPDAIVK------------SKLVFFgdgdgyel---ddllRSTAGVL  262
              +K  E+ +  A +P A V              KL+FFG          +DLLR++A VL
Sbjct  246   GRKPPEMTSAAAVAPMATVGHPHAPLGQSTSGKKLIFFGSAAAVSPFDLEDLLRASAEVL  305

Query  263   GKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPS  442
             GKG FGT+YK+ L     VAVKRLK   L+  EF +R+ ++G++ HE ++PLRAY ++  
Sbjct  306   GKGAFGTTYKAVLESGATVAVKRLKDVTLSEPEFRDRIADIGELQHEFIVPLRAYYYSKD  365

Query  443   EILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNI  622
             E LLVYD M MGSL+  LHGN G  +  LNWE R+SIA   A  ++ +H+  S+  HGNI
Sbjct  366   EKLLVYDFMPMGSLSAVLHGNRGSGRTPLNWETRSSIALAAARGVEYIHSTSSSASHGNI  425

Query  623   RSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLL  802
             +SSNV LT   + RVS+  L  L+ P S     +GYRAPEVT P +V  ++DVYSFGVLL
Sbjct  426   KSSNVLLTKSYQARVSDNGLSALVGPSSAPSRATGYRAPEVTDPRRVPQKADVYSFGVLL  485

Query  803   LELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAI  982
             LELLTGKAP +A    +GVDLP WV+++ R +   +VFD  L + +   EQ+VQLLQ+AI
Sbjct  486   LELLTGKAPSQAALNDEGVDLPRWVQSVVRSEWTAEVFDMELLRYQHVEEQMVQLLQLAI  545

Query  983   CCTFQYPNKRPSMAAVADQIKK  1048
              C    P+ RPSM  V  +I++
Sbjct  546   DCVASVPDARPSMPHVVLRIEE  567



>ref|XP_006406685.1| hypothetical protein EUTSA_v10020262mg [Eutrema salsugineum]
 gb|ESQ48138.1| hypothetical protein EUTSA_v10020262mg [Eutrema salsugineum]
Length=648

 Score =   253 bits (645),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/291 (49%), Positives = 191/291 (66%), Gaps = 5/291 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  348   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFK  407

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  +  L+WE+R+
Sbjct  408   EKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRTPLDWEIRS  467

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q     HGN+++SN+ LTN  + RVS+F L QL+   S   + V+
Sbjct  468   RIALGAARGLDYLHSQDPLSSHGNVKASNILLTNSHDARVSDFGLAQLVGSSSTTPNRVT  527

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  528   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVEREEWR  587

Query  905   CDVFDSTLAKAEQNveqlvqllqv---AICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E       ++  +    I CT Q+P KRP M  V  +I +
Sbjct  588   SEVFDSELMSLETVASVEEEMAGMLQLGIDCTEQHPEKRPVMVEVVRRIHE  638



>gb|KFK39109.1| hypothetical protein AALP_AA3G202300 [Arabis alpina]
Length=649

 Score =   253 bits (645),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 196/291 (67%), Gaps = 5/291 (2%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     EL+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A   F 
Sbjct  349   KLVFFGNATKVFELEDLLRASAEVLGKGTFGTAYKAVLDAATLVAVKRLKDVTMADRVFK  408

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  ++ L+WE+R+
Sbjct  409   EKIETVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRSPLDWEIRS  468

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVS  724
              IA G A  +  LH+Q     HGN++SSN+ LTN  + RVS+F L QL+ S  +  + V+
Sbjct  469   RIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVGSSTTTPNRVT  528

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE+  
Sbjct  529   GYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVEREEWR  588

Query  905   CDVFDSTLAKAEQNveqlvqllqv---AICCTFQYPNKRPSMAAVADQIKK  1048
              +VFDS L   E  V    ++ ++    + CT Q+P+KRP M  V  +I++
Sbjct  589   SEVFDSELMSLETVVSVEAEMAEMLQLGLECTEQHPDKRPVMVEVVKRIQE  639



>dbj|BAJ89911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97284.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=689

 Score =   252 bits (643),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 184/275 (67%), Gaps = 3/275 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKG FGT+YK+ +    AVAVKRLK   L   EF ER+  +G + HE ++PLR
Sbjct  393   RASAEVLGKGAFGTAYKAVMESGAAVAVKRLKDVDLPEPEFRERIAAIGAVQHELVVPLR  452

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD+MSMGSL+  LHGN       L+WE R++IA   A  +  +H+ G 
Sbjct  453   AYYFSKDEKLLVYDYMSMGSLSALLHGNRSSGLTPLDWEARSAIALATARGVAHIHSTGP  512

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSNV LT   E RVS+  L  L+ P      VSGYRAPEVT   +VS ++DV
Sbjct  513   TASHGNIKSSNVLLTKSYEARVSDHGLPTLVGPSFSPTRVSGYRAPEVTDIRRVSQKADV  572

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+   +VFD  L +     E++V
Sbjct  573   YSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEWTAEVFDQELLRYHNVEEEMV  632

Query  962   qllqvAICCTFQYPNKRPSM---AAVADQIKKTCS  1057
             QLLQ+AI C+ Q+P++RP+M   AA  D+I+++ S
Sbjct  633   QLLQLAIDCSAQHPDRRPNMSDAAARIDEIRRSAS  667



>ref|XP_009390354.1| PREDICTED: probable inactive receptor kinase RLK902 [Musa acuminata 
subsp. malaccensis]
Length=667

 Score =   251 bits (641),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 150/304 (49%), Positives = 197/304 (65%), Gaps = 2/304 (1%)
 Frame = +2

Query  152   NIMAWSPDAIVKS-KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAV  325
             N+ + +P A   + KLVFFG      +L+DLLR++A VLGKGTFGT+YK+ L   T +AV
Sbjct  332   NVQSATPVAAAGAEKLVFFGGRAALFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTTLAV  391

Query  326   KRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGN  505
             KRL+   L   EF E+V  +G M H  L+PLRAY ++  E LLVYD+M +GSL+  LHGN
Sbjct  392   KRLRDVALTEREFREKVEVIGAMDHPTLVPLRAYLYSKDEKLLVYDYMPLGSLSALLHGN  451

Query  506   EGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLG  685
              G  +  LN E R  I    A  I+ +H+ G    HGNI+SSN+ LT   E R+S+  L 
Sbjct  452   RGSGRTPLNLETRIGIVLAAARGIEYIHSAGPWASHGNIKSSNILLTKSYEGRLSDHGLA  511

Query  686   QLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDL  865
              L  P S    VSGYRAPEVT P +VS ++DVYSFGVLLLELLTGKAP +A    +GVDL
Sbjct  512   LLAGPISSPTRVSGYRAPEVTDPCRVSQKADVYSFGVLLLELLTGKAPTQALLNDEGVDL  571

Query  866   PNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
             P WVR++ R++   +VFD  L + +   E++VQLLQ+AI C  Q P+ RPSM  V  +I+
Sbjct  572   PRWVRSIVRDEWAAEVFDPELLRYQNVEEEMVQLLQLAINCAAQSPDMRPSMPEVVVRIE  631

Query  1046  KTCS  1057
             +  S
Sbjct  632   EIRS  635



>ref|XP_009145968.1| PREDICTED: probable inactive receptor kinase RLK902 [Brassica 
rapa]
Length=631

 Score =   250 bits (638),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 147/292 (50%), Positives = 197/292 (67%), Gaps = 3/292 (1%)
 Frame = +2

Query  182   VKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVD  358
              + KLVFFG+     EL+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  
Sbjct  330   TRRKLVFFGNATKVFELEDLLRASAEVLGKGTFGTAYKAVLDAATMVAVKRLKDVTMADR  389

Query  359   EFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWE  538
             EF E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  ++ L+WE
Sbjct  390   EFKEKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRSPLDWE  449

Query  539   VRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKLD  715
             VR+ IA G A  +  LH+Q     HGN++SSNV LTN  + RVS+F L QL+ S  +  +
Sbjct  450   VRSRIALGAARGLDYLHSQDPLSSHGNVKSSNVLLTNSHDARVSDFGLAQLVGSSTATTN  509

Query  716   LVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFRE  895
              V+GYRAPEVT   +VS ++DVYSFGV+LLELLTGKAP  +    +G+DL  WV ++ RE
Sbjct  510   RVTGYRAPEVTDARRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVGRE  569

Query  896   KPICDVFDSTLAKAEQNveqlvqll-qvAICCTFQYPNKRPSMAAVADQIKK  1048
                 +VF+S L   E  VE  ++ + Q+ I CT  +P+KRP M  V  +I++
Sbjct  570   AWRSEVFESELMSLETVVEGEMEEMLQLGIECTEPHPDKRPVMVEVVRRIQE  621



>ref|XP_010551132.1| PREDICTED: probable inactive receptor kinase At1g48480 [Tarenaya 
hassleriana]
Length=651

 Score =   250 bits (639),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/287 (49%), Positives = 195/287 (68%), Gaps = 2/287 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +A  EF 
Sbjct  354   KLVFFGNATRVFDLEDLLRASAEVLGKGTFGTAYKAVLDAATVVAVKRLKDVTMAEREFR  413

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEG-KNKASLNWEVR  544
             E++  +G M HENL+PLRAY ++  E LLV+D M MGSL+  +HGN G   +  LNWE+R
Sbjct  414   EKIEVVGAMDHENLVPLRAYYYSRDEKLLVHDFMPMGSLSALIHGNRGGPGRTPLNWEIR  473

Query  545   TSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVS  724
               IA G AN +  LH+QG++  HGN +SSN+ LT   E RVS+F L QL+ P    +  +
Sbjct  474   ARIAMGAANGLNYLHSQGTSSSHGNFKSSNILLTKSKEARVSDFGLAQLVGPSPTPNRGT  533

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT   +VS ++DVYSFG+++LELLTGK P+ +    +GVDL  WV +M R +  
Sbjct  534   GYRAPEVTEGRRVSQKADVYSFGMVMLELLTGKPPVNSVMNEEGVDLRRWVESMDRGEWR  593

Query  905   CDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +V DS L + E+   ++ ++LQ+ I CT Q+P+KRP+M  V  +I+
Sbjct  594   SEVLDSELLRNEREAAEMEEMLQLGIECTEQHPDKRPTMEDVVRRIQ  640



>ref|XP_004981996.1| PREDICTED: probable inactive receptor kinase RLK902-like [Setaria 
italica]
Length=692

 Score =   251 bits (641),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/294 (49%), Positives = 190/294 (65%), Gaps = 6/294 (2%)
 Frame = +2

Query  191   KLVFFgdgdgye---lddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KLVFFG         L+DLLR++A VLGKG FGT+YK+ L     VAVKRLK   L+  E
Sbjct  373   KLVFFGSAAAVAPFDLEDLLRASAEVLGKGAFGTTYKAVLESGATVAVKRLKDVTLSEPE  432

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+ E+G++ HE ++PLRAY ++  E LLVYD M MGSL+  LHGN    +  LNWE+
Sbjct  433   FRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPMGSLSAVLHGNRSSGRTPLNWEL  492

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA   A  ++ +H+  ST  HGNI+SSNV L    + RVS+  L  L+ P S     
Sbjct  493   RSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGKSYQARVSDNGLTTLVGPSSSPSRT  552

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             +GYRAPEV    ++S ++DVYSFGVLLLELLTGKAP +A    +GVDLP WV+++ R + 
Sbjct  553   TGYRAPEVIDSRRISQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVNRSEW  612

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
               +VFD  L + +   E + QLLQ+AI C  Q P  RPSMA V    ++IKK+ 
Sbjct  613   SSEVFDMELMRHQNGEEPMAQLLQLAIDCVAQVPEARPSMAHVVMRLEEIKKSS  666



>ref|XP_010558597.1| PREDICTED: probable inactive receptor kinase At5g16590 [Tarenaya 
hassleriana]
Length=619

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 176/263 (67%), Gaps = 3/263 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFG+SYK+       VAVKRL+   +   EF ER+  LG ++H NL+   
Sbjct  341   KASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFRERLQFLGSLSHVNLVTFL  400

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++P E LLVY+ M  GSL+  LHGN+G  ++ LNWE R  IA G A AI  +H+  +
Sbjct  401   AYYFSPDEKLLVYEFMPRGSLSALLHGNKGGGRSPLNWETRAGIALGTARAISYIHSLDT  460

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+   E +VS++CL  L++P S  + + GYRAPEVT   ++S ++DV
Sbjct  461   TTSHGNIKSSNILLSESYEAKVSDYCLAPLITPTSTPNRIDGYRAPEVTDARKISQKADV  520

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE---QNve  952
             YSFGVLLLELLTGK+P +     +GVDLP WV+A+  ++   DVFD  L + E      E
Sbjct  521   YSFGVLLLELLTGKSPTQQQLNEEGVDLPRWVQAVAEQQSPSDVFDPELTRYEPEGNGNE  580

Query  953   qlvqllqvAICCTFQYPNKRPSM  1021
              +++LL++ I CT QYP+KRPSM
Sbjct  581   NMIRLLKIGISCTAQYPDKRPSM  603



>emb|CDX77309.1| BnaC08g03540D [Brassica napus]
Length=646

 Score =   248 bits (632),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 196/288 (68%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +   +F 
Sbjct  345   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVVMPDKDFR  404

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY  +  E LLVYD M MGSL+  LHGN G+ +  L W+VR+
Sbjct  405   EKIELVGAMDHENLVPLRAYYLSRDEKLLVYDFMHMGSLSALLHGNRGEGRTPLTWDVRS  464

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+QG++  HGN++SSN  LT   + +VS+F L QL++  S   +  +
Sbjct  465   RIALGAARGLDYLHSQGTSTSHGNVKSSNTLLTKSHDAKVSDFGLSQLVAASSTTPNRGT  524

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DVYSFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  525   GYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVVRDEWR  584

Query  905   CDVFDSTLAKAEQNveqlvqllqv-AICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS L   E+  E++++ +    I CT Q+P++RP MA V  +I+
Sbjct  585   REVFDSELLSLEREEEEMMEEMVQLGIECTSQHPDQRPEMAEVVSKIE  632



>ref|XP_009403541.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=676

 Score =   246 bits (628),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 189/288 (66%), Gaps = 2/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy--elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEF  364
             KLVFFG G     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   L   EF
Sbjct  346   KLVFFGRGGARRFDLEDLLRASAEVLGKGTFGTTYKAVLETGITVAVKRLKDVNLQEQEF  405

Query  365   TERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVR  544
              E++  +G M H N++PL AY ++  E LLVYD++ MGSL+  LHGN G  + S NW  R
Sbjct  406   KEKMEAIGAMDHPNVVPLMAYYFSKDEKLLVYDYVPMGSLSALLHGNRGSGRTSFNWVTR  465

Query  545   TSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVS  724
               I    A  I+ +H+ G +  HGNI+SSN+ LT   E RVS+  L  L+   S    ++
Sbjct  466   IGIGLSAARGIEYIHSTGPSSSHGNIKSSNILLTKPYEARVSDHGLALLMGSASTTTRIA  525

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEV  P +VS ++DVYSFGVLLLELLTGKAP +A    +G+DLP WV+++ RE+  
Sbjct  526   GYRAPEVADPQKVSQKADVYSFGVLLLELLTGKAPAQALLNDEGIDLPIWVQSVVREEWT  585

Query  905   CDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
              +VFD  L + +   E +VQLLQ+AI C  ++P+KRP MA V  +I +
Sbjct  586   AEVFDVELLRYQSVEEDMVQLLQLAIECVARFPDKRPCMAEVVIRISE  633



>ref|XP_010910915.1| PREDICTED: probable inactive receptor kinase At1g48480 [Elaeis 
guineensis]
Length=630

 Score =   245 bits (625),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 177/269 (66%), Gaps = 0/269 (0%)
 Frame = +2

Query  245   STAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRA  424
             ++A VLG+GT GT+YK+ L     VAVKRLK   L  +EF E+V  +G M H NL+PL A
Sbjct  326   ASAAVLGRGTTGTTYKAMLETGMVVAVKRLKDVNLPEEEFREKVEAIGAMDHPNLVPLHA  385

Query  425   YCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGST  604
             +  +  E LLVYD++ MGSL+  LHGN G     L+WE R+ IA   A  I+ +H+ GS 
Sbjct  386   FYRSKDEKLLVYDYIPMGSLSSVLHGNRGAGWTPLDWETRSGIALAAARGIEYIHSIGSE  445

Query  605   ICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVY  784
             + HGNI+SSN+ L N  E  VS++ L  L+SP       + YRAPEVT   +VS ++DVY
Sbjct  446   VSHGNIKSSNILLGNSFEAHVSDYSLANLVSPSDTPSHAACYRAPEVTDAQKVSQKADVY  505

Query  785   SFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvq  964
             SFGVLLLELLTGK P++ F    G DLP WV+++ +E+ I +VFD  L + +   E++VQ
Sbjct  506   SFGVLLLELLTGKPPMQGFHDEGGPDLPRWVQSVVQEEWISEVFDLGLLRYQNVEEEMVQ  565

