BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c828_g2_i1 len=476 path=[454:0-475]

Length=476
                                                                      Score     E

emb|CBI40336.3|  unnamed protein product                                183   2e-54   
ref|XP_011093147.1|  PREDICTED: actin-depolymerizing factor 10-like     175   1e-52   
ref|XP_002271495.1|  PREDICTED: actin-depolymerizing factor 10          174   4e-52   Vitis vinifera
ref|XP_009771651.1|  PREDICTED: actin-depolymerizing factor 12-like     173   6e-52   
ref|NP_171680.1|  actin depolymerizing factor 11                        172   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010249803.1|  PREDICTED: actin-depolymerizing factor             172   3e-51   
ref|XP_009630108.1|  PREDICTED: actin-depolymerizing factor 10-like     171   3e-51   
gb|KCW71635.1|  hypothetical protein EUGRSUZ_E00162                     170   1e-50   
gb|KDO76170.1|  hypothetical protein CISIN_1g046281mg                   169   1e-50   
ref|XP_006304638.1|  hypothetical protein CARUB_v10011760mg             170   2e-50   
ref|XP_010479839.1|  PREDICTED: actin-depolymerizing factor 10          170   2e-50   
ref|XP_010427310.1|  PREDICTED: actin-depolymerizing factor 8           169   2e-50   
ref|XP_009615468.1|  PREDICTED: actin-depolymerizing factor 10-like     169   2e-50   
ref|XP_009111466.1|  PREDICTED: actin-depolymerizing factor 8           169   2e-50   
ref|XP_006341722.1|  PREDICTED: actin-depolymerizing factor 10-like     169   3e-50   
ref|XP_008794195.1|  PREDICTED: actin-depolymerizing factor-like        169   4e-50   
ref|XP_010327379.1|  PREDICTED: actin-depolymerizing factor 10-like     169   4e-50   
emb|CDP08835.1|  unnamed protein product                                169   4e-50   
ref|XP_006476590.1|  PREDICTED: actin-depolymerizing factor 1-like      169   4e-50   
ref|XP_002892045.1|  hypothetical protein ARALYDRAFT_887267             169   5e-50   
ref|XP_006339546.1|  PREDICTED: actin-depolymerizing factor 12-like     168   5e-50   
ref|XP_010544380.1|  PREDICTED: actin-depolymerizing factor 8 iso...    168   5e-50   
ref|XP_009793423.1|  PREDICTED: actin-depolymerizing factor 10-like     168   5e-50   
ref|XP_007051847.1|  Actin depolymerizing factor 11                     168   6e-50   
ref|XP_009411533.1|  PREDICTED: actin-depolymerizing factor 1-like      169   6e-50   
ref|XP_002872934.1|  hypothetical protein ARALYDRAFT_490501             168   7e-50   
ref|XP_011091992.1|  PREDICTED: actin-depolymerizing factor 10-like     168   8e-50   
ref|XP_006439576.1|  hypothetical protein CICLE_v10023304mg             168   9e-50   
ref|NP_567182.1|  actin depolymerizing factor 8                         168   9e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384093.1|  PREDICTED: actin-depolymerizing factor 1           167   1e-49   
ref|XP_002318237.1|  actin-depolymerizing factor family protein         167   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010419619.1|  PREDICTED: actin-depolymerizing factor 8-like      167   2e-49   
ref|XP_006363318.1|  PREDICTED: actin-depolymerizing factor 7-like      167   2e-49   
ref|XP_009787751.1|  PREDICTED: actin-depolymerizing factor 10-like     167   2e-49   
ref|NP_001053519.1|  Os04g0555700                                       167   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010456252.1|  PREDICTED: actin-depolymerizing factor 8-like      167   2e-49   
ref|XP_006396264.1|  hypothetical protein EUTSA_v10029050mg             167   2e-49   