Query  965   llqvAICCTFQYPNKRPSMAAVADQIKKT  1051
             LLQV I C  QYP+KRPSM+ V  QI++ 
Sbjct  566   LLQVGIDCAAQYPDKRPSMSQVVIQIEEV  594



>ref|NP_197162.1| leucine-rich repeat protein 1 [Arabidopsis thaliana]
 sp|Q9FMD7.1|Y5659_ARATH RecName: Full=Probable inactive receptor kinase At5g16590; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10186.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAS49054.1| At5g16590 [Arabidopsis thaliana]
 gb|AAS76757.1| At5g16590 [Arabidopsis thaliana]
 dbj|BAF00775.1| receptor like protein kinase [Arabidopsis thaliana]
 gb|ACN59369.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92314.1| leucine-rich repeat protein 1 [Arabidopsis thaliana]
Length=625

 Score =   244 bits (624),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 131/300 (44%), Positives = 194/300 (65%), Gaps = 1/300 (0%)
 Frame = +2

Query  152   NIMAWSPDAIVKSKLVFFgdgdgyelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKR  331
             N ++ +P A+ K    F      ++LD LL+++A VLGKGTFG+SYK+       VAVKR
Sbjct  313   NGVSKNPAAVSKDLTFFVKSFGEFDLDGLLKASAEVLGKGTFGSSYKASFDHGLVVAVKR  372

Query  332   LKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEG  511
             L+   +   EF E++  LG ++H NL+ L AY ++  E L+V+++MS GSL+  LHGN+G
Sbjct  373   LRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKG  432

Query  512   KNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQL  691
               ++ LNWE R +IA G A AI  LH++ +T  HGNI+SSN+ L+   E +VS++CL  +
Sbjct  433   SGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPM  492

Query  692   LSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPN  871
             +SP S  + + GYRAPEVT   ++S ++DVYSFGVL+LELLTGK+P       +GVDLP 
Sbjct  493   ISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPR  552

Query  872   WVRAMFREKPICDVFDSTLAKAEQNveqlvq-llqvAICCTFQYPNKRPSMAAVADQIKK  1048
             WV ++  ++   DVFD  L + + +  + +  LL + I CT QYP+ RP+M  V   I++
Sbjct  553   WVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVTRLIEE  612



>emb|CDY49655.1| BnaC09g41330D [Brassica napus]
Length=617

 Score =   244 bits (623),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 181/270 (67%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFG+SYK+       VAVKRL+   +   EF E++  LG ++H NL+ L 
Sbjct  335   KASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKMQALGSISHVNLVTLI  394

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ LNWE R  IA G A AI  LH++ +
Sbjct  395   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRDA  454

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  455   TTSHGNIKSSNILLSESYEAKVSDYCLAPMISPTSTPNRIEGYRAPEVTDARRISQKADV  514

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQ-Nveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L + +  + E +
Sbjct  515   YSFGVLILELLTGKSPTHQQLSEEGVDLPRWVSSITEQQSTSDVFDPELTRYQDGDNENM  574

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ I CT QYP+ RPSM  V   I++
Sbjct  575   IRLLKIGISCTAQYPDSRPSMPEVTRLIEE  604



>emb|CDY41827.1| BnaA08g03220D [Brassica napus]
Length=647

 Score =   244 bits (624),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 195/288 (68%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +   +F 
Sbjct  346   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVVMQDKDFR  405

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY  +  E LLVYD M MGSL+  LHGN G  +  L W+VR+
Sbjct  406   EKIELVGAMDHENLVPLRAYYLSRDEKLLVYDFMHMGSLSALLHGNRGAGRTPLTWDVRS  465

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+QG++  HGN++SSN+ LT   + +VS+F L QL++  +   +  +
Sbjct  466   RIALGAARGLDYLHSQGTSTSHGNVKSSNILLTKSHDAKVSDFGLSQLVAASTTTPNRGT  525

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DVYSFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  526   GYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVVRDEWR  585

Query  905   CDVFDSTLAKAEQNveqlvqllqv-AICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS L   E+  E++++ +    I CT Q+P++RP M  V  +I+
Sbjct  586   REVFDSELLSLEREEEEMMEEMVQLGIECTSQHPDQRPEMTEVVRKIE  633



>ref|XP_009107354.1| PREDICTED: probable inactive receptor kinase At1g48480 [Brassica 
rapa]
Length=666

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 195/288 (68%), Gaps = 3/288 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +   +F 
Sbjct  365   KLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVVMQDKDFR  424

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY  +  E LLVYD M MGSL+  LHGN G  +  L W+VR+
Sbjct  425   EKIELVGAMDHENLVPLRAYYLSRDEKLLVYDFMHMGSLSALLHGNRGAGRTPLTWDVRS  484

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+QG++  HGN++SSN+ LT   + +VS+F L QL++  +   +  +
Sbjct  485   RIALGAARGLDYLHSQGTSTSHGNVKSSNILLTKSHDAKVSDFGLSQLVAASTTTPNRGT  544

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT P +VS + DVYSFGV+LLEL+TGKAP  +    +GVDLP WV+++ R++  
Sbjct  545   GYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVVRDEWR  604

Query  905   CDVFDSTLAKAEQNveqlvqllqv-AICCTFQYPNKRPSMAAVADQIK  1045
              +VFDS L   E+  E++++ +    I CT Q+P++RP M  V  +I+
Sbjct  605   REVFDSELLSLEREEEEMMEEMVQLGIECTSQHPDQRPEMTEVVRKIE  652



>ref|NP_001105207.1| atypical receptor-like kinase MARK precursor [Zea mays]
 gb|AAO83390.1| atypical receptor-like kinase MARK [Zea mays]
Length=694

 Score =   246 bits (627),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 142/294 (48%), Positives = 188/294 (64%), Gaps = 6/294 (2%)
 Frame = +2

Query  191   KLVFFgdgdgyel---ddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KLVFFG          +DLLR++A VLGKG FGT+YK+ L     VAVKRLK   L+  E
Sbjct  374   KLVFFGSAAAVAPFDLEDLLRASAEVLGKGAFGTTYKAVLESGATVAVKRLKDVTLSEAE  433

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+ E+G++ HE ++PLRAY ++  E LLVYD M MGSL+  LHGN    +  LNW++
Sbjct  434   FRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPMGSLSAVLHGNVSSGRTPLNWDL  493

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA   A  ++ +H+  ST  HGNI+SSNV L    + RVSE  L  L+ P S     
Sbjct  494   RSSIALAAARGVEYIHSTTSTASHGNIKSSNVLLGKSYQARVSENGLTTLVGPSSSSSRT  553

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             +GYRAPEV    +VS ++DVYSFGVLLLEL+TGKAP +A    +GVDLP WV+++ R + 
Sbjct  554   TGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVDLPRWVQSVNRSEW  613

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
                VFD  L + +   E + QL+ +A+ CT Q P  RPSMA V    ++IKK+ 
Sbjct  614   GSLVFDMELMRHQTGEEPMAQLVLLAMDCTAQVPEARPSMAHVVMRIEEIKKSS  667



>tpg|DAA50992.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=694

 Score =   245 bits (626),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/294 (48%), Positives = 188/294 (64%), Gaps = 6/294 (2%)
 Frame = +2

Query  191   KLVFFgdgdgyel---ddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KLVFFG          +DLLR++A VLGKG FGT+YK+ L     VAVKRLK   L+  E
Sbjct  374   KLVFFGSAAAVAPFDLEDLLRASAEVLGKGAFGTTYKAVLESGATVAVKRLKDVTLSEAE  433

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+ E+G++ HE ++PLRAY ++  E LLVYD M MGSL+  LHGN    +  LNW++
Sbjct  434   FRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPMGSLSAVLHGNVSSGRTPLNWDL  493

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA   A  ++ +H+  ST  HGNI+SSNV L    + RVSE  L  L+ P S     
Sbjct  494   RSSIALAAARGVEYIHSTTSTASHGNIKSSNVLLGKSYQARVSENGLTTLVGPSSSSSRT  553

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             +GYRAPEV    +VS ++DVYSFGVLLLEL+TGKAP +A    +GVDLP WV+++ R + 
Sbjct  554   TGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVDLPRWVQSVNRSEW  613

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
                VFD  L + +   E + QL+ +A+ CT Q P  RPSMA V    ++IKK+ 
Sbjct  614   GSLVFDMELMRHQTGEEPMAQLVLLAMDCTAQVPEARPSMAHVVMRIEEIKKSS  667



>ref|XP_009147309.1| PREDICTED: probable inactive receptor kinase At3g02880 [Brassica 
rapa]
Length=623

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/270 (48%), Positives = 181/270 (67%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   +F ER+  LG M+H NL+ L 
Sbjct  341   KASAEVLGKGTVGSSYKASFEHGLVVAVKRLRDVVVPEKDFRERMQVLGSMSHPNLVTLI  400

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++P E LLV ++MS GSL+  LHGN+G  +A LNWE R SIA G A AI  LH++ S
Sbjct  401   AYYFSPDEKLLVSEYMSRGSLSALLHGNKGNGRAPLNWETRASIALGAARAISYLHSRDS  460

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+N  E +VS++ L  ++S  S  + + GYRAPEVT   ++S ++DV
Sbjct  461   TTSHGNIKSSNILLSNSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADV  520

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE-QNveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV+++  ++    VFD  LA  + +  E +
Sbjct  521   YSFGVLILELLTGKSPTHQQLTEEGVDLPRWVQSITDQQSPSQVFDPELAGHQSEGNENM  580

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ I CT QYP+ RPSMA V   I++
Sbjct  581   IRLLKIGISCTAQYPDSRPSMAEVTRLIEE  610



>emb|CDY51524.1| BnaA05g33240D [Brassica napus]
Length=620

 Score =   244 bits (622),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/270 (48%), Positives = 181/270 (67%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   +F ER+  LG M+H NL+ L 
Sbjct  338   KASAEVLGKGTVGSSYKASFEHGLVVAVKRLRDVVVPEKDFRERMQVLGSMSHPNLVTLI  397

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++P E LLV ++MS GSL+  LHGN+G  +A LNWE R SIA G A AI  LH++ S
Sbjct  398   AYYFSPDEKLLVSEYMSRGSLSALLHGNKGNGRAPLNWETRASIALGAARAISYLHSRDS  457

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+N  E +VS++ L  ++S  S  + + GYRAPEVT   ++S ++DV
Sbjct  458   TTSHGNIKSSNILLSNSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADV  517

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE-QNveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV+++  ++    VFD  LA  + +  E +
Sbjct  518   YSFGVLILELLTGKSPTHQQLTEEGVDLPRWVQSITDQQSPSQVFDPELAGHQSEGNENM  577

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ I CT QYP+ RPSMA V   I++
Sbjct  578   IRLLKIGISCTAQYPDSRPSMAEVTRLIEE  607



>ref|XP_010525076.1| PREDICTED: probable inactive receptor kinase At5g16590 [Tarenaya 
hassleriana]
Length=624

 Score =   244 bits (622),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 179/270 (66%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   EF ER+  LG  +H NL+ L 
Sbjct  342   KASAEVLGKGTLGSSYKASFDHGMVVAVKRLRDVVVPEKEFRERLQMLGSFSHVNLVTLL  401

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVY++M  GSL+  LHGN+G  +  LNWE R  IA G A AI  +H++ +
Sbjct  402   AYYFSRDEKLLVYEYMPRGSLSALLHGNKGSGRTPLNWETRAGIALGAARAISYIHSRDT  461

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
                HGNI+SSNV L+   E +VS++CL  L+SP S  + + GYRAPEVT   ++S ++DV
Sbjct  462   MTSHGNIKSSNVLLSESYEAKVSDYCLAPLISPASAPNRIDGYRAPEVTDARRISQKADV  521

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQN-veql  958
             YSFGVL+LELLTGK+P       +GVDLP WV+++  ++   DVFD  L + + +  E +
Sbjct  522   YSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVAEQQSQSDVFDPELTRYQSDGNENM  581

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ I CT QYP+KRPSMA V   I++
Sbjct  582   IRLLKIGIGCTAQYPDKRPSMAEVTRLIEE  611



>ref|XP_001778286.1| predicted protein [Physcomitrella patens]
 gb|EDQ56953.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/284 (49%), Positives = 191/284 (67%), Gaps = 2/284 (1%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             ++KLVFF       +L+DLLR++A VLGKG+ GT+YK+ L E T +AVKRLK   ++  +
Sbjct  313   RNKLVFFEGKRFSFDLEDLLRASAEVLGKGSAGTAYKAVLEEGTILAVKRLKDVSISRKD  372

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F  ++  +GK+ H NL+PLRAY ++  E LLVYD+MSMGSL+  LHGN G ++  L+W  
Sbjct  373   FEAQIEVVGKLQHRNLVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRGSSRTPLDWVT  432

Query  542   RTSIAYGVANAIQSLHAQG-STICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL  718
             R  IA G A  +  LHAQG S   HGNI+SSN+ L   LE  +S+F L QLLS  S    
Sbjct  433   RVRIALGAARGLAYLHAQGGSRFVHGNIKSSNILLNRDLEACISDFGLAQLLSSTSASSR  492

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             + GYRAPE++   +V+ QSDVYSFGVLLLELLTGKAP +     +G+DLP WV+++ RE+
Sbjct  493   IIGYRAPEISETRKVTQQSDVYSFGVLLLELLTGKAPAQVSMNEEGIDLPGWVQSVVREE  552

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAV  1030
                +VFD  L + +   E++V +LQ+A+ C    P++RP MA V
Sbjct  553   WTAEVFDLELMRYQNIEEEMVGMLQIAMQCVDAVPDRRPKMADV  596



>gb|AGT16430.1| kinase [Saccharum hybrid cultivar R570]
Length=692

 Score =   244 bits (624),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 140/294 (48%), Positives = 189/294 (64%), Gaps = 6/294 (2%)
 Frame = +2

Query  191   KLVFFgdgdgye---lddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KLVFFG         L+DLLR++A VLGKG FGT+YK+ L     VAVKRLK   L+  E
Sbjct  373   KLVFFGSAAAVTPFDLEDLLRASAEVLGKGAFGTTYKAVLESGATVAVKRLKDVTLSEPE  432

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+ E+G++ HE ++PLRAY ++  E LLVYD M MGSL+  LHGN    +  LNWE+
Sbjct  433   FRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPMGSLSAVLHGNRSSGRTPLNWEL  492

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA   A  ++ +H+  S   HGNI+SSNV L    + RVS+  +  L+ P S     
Sbjct  493   RSSIALAAARGVEYIHSTSSMASHGNIKSSNVLLGKSYQARVSDNGINTLVGPSSSPSRT  552

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             +GYRAPEV    +VS ++DVYSFGVLLLEL+TGKAP +A    +GVDLP WV+++ R + 
Sbjct  553   TGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVDLPRWVQSVNRSEW  612

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
               +VFD+ L + +   E L QL+ +A+ C  Q P+ RPSM  V    ++IKK+ 
Sbjct  613   GSEVFDTELTRHQPGEEPLAQLVLLAMDCVAQVPDARPSMTHVVMRIEEIKKSS  666



>ref|XP_010420358.1| PREDICTED: probable inactive receptor kinase At5g16590 [Camelina 
sativa]
Length=633

 Score =   243 bits (621),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/271 (47%), Positives = 182/271 (67%), Gaps = 3/271 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFG+SYK+       VAVKRL+   +   EF E++  LG ++H NL+ L 
Sbjct  351   KASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLI  410

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ LNWE R  IA G A AI  LH++ +
Sbjct  411   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRDA  470

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  471   TTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADV  530

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAK--AEQNveq  955
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L +  AE N E 
Sbjct  531   YSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPLDVFDPELTRYQAEGN-EN  589

Query  956   lvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +V+LL++ I CT QYP+ RP+M  V   I++
Sbjct  590   MVRLLKIGISCTAQYPDSRPTMTEVTRLIEE  620



>ref|XP_006287270.1| hypothetical protein CARUB_v10000461mg [Capsella rubella]
 gb|EOA20168.1| hypothetical protein CARUB_v10000461mg [Capsella rubella]
Length=626

 Score =   243 bits (620),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 181/270 (67%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFG+SYK+       VAVKRL+   +   EF E++  LG ++H NL+ L 
Sbjct  344   KASAEVLGKGTFGSSYKASFEHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLI  403

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ LNWE R  IA G A AI  LH++ +
Sbjct  404   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRDA  463

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  464   TTSHGNIKSSNILLSETFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADV  523

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE-QNveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L + + +  E +
Sbjct  524   YSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQTPSDVFDPELTRYQSEGNENM  583

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ I CT QYP+ RP+M  V   I++
Sbjct  584   IRLLKIGISCTAQYPDSRPTMPEVTRLIEE  613



>emb|CDX69441.1| BnaA10g17900D [Brassica napus]
Length=618

 Score =   243 bits (620),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 181/270 (67%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   EF E++H LG ++H NL+ L 
Sbjct  336   KASAEVLGKGTLGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKMHVLGSISHVNLVMLI  395

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ LNWE R  IA G A AI  LH++ +
Sbjct  396   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRDA  455

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  456   TTSHGNIKSSNILLSESYEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADV  515

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQ-Nveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L + +  + E +
Sbjct  516   YSFGVLILELLTGKSPTHQQLSEEGVDLPRWVSSITEQQSTSDVFDPELTRYQDGDNENM  575

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ I CT QYP+ RP+M  V   I++
Sbjct  576   IRLLKIGISCTAQYPDSRPTMPEVTRLIEE  605



>ref|XP_010932563.1| PREDICTED: probable inactive receptor kinase At1g48480 [Elaeis 
guineensis]
Length=671

 Score =   244 bits (622),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/271 (48%), Positives = 180/271 (66%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT GT+YK+ L     VAVKRLK   L   EF E++  +G M H+NL+PL+
Sbjct  367   RASAEVLGKGTTGTTYKAMLEMGMVVAVKRLKDVNLPEKEFREKIGAIGAMDHQNLVPLQ  426

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             A+ ++  E LL+YD+M MGSL+  LHGN    +  L+WE R+ IA   A  I+ +H+ G 
Sbjct  427   AFYYSRDEKLLIYDYMPMGSLSSLLHGNRVSGRTPLDWETRSGIALDAARGIEYIHSMGP  486

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              + HGNI+SSN+ L   L+  VSE  L  L+ P S  +  +GY APEVT   + S + DV
Sbjct  487   GVSHGNIKSSNILLGKSLDAHVSEHGLANLVGPSSTPNRAAGYLAPEVTDVRKASQKGDV  546

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELL+GKAP +AF   +G+DLP WV+++ RE+   +VFD  L + +   E++V
Sbjct  547   YSFGVLLLELLSGKAPAQAFLNEEGIDLPRWVQSVVREEWTSEVFDLELLRYQNVEEEMV  606

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+A+ C  QYP+ RPSM+ V  +I++ C
Sbjct  607   QLLQLAVDCAAQYPDSRPSMSEVVVRIEEIC  637



>ref|XP_006400197.1| hypothetical protein EUTSA_v10012966mg [Eutrema salsugineum]
 gb|ESQ41650.1| hypothetical protein EUTSA_v10012966mg [Eutrema salsugineum]
Length=628

 Score =   243 bits (620),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 180/270 (67%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   EF E++  LG ++H NL+ L 
Sbjct  346   KASAEVLGKGTLGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKMQVLGSLSHVNLVTLI  405

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ LNWE R  IA G A AI  LH++ +
Sbjct  406   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRDA  465

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSNV L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  466   TTSHGNIKSSNVLLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADV  525

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQN-veql  958
             YSFGVLLLELLTGK+P       +GVDLP WV ++  ++   DVFD  L + + +  E +
Sbjct  526   YSFGVLLLELLTGKSPTHQQLTEEGVDLPRWVSSITEQQSPSDVFDPELTRYQADGNENM  585

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ I CT QYP+ RPSM  V   I++
Sbjct  586   IRLLKIGISCTAQYPDSRPSMPEVTRLIEE  615



>ref|XP_009381014.1| PREDICTED: probable inactive receptor kinase RLK902 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   243 bits (621),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 189/287 (66%), Gaps = 3/287 (1%)
 Frame = +2

Query  191   KLVFFgdgdgy--elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEF  364
             KLVFFG+G     +L+DLLR++A VLGKGTFGT+YK+ L     VAVKRLK   L   EF
Sbjct  346   KLVFFGEGGTRPFDLEDLLRASAEVLGKGTFGTAYKAVLETGMTVAVKRLKDVNLQETEF  405

Query  365   TERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVR  544
              E++  +G + H NL+PL AY ++  E LLVY++M MGSL+  LHGN G  +   NWE R
Sbjct  406   REKMEAIGAIDHPNLVPLMAYYFSKDEKLLVYEYMPMGSLSALLHGNRGSGRTPFNWETR  465

Query  545   TSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVS  724
             T IA   A  I+ +H+ G +  HGNI+SSN+ LT   + RVS+  L  L+   S    V+
Sbjct  466   TGIALAAARGIEYIHSTGPSAAHGNIKSSNILLTKSYQARVSDHGLALLVGSASATARVA  525

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPI  904
             GYRAPEVT   +VS ++DVYSFGVLLLELLTGKAP +A     G DLP WV+++ +E+  
Sbjct  526   GYRAPEVTDTRKVSQKADVYSFGVLLLELLTGKAPSQAL-NDDGFDLPRWVQSVVKEEWT  584

Query  905   CDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
              +VFD  L + +   E +VQLLQ+A  C  QYP+KRPSM  V  +I+
Sbjct  585   AEVFDPELLRYQNVEEDMVQLLQLATDCAAQYPDKRPSMPDVVARIE  631



>ref|XP_002463998.1| hypothetical protein SORBIDRAFT_01g010290 [Sorghum bicolor]
 gb|EER90996.1| hypothetical protein SORBIDRAFT_01g010290 [Sorghum bicolor]
Length=696

 Score =   244 bits (623),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 140/294 (48%), Positives = 189/294 (64%), Gaps = 6/294 (2%)
 Frame = +2

Query  191   KLVFFgdgdgye---lddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KLVFFG         L+DLLR++A VLGKG FGT+YK+ L     VAVKRLK   L+  E
Sbjct  377   KLVFFGTAAAVAPFDLEDLLRASAEVLGKGAFGTTYKAVLESGATVAVKRLKDVTLSEPE  436

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+ E+G++ HE ++PLRAY ++  E LLVYD M MGSL+  LHGN    +  LNW++
Sbjct  437   FRERISEVGELQHEFIVPLRAYYYSKDEKLLVYDFMPMGSLSAVLHGNRSSGRTPLNWDL  496

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA   A  ++ +H+  S   HGNI+SSN+ L    + RVS+  L  L+ P S     
Sbjct  497   RSSIALAAARGVEYIHSTSSMASHGNIKSSNILLGKSYQARVSDNGLNTLVGPSSSPSRT  556

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             +GYRAPEV    +VS ++DVYSFGVLLLEL+TGKAP +A    +GVDLP WV+++ R + 
Sbjct  557   TGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVDLPRWVQSVNRSEW  616

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTC  1054
               +VFD  L + +   E L QL+ +A+ C  Q P+ RPSMA V    ++IKK+ 
Sbjct  617   GSEVFDMELTRHQTGEEPLAQLVLLAMDCVAQVPDARPSMAHVVMRIEEIKKSS  670



>ref|XP_010495229.1| PREDICTED: probable inactive receptor kinase At5g16590, partial 
[Camelina sativa]
Length=632

 Score =   243 bits (619),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/271 (47%), Positives = 182/271 (67%), Gaps = 3/271 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFG+SYK+       VAVKRL+   +   EF E++  LG ++H NL+ L 
Sbjct  350   KASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHVNLVTLI  409

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ LNWE R  IA G A AI  LH++ +
Sbjct  410   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRDA  469

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  470   TTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADV  529

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAK--AEQNveq  955
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L +  AE N E 
Sbjct  530   YSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQAEGN-EN  588

Query  956   lvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +V+LL++ I CT QYP+ RP+M  V   I++
Sbjct  589   MVRLLKIGISCTAQYPDSRPTMPEVTRLIEE  619



>ref|XP_009118618.1| PREDICTED: probable inactive receptor kinase At3g02880 [Brassica 
rapa]
Length=609

 Score =   242 bits (617),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 194/298 (65%), Gaps = 2/298 (1%)
 Frame = +2

Query  161   AWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLK  337
             A +   +V   L+FF    G  +LD LL+++A VLGKG+ G+SYK+       VAVKRL+
Sbjct  299   AAAESGVVSKDLIFFVKSFGEFDLDGLLKASAEVLGKGSVGSSYKASFDHGLVVAVKRLR  358

Query  338   IGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKN  517
                +   +F ER+  LG M+H NL+ L AY ++  E LLV+++MS GSL+  LHGN+G  
Sbjct  359   DVVVPEKDFRERMQVLGSMSHPNLVTLIAYYFSRDEKLLVFEYMSRGSLSALLHGNKGSG  418

Query  518   KASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLS  697
             +  LNWE R  IA G A AI  LH++ ST  HGNI+SSN+ L+N  E +VS++ L  ++S
Sbjct  419   RTPLNWETRAGIALGAARAISYLHSRDSTTSHGNIKSSNILLSNSYEAKVSDYGLAPIIS  478

Query  698   PDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWV  877
               S  + + GYRAPEVT   ++S ++DVYSFGVL+LELLTGK+P       +GVDLP WV
Sbjct  479   STSAPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWV  538

Query  878   RAMFREKPICDVFDSTLAKAE-QNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +++  ++   DVFD  L + E +  E +++LL++ + CT QYP+ RPSMA V   I++
Sbjct  539   QSVTDQQSTSDVFDPELTRYESEGNENIIRLLKIGMSCTAQYPDSRPSMADVTRLIEE  596



>ref|XP_010453822.1| PREDICTED: probable inactive receptor kinase At5g16590 [Camelina 
sativa]
Length=636

 Score =   242 bits (618),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 127/271 (47%), Positives = 182/271 (67%), Gaps = 3/271 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFG+SYK+       VAVKRL+   +   EF E++  LG ++H NL+ L 
Sbjct  354   KASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVMVPEKEFREKLQVLGSISHVNLVTLI  413

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ LNWE R  IA G A AI  LH++ +
Sbjct  414   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRDA  473

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  474   TTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADV  533

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAK--AEQNveq  955
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L +  AE N E 
Sbjct  534   YSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQAEGN-EN  592

Query  956   lvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +V+LL++ I CT QYP+ RP+M  V   I++
Sbjct  593   MVRLLKIGISCTAQYPDSRPTMPEVTRLIEE  623



>emb|CDY28719.1| BnaCnng06050D [Brassica napus]
Length=604

 Score =   241 bits (616),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 180/272 (66%), Gaps = 1/272 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   +F ER+  LG M+H NL+ L 
Sbjct  322   KASAEVLGKGTVGSSYKASFEHGLVVAVKRLRDVVVPEKDFRERLQVLGSMSHPNLVTLI  381

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++P E LLV ++MS GSL+  LHGN+G  +A LNWE R  IA G A AI  LH++ S
Sbjct  382   AYYFSPDEKLLVSEYMSRGSLSALLHGNKGNGRAPLNWETRAGIALGAARAISYLHSRDS  441

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+N  E +VS++ L  ++S  S  + + GYRAPEVT   ++S ++DV
Sbjct  442   TTSHGNIKSSNILLSNSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADV  501

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE-QNveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV+++  ++    VFD  LA  + +  E +
Sbjct  502   YSFGVLILELLTGKSPTHQQLTEEGVDLPRWVQSITDQQSPSQVFDPELAGHQSEGNENM  561

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             ++LL++AI CT QYP+ RP MA V   I++  
Sbjct  562   IRLLKIAISCTAQYPDSRPFMADVTRLIEEVS  593



>ref|NP_001151626.1| atypical receptor-like kinase MARK precursor [Zea mays]
 gb|ACG43563.1| atypical receptor-like kinase MARK [Zea mays]
Length=684

 Score =   243 bits (620),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 186/289 (64%), Gaps = 3/289 (1%)
 Frame = +2

Query  191   KLVFFgdgdgyel---ddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KLVFFG          +DLLR++A VLGKGTFGT+YK+ L     +AVKRLK   L+  E
Sbjct  364   KLVFFGSSAAVASFKLEDLLRASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPE  423

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+ E+G++ HE ++PLRAY ++  E LLVYD M  GSL+  LHGN    K  LNW++
Sbjct  424   FRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDL  483

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA   A  ++ +H+  ST  HGNI+SSNV L    +  VS+  L  L+ P S     
Sbjct  484   RSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRA  543

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             +GYRAPEV  P +VS ++DVYSFGVLLLEL+TGKAP +A    +GV+LP WV+++ R + 
Sbjct  544   TGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEW  603

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
               +VFD  L + E + E + QL+ +A+ C  Q P  RPSM  V  +I++
Sbjct  604   GSEVFDIELMRHEADEELMAQLVLLALDCVAQVPEARPSMGHVVTRIEE  652



>ref|XP_009121473.1| PREDICTED: probable inactive receptor kinase At5g16590 [Brassica 
rapa]
Length=617

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 180/270 (67%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   EF E++  LG ++H NL+ L 
Sbjct  335   KASAEVLGKGTLGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKMQALGSISHVNLVTLI  394

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ LNWE R  IA G A AI  LH++ +
Sbjct  395   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRDA  454

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  455   TTSHGNIKSSNILLSESYEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADV  514

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQ-Nveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L + +  + E +
Sbjct  515   YSFGVLILELLTGKSPTHQQLSEEGVDLPRWVSSISEQQSTSDVFDPELTRYQDGDNENM  574

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ I CT QYP+ RP+M  V   I++
Sbjct  575   IRLLKIGISCTAQYPDSRPTMPEVTRLIEE  604



>gb|AFW67828.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=724

 Score =   242 bits (618),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 185/289 (64%), Gaps = 3/289 (1%)
 Frame = +2

Query  191   KLVFFgdgdgyel---ddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KLVFFG          +DLLR++A VLGKGTFGT+YK+ L     +AVKRLK   L+  E
Sbjct  404   KLVFFGSAAAVASFKLEDLLRASAEVLGKGTFGTTYKAVLESGATLAVKRLKDVTLSEPE  463

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F ER+ E+G++ HE ++PLRAY ++  E LLVYD M  GSL+  LHGN    K  LNW++
Sbjct  464   FRERISEIGELQHEFIVPLRAYYYSKDEKLLVYDFMPKGSLSAVLHGNITSGKTPLNWDL  523

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA   A  ++ +H+  ST  HGNI+SSNV L    +  VS+  L  L+ P S     
Sbjct  524   RSSIALAAARGVEYIHSTSSTASHGNIKSSNVLLGESYQAHVSDNGLTALVGPSSSPSRA  583

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             +GYRAPEV  P +VS ++DVYSFGVLLLEL+TGKAP +A    +GV+LP WV+++ R + 
Sbjct  584   TGYRAPEVIDPRRVSQKADVYSFGVLLLELVTGKAPSQAALNDEGVNLPRWVQSVSRSEW  643

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
               +VFD  L + E   E + QL+ +A+ C  Q P  RPSM  V  +I++
Sbjct  644   GSEVFDIELMRHEAGEEPMAQLVLLALDCVAQVPEARPSMGHVVTRIEE  692



>ref|XP_009126125.1| PREDICTED: probable inactive receptor kinase At5g16590 [Brassica 
rapa]
 emb|CDX85498.1| BnaA02g03150D [Brassica napus]
Length=613

 Score =   239 bits (611),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 181/271 (67%), Gaps = 3/271 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKG FG+SYK+       VAVKRL+   +   EF E++  LG ++H NL+ L 
Sbjct  331   KASAEVLGKGAFGSSYKASFEHGLVVAVKRLRDVVVPEKEFKEKLQVLGSISHPNLVALI  390

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ L+WE R  IA G A AI  LH++ +
Sbjct  391   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLSWETRAGIALGAARAISYLHSRDA  450

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+S N+ L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  451   TTSHGNIKSCNILLSESYEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADV  510

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAK--AEQNveq  955
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L +  AE N E 
Sbjct  511   YSFGVLILELLTGKSPTHQQLNEEGVDLPRWVSSITEQQSPSDVFDPELTRYQAEGN-EN  569

Query  956   lvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +++LL++ I CT QYP+ RPSMA V   I++
Sbjct  570   MIRLLKIGISCTAQYPDSRPSMAEVTRLIEE  600



>ref|XP_006408370.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
 gb|ESQ49823.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
Length=622

 Score =   239 bits (611),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 180/270 (67%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   +F ER+  LG M+H NL+ L 
Sbjct  340   KASAEVLGKGTVGSSYKASFDHGLVVAVKRLRDVVVPEKDFRERLQVLGSMSHANLVTLI  399

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+++MS GSL+  LHGN+G  +  LNWE R  IA G A AI  LH++ S
Sbjct  400   AYYFSRDEKLLVFEYMSRGSLSALLHGNKGSGRTQLNWETRAGIALGAARAISYLHSRDS  459

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L++  E +VS++ L  ++S  S  + + GYRAPEVT   ++S ++DV
Sbjct  460   TTSHGNIKSSNILLSDSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADV  519

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE-QNveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV+++  ++   DVFD  L + + +  E +
Sbjct  520   YSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSITDQQSPSDVFDPELTRYQSEGNENM  579

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ + CT QYP+ RPSMA V   I++
Sbjct  580   IRLLKIGMSCTAQYPDSRPSMAEVTRLIEE  609



>gb|KFK37686.1| hypothetical protein AALP_AA3G015500 [Arabis alpina]
Length=618

 Score =   239 bits (610),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 190/295 (64%), Gaps = 2/295 (1%)
 Frame = +2

Query  176   AIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLA  352
              +V   L+FF    G   LD LL+++A VLGKGT G+SYK+       VAVKRL+   + 
Sbjct  313   GVVSKDLIFFVKSFGEFNLDGLLKASAEVLGKGTVGSSYKASFDHGLVVAVKRLRDVVVP  372

Query  353   VDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLN  532
               EF E++  LG M+H NL+ L AY ++  E LLV+++MS GSL+  LHGN+G  +  LN
Sbjct  373   EKEFREKLQVLGSMSHANLVTLIAYYFSRDEKLLVFEYMSRGSLSALLHGNKGNGRTPLN  432