gb|KFK30636.1|  hypothetical protein AALP_AA6G007700                    170   3e-49   
dbj|BAK06235.1|  predicted protein                                      166   3e-49   
gb|EYU32098.1|  hypothetical protein MIMGU_mgv1a026462mg                166   3e-49   
ref|XP_010662752.1|  PREDICTED: actin-depolymerizing factor 1           166   3e-49   
ref|XP_008804935.1|  PREDICTED: actin-depolymerizing factor isofo...    166   4e-49   
gb|KCW46430.1|  hypothetical protein EUGRSUZ_K00262                     166   4e-49   
gb|AAL91667.1|  pollen specific actin-depolymerizing factor 2           166   4e-49   Nicotiana tabacum [American tobacco]
ref|XP_009595762.1|  PREDICTED: actin-depolymerizing factor 10-like     166   4e-49   
ref|XP_011029243.1|  PREDICTED: actin-depolymerizing factor isofo...    166   5e-49   
gb|AEZ00870.1|  putative actin depolymerizing factor protein            167   6e-49   
ref|XP_004240732.1|  PREDICTED: actin-depolymerizing factor 7           166   7e-49   
ref|XP_010053689.1|  PREDICTED: actin-depolymerizing factor             165   8e-49   
ref|XP_004953378.1|  PREDICTED: actin-depolymerizing factor 1-like      165   8e-49   
gb|AEW90956.1|  actin depolymerizing factor 4-2                         165   8e-49   
ref|NP_001047657.1|  Os02g0663800                                       165   9e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010910598.1|  PREDICTED: actin-depolymerizing factor             166   9e-49   
ref|XP_009770352.1|  PREDICTED: actin-depolymerizing factor 7           165   1e-48   
gb|EYU35082.1|  hypothetical protein MIMGU_mgv1a015967mg                165   1e-48   
ref|XP_008393892.1|  PREDICTED: actin-depolymerizing factor 1           165   1e-48   
gb|KGN50293.1|  hypothetical protein Csa_5G165880                       165   1e-48   
ref|XP_002509779.1|  actin depolymerizing factor, putative              165   1e-48   Ricinus communis
ref|XP_002448300.1|  hypothetical protein SORBIDRAFT_06g024870          165   1e-48   Sorghum bicolor [broomcorn]
ref|XP_008437023.1|  PREDICTED: actin-depolymerizing factor 7           165   1e-48   
ref|XP_002322471.2|  hypothetical protein POPTR_0015s13080g             164   2e-48   Populus trichocarpa [western balsam poplar]
gb|AEP25120.1|  actin depolymerising factor                             164   2e-48   
gb|AGW22223.1|  actin-depolymerizing factor 4                           164   2e-48   
emb|CDY38025.1|  BnaCnng08860D                                          166   2e-48   
ref|XP_007143417.1|  hypothetical protein PHAVU_007G070500g             164   2e-48   
ref|XP_009386059.1|  PREDICTED: actin-depolymerizing factor             164   2e-48   
emb|CDY51146.1|  BnaA09g51810D                                          170   3e-48   
ref|XP_006285474.1|  hypothetical protein CARUB_v10006893mg             164   3e-48   
ref|XP_007040194.1|  Actin depolymerizing factor 8                      164   3e-48   
ref|NP_001151716.1|  LOC100285352                                       164   3e-48   Zea mays [maize]
ref|XP_010544379.1|  PREDICTED: actin-depolymerizing factor 8 iso...    165   4e-48   
ref|XP_009131962.1|  PREDICTED: actin-depolymerizing factor 3           164   4e-48   
ref|XP_002298043.1|  actin-depolymerizing factor family protein         164   4e-48   Populus trichocarpa [western balsam poplar]
gb|AEW90955.1|  actin depolymerizing factor 4-1                         164   4e-48   
ref|XP_006418454.1|  hypothetical protein EUTSA_v10009057mg             164   4e-48   
ref|XP_009599636.1|  PREDICTED: actin-depolymerizing factor 7           163   5e-48   
gb|ADI78873.1|  actin-depolymerizing factor                             163   5e-48   
gb|KHG23104.1|  Actin-depolymerizing factor 1                           163   5e-48   
dbj|BAK04382.1|  predicted protein                                      163   6e-48   
ref|XP_010253266.1|  PREDICTED: actin-depolymerizing factor 2           163   6e-48   
ref|XP_010922979.1|  PREDICTED: actin-depolymerizing factor 7-like      167   6e-48   
sp|P30175.1|ADF_LILLO  RecName: Full=Actin-depolymerizing factor;...    163   7e-48   Lilium longiflorum [Easter lily]
ref|XP_006436042.1|  hypothetical protein CICLE_v10033029mg             163   8e-48   
gb|KDP25456.1|  hypothetical protein JCGZ_20612                         162   9e-48   
ref|XP_007038697.1|  Actin depolymerizing factor 7                      162   9e-48   
ref|XP_006413292.1|  hypothetical protein EUTSA_v10026532mg             162   9e-48   
ref|XP_010260094.1|  PREDICTED: actin-depolymerizing factor 2-like      162   1e-47   
ref|XP_007206123.1|  hypothetical protein PRUPE_ppa013110mg             162   1e-47   
ref|XP_002867603.1|  actin binding protein                              162   1e-47   
gb|KGN57376.1|  hypothetical protein Csa_3G182120                       162   1e-47   
ref|XP_006647644.1|  PREDICTED: actin-depolymerizing factor 1-like      162   1e-47   
ref|XP_006843593.1|  hypothetical protein AMTR_s00007p00126220          162   1e-47   
ref|XP_011080987.1|  PREDICTED: actin-depolymerizing factor-like        162   1e-47   
ref|XP_009120511.1|  PREDICTED: actin-depolymerizing factor 3-like      162   2e-47   
ref|XP_004496563.1|  PREDICTED: actin-depolymerizing factor 7-like      162   2e-47   
ref|XP_007144457.1|  hypothetical protein PHAVU_007G157800g             162   2e-47   
ref|XP_008244913.1|  PREDICTED: actin-depolymerizing factor 10          162   2e-47   
ref|XP_011084418.1|  PREDICTED: actin-depolymerizing factor 7           162   2e-47   
ref|XP_002303579.1|  actin-depolymerizing factor family protein         162   2e-47   Populus trichocarpa [western balsam poplar]
ref|XP_007218574.1|  hypothetical protein PRUPE_ppa013108mg             162   2e-47   
ref|XP_007027090.1|  Actin depolymerizing factor 4 isoform 2            163   2e-47   
ref|XP_010672167.1|  PREDICTED: actin-depolymerizing factor 10          162   2e-47   
ref|XP_006400899.1|  hypothetical protein EUTSA_v10014975mg             162   2e-47   
gb|KDP22276.1|  hypothetical protein JCGZ_26107                         162   2e-47   
ref|XP_009593022.1|  PREDICTED: actin-depolymerizing factor 2-like      162   2e-47   
ref|NP_194289.2|  actin depolymerizing factor 7                         162   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284292.1|  PREDICTED: actin-depolymerizing factor 2           162   2e-47   Vitis vinifera
ref|XP_007016496.1|  Actin depolymerizing factor 4                      161   2e-47   
gb|ABD66504.1|  actin depolymerizing factor 8                           161   2e-47   Gossypium hirsutum [American cotton]
ref|XP_008438059.1|  PREDICTED: actin-depolymerizing factor 7-like      161   3e-47   
gb|EYU18949.1|  hypothetical protein MIMGU_mgv1a015984mg                161   3e-47   
ref|XP_010433613.1|  PREDICTED: actin-depolymerizing factor 7-like      161   3e-47   
gb|KHG06644.1|  Actin-depolymerizing factor 1                           161   3e-47   
gb|ADV04049.1|  actin depolymerizing factor 4                           161   3e-47   
emb|CDY07204.1|  BnaCnng02190D                                          166   3e-47   
ref|XP_006424770.1|  hypothetical protein CICLE_v10029538mg             161   3e-47   