Query  533   WEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL  712
             WE R  IA G A AI  +H++ ST  HGNI+SSN+ L+   E +VS++ L  ++S  S  
Sbjct  433   WETRAGIALGAARAISYIHSRDSTTSHGNIKSSNILLSKSYEAKVSDYGLAPIISSTSAP  492

Query  713   DLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFR  892
             + + GYRAPEVT   ++S ++DVYSFGVL+LELLTGK+P       +GVDLP WV+++  
Sbjct  493   NRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSITE  552

Query  893   EKPICDVFDSTLAKAE-QNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             ++   DVFD  L + + +  E +++LL++ + CT QYP+KRPSM  V   I++  
Sbjct  553   QQTPSDVFDPELTRYQSEGNENMIRLLKIGMSCTAQYPDKRPSMVEVTRLIEEVS  607



>gb|KFK25876.1| hypothetical protein AALP_AA8G173700 [Arabis alpina]
Length=619

 Score =   239 bits (610),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 136/301 (45%), Positives = 194/301 (64%), Gaps = 4/301 (1%)
 Frame = +2

Query  155   IMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKR  331
             +   S + +V   L FF    G  +LD LL+++A VLGKGTFG+SYK+       VAVKR
Sbjct  307   VNGGSKNPVVSKDLTFFVKSFGEFDLDGLLKASAEVLGKGTFGSSYKASFEHGLVVAVKR  366

Query  332   LKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEG  511
             L+   +   EF E++  LG ++H NL+ L AY ++  E L+V+++MS GSL+  LHGN+G
Sbjct  367   LRDVVVPEKEFREKLQILGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKG  426

Query  512   KNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQL  691
               ++ LNWE R  IA G A AI  LH++  T  HGNI+SSN+ L+   E +VS++ L  +
Sbjct  427   SGRSPLNWETRAGIALGAARAISYLHSRDPTTSHGNIKSSNILLSESYEAKVSDYGLAPM  486

Query  692   LSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPN  871
             +SP S  + + GYRAPEVT   ++S ++DVYSFGVLLLELLTGK+P       +GVDLP 
Sbjct  487   ISPTSTPNRIDGYRAPEVTDARRISQKADVYSFGVLLLELLTGKSPTHQQLNEEGVDLPR  546

Query  872   WVRAMFREKPICDVFDSTLAK--AEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
             WV ++  ++   DVFD  L +  AE N E +++LL++ I CT QYP+ RP+M  V   I+
Sbjct  547   WVSSITEQQSPSDVFDPELTRYQAEGN-ENMIRLLKIGISCTAQYPDSRPTMPEVTRLIE  605

Query  1046  K  1048
             +
Sbjct  606   E  606



>emb|CDY38103.1| BnaC02g06700D [Brassica napus]
Length=613

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 181/271 (67%), Gaps = 3/271 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKG FG+SYK+       VAVKRL+   +   EF E++  LG ++H N++ L 
Sbjct  331   KASAEVLGKGAFGSSYKASFEHGLVVAVKRLRDVVVPEKEFKEKLQVLGSISHPNIVTLI  390

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ L+WE R  IA G A AI  LH++ +
Sbjct  391   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLSWETRAGIALGAARAISYLHSRDA  450

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+S N+ L+   E +VS++CL  ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  451   TTSHGNIKSCNILLSESYEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADV  510

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAK--AEQNveq  955
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L +  AE N E 
Sbjct  511   YSFGVLILELLTGKSPTHQQLNEEGVDLPRWVSSITEQQSPSDVFDPELTRYQAEGN-EN  569

Query  956   lvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +++LL++ I CT QYP+ RPSMA V   I++
Sbjct  570   MIRLLKIGISCTAQYPDSRPSMAEVTRLIEE  600



>gb|ABR17070.1| unknown [Picea sitchensis]
Length=340

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/289 (46%), Positives = 188/289 (65%), Gaps = 2/289 (1%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             ++KLVFF       +L+DLLR++A VLGKG+ GT+YK+ L + T V VKRLK       +
Sbjct  9     RNKLVFFEGSQYTFDLEDLLRASAEVLGKGSVGTAYKAVLEDGTTVVVKRLKDVAANRKD  68

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F +++  +G++ H NL+PLRA+ ++  E LLVYD+M  GSL+  LHG+ G  +  L+W+ 
Sbjct  69    FEQQMELVGRIRHRNLVPLRAFYYSKDEKLLVYDYMPTGSLSALLHGSRGSGRTPLDWDT  128

Query  542   RTSIAYGVANAIQSLHAQGS-TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL  718
             R  IA G A  I  +H +G     HGNI+SSNV LT  L+  VS+F L  L S  +  + 
Sbjct  129   RMRIALGAARGISHIHEEGGGKFTHGNIKSSNVLLTTDLDGCVSDFGLVPLFSAAAAANR  188

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             ++GYRAPEV    +V+ +SDVYSFGVLLLELLTGKAP +A    +G+DLP WV+++ RE+
Sbjct  189   IAGYRAPEVIETRKVTQKSDVYSFGVLLLELLTGKAPNQASLNDEGIDLPRWVQSVVREE  248

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
                +VFD  L + +   E++VQLLQ+A+ C    P++RP M  V   I+
Sbjct  249   WTAEVFDVELMRYQNIEEEMVQLLQIAMACVAAVPDQRPRMQDVVKMIE  297



>ref|XP_003559525.1| PREDICTED: probable inactive receptor kinase RLK902 [Brachypodium 
distachyon]
Length=679

 Score =   238 bits (608),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 140/296 (47%), Positives = 193/296 (65%), Gaps = 6/296 (2%)
 Frame = +2

Query  191   KLVFFgdgdgyel---ddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             KLVFFG          +DLLR++A VLGKG  GT+YK+ L     VAVKRLK   ++  E
Sbjct  353   KLVFFGSAANVAPFDLEDLLRASAEVLGKGAIGTTYKAVLESGATVAVKRLKDVTMSEPE  412

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F +R+ ++G++ HE ++PLRAY ++  E LLVYD M MGSL+  LHGN G  +  LNW +
Sbjct  413   FRDRIADIGELQHEFIVPLRAYYYSKDEKLLVYDFMPMGSLSALLHGNRGSGRTPLNWAI  472

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R+SIA   A  ++ +H+  S+  HGNI+SSN+ L    + RV++  L  L+ P S     
Sbjct  473   RSSIALAAARGLEFIHSTSSSTSHGNIKSSNILLAKSYQARVTDNGLATLVGPSSTPSRT  532

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             +GYRAPEVT P +VS ++DVYSFGVLLLELLTGKAP +A    +GVDLP WV+++ R + 
Sbjct  533   TGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPSQAALNDEGVDLPRWVQSVVRSEW  592

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTCSL  1060
               +VFD  L + +   EQ+VQLLQ+AI C  Q P+ RP+M+ +    D+IKK   +
Sbjct  593   TAEVFDMELLRHQNVEEQMVQLLQLAIDCVAQVPDARPTMSHIVVRIDEIKKASEI  648



>ref|NP_186938.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9M8T0.1|Y3288_ARATH RecName: Full=Probable inactive receptor kinase At3g02880; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF26971.1|AC018363_16 putative protein kinase [Arabidopsis thaliana]
 gb|AAK50106.1|AF372969_1 AT3g02880/F13E7_17 [Arabidopsis thaliana]
 gb|AAP21160.1| At3g02880/F13E7_17 [Arabidopsis thaliana]
 gb|ACN59311.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE73873.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=627

 Score =   237 bits (604),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 179/270 (66%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   EF ER+H LG M+H NL+ L 
Sbjct  345   KASAEVLGKGTVGSSYKASFEHGLVVAVKRLRDVVVPEKEFRERLHVLGSMSHANLVTLI  404

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+++MS GSL+  LHGN+G  +  LNWE R  IA G A AI  LH++  
Sbjct  405   AYYFSRDEKLLVFEYMSKGSLSAILHGNKGNGRTPLNWETRAGIALGAARAISYLHSRDG  464

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L++  E +VS++ L  ++S  S  + + GYRAPE+T   ++S ++DV
Sbjct  465   TTSHGNIKSSNILLSDSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEITDARKISQKADV  524

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE-QNveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV+++  ++   DV D  L + + +  E +
Sbjct  525   YSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVTEQQTPSDVLDPELTRYQPEGNENI  584

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ + CT Q+P+ RPSMA V   I++
Sbjct  585   IRLLKIGMSCTAQFPDSRPSMAEVTRLIEE  614



>ref|XP_001774015.1| predicted protein [Physcomitrella patens]
 gb|EDQ61205.1| predicted protein [Physcomitrella patens]
Length=591

 Score =   236 bits (601),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/284 (47%), Positives = 187/284 (66%), Gaps = 2/284 (1%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             ++KLVFF        L+DLLR++A VLGKG+ GT+YK+ L + T +AVKRLK       +
Sbjct  303   RNKLVFFDGKKYSFNLEDLLRASAEVLGKGSVGTAYKAILEDGTIMAVKRLKDVTTGKKD  362

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F  ++  +GK+ H+NL+PLRAY ++  E LLVYD+M MGSL+  LHGN G ++  L+W  
Sbjct  363   FESQIQAVGKLLHKNLVPLRAYYFSKDEKLLVYDYMPMGSLSALLHGNRGSSRTPLDWLS  422

Query  542   RTSIAYGVANAIQSLHAQG-STICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDL  718
             R  IA G A  +  LHAQG S   H NI+SSN+ L+  L+  +S++ L QLL+  S    
Sbjct  423   RVKIALGAARGLAYLHAQGGSKFAHANIKSSNILLSRDLDACISDYGLAQLLNSSSAASR  482

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             + GYRAPEVT   +V+ +SDVYSFGVLLLELLTGKAP +A    +G+DLP WV+++ RE+
Sbjct  483   IVGYRAPEVTDARKVTQKSDVYSFGVLLLELLTGKAPTQAALNDEGIDLPRWVQSVVREE  542

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAV  1030
                +VFD  L + +   E++V +LQ+A+ C    P +RP M  V
Sbjct  543   WTAEVFDLELMRYQNIEEEMVSMLQIAMQCVDPVPERRPKMNNV  586



>ref|XP_002882256.1| hypothetical protein ARALYDRAFT_896266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58515.1| hypothetical protein ARALYDRAFT_896266 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score =   235 bits (600),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 180/270 (67%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   EF ER+  LG M+H NL+ L 
Sbjct  344   KASAEVLGKGTVGSSYKASFDHGLVVAVKRLRDVVVPEKEFRERLQVLGSMSHANLVTLI  403

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+++MS GSL+  LHGN+G  +  LNWE R  IA G A AI  LH++ +
Sbjct  404   AYYFSRDEKLLVFEYMSRGSLSALLHGNKGNGRTPLNWETRAGIAVGAARAISYLHSRDA  463

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L++  E +VS++ L  ++S  S  + + GYRAPEVT   ++S ++DV
Sbjct  464   TTSHGNIKSSNILLSDSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADV  523

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE-QNveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV+++  ++   DV D  L + + ++ E +
Sbjct  524   YSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVTDQQSPSDVLDPELTRYQPESNENI  583

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ + CT Q+P+ RPSMA V   I++
Sbjct  584   IRLLKIGMSCTAQFPDSRPSMAEVTRLIEE  613



>gb|EYU45792.1| hypothetical protein MIMGU_mgv1a020384mg [Erythranthe guttata]
Length=593

 Score =   234 bits (596),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 136/278 (49%), Positives = 180/278 (65%), Gaps = 7/278 (3%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEK-TAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPL  418
             R++A VLGKGTFGT+YK+EL      V VK L+   +A  EF  ++ E+G+M H NL+PL
Sbjct  314   RASAEVLGKGTFGTAYKAELESGLVVVVVKGLRDVSMAEMEFRAKMDEIGRMDHRNLVPL  373

Query  419   RAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQG  598
             RAY +N  E LLVYD+  +GSL   LHGN+G  + +LNWE R SIA G    I  LH  G
Sbjct  374   RAYYYNRHEKLLVYDYFPIGSLYALLHGNKGDTR-TLNWETRASIALGATQGISYLHLHG  432

Query  599   STICHGNIRSSNVFLTNFLEVRVSEFCLGQLL--SPDSKLDLVSGYRAPEVTSPHQVSHQ  772
              +I HGNI SSN+ LT   E RVS+F L  L    P S    V GYRAPEVT P +VS +
Sbjct  433   PSISHGNITSSNILLTKTYEPRVSDFLLAGLARPGPTSGPSRVEGYRAPEVTDPRRVSQK  492

Query  773   SDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNve  952
             +DVYSFGVL+LE++TGK+P+       G DLP WVR++ ++    +V D+ L + +  VE
Sbjct  493   ADVYSFGVLVLEIMTGKSPV---VGEDGFDLPLWVRSVVKDAWTSEVLDAELLRYQNVVE  549

Query  953   qlvqllqvAICCTFQYPNKRPSMAAVADQIKKTCSLWF  1066
              +V LLQ+ + CT  +P+KRPSMA VA +I++ C   F
Sbjct  550   DMVWLLQIGVDCTGSHPDKRPSMAEVATKIEELCRWSF  587



>ref|XP_006297231.1| hypothetical protein CARUB_v10013240mg [Capsella rubella]
 gb|EOA30129.1| hypothetical protein CARUB_v10013240mg [Capsella rubella]
Length=617

 Score =   234 bits (597),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 139/331 (42%), Positives = 198/331 (60%), Gaps = 8/331 (2%)
 Frame = +2

Query  86    KENRPACRNQEQIKAKKSC------ELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllR  244
             KE  P  RN E   A  +       E    +  S   +V   L FF    G   LD LL+
Sbjct  276   KEENPPARNVEAPVAAPASTAAIPKETVAGVPPSESGVVSKDLTFFVKSFGEFNLDGLLK  335

Query  245   STAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRA  424
             ++A VLGKGT G+SYK+       VAVKRL+   +   EF ER+  LG M+H NL+ L A
Sbjct  336   ASAEVLGKGTVGSSYKASFDHGLVVAVKRLRDVVVPEKEFRERLQVLGSMSHPNLVTLIA  395

Query  425   YCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGST  604
             Y ++  E LLV + +S GSL+  LHGN+G  +  LNWE R S+A G A AI  +H++ +T
Sbjct  396   YYFSRDEKLLVVEFLSRGSLSALLHGNKGSGRTPLNWETRVSVALGAAKAISYIHSRDAT  455

Query  605   ICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVY  784
               HGNI+SSN+ L+   E +VS++ L  ++S  S  + + GYRAPEVT   ++S ++DVY
Sbjct  456   TSHGNIKSSNILLSESYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADVY  515

Query  785   SFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE-QNveqlv  961
             SFGVL+LELLTGK+P       +GVDLP WV+++  ++   DV D  L + + +  E ++
Sbjct  516   SFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVTEQQSPSDVLDPELTRYQPEGNENII  575

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +LL++ + CT QYP+ RPSMA V   I++  
Sbjct  576   RLLKIGMSCTAQYPDSRPSMADVTRLIEEVS  606



>ref|XP_010485618.1| PREDICTED: probable inactive receptor kinase At3g02880 [Camelina 
sativa]
Length=630

 Score =   234 bits (597),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 192/296 (65%), Gaps = 2/296 (1%)
 Frame = +2

Query  167   SPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIG  343
             S   +V   L+FF    G  +LD LL+++A VLGKGT G+SYK+       VAVKRL+  
Sbjct  321   SESGVVSKDLIFFVKTFGEFDLDGLLKASAEVLGKGTVGSSYKASFDHGLIVAVKRLRDV  380

Query  344   CLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKA  523
              +   EF ER+  LG M+H NL+ L AY ++  E LLV+++MS GSL+  LHGN+G  + 
Sbjct  381   VVPEKEFRERLQVLGSMSHPNLVTLIAYYFSRDEKLLVFEYMSRGSLSAILHGNKGNGRT  440

Query  524   SLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPD  703
              LNWE R  +A G A AI+ LH++ +T  HGNI+SSNV L+   E +VS++ L  ++S  
Sbjct  441   PLNWETRVGVALGAARAIKFLHSRDATTSHGNIKSSNVLLSESYEAKVSDYGLAPIISST  500

Query  704   SKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRA  883
             S  + + GYRAPEVT   ++S ++DVYSFGVL+LELLTGK+P       +GVDLP WV++
Sbjct  501   SAPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQS  560

Query  884   MFREKPICDVFDSTLAKAE-QNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +  ++   +V D  L + + +  E +++LL++ + CT QYP+ RPSMA V   I++
Sbjct  561   VTDQQSPSEVLDPELTRYQPEGNENIIRLLKIGMSCTAQYPDSRPSMADVTRLIEE  616



>ref|XP_002960794.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
 ref|XP_002983874.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ14886.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ38333.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
Length=649

 Score =   234 bits (598),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 174/269 (65%), Gaps = 1/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKG+ GT+YK+ L + + VAVKRLK   ++  EF +++  +G++ H NL+PLR
Sbjct  324   RASAEVLGKGSVGTAYKAVLEDGSVVAVKRLKDVSISGREFEQQIQTIGRLQHPNLVPLR  383