ref|XP_010047513.1|  PREDICTED: actin-depolymerizing factor 2           161   4e-47   
gb|KHN05922.1|  Actin-depolymerizing factor 2                           161   4e-47   
ref|XP_010535543.1|  PREDICTED: actin-depolymerizing factor 4           160   5e-47   
gb|EPS69954.1|  hypothetical protein M569_04811                         162   5e-47   
gb|KFK27528.1|  hypothetical protein AALP_AA8G395200                    160   5e-47   
emb|CDX71068.1|  BnaC03g11520D                                          161   5e-47   
ref|XP_010448409.1|  PREDICTED: actin-depolymerizing factor 7           160   6e-47   
gb|KHN26651.1|  Actin-depolymerizing factor 7                           160   6e-47   
emb|CDX88730.1|  BnaA03g09190D                                          161   6e-47   
emb|CDX80216.1|  BnaC09g35260D                                          164   6e-47   
gb|EMS51874.1|  Actin-depolymerizing factor 6                           166   6e-47   
ref|XP_010529845.1|  PREDICTED: actin-depolymerizing factor 2-like      160   6e-47   
gb|ABX79380.1|  actin-depolymerizing factor                             160   6e-47   Gossypium barbadense [Egyptian cotton]
ref|XP_008463478.1|  PREDICTED: actin-depolymerizing factor 2 iso...    160   6e-47   
ref|XP_004142738.1|  PREDICTED: actin-depolymerizing factor 2-like      160   6e-47   
ref|XP_010555668.1|  PREDICTED: actin-depolymerizing factor 7           160   7e-47   
ref|XP_009118832.1|  PREDICTED: actin-depolymerizing factor 10 is...    160   7e-47   
ref|XP_010908104.1|  PREDICTED: zinc finger CCHC domain-containin...    167   8e-47   
ref|XP_009591841.1|  PREDICTED: actin-depolymerizing factor 2-like      160   8e-47   
gb|KGN56524.1|  hypothetical protein Csa_3G122480                       160   8e-47   
ref|XP_009119731.1|  PREDICTED: actin-depolymerizing factor 10-like     160   9e-47   
ref|XP_009397611.1|  PREDICTED: actin-depolymerizing factor 1-like      160   9e-47   
ref|XP_010669849.1|  PREDICTED: actin-depolymerizing factor 4-like      160   1e-46   
ref|XP_009414703.1|  PREDICTED: actin-depolymerizing factor-like        160   1e-46   
ref|XP_009793756.1|  PREDICTED: actin-depolymerizing factor 7-like      160   1e-46   
ref|XP_009421345.1|  PREDICTED: actin-depolymerizing factor 7-like      159   1e-46   
ref|XP_011030201.1|  PREDICTED: uncharacterized protein LOC105129717    164   2e-46   
gb|KGN58886.1|  hypothetical protein Csa_3G734880                       159   2e-46   
ref|XP_006846080.1|  hypothetical protein AMTR_s00012p00089320          159   2e-46   
ref|XP_010669850.1|  PREDICTED: actin-depolymerizing factor 4           159   2e-46   
ref|XP_006365713.1|  PREDICTED: actin-depolymerizing factor 2-like      159   2e-46   
ref|XP_006424771.1|  hypothetical protein CICLE_v10029538mg             159   2e-46   
ref|XP_002533101.1|  actin depolymerizing factor, putative              159   2e-46   Ricinus communis
ref|XP_009137539.1|  PREDICTED: actin-depolymerizing factor-like        159   2e-46   
ref|XP_008442569.1|  PREDICTED: actin-depolymerizing factor 2-like      159   2e-46   
gb|EYU26572.1|  hypothetical protein MIMGU_mgv1a015955mg                159   3e-46   
gb|AFK48761.1|  unknown                                                 159   3e-46   
ref|XP_010920670.1|  PREDICTED: actin-depolymerizing factor 7           159   3e-46   
ref|XP_004236758.1|  PREDICTED: actin-depolymerizing factor 2           159   3e-46   
ref|XP_008776502.1|  PREDICTED: actin-depolymerizing factor 7           159   4e-46   
ref|XP_008788089.1|  PREDICTED: actin-depolymerizing factor 7-like      159   4e-46   