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQG-  598
             AY ++  E LLVYD+M MGSL+  LHG  G  +  L+W  R  IA G A  I  LH QG 
Sbjct  384   AYYFSKDEKLLVYDYMPMGSLSALLHGTRGAGRTPLDWVSRVRIALGAARGITYLHEQGG  443

Query  599   STICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSD  778
             S   HGNI+SSN+ L    +  VS+F L QL +  S    + GYRAPEV    + + +SD
Sbjct  444   SNFVHGNIKSSNILLKKNYDAAVSDFGLAQLFNSSSAASRIVGYRAPEVAETRKSTQRSD  503

Query  779   VYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveql  958
             VYSFGVLLLELLTGKAP +A    +G+DLP WV+++ RE+   +VFD  L + +   E++
Sbjct  504   VYSFGVLLLELLTGKAPTQASLNDEGIDLPRWVQSVVREEWTAEVFDLELMRYQNIEEEM  563

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIK  1045
             VQLLQVA+ C    P++RP M  V   I+
Sbjct  564   VQLLQVAMACVATSPDQRPKMKDVVRMIE  592



>ref|XP_010502431.1| PREDICTED: probable inactive receptor kinase At3g02880 [Camelina 
sativa]
Length=629

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 192/296 (65%), Gaps = 2/296 (1%)
 Frame = +2

Query  167   SPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIG  343
             S   +V   L+FF    G  +LD LL+++A VLGKGT G+SYK+       VAVKRL+  
Sbjct  320   SESGVVSKDLIFFVKSFGEFDLDGLLKASAEVLGKGTVGSSYKASFDHGLIVAVKRLRDV  379

Query  344   CLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKA  523
              +   EF ER+  LG M+H NL+ L AY ++  E LLV+++MS GSL+  LHGN+G  + 
Sbjct  380   VVPEKEFRERLQVLGSMSHPNLVTLIAYYFSRDEKLLVFEYMSRGSLSAILHGNKGNGRT  439

Query  524   SLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPD  703
              LNWE R  +A G A AI+ LH++ +T  HGNI+SSNV L+   E +VS++ L  ++S  
Sbjct  440   PLNWETRVGVALGAARAIKFLHSRDATTSHGNIKSSNVLLSESYEAKVSDYGLAPIISST  499

Query  704   SKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRA  883
             S  + + GYRAPEVT   ++S ++DVYSFGVL+LELLTGK+P       +GVDLP WV++
Sbjct  500   SAPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQS  559

Query  884   MFREKPICDVFDSTLAKAE-QNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             +  ++   +V D  L + + +  E +++LL++ + CT QYP+ RPSMA V   I++
Sbjct  560   VTDQQSPSEVLDPELTRYQPEGNENIIRLLKIGMSCTAQYPDSRPSMADVTRLIEE  615



>ref|XP_008381374.1| PREDICTED: probable inactive receptor kinase RLK902 [Malus domestica]
Length=236

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 149/222 (67%), Gaps = 0/222 (0%)
 Frame = +2

Query  392   MTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVAN  571
             M H NL+PLRAY ++  E L VYD+M MGSL+  LHG  G  +  LNWE R+ IA GVA 
Sbjct  1     MDHSNLVPLRAYYYSRDEKLFVYDYMPMGSLSALLHGTRGSGRTPLNWETRSGIAVGVAR  60

Query  572   AIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTS  751
             AI  +H+ G T  HGNI+SSN+ LT   E  VS+FCL  L SP S  + +SGYRAPE+T 
Sbjct  61    AITYIHSHGPTTSHGNIKSSNILLTRSYEACVSDFCLAHLASPTSTPNRISGYRAPELTD  120

Query  752   PHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLA  931
               +V+ ++DVYSFGVLLLE+LTGK P +     +GVDLP WV ++ RE+   +VFD  L 
Sbjct  121   TSKVTQKADVYSFGVLLLEILTGKPPTQTIMNEEGVDLPRWVHSVVREEWTAEVFDFELL  180

Query  932   KAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
             + +   E++VQLLQ+A+ CT QYP+ RPSM  V  +I+   S
Sbjct  181   RYQNVEEEMVQLLQIALECTVQYPDSRPSMGEVTSRIEDLYS  222



>ref|XP_010549038.1| PREDICTED: probable inactive receptor kinase At1g48480 [Tarenaya 
hassleriana]
Length=642

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 144/288 (50%), Positives = 192/288 (67%), Gaps = 17/288 (6%)
 Frame = +2

Query  191   KLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFT  367
             KLVFFG+     +L+DLLR++A VLGKGTFGT+YK+ L   T VAVKRLK   +   EF 
Sbjct  354   KLVFFGNATRVFDLEDLLRASAEVLGKGTFGTAYKAVLDATTVVAVKRLKDVTMEEREFR  413

Query  368   ERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRT  547
             E++  +G M HENL+PLRAY ++  E LLVYD M MGSL+  LHGN+G  ++ L+WE+R 
Sbjct  414   EKIEAVGAMDHENLVPLRAYYYSRDEKLLVYDFMPMGSLSALLHGNKGGGRSPLSWEMRA  473

Query  548   SIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-DLVS  724
              IA G A  +  LH+Q S   HGN++SSN+ L+   E RVS+F L QL+   S   +  +
Sbjct  474   GIALGAARGLNYLHSQCS---HGNVKSSNILLSKANEARVSDFGLAQLVGLSSATPNRGT  530

Query  725   GYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRA--MFREK  898
             GYRAPEVT P +VS ++DVYSFGV+LLEL+TGKAP  +    +GVDLP WV +  + RE 
Sbjct  531   GYRAPEVTDPKRVSQKADVYSFGVVLLELITGKAPGNS---EEGVDLPRWVLSEELRRE-  586

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQI  1042
                ++FDS L   E       ++LQ+ I CT Q+P+KRP+M  V  +I
Sbjct  587   ---ELFDSELLSHEAE---AEEMLQLGIECTAQHPDKRPTMDDVVTRI  628



>ref|XP_008812474.1| PREDICTED: probable inactive receptor kinase At1g48480 [Phoenix 
dactylifera]
Length=657

 Score =   233 bits (595),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/269 (48%), Positives = 179/269 (67%), Gaps = 0/269 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT GT+YK+ L    AVAVKRLK   L   EF E+V  +  M H NL+PL+
Sbjct  343   RASAEVLGKGTTGTTYKAMLEMGMAVAVKRLKDVNLPEGEFWEKVEAIVAMDHRNLVPLQ  402

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             A+  +  E LLVYD++ MGSL+  LHGN G  +  L+WE R+ IA   A  I+ +H+ G 
Sbjct  403   AFYCSKDERLLVYDYIPMGSLSSILHGNRGALQTPLDWETRSGIALDAARGIEYIHSMGP  462

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              + HGNI+SSN+ L    E  VS+  L  L+SP +     +GY APEVT   +VS +++V
Sbjct  463   GVSHGNIKSSNILLDKSFEAHVSDHGLANLVSPSTTPCHAAGYCAPEVTDARRVSQKAEV  522

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLLLELLTG++P +AF   +G +LP WVR++ RE  + +VFD  L + +   E++V
Sbjct  523   YSFGVLLLELLTGRSPTQAFHDEEGTNLPKWVRSVVREDWVSEVFDLELLRYQNLKEEMV  582

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             QLLQ+AI C  +YP+KRPSM+ V  +I++
Sbjct  583   QLLQLAIDCAARYPDKRPSMSEVVIRIEE  611



>ref|XP_010463719.1| PREDICTED: probable inactive receptor kinase At3g02880 [Camelina 
sativa]
Length=627

 Score =   232 bits (592),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 178/270 (66%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGT G+SYK+       VAVKRL+   +   EF ER+  LG M+H NL+ L 
Sbjct  344   KASAEVLGKGTVGSSYKASFDHGLIVAVKRLRDVVVPEKEFRERLQVLGSMSHPNLVTLI  403

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV+++MS GSL+  LHGN+G  +  LNWE R  +A G A AI+ LH++  
Sbjct  404   AYYFSRDEKLLVFEYMSRGSLSAILHGNKGNGRTPLNWETRVGVALGAARAIKFLHSRDG  463

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSNV L+   E +VS++ L  ++S  S  + + GYRAPEVT   ++S ++DV
Sbjct  464   TTSHGNIKSSNVLLSESYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADV  523

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAE-QNveql  958
             YSFGVL+LELLTGK+P       +GVDLP WV+++  ++   +V D  L + + +  E +
Sbjct  524   YSFGVLILELLTGKSPTHQQLNEEGVDLPRWVQSVTDQQSPSEVLDPELTRYQPEGNENI  583

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             ++LL++ + CT QYP+ RPSMA V   I++
Sbjct  584   IRLLKIGMSCTAQYPDTRPSMADVTRLIEE  613



>ref|XP_004975871.1| PREDICTED: probable inactive receptor kinase RLK902-like [Setaria 
italica]
Length=673

 Score =   231 bits (588),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 182/272 (67%), Gaps = 3/272 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT+GT+YK+ +     +AVKRLK   L   EF ++V  +G + H N++PL+
Sbjct  367   RASAEVLGKGTYGTTYKAAIESGPVMAVKRLKETSLPEREFRDKVAAIGGIDHPNVVPLQ  426

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+VY+ ++MGSL+  LHGN G  ++ L+WE R  IA   A  ++ +HA GS
Sbjct  427   AYYFSKDEKLMVYEFVAMGSLSSMLHGNRGSGRSPLSWESRRRIALASARGLEYIHATGS  486

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDS--KLDLVSGYRAPEVTS-PHQVSHQ  772
              + HGNIRSSN+ L+  ++ RV++  L  L+ P        V+GYRAPEV + P +VS +
Sbjct  487   MVTHGNIRSSNILLSRSVDARVADHGLAHLVGPAGAPAATRVAGYRAPEVVADPRRVSQK  546

Query  773   SDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNve  952
             +DVYSFGVLLLE+LTGKAP  A    +GVDLP W R++ +E+   +VFD+ L +     E
Sbjct  547   ADVYSFGVLLLEMLTGKAPTHAVLHDEGVDLPRWARSVVKEEWTAEVFDTELLRHPGAEE  606

Query  953   qlvqllqvAICCTFQYPNKRPSMAAVADQIKK  1048
             Q+V++L++A+ CT   P++RP+M  +  +I++
Sbjct  607   QMVEMLRLAMDCTVPAPDQRPAMPEIVARIEE  638



>dbj|BAJ89083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=669

 Score =   231 bits (588),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 199/300 (66%), Gaps = 3/300 (1%)
 Frame = +2

Query  167   SPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIG  343
             +P ++ + KL FFG      +L+DLLR++A VLGKGT+GT+YK+ L    AVAVKRLK  
Sbjct  337   APVSVGRKKLFFFGRVPRPYDLEDLLRASAEVLGKGTYGTTYKAALETAPAVAVKRLKET  396

Query  344   CLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKA  523
              L   EF +++  +G + H N++PL+AY ++  E L+VY+ ++ GSL+  LHGN G  ++
Sbjct  397   SLPEREFRDKIAAIGGLDHPNVVPLQAYYFSKDERLMVYEFVATGSLSSMLHGNRGAGRS  456

Query  524   SLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPD  703
              L+W+ R  IA   A  ++ +HA GS + HGNI+SSN+ L   ++ RV++  L  L+ P 
Sbjct  457   PLSWDSRRRIALASARGLEYIHATGSKVAHGNIKSSNILLGRSVDARVADHGLASLVGPA  516

Query  704   SKLDL-VSGYRAPEVTS-PHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWV  877
                 + V+GYRAPEV + P ++S ++DVYSFGVLLLE+LTGKAP  A    +GVDLP W 
Sbjct  517   GAPSMRVAGYRAPEVVADPRRLSQKADVYSFGVLLLEMLTGKAPTNAVLHDEGVDLPRWA  576

Query  878   RAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIKKTCS  1057
             R++ RE+   +VFD+ L +     E++V++L++A+ CT   P++RP+M  +  +I++  +
Sbjct  577   RSVVREEWTSEVFDTELLRHPGAEEEMVEMLRLAMDCTVPVPDQRPAMPEIVVRIEELAA  636



>dbj|BAJ95574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=671

 Score =   229 bits (585),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 204/320 (64%), Gaps = 13/320 (4%)
 Frame = +2

Query  128   AKKSCELYNIMAWSPDAIVK---------SKLVFFgdgdgyel---ddllRSTAGVLGKG  271
              +K  EL +  A +P A V           KLVFFG     +    +DLLR++A VLGKG
Sbjct  321   GRKPPELPSGSAVAPMATVGHPAGQSTSGKKLVFFGSAAAVQPFDLEDLLRASAEVLGKG  380

Query  272   TFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEIL  451
               GT+YK+ L     VAVKRLK   ++  EF +R+ ++G++ HE ++PLRAY ++  E L
Sbjct  381   AIGTTYKAVLESSATVAVKRLKDVTMSEPEFRDRIADIGELQHEFIVPLRAYYYSKDEKL  440

Query  452   LVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSS  631
             LVYD M MGSL+  LHGN G  +  L+W +R+SIA   A  I+ +H+  S+  HGNI+SS
Sbjct  441   LVYDFMPMGSLSAVLHGNRGSGRTPLDWPIRSSIALAAARGIEYIHSTSSSTSHGNIKSS  500

Query  632   NVFLTNFLEVRVSEFCLGQLL-SPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLE  808
             N+ L+   + RVS+  L  L+ S  S     +GYRAPEVT P +VS ++DV+SFGVLLLE
Sbjct  501   NILLSKAYQARVSDNGLATLVGSSSSGPSRATGYRAPEVTDPRRVSQKADVFSFGVLLLE  560

Query  809   LLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICC  988
             LLTGKAP ++    +GVDLP WV+++ R +   +VFD  L + + + EQ+VQLLQ+AI C
Sbjct  561   LLTGKAPSQSALNDEGVDLPRWVQSVVRSEWTSEVFDMELLRNQSSEEQMVQLLQLAIDC  620

Query  989   TFQYPNKRPSMAAVADQIKK  1048
               Q P+ RP+M+ V  +I++
Sbjct  621   VAQVPDARPTMSHVVVRIEE  640



>gb|AGT16967.1| hypothetical protein SHCRBa_121_P14_R_290 [Saccharum hybrid cultivar 
R570]
Length=670

 Score =   229 bits (584),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 182/270 (67%), Gaps = 2/270 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT+GT+YK+ +     +AVKRLK   L   EF ++V  +G + H N++PL+
Sbjct  364   RASAEVLGKGTYGTTYKAAIESGPVMAVKRLKETSLPEREFRDKVAAIGGIDHPNVVPLQ  423

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+VY+ ++MGSL+  LHGN G  ++ L+WE R  IA   A  ++ +HA GS
Sbjct  424   AYYFSKDEKLMVYEFVAMGSLSSMLHGNRGSGRSPLSWESRRRIALASARGLEYIHATGS  483

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSP-DSKLDLVSGYRAPEVTS-PHQVSHQS  775
              + HGNI+SSN+ L+  ++ RV++  L  L+ P  +    V+GYRAPEV + P +VS ++
Sbjct  484   MVTHGNIKSSNILLSRSVDARVADHGLAHLVGPAGAPTTRVAGYRAPEVVADPRRVSQKA  543

Query  776   DVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveq  955
             DVYSFGVLLLELLTGKAP  A    +GVDLP W R++ +E+   +VFD+ L +     E+
Sbjct  544   DVYSFGVLLLELLTGKAPTHAVLHDEGVDLPRWARSVVKEEWTSEVFDTELLRHPGAEEE  603

Query  956   lvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
             +V++L++A+ CT   P++RP+M  +  +I+
Sbjct  604   MVEMLRLAMDCTEPAPDQRPAMPEIVARIE  633



>ref|XP_004508557.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Cicer 
arietinum]
Length=648

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 140/289 (48%), Positives = 189/289 (65%), Gaps = 3/289 (1%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             ++KLVFF  G    +L+DLLR++A VLGKG+ GTSYK+ L E T V VKRLK   +   E
Sbjct  321   RNKLVFFDGGIYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVVVTKKE  380

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F  ++  LGK+ HEN++PLRA+ ++  E LLVYD+MS GSL+  LHG+ G  +  L+W+ 
Sbjct  381   FEMQMEILGKIKHENVVPLRAFYFSKDEKLLVYDYMSAGSLSALLHGSRGSGRTPLDWDN  440

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTN-FLEVRVSEFCLGQLLSPDSKLDL  718
             R  IA G A  +  LH  G  I HGNI+SSN+ L     E  VS+F L  L    S  + 
Sbjct  441   RMRIALGAARGVSCLHVSGKVI-HGNIKSSNILLRGPDHEASVSDFGLNPLFGNGSPSNR  499

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             V+GYRAPEV    +VS +SDVYSFGVLLLELLTGKAP +A    +G+DLP WV+++ RE+
Sbjct  500   VAGYRAPEVLETRKVSFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREE  559

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
                +VFD+ L +     E++VQLLQ+A+ C    P++RP+M  V   I+
Sbjct  560   WTAEVFDAELMRFHNIEEEMVQLLQIAMACVSVVPDQRPTMQDVVRMIE  608



>gb|EYU34504.1| hypothetical protein MIMGU_mgv1a003961mg [Erythranthe guttata]
Length=552

 Score =   226 bits (576),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 176/274 (64%), Gaps = 12/274 (4%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A V+GKGT G++YK+ L     V VKRLK   ++  EF +++ E   + HENL PLR
Sbjct  287   RASAQVMGKGTVGSTYKAYLDSGVEVIVKRLKSVSVSEKEFKDKMEEFASLVHENLEPLR  346

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
              Y +   E LL+YD +S GSL+  LHG+   NK  L+WE R  IA G A+ I  LH+  S
Sbjct  347   GYFYGRDEKLLIYDPLSNGSLSSILHGS---NKRRLSWETRAKIALGAASGINYLHSVNS  403

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLS--PDSKLDLVSGYRAPEVTSPHQVSHQS  775
                HGNI SSNVFLT+ LE RVSEF L +L+S  P+S     +GY APEV    ++S ++
Sbjct  404   QTAHGNINSSNVFLTDNLEARVSEFGLTELVSSVPNS-----NGYPAPEVNDSRKISQKA  458

Query  776   DVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQN-ve  952
             DVYSFG++LLELLTGKAP     + +G++LPNWV ++ +EK    VFD  L    +N  E
Sbjct  459   DVYSFGIVLLELLTGKAPDHVLTE-EGIELPNWVNSVVQEKWTIQVFDPDLLVEYENLDE  517

Query  953   qlvqllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             ++V LL +AI CT   P+KRPSM  V  +I++ C
Sbjct  518   KMVHLLHIAITCTALLPDKRPSMLEVTQRIREIC  551



>gb|EPS60479.1| hypothetical protein M569_14322, partial [Genlisea aurea]
Length=588

 Score =   226 bits (576),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 178/263 (68%), Gaps = 0/263 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             RS+A VLGKG+FGT+YK+ L    AVAVKRL+   L+ +EF  +++++G++ H NL+PL+
Sbjct  326   RSSAEVLGKGSFGTTYKALLGTGLAVAVKRLREVDLSENEFKYKINQIGRLDHRNLVPLK  385

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVYD++  GSL+  LHGN G  +  LNWE R +IA+G A  I  +H+ G 
Sbjct  386   AYYYHRDEQLLVYDYLPSGSLSALLHGNRGGGRTPLNWETRAAIAHGAAAGISYIHSHGP  445

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             ++ HGN++SSNV LT   E  VS+  L ++  P +    ++G+RAPEVT P  VS  +DV
Sbjct  446   SVSHGNVKSSNVLLTGSYEACVSDLGLARIAVPSTGNSRLAGFRAPEVTDPRNVSQSADV  505

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG+LLLEL+T +AP ++     GVDL  WV+++ +E  + +VFD  L +     E +V
Sbjct  506   YSFGILLLELMTARAPADSPTNEDGVDLRRWVQSVVKEDWMGEVFDVELFRYRNAEEDMV  565

Query  962   qllqvAICCTFQYPNKRPSMAAV  1030
             QL+++A+ CT QYP KRPSM  V
Sbjct  566   QLVELALECTSQYPEKRPSMDVV  588



>ref|XP_009601083.1| PREDICTED: probable inactive receptor kinase At5g16590 [Nicotiana 
tomentosiformis]
Length=209

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 136/199 (68%), Gaps = 1/199 (1%)
 Frame = +2

Query  461   DHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVF  640
             D+M   SLA RLH N    KASL  E+RT IAYGVA A++ LHAQG  +CHGNIRSSNV 
Sbjct  7     DYMPTSSLASRLHDNVMAKKASLACEIRTRIAYGVARALEFLHAQGPGVCHGNIRSSNVL  66

Query  641   LTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTG  820
             L N+   R+SE  + +   P+SK  L+ GY+APEV +   VS +S VYS GVL+LELL+G
Sbjct  67    LANYFYFRLSEHGMFRFFVPNSKFVLIPGYQAPEVENAFDVSPKSVVYSSGVLILELLSG  126

Query  821   KAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAI-CCTFQ  997
             KAPLEA  K   VDLP+WVR MF+EKPI DVFDS L    QN  + +  L   + CCTF+
Sbjct  127   KAPLEAIGKNTWVDLPSWVRVMFQEKPIIDVFDSMLLHNYQNFGEHMVQLLQLVNCCTFK  186

Query  998   YPNKRPSMAAVADQIKKTC  1054
              P+KRPSM  V ++I KTC
Sbjct  187   NPSKRPSMVEVTNRINKTC  205



>ref|XP_001778285.1| predicted protein [Physcomitrella patens]
 gb|EDQ56952.1| predicted protein [Physcomitrella patens]
Length=658

 Score =   227 bits (578),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 174/271 (64%), Gaps = 1/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT GT+YK+ L + T +AVKRLK       +F   +  +GK+ H NL+PLR
Sbjct  326   RASAEVLGKGTVGTAYKAILEDGTVMAVKRLKDVTTCKKDFETLIQVVGKLQHRNLVPLR  385

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLV D+M MG+LA  LH N GKN+  ++W  R  IA G    +  LH+QG 
Sbjct  386   AYYFSKDEKLLVSDYMPMGNLAALLHNNRGKNRTPVDWLTRVRIAIGAGKGLAYLHSQGG  445

Query  602   -TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSD  778
              +  HGNI+SSN+ L   LE  +++F L QLLS  S    + GYRAPEV++  +V+ +SD
Sbjct  446   PSFVHGNIKSSNILLNRDLEACIADFGLAQLLSSSSSGSKMVGYRAPEVSATRKVTQKSD  505

Query  779   VYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveql  958
             VYSFGVLLLELLTGKAP  A +  + VDLP WV+++ RE+   +VFD  L + +    +L
Sbjct  506   VYSFGVLLLELLTGKAPTPASSNDEPVDLPRWVQSIVREEWTAEVFDLELMRYQNIEGEL  565

Query  959   vqllqvAICCTFQYPNKRPSMAAVADQIKKT  1051
             V +LQ+A+ C    P +RP M  V  Q+++ 
Sbjct  566   VTMLQIAMKCVDPVPERRPKMHTVVSQLEEV  596



>ref|XP_010921194.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=349

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/298 (43%), Positives = 192/298 (64%), Gaps = 7/298 (2%)
 Frame = +2

Query  185   KSKLVFFgd-gdgyelddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             K+KLVFF      ++L+DLLR++A VLGKG++GT+YK+ L + TAV VKRLK   +   E
Sbjct  38    KNKLVFFEGCAYNFDLEDLLRASAEVLGKGSYGTAYKAVLEDGTAVVVKRLKEVVVGKRE  97

Query  362   FTERVHELGKM-THENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWE  538
             F +++  +G++  H  L+PLRAY ++  E LLVYD++  GS +  LHGN G  +  L+W+
Sbjct  98    FEQQMEIIGRVGQHPKLVPLRAYFYSKDEKLLVYDYVPTGSFSTLLHGNRGSERTPLDWD  157

Query  539   VRTSIAYGVANAIQSLHAQGS-TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKL-  712
              R  +  G A+ I  +H++G     HGNI+SSN+ L   L   VS++ L  L++P + L 
Sbjct  158   SRVKVILGTAHGIAHIHSEGGPKFVHGNIKSSNILLGQDLNPLVSDYGLSPLMNPPATLS  217

Query  713   DLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFR  892
              L+ GYRAPE     +++ +SDVYSFGV+LLE+LTGKAPL++       DLP WV+++ R
Sbjct  218   QLMVGYRAPETMETRKITQKSDVYSFGVVLLEMLTGKAPLQSQGHDDVADLPRWVQSVVR  277

Query  893   EKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVA---DQIKKTCS  1057
             E+   +VFD  L     N E+LV++LQ+A+ C  + P +RP M  V    ++I+K+ S
Sbjct  278   EEWTAEVFDVELMMDHNNEEELVRMLQIAMSCVARTPEQRPRMEDVVRMIEEIRKSGS  335



>ref|XP_002447974.1| hypothetical protein SORBIDRAFT_06g019120 [Sorghum bicolor]
 gb|EES12302.1| hypothetical protein SORBIDRAFT_06g019120 [Sorghum bicolor]
Length=662

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/270 (44%), Positives = 181/270 (67%), Gaps = 2/270 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT+GT+YK+ +     +AVKRLK   L   EF ++V  +G + H N++PL+
Sbjct  356   RASAEVLGKGTYGTTYKAAIESGPVMAVKRLKETSLPEREFRDKVAAIGGIDHPNVVPLQ  415

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+VY+ ++MGSL+  LHGN G  ++ L+WE R  IA   A  ++ +HA GS
Sbjct  416   AYYFSKDEKLMVYEFVAMGSLSSMLHGNRGSGRSPLSWESRRRIALASARGLEYIHATGS  475

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSP-DSKLDLVSGYRAPEVTS-PHQVSHQS  775
              + HGNI+SSN+ L+  ++ RV++  L  L+ P  +    V+GYRAPEV + P + S ++
Sbjct  476   MVTHGNIKSSNILLSRSVDARVADHGLAHLVGPAGAPTTRVAGYRAPEVVADPRRASQKA  535

Query  776   DVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveq  955
             DVYSFGVLLLELLTGKAP  A    +GVDLP W R++ +E+   +VFD+ L +     E+
Sbjct  536   DVYSFGVLLLELLTGKAPTHAVLHEEGVDLPRWARSVVKEEWTSEVFDTELLRHPGAEEE  595

Query  956   lvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
             +V++LQ+A+ C+   P++RP+M  +  +I+
Sbjct  596   MVEMLQLAMDCSEPAPDQRPAMPEIVARIE  625



>ref|XP_007154939.1| hypothetical protein PHAVU_003G159700g [Phaseolus vulgaris]
 gb|ESW26933.1| hypothetical protein PHAVU_003G159700g [Phaseolus vulgaris]
Length=645

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 138/289 (48%), Positives = 189/289 (65%), Gaps = 3/289 (1%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             ++KLVFF  G    +L+DLLR++A VLGKG+ GTSYK+ L E T V VKRLK   +   E
Sbjct  319   RNKLVFFEGGIYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVVVTKKE  378

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F  ++  LGK+ HEN++PLRA+ ++  E LLVYD+MS GSL+  LHG+ G  +  L+W+ 
Sbjct  379   FELQMEVLGKIKHENVVPLRAFYFSKDEKLLVYDYMSAGSLSALLHGSRGSGRTPLDWDS  438

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTN-FLEVRVSEFCLGQLLSPDSKLDL  718
             R  IA G A  +  LH  G  + HGNI+SSN+ L     +  VS+F L  L    +  + 
Sbjct  439   RMKIAVGAARGLACLHVAGK-VVHGNIKSSNILLRGPDHDAGVSDFGLNPLFGNGAPSNR  497

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             V+GYRAPEV    +VS +SDVYSFGVLLLELLTGKAP +A    +G+DLP WV+++ RE+
Sbjct  498   VAGYRAPEVVETRKVSFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREE  557

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
                +VFD+ L +     E++VQLLQ+A+ C    P++RPSM  V   I+
Sbjct  558   WTAEVFDAELMRYHNFEEEMVQLLQIAMACVSVVPDQRPSMQDVVRMIE  606



>ref|XP_007204237.1| hypothetical protein PRUPE_ppa002548mg [Prunus persica]
 gb|EMJ05436.1| hypothetical protein PRUPE_ppa002548mg [Prunus persica]
Length=659

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 198/316 (63%), Gaps = 3/316 (1%)
 Frame = +2

Query  101   ACRNQEQIKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTF  277
             A R+    +A  S    +I   S +A  ++KLVFF  G    +L+DLLR++A VLGKG+ 
Sbjct  305   ATRSVAVAEAGTSSSKDDITGGSTEA-ERNKLVFFDGGVYSFDLEDLLRASAEVLGKGSV  363

Query  278   GTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLV  457
             GTSYK+ L E T V VKRLK   +   EF  ++  LGK+ H+N++PLRA+ ++  E LLV
Sbjct  364   GTSYKAVLEEGTTVVVKRLKDVVVTKREFEMQMEVLGKIKHDNVVPLRAFYFSKDEKLLV  423

Query  458   YDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNV  637
             YD+M+ GSL+  LHG+ G  +  L+W+ R  IA   A  I  LH  G  + HGNI+SSN+
Sbjct  424   YDYMAAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHVSGK-VVHGNIKSSNI  482

Query  638   FLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLT  817
              L    +  VS+F L  L    +  + V+GYRAPEV    +V+ +SDVYSFGVLLLELLT
Sbjct  483   LLRPEHDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLT  542

Query  818   GKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQ  997
             GKAP +A    +G+DLP WV+++ RE+   +VFD  L +     E++VQLLQ+A+ C   
Sbjct  543   GKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVST  602

Query  998   YPNKRPSMAAVADQIK  1045
              P++RP+M  V   I+
Sbjct  603   VPDQRPAMQEVVRMIE  618



>ref|XP_008242698.1| PREDICTED: probable inactive receptor kinase At2g26730 [Prunus 
mume]
Length=659

 Score =   226 bits (575),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 198/316 (63%), Gaps = 3/316 (1%)
 Frame = +2

Query  101   ACRNQEQIKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTF  277
             A R+    +A  S    +I   S +A  ++KLVFF  G    +L+DLLR++A VLGKG+ 
Sbjct  305   AARSVAVAEAGTSSSKDDITGGSTEA-ERNKLVFFDGGVYSFDLEDLLRASAEVLGKGSV  363

Query  278   GTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLV  457
             GTSYK+ L E T V VKRLK   +   EF  ++  LGK+ H+N++PLRA+ ++  E LLV
Sbjct  364   GTSYKAVLEEGTTVVVKRLKDVVVTKREFEMQMEVLGKIKHDNVVPLRAFYFSKDEKLLV  423

Query  458   YDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNV  637
             YD+M+ GSL+  LHG+ G  +  L+W+ R  IA   A  I  LH  G  + HGNI+SSN+
Sbjct  424   YDYMAAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHVSGK-VVHGNIKSSNI  482

Query  638   FLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLT  817
              L    +  VS+F L  L    +  + V+GYRAPEV    +V+ +SDVYSFGVLLLELLT
Sbjct  483   LLRPEHDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLT  542

Query  818   GKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQ  997
             GKAP +A    +G+DLP WV+++ RE+   +VFD  L +     E++VQLLQ+A+ C   
Sbjct  543   GKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVST  602

Query  998   YPNKRPSMAAVADQIK  1045
              P++RP+M  V   I+
Sbjct  603   VPDQRPAMQEVVRMIE  618



>ref|XP_004287382.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Fragaria 
vesca subsp. vesca]
Length=654

 Score =   225 bits (574),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 198/316 (63%), Gaps = 3/316 (1%)
 Frame = +2

Query  101   ACRNQEQIKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTF  277
             A R+    +A  S    +I   S +A  ++KLVFF  G    +L+DLLR++A VLGKG+ 
Sbjct  300   AARSVPAAEAGTSSSKDDITGTSTEA-ERNKLVFFNGGIYSFDLEDLLRASAEVLGKGSV  358

Query  278   GTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLV  457
             GTSYK+ L E T V VKRLK   +   EF   +  LGK+ H+N++PLRA+ ++  E LLV
Sbjct  359   GTSYKAVLEEGTTVVVKRLKDVVVTKKEFDMTMEVLGKIKHDNVVPLRAFYFSKDEKLLV  418

Query  458   YDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNV  637
             YD+M+ GSL+  LHG+ G  +  L+W+ R  IA   A  +  LH  G  + HGNI+SSN+
Sbjct  419   YDYMTAGSLSALLHGSRGSGRTPLDWDNRMRIALSAARGLAHLHVAGK-VVHGNIKSSNI  477

Query  638   FLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLT  817
              L    +  +S+F L  L    +  + V+GYRAPEV    +V+ +SDVYSFGVLLLELLT
Sbjct  478   LLRPDHDATISDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLT  537

Query  818   GKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQ  997
             GKAP +A    +G+DLP WV+++ RE+   +VFD  L + +   E++VQLLQ+A+ C   
Sbjct  538   GKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQLLQIAMACVST  597

Query  998   YPNKRPSMAAVADQIK  1045
              P++RP+M  V   I+
Sbjct  598   VPDQRPAMQEVVRMIE  613



>ref|XP_009391414.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=643

 Score =   225 bits (573),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 170/271 (63%), Gaps = 0/271 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT GT+YK+ L     VAVKRL+   L   EF +R+  +G M H N + L+
Sbjct  348   RASAEVLGKGTSGTTYKAMLEMGMVVAVKRLRDVNLPEKEFRDRMEVIGAMDHPNSVTLQ  407

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E LLVY+ +  GSL+  LHGN+   +  L+W+ R  IA G A  I+ +H + S
Sbjct  408   AYYYSKDEKLLVYEFVPNGSLSSVLHGNKSSGRTPLDWKTRLEIALGAARGIEYIHLKSS  467

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              + HGNI SSN+ L  F E  VS+F L  L S        +GYRAPEVT   +VS ++DV
Sbjct  468   GLSHGNITSSNIVLAKFNEALVSDFGLNSLGSTPMPSQRAAGYRAPEVTDIRRVSQKADV  527