gb|KHG18554.1|  Actin-depolymerizing factor                             159   4e-46   
ref|XP_006401834.1|  hypothetical protein EUTSA_v10014982mg             158   4e-46   
ref|XP_010937681.1|  PREDICTED: actin-depolymerizing factor 7-like      158   4e-46   
gb|KDP35600.1|  hypothetical protein JCGZ_09038                         158   4e-46   
ref|XP_009118831.1|  PREDICTED: actin-depolymerizing factor 10 is...    159   4e-46   
gb|ABD66503.1|  actin depolymerizing factor 7                           158   4e-46   Gossypium hirsutum [American cotton]
ref|XP_011077447.1|  PREDICTED: actin-depolymerizing factor 1-like      159   4e-46   
ref|XP_011016059.1|  PREDICTED: actin-depolymerizing factor 2-like      158   5e-46   
ref|NP_001238519.1|  uncharacterized protein LOC100499953               158   5e-46   
ref|XP_009389157.1|  PREDICTED: actin-depolymerizing factor 1-like      158   5e-46   
ref|XP_006843087.1|  hypothetical protein AMTR_s00140p00036970          158   5e-46   
ref|XP_009600590.1|  PREDICTED: actin-depolymerizing factor 2           158   6e-46   
ref|XP_002299887.1|  hypothetical protein POPTR_0001s24330g             158   6e-46   Populus trichocarpa [western balsam poplar]
ref|XP_009342975.1|  PREDICTED: actin-depolymerizing factor 7           158   6e-46   
ref|XP_010909358.1|  PREDICTED: actin-depolymerizing factor 7-like      158   6e-46   
ref|XP_007218573.1|  hypothetical protein PRUPE_ppa013105mg             158   6e-46   
gb|EYU36258.1|  hypothetical protein MIMGU_mgv1a015971mg                158   7e-46   
ref|XP_009132530.1|  PREDICTED: actin-depolymerizing factor 12-like     158   7e-46   
ref|XP_007158489.1|  hypothetical protein PHAVU_002G156700g             158   7e-46   
ref|XP_009767736.1|  PREDICTED: actin-depolymerizing factor 7-lik...    158   7e-46   
ref|XP_006445079.1|  hypothetical protein CICLE_v10023747mg             158   7e-46   
ref|XP_006490391.1|  PREDICTED: actin-depolymerizing factor 7-like      157   7e-46   
ref|XP_009388628.1|  PREDICTED: actin-depolymerizing factor 7           157   8e-46   
gb|AAL91666.1|  pollen specific actin-depolymerizing factor 1           157   8e-46   Nicotiana tabacum [American tobacco]
ref|XP_003538360.1|  PREDICTED: actin-depolymerizing factor 7-lik...    157   1e-45   
ref|XP_002273958.2|  PREDICTED: actin-depolymerizing factor 1-like      159   1e-45   Vitis vinifera
ref|XP_010553292.1|  PREDICTED: actin-depolymerizing factor 1           157   1e-45   
ref|XP_004495011.1|  PREDICTED: actin-depolymerizing factor 2-like      157   1e-45   
ref|XP_010055150.1|  PREDICTED: actin-depolymerizing factor 8           157   1e-45   
emb|CDY15154.1|  BnaC05g00330D                                          157   1e-45   
ref|XP_007218580.1|  hypothetical protein PRUPE_ppa013189mg             157   1e-45   
ref|XP_004172071.1|  PREDICTED: actin-depolymerizing factor 1-like      157   1e-45   
gb|KHN48988.1|  Actin-depolymerizing factor 2                           157   1e-45   
emb|CDX92721.1|  BnaC07g39790D                                          158   1e-45   
gb|ACR38016.1|  unknown                                                 157   2e-45   Zea mays [maize]
ref|XP_010038440.1|  PREDICTED: uncharacterized protein LOC104426974    165   2e-45   
ref|XP_002314195.1|  actin-depolymerizing factor family protein         157   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008804936.1|  PREDICTED: zinc finger CCHC domain-containin...    163   2e-45   
ref|XP_008376578.1|  PREDICTED: actin-depolymerizing factor 7 iso...    157   2e-45   