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLL+ELLTGK P +A     GVDLP WV ++ RE+   +VFD  L + +   E +V
Sbjct  528   YSFGVLLMELLTGKPPTQALNNEDGVDLPRWVESVVREEWNSEVFDLELLRYQNVEEAMV  587

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             QLLQ+AI C  Q+P  RPSM+ V  +I++ C
Sbjct  588   QLLQLAIDCAVQFPENRPSMSEVVARIEEIC  618



>ref|XP_004139332.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Cucumis 
sativus]
 gb|KGN60644.1| Protein kinase [Cucumis sativus]
Length=653

 Score =   224 bits (572),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 197/320 (62%), Gaps = 2/320 (1%)
 Frame = +2

Query  101   ACRNQEQIKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTF  277
             A R+    +A  S    +I   S +A  ++KLVFF  G    +L+DLLR++A VLGKG+ 
Sbjct  298   AARSIPVAEAGTSSSKDDITGGSVEATERNKLVFFEGGIYNFDLEDLLRASAEVLGKGSV  357

Query  278   GTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLV  457
             GTSYK+ L E T V VKRLK   +   EF  ++  LGK+ HEN++PLRA+ ++  E LLV
Sbjct  358   GTSYKAVLEEGTTVVVKRLKDVVVTKKEFENQMEILGKIKHENVVPLRAFYFSKDEKLLV  417

Query  458   YDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNV  637
             YD++S GSL+  LHG+ G  +  L+W+ R  IA      +  LH  G  + HGNI+SSN+
Sbjct  418   YDYISTGSLSASLHGSRGSGRTPLDWDSRMRIALSAGRGLAHLHLTGK-VVHGNIKSSNI  476

Query  638   FLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLT  817
              L    +  +S+F L  L    +  + V+GYRAPEV    +V+ +SDVYS+GVLLLELLT
Sbjct  477   LLRPDHDACISDFGLNPLFGTATPPNRVAGYRAPEVVETRKVTFKSDVYSYGVLLLELLT  536

Query  818   GKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQ  997
             GKAP +      G+DLP WV+++ RE+   +VFD+ L +     E++VQLLQ+A+ C   
Sbjct  537   GKAPNQQSLGEDGIDLPRWVQSVVREEWTAEVFDAELMRFHNIEEEMVQLLQIAMSCVST  596

Query  998   YPNKRPSMAAVADQIKKTCS  1057
              P++RP+M  V   I+   S
Sbjct  597   VPDQRPAMPEVVRMIEDMSS  616



>ref|XP_003609204.1| hypothetical protein MTR_4g113100 [Medicago truncatula]
 gb|AES91401.1| LRR receptor-like kinase [Medicago truncatula]
Length=655

 Score =   224 bits (572),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 136/289 (47%), Positives = 190/289 (66%), Gaps = 3/289 (1%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             ++KLVFF  G    +L+DLLR++A VLGKG+ GTSYK+ L E T V VKRLK   +   E
Sbjct  328   RNKLVFFDGGIYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVVVTKKE  387

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F  ++  LGK+ H+N++PLRA+ ++  E LLVYD+M+ GSL+  LHG+ G  +  L+W+ 
Sbjct  388   FEMQMEILGKIKHDNVVPLRAFYYSKDEKLLVYDYMAAGSLSALLHGSRGSGRTPLDWDN  447

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTN-FLEVRVSEFCLGQLLSPDSKLDL  718
             R  IA G +  +  LHA G  + HGNI+SSN+ L     +  VS+F L  L    S  + 
Sbjct  448   RMRIALGASRGVACLHASGK-VVHGNIKSSNILLKGPDNDASVSDFGLNPLFGNGSPSNR  506

Query  719   VSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREK  898
             V+GYRAPEV    +V+ +SDVYSFGVLLLELLTGKAP +A    +G+DLP WV+++ RE+
Sbjct  507   VAGYRAPEVLETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREE  566

Query  899   PICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
                +VFD+ L +     E++VQLLQ+A+ C    P++RPSM  V   I+
Sbjct  567   WTAEVFDAELMRFHNIEEEMVQLLQIAMACVSIVPDQRPSMQDVVRMIE  615



>ref|XP_002529343.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33010.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=657

 Score =   224 bits (571),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 195/309 (63%), Gaps = 3/309 (1%)
 Frame = +2

Query  122   IKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSE  298
             ++A  S    +I   S +A  ++KLVFF  G    +L+DLLR++A VLGKG+ GTSYK+ 
Sbjct  311   VEAGTSSSKDDITGGSTEA-ERNKLVFFEGGIYSFDLEDLLRASAEVLGKGSVGTSYKAV  369

Query  299   LPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMG  478
             L E T V VKRLK   ++  EF  ++  LGK+ H+N++PLRA+ ++  E LLVYD M+ G
Sbjct  370   LEEGTTVVVKRLKDVVVSKREFETQMENLGKIKHDNVVPLRAFYYSKDEKLLVYDFMAAG  429

Query  479   SLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLE  658
             SL+  LHG+ G  +  L+W+ R  IA   A  +  LH  G  + HGNI+SSN+ L    +
Sbjct  430   SLSALLHGSRGSGRTPLDWDNRMRIAMSAARGLAHLHVVGK-VVHGNIKSSNILLRPDQD  488

Query  659   VRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEA  838
               +S+F L  L    +    V+GYRAPEV    +V+ +SDVYSFGVLLLELLTGKAP +A
Sbjct  489   AAISDFALNPLFGTATPPSRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQA  548

Query  839   FAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPS  1018
                 +G+DLP WV+++ RE+   +VFD  L +     E++VQLLQ+A+ C    P++RP+
Sbjct  549   SLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVSTVPDQRPA  608

Query  1019  MAAVADQIK  1045
             M  V   I+
Sbjct  609   MQEVVRMIE  617



>ref|XP_002281635.1| PREDICTED: probable inactive receptor kinase At2g26730 [Vitis 
vinifera]
 emb|CBI28134.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   224 bits (571),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 135/288 (47%), Positives = 186/288 (65%), Gaps = 2/288 (1%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             ++KLVFF  G    +L+DLLR++A VLGKG+ GTSYK+ L E T V VKRLK   +   E
Sbjct  327   RNKLVFFEGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVTVTKKE  386

Query  362   FTERVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEV  541
             F  ++  LGK+ HEN++PLRA+ ++  E LLVYD M+ GSL+  LHG+ G  +  L+W+ 
Sbjct  387   FEMQIDVLGKIKHENVVPLRAFYFSKDEKLLVYDFMAAGSLSALLHGSRGSGRTPLDWDN  446

Query  542   RTSIAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLV  721
             R  IA   A  I  LH  G  + HGNI+SSN+ L    +  VS+F L  L    +  + V
Sbjct  447   RMRIALSAARGIAHLHVSGK-VVHGNIKSSNILLRPDHDACVSDFGLNPLFGNSTPPNRV  505

Query  722   SGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKP  901
             +GYRAPEV    +V+ +SDVYSFGVLLLELLTGKAP +A    +G+DLP WV+++ RE+ 
Sbjct  506   AGYRAPEVMETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEW  565

Query  902   ICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
               +VFD  L +     E++VQLLQ+A+ C    P++RP+M  V   I+
Sbjct  566   TAEVFDVELMRYHNIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIE  613



>ref|XP_008463153.1| PREDICTED: probable inactive receptor kinase At3g02880 [Cucumis 
melo]
Length=633

 Score =   224 bits (570),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 175/273 (64%), Gaps = 0/273 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKG+FG++YK+ L     V VKRL+   ++ +EF E++  LG M H+NL+P++
Sbjct  325   KASAEVLGKGSFGSTYKAALDVGITVVVKRLRDVKVSEEEFKEKIESLGMMNHQNLVPIK  384

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
              Y +   E LL+ DH+SMGSL+  LHGN+  ++ SL WE R  IA   A  I  LH++  
Sbjct  385   GYYYGRDEKLLLSDHISMGSLSVHLHGNKDPSRTSLKWEARAGIALAAAQGITYLHSRRP  444

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
                HGNI+SSN+ L       VS+F L Q+ SP S  + V+ YRAPEVT P +VS ++DV
Sbjct  445   PTSHGNIKSSNILLNRSHTACVSDFGLIQIASPASTPNHVATYRAPEVTDPRKVSLKADV  504

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFG+++LELLTGKAP  A     GVDLP WV +   EK   +VFD  L + +  ++++V
Sbjct  505   YSFGIVILELLTGKAPNSAMFNDDGVDLPRWVHSKVEEKKTAEVFDEELLEYKNGLDEMV  564

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTCSL  1060
             QLL +A+ CT  +P+ RPSM  V  +I +   L
Sbjct  565   QLLHLAMLCTAPHPDSRPSMGKVTSRINEIYHL  597



>ref|XP_002868800.1| hypothetical protein ARALYDRAFT_356181 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45059.1| hypothetical protein ARALYDRAFT_356181 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   223 bits (569),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 179/270 (66%), Gaps = 1/270 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             +++A VLGKGTFG+SYK+       +AVKRL+   +   EF E++  LG ++H NL+ L 
Sbjct  341   KASAEVLGKGTFGSSYKASFDNGLVLAVKRLRDVVVPEKEFREKLQVLGSISHPNLVTLI  400

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+V+++MS GSL+  LHGN+G  ++ LNWE R +IA G A AI  LH++ +
Sbjct  401   AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAAIALGAARAISYLHSRDA  460

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
             T  HGNI+SSN+ L+   E +VS++C   ++SP S  + + GYRAPEVT   ++S ++DV
Sbjct  461   TTSHGNIKSSNILLSESFEPKVSDYCFAPMISPTSTPNRIDGYRAPEVTDARKISQKADV  520

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVL+LELLTGK+P       +GVDLP WV ++  ++   DVFD  L + + ++ + +
Sbjct  521   YSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDINENM  580

Query  962   ql-lqvAICCTFQYPNKRPSMAAVADQIKK  1048
                L++ I CT QYP+ RP+M  V   I++
Sbjct  581   IKLLKMGISCTAQYPDSRPTMLEVTRLIEE  610



>ref|XP_008458016.1| PREDICTED: probable inactive receptor kinase At2g26730 [Cucumis 
melo]
Length=652

 Score =   224 bits (571),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 138/320 (43%), Positives = 197/320 (62%), Gaps = 2/320 (1%)
 Frame = +2

Query  101   ACRNQEQIKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGTF  277
             A R+    +A  S    +I   S +A  ++KLVFF  G    +L+DLLR++A VLGKG+ 
Sbjct  297   AARSIPVAEAGTSSSKDDITGGSVEATERNKLVFFEGGIYNFDLEDLLRASAEVLGKGSV  356

Query  278   GTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILLV  457
             GTSYK+ L E T V VKRLK   +   EF  ++  LGK+ HEN++PLRA+ ++  E LLV
Sbjct  357   GTSYKAVLEEGTTVVVKRLKDVVVTKKEFENQMEILGKIKHENVVPLRAFYFSKDEKLLV  416

Query  458   YDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSNV  637
             YD++S GSL+  LHG+ G  +  L+W+ R  IA      +  LH  G  + HGNI+SSN+
Sbjct  417   YDYISTGSLSASLHGSRGSGRTPLDWDSRMRIALSAGRGLAHLHLTGK-VVHGNIKSSNI  475

Query  638   FLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLT  817
              L    +  +S+F L  L    +  + V+GYRAPEV    +V+ +SDVYS+GVLLLELLT
Sbjct  476   LLRPDHDACISDFGLNPLFGTATPPNRVAGYRAPEVVETRKVTFKSDVYSYGVLLLELLT  535

Query  818   GKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQ  997
             GKAP +      G+DLP WV+++ RE+   +VFD+ L +     E++VQLLQ+A+ C   
Sbjct  536   GKAPNQQSLGEDGIDLPRWVQSVVREEWTAEVFDAELMRFHNIEEEMVQLLQIAMSCVST  595

Query  998   YPNKRPSMAAVADQIKKTCS  1057
              P++RP+M  V   I+   S
Sbjct  596   VPDQRPAMPEVVRMIEDMSS  615



>tpg|DAA37428.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=677

 Score =   224 bits (571),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 180/271 (66%), Gaps = 3/271 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT GT+YK+ +     +AVKRLK   L   EF ++V  +G + H N++PL+
Sbjct  369   RASAEVLGKGTHGTTYKAAIESGPVMAVKRLKETSLPEREFRDKVAAIGGIDHPNVVPLQ  428

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+VY+ ++MGSL+  LHGN G  ++ L+WE R  IA   A  ++ +HA GS
Sbjct  429   AYYFSKDEKLMVYEFVAMGSLSSMLHGNRGSGRSPLSWESRRRIALASARGLEYIHATGS  488

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSP--DSKLDLVSGYRAPEVTS-PHQVSHQ  772
              + HGNI+SSN+ L+  ++ RV++  L  L++P   +    V+GYRAPEV + P + S +
Sbjct  489   MVTHGNIKSSNILLSRTVDARVADHGLAHLVNPAGAATTTRVAGYRAPEVVADPRRASQK  548

Query  773   SDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNve  952
             +D YSFGVLLLELLTGKAP  A    +GVDLP W R++ +E+   +VFD+ L +     +
Sbjct  549   ADAYSFGVLLLELLTGKAPAHAVLHDEGVDLPRWARSVVKEEWTSEVFDTELLRHPGAED  608

Query  953   qlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
             ++V++L++A+ CT   P++RP+M  +  +I+
Sbjct  609   EMVEMLRLAMDCTEPAPDQRPAMPEIVARIE  639



>ref|XP_008386031.1| PREDICTED: probable inactive receptor kinase At2g26730 [Malus 
domestica]
Length=656

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 195/317 (62%), Gaps = 3/317 (1%)
 Frame = +2

Query  98    PACRNQEQIKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGT  274
             P      + +A  S    +I   S +A  ++KLVFF  G    +L+DLLR++A VLGKG+
Sbjct  301   PVATRSVETEAGTSSSKDDITGGSTEA-ERNKLVFFNGGVYSFDLEDLLRASAEVLGKGS  359

Query  275   FGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILL  454
              GTSYK+ L E T V VKRLK   +   EF   +  LGK+ H+N++PLRA+ ++  E LL
Sbjct  360   VGTSYKAVLEEGTTVVVKRLKDVVVTKREFEMTMEVLGKIKHDNVVPLRAFYFSKDEKLL  419

Query  455   VYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSN  634
             V D+MS GSL+  LHG+ G  +  L+W+ R  IA   A  I  LH  G  + HGNI+SSN
Sbjct  420   VSDYMSAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHVSGK-VVHGNIKSSN  478

Query  635   VFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELL  814
             + L    +  VS+F L  L    +  + V+GYRAPEV    +V+ +SDVYSFGVLLLELL
Sbjct  479   ILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELL  538

Query  815   TGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTF  994
             TGKAP +A    +G+DLP WV+++ RE+   +VFD  L +     E++VQLLQ+A+ C  
Sbjct  539   TGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVS  598

Query  995   QYPNKRPSMAAVADQIK  1045
               P++RP+M  V   I+
Sbjct  599   TVPDQRPAMQEVVRMIE  615



>gb|EYU30110.1| hypothetical protein MIMGU_mgv1a020518mg [Erythranthe guttata]
Length=609

 Score =   223 bits (568),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 175/271 (65%), Gaps = 10/271 (4%)
 Frame = +2

Query  251   AGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYC  430
             A  +GKGT G++YK+       V VKRLK   ++ +EF  ++ E+G   HENL P+R Y 
Sbjct  345   AEAMGKGTVGSTYKAYFDSGVEVIVKRLKNVRVSEEEFIVKIEEVGLFDHENLEPVRGYF  404

Query  431   WNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTIC  610
             +   E LL+Y+  + GSL+  LHGN   NK  L+WE R  IA GVA  I+ LH+ G T  
Sbjct  405   YGRDEKLLLYEPKTNGSLSELLHGN---NKRQLSWENRAKIALGVARGIEYLHSVGPTTA  461

Query  611   HGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSF  790
             HGN++SSNVFLT   E  VSEFCL  L+SP   L+   GYRAPEV     VS Q+DVYSF
Sbjct  462   HGNLKSSNVFLTENYEALVSEFCLTHLVSPLGNLN---GYRAPEVADTRDVSRQADVYSF  518

Query  791   GVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDST--LAKAEQ-Nveqlv  961
             G+LLLE+LTGK P +   + +G++LPNWVR++ REK   +V DS+  L   E     +LV
Sbjct  519   GILLLEILTGKEPDKVLTE-EGIELPNWVRSVDREKWSVEVLDSSSDLVGFENFEERKLV  577

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIKKTC  1054
             +LL++A+ CT Q P++RPS+  VA +I+K C
Sbjct  578   KLLKLAMSCTDQLPDERPSIEEVARRIEKIC  608



>ref|XP_007013302.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY30921.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=650

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 142/324 (44%), Positives = 198/324 (61%), Gaps = 6/324 (2%)
 Frame = +2

Query  86    KENRPAC---RNQEQIKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTA  253
             K+ +P     R   Q +A  S    +I   S +   ++KLVFF  G    +L+DLLR++A
Sbjct  289   KQQKPVTAPTRAVPQAEAGTSSSKDDITGGSTEG-ERNKLVFFEGGVYSFDLEDLLRASA  347

Query  254   GVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCW  433
              VLGKG+ GTSYK+ L E T V VKRLK   ++  EF  ++  LGK+ HEN++PLRA+ +
Sbjct  348   EVLGKGSVGTSYKAVLEEGTTVVVKRLKDVAVSKREFETQMEMLGKIKHENVVPLRAFYY  407

Query  434   NPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICH  613
             +  E LLVYD M  GSL+  LHG+ G  +  L+W+ R  IA   A  +  LH  G  + H
Sbjct  408   SKDEKLLVYDFMRDGSLSALLHGSRGSGRTPLDWDSRMRIALSAARGLTHLHVSGK-VVH  466

Query  614   GNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFG  793
             GNI+SSN+ L    E  +S+F L  L    +    V+GYRAPEV    +V+ +SDVYSFG
Sbjct  467   GNIKSSNILLRPDHEACISDFGLNPLFGNTTPPSRVAGYRAPEVVETRKVTFKSDVYSFG  526

Query  794   VLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllq  973
             VLLLELLTGKAP +A    +G+DLP WV+++ RE+   +VFD  L +     E++VQLLQ
Sbjct  527   VLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHSIEEEMVQLLQ  586

Query  974   vAICCTFQYPNKRPSMAAVADQIK  1045
             +A+ C    P++RP+M  V   I+
Sbjct  587   IAMTCVSTVPDQRPAMEDVVRMIE  610



>gb|ACZ98536.1| protein kinase [Malus domestica]
Length=655

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 195/317 (62%), Gaps = 3/317 (1%)
 Frame = +2

Query  98    PACRNQEQIKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGT  274
             P      + +A  S    +I   S +A  ++KLVFF  G    +L+DLLR++A VLGKG+
Sbjct  300   PVATRSVETEAGTSSSKDDITGGSTEA-ERNKLVFFNGGVYSFDLEDLLRASAEVLGKGS  358

Query  275   FGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILL  454
              GTSYK+ L E T V VKRLK   +   EF   +  LGK+ H+N++PLRA+ ++  E LL
Sbjct  359   VGTSYKAVLEEGTTVVVKRLKDVVVTKREFEMTMEVLGKIKHDNVVPLRAFYFSKDEKLL  418

Query  455   VYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSN  634
             V D+MS GSL+  LHG+ G  +  L+W+ R  IA   A  I  LH  G  + HGNI+SSN
Sbjct  419   VSDYMSAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHVSGK-VVHGNIKSSN  477

Query  635   VFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELL  814
             + L    +  VS+F L  L    +  + V+GYRAPEV    +V+ +SDVYSFGVLLLELL
Sbjct  478   ILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELL  537

Query  815   TGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTF  994
             TGKAP +A    +G+DLP WV+++ RE+   +VFD  L +     E++VQLLQ+A+ C  
Sbjct  538   TGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVS  597

Query  995   QYPNKRPSMAAVADQIK  1045
               P++RP+M  V   I+
Sbjct  598   TVPDQRPAMQEVVRMIE  614



>emb|CBI26846.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   222 bits (565),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 174/268 (65%), Gaps = 1/268 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT GT+YK+ + E   V VKRL+  C+   EF E V  LG M HENL  +R
Sbjct  284   RASAEVLGKGTCGTTYKAMVGEGVEVVVKRLRNICVYEREFLEEVARLGGMVHENLASIR  343

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY +   E LL+YD + MG+L+  LHG+ G  +A L+WEVR  IA G A  I+ LH+ G 
Sbjct  344   AYYYGRDEKLLIYDCLPMGNLSSLLHGDRGAWRAPLSWEVRGRIALGAARGIKYLHSHGP  403

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              + HGNI+SSN+ LTN  +  V+EF + QL+S  S     SGY APE    + VS ++DV
Sbjct  404   NVSHGNIKSSNILLTNSCDALVTEFGIVQLVSVTSAPK-HSGYCAPETRGSYTVSQKADV  462

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGV+LLELLT KAP  A +  + ++LP WV ++  E+   DVFD  L + +   EQ+V
Sbjct  463   YSFGVVLLELLTAKAPTYALSNEEEMELPRWVESVVEERGTIDVFDLELLRYDNIEEQVV  522

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIK  1045
             QLL +A+ CT ++P +RPSMA V  QI+
Sbjct  523   QLLHLALLCTSKHPKRRPSMAEVTRQIE  550



>ref|XP_008343962.1| PREDICTED: probable inactive receptor kinase At2g26730 [Malus 
domestica]
Length=656

 Score =   224 bits (570),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 195/317 (62%), Gaps = 3/317 (1%)
 Frame = +2

Query  98    PACRNQEQIKAKKSCELYNIMAWSPDAIVKSKLVFFgdgdgy-elddllRSTAGVLGKGT  274
             P      + +A  S    +I   S +A  ++KLVFF  G    +L+DLLR++A VLGKG+
Sbjct  301   PVATRSVETEAGTSSSKDDITGGSTEA-ERNKLVFFNGGVYSFDLEDLLRASAEVLGKGS  359

Query  275   FGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRAYCWNPSEILL  454
              GTSYK+ L E T V VKRLK   +   EF   +  LGK+ H+N++PLRA+ ++  E LL
Sbjct  360   VGTSYKAVLEEGTTVVVKRLKDVVVTKREFEMTMEVLGKIKHDNVVPLRAFYFSKDEKLL  419

Query  455   VYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGSTICHGNIRSSN  634
             V D+MS GSL+  LHG+ G  +  L+W+ R  IA   A  I  LH  G  + HGNI+SSN
Sbjct  420   VSDYMSAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGIAHLHVSGK-VVHGNIKSSN  478

Query  635   VFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELL  814
             + L    +  VS+F L  L    +  + V+GYRAPEV    +V+ +SDVYSFGVLLLELL
Sbjct  479   ILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELL  538

Query  815   TGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvqllqvAICCTF  994
             TGKAP +A    +G+DLP WV+++ RE+   +VFD  L +     E++VQLLQ+A+ C  
Sbjct  539   TGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVS  598

Query  995   QYPNKRPSMAAVADQIK  1045
               P++RP+M  V   I+
Sbjct  599   TVPDQRPAMQEVVRMIE  615



>gb|KCW69386.1| hypothetical protein EUGRSUZ_F02867 [Eucalyptus grandis]
Length=593

 Score =   222 bits (566),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 166/267 (62%), Gaps = 0/267 (0%)
 Frame = +2

Query  245   STAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRA  424
             ++A VLGKGTFGT+YK+ L     VAVKRLK    +  EF E++ E+G M HE L+PL A
Sbjct  315   ASAEVLGKGTFGTTYKASLGAGITVAVKRLKDVSDSEIEFGEKIKEIGSMNHEGLVPLVA  374

Query  425   YCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGST  604
             Y ++  E LLVYD++  GSL+  LH + G     L+W+ R  IA   A A+  +H+ G  
Sbjct  375   YYYSRGEKLLVYDYIPTGSLSALLHDDNGVGWTPLSWDTRCRIALRTAQAVAHIHSWGPG  434

Query  605   ICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVY  784
               HGNI+SS V LT   E  +S++ L +L  P        GYRAPEV     VS ++DVY
Sbjct  435   ASHGNIKSSTVLLTKLYEPCLSDYGLARLAGPAVSPSRFHGYRAPEVIDIRIVSQEADVY  494

Query  785   SFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvq  964
             SFGVL+LEL+TGKAPL +     GVDLP WVR    + P  +VFD+ L + +   E ++Q
Sbjct  495   SFGVLILELVTGKAPLMSLLAEDGVDLPRWVRGAVEQDPTAEVFDAELLRYQNVEEDMIQ  554

Query  965   llqvAICCTFQYPNKRPSMAAVADQIK  1045
             +LQ+ I CT Q P++RPSMA +  +++
Sbjct  555   MLQIGIDCTEQSPDQRPSMAQLTKRME  581



>ref|XP_009414081.1| PREDICTED: probable inactive receptor kinase At1g48480 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score =   223 bits (569),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/268 (48%), Positives = 173/268 (65%), Gaps = 1/268 (0%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT GT+YK+ L     V VKRL+   +   EF ER+  +G M H NL+ L+
Sbjct  371   RASAEVLGKGTAGTTYKAMLEMGMVVTVKRLRDVNVPEKEFRERMEAIGAMDHPNLVALQ  430

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY  +  E LLV++ +  GSL+  LHG++   +  L+WE R  IA G A  I+ +H QGS
Sbjct  431   AYYHSKDEKLLVHELVPNGSLSSILHGSKVSGRTPLDWETRLEIALGAARGIEFIHLQGS  490

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDV  781
              + HGNI+SSN+ L+   E RVS+F L  L S        + YRAPEVT   +VS ++DV
Sbjct  491   GLTHGNIKSSNIILSKSNEARVSDFGLSSLGSTPMPNQRAASYRAPEVTDVRKVSQKADV  550

Query  782   YSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlv  961
             YSFGVLL+ELLTGK P +A     GVDLP WV+++ REK   +VFD  L +  QNVE+++
Sbjct  551   YSFGVLLMELLTGKPPTQALHNEDGVDLPRWVQSVVREKWSSEVFDHELLR-HQNVEEMM  609

Query  962   qllqvAICCTFQYPNKRPSMAAVADQIK  1045
             QLLQ+AI C  Q+P  RPSM+ V  +I+
Sbjct  610   QLLQLAIDCAVQFPENRPSMSEVVARIE  637



>tpg|DAA57078.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=637

 Score =   223 bits (567),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/291 (45%), Positives = 193/291 (66%), Gaps = 5/291 (2%)
 Frame = +2

Query  185   KSKLVFFgdgdgy-elddllRSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDE  361
             ++KLVFFG      +L+DLLR++A VLGKG++GT+YK+ L + T V VKRLK   ++  +
Sbjct  320   RNKLVFFGGSSYNFDLEDLLRASAEVLGKGSYGTTYKAVLEDGTTVVVKRLKEVVVSKKD  379

Query  362   FTERVHELGKM-THENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWE  538
             F +++  +G++  H+N++PLRAY ++  E LLV+D++  GSLA  LHGN+   +A LNWE
Sbjct  380   FEQQMEIIGRVGQHQNVIPLRAYYYSKDEKLLVFDYVPSGSLAVVLHGNKADGRAPLNWE  439

Query  539   VRTSIAYGVANAIQSLHAQ-GSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLL-SPDSKL  712
              R  I+  VA  I  LHA+ G    HGNI++SNV L+  L+ RVSEF L Q++ +P + L
Sbjct  440   TRVKISLDVARGIAHLHAEGGGKFIHGNIKASNVLLSQNLDGRVSEFGLAQIMTTPQTSL  499

Query  713   DLVSGYRAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVD-LPNWVRAMF  889
               + GYRAPEV    +   +SDVYSFGVLLLE+LTGKAPL +  +   V+ LP WVR++ 
Sbjct  500   PQLVGYRAPEVLETKKTIQKSDVYSFGVLLLEMLTGKAPLRSPGRKDSVEHLPKWVRSVV  559

Query  890   REKPICDVFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSMAAVADQI  1042
             RE+   ++FD  L +     +++VQ+LQ+A+ C    P +RP M  V  +I
Sbjct  560   REEWTAEIFDVDLLRHPNVEDEMVQMLQIAMACVAADPEQRPRMDEVIRRI  610



>gb|EMT33198.1| hypothetical protein F775_43654 [Aegilops tauschii]
Length=373

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 157/232 (68%), Gaps = 3/232 (1%)
 Frame = +2

Query  371   RVHELGKMTHENLLPLRAYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTS  550
             R+  +G + HE ++PLRAY ++  E LLVYD+MSMGSL+  LHGN    +  L+WE R++
Sbjct  119   RIAAIGAVQHELVVPLRAYYFSKDEKLLVYDYMSMGSLSALLHGNRSSGRTPLDWEARSA  178

Query  551   IAYGVANAIQSLHAQGSTICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGY  730
             IA   A  +  +H+ G T  HGNI+SSNV LT   E RVS+  L  L+ P      VSGY
Sbjct  179   IALSTARGVAHIHSTGPTASHGNIKSSNVLLTKSYEARVSDHGLPTLVGPSFSPTRVSGY  238

Query  731   RAPEVTSPHQVSHQSDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICD  910
             RAPEVT   +VS ++DVYSFGVLLLELLTGKAP  A    +G+DLP WV+++ RE+   +
Sbjct  239   RAPEVTDIRRVSQKADVYSFGVLLLELLTGKAPTHAVVNEEGLDLPRWVQSVVREEWTAE  298

Query  911   VFDSTLAKAEQNveqlvqllqvAICCTFQYPNKRPSM---AAVADQIKKTCS  1057
             VFD  L + +   E++VQLLQ+AI C+ Q+P++RPSM   AA  D+I+++ S
Sbjct  299   VFDQELLRYQNVEEEMVQLLQLAIDCSAQHPDRRPSMSDAAARIDEIRRSAS  350



>ref|XP_010062272.1| PREDICTED: probable inactive receptor kinase At5g16590 [Eucalyptus 
grandis]
Length=647

 Score =   223 bits (567),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 166/267 (62%), Gaps = 0/267 (0%)
 Frame = +2

Query  245   STAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLRA  424
             ++A VLGKGTFGT+YK+ L     VAVKRLK    +  EF E++ E+G M HE L+PL A
Sbjct  369   ASAEVLGKGTFGTTYKASLGAGITVAVKRLKDVSDSEIEFGEKIKEIGSMNHEGLVPLVA  428

Query  425   YCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGST  604
             Y ++  E LLVYD++  GSL+  LH + G     L+W+ R  IA   A A+  +H+ G  
Sbjct  429   YYYSRGEKLLVYDYIPTGSLSALLHDDNGVGWTPLSWDTRCRIALRTAQAVAHIHSWGPG  488

Query  605   ICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSPDSKLDLVSGYRAPEVTSPHQVSHQSDVY  784
               HGNI+SS V LT   E  +S++ L +L  P        GYRAPEV     VS ++DVY
Sbjct  489   ASHGNIKSSTVLLTKLYEPCLSDYGLARLAGPAVSPSRFHGYRAPEVIDIRIVSQEADVY  548

Query  785   SFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNveqlvq  964
             SFGVL+LEL+TGKAPL +     GVDLP WVR    + P  +VFD+ L + +   E ++Q
Sbjct  549   SFGVLILELVTGKAPLMSLLAEDGVDLPRWVRGAVEQDPTAEVFDAELLRYQNVEEDMIQ  608

Query  965   llqvAICCTFQYPNKRPSMAAVADQIK  1045
             +LQ+ I CT Q P++RPSMA +  +++
Sbjct  609   MLQIGIDCTEQSPDQRPSMAQLTKRME  635



>ref|XP_008669312.1| PREDICTED: probable inactive receptor kinase RLK902 isoform X2 
[Zea mays]
Length=744

 Score =   224 bits (571),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 180/271 (66%), Gaps = 3/271 (1%)
 Frame = +2

Query  242   RSTAGVLGKGTFGTSYKSELPEKTAVAVKRLKIGCLAVDEFTERVHELGKMTHENLLPLR  421
             R++A VLGKGT GT+YK+ +     +AVKRLK   L   EF ++V  +G + H N++PL+
Sbjct  436   RASAEVLGKGTHGTTYKAAIESGPVMAVKRLKETSLPEREFRDKVAAIGGIDHPNVVPLQ  495

Query  422   AYCWNPSEILLVYDHMSMGSLAFRLHGNEGKNKASLNWEVRTSIAYGVANAIQSLHAQGS  601
             AY ++  E L+VY+ ++MGSL+  LHGN G  ++ L+WE R  IA   A  ++ +HA GS
Sbjct  496   AYYFSKDEKLMVYEFVAMGSLSSMLHGNRGSGRSPLSWESRRRIALASARGLEYIHATGS  555

Query  602   TICHGNIRSSNVFLTNFLEVRVSEFCLGQLLSP--DSKLDLVSGYRAPEVTS-PHQVSHQ  772
              + HGNI+SSN+ L+  ++ RV++  L  L++P   +    V+GYRAPEV + P + S +
Sbjct  556   MVTHGNIKSSNILLSRTVDARVADHGLAHLVNPAGAATTTRVAGYRAPEVVADPRRASQK  615

Query  773   SDVYSFGVLLLELLTGKAPLEAFAKGKGVDLPNWVRAMFREKPICDVFDSTLAKAEQNve  952
             +D YSFGVLLLELLTGKAP  A    +GVDLP W R++ +E+   +VFD+ L +     +
Sbjct  616   ADAYSFGVLLLELLTGKAPAHAVLHDEGVDLPRWARSVVKEEWTSEVFDTELLRHPGAED  675

Query  953   qlvqllqvAICCTFQYPNKRPSMAAVADQIK  1045
             ++V++L++A+ CT   P++RP+M  +  +I+
Sbjct  676   EMVEMLRLAMDCTEPAPDQRPAMPEIVARIE  706



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2912022441477