ref|XP_010031001.1|  PREDICTED: actin-depolymerizing factor 2-like      157   2e-45   
gb|KFK26837.1|  hypothetical protein AALP_AA8G300400                    157   2e-45   
ref|NP_001148898.1|  actin-depolymerizing factor                        157   2e-45   Zea mays [maize]
ref|XP_009127248.1|  PREDICTED: actin-depolymerizing factor 12          156   2e-45   
ref|XP_009767730.1|  PREDICTED: uncharacterized protein LOC104218...    161   2e-45   
ref|XP_009106793.1|  PREDICTED: actin-depolymerizing factor 7           156   2e-45   
ref|XP_004142080.1|  PREDICTED: actin-depolymerizing factor 1-like      156   2e-45   
ref|XP_004249528.1|  PREDICTED: actin-depolymerizing factor 1-like      156   2e-45   
ref|XP_011000294.1|  PREDICTED: actin-depolymerizing factor 2-like      156   3e-45   
ref|XP_007211217.1|  hypothetical protein PRUPE_ppa013153mg             156   3e-45   
gb|ABK94603.1|  unknown                                                 156   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009357677.1|  PREDICTED: actin-depolymerizing factor 1           156   3e-45   
ref|XP_002284029.1|  PREDICTED: actin-depolymerizing factor 2-lik...    156   3e-45   Vitis vinifera
gb|ADV02778.1|  actin depolymerizing factor 1                           156   3e-45   
ref|XP_004294586.1|  PREDICTED: actin-depolymerizing factor 2-lik...    156   3e-45   
gb|EEE61469.1|  hypothetical protein OsJ_15732                          163   4e-45   Oryza sativa Japonica Group [Japonica rice]
gb|EAY95118.1|  hypothetical protein OsI_16935                          163   4e-45   Oryza sativa Indica Group [Indian rice]
gb|AEJ88268.1|  putative actin-depolymerizing factor                    156   4e-45   
ref|XP_009353719.1|  PREDICTED: actin-depolymerizing factor 1-like      155   4e-45   
ref|XP_010227222.1|  PREDICTED: uncharacterized protein LOC100826202    165   4e-45   
ref|XP_009109200.1|  PREDICTED: actin-depolymerizing factor-like        155   5e-45   
sp|Q9FVI1.1|ADF2_PETHY  RecName: Full=Actin-depolymerizing factor...    156   5e-45   Petunia x hybrida [garden petunia]
ref|XP_008343560.1|  PREDICTED: actin-depolymerizing factor 1           155   5e-45   
gb|KDP29838.1|  hypothetical protein JCGZ_18413                         155   5e-45   
ref|XP_011094831.1|  PREDICTED: actin-depolymerizing factor 1 iso...    155   6e-45   
gb|AFK45315.1|  unknown                                                 155   6e-45   
gb|AAT42170.1|  putative actin depolymerizing factor                    164   6e-45   Sorghum bicolor [broomcorn]
gb|AFK35836.1|  unknown                                                 155   6e-45   
ref|XP_002311154.2|  hypothetical protein POPTR_0008s05210g             158   6e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008385227.1|  PREDICTED: actin-depolymerizing factor 1-like      155   7e-45   
ref|XP_009416252.1|  PREDICTED: actin-depolymerizing factor 7-like      155   7e-45   
gb|KHG04895.1|  Actin-depolymerizing factor 10 -like protein            155   8e-45   
ref|XP_002299888.1|  actin-depolymerizing factor family protein         155   8e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009404611.1|  PREDICTED: actin-depolymerizing factor 7-like      155   8e-45   
ref|XP_006590525.1|  PREDICTED: actin-depolymerizing factor 7-lik...    155   9e-45   
ref|XP_004294585.1|  PREDICTED: actin-depolymerizing factor 2-lik...    155   9e-45   
emb|CBI31711.3|  unnamed protein product                                157   9e-45   
ref|XP_009419950.1|  PREDICTED: actin-depolymerizing factor 4           155   9e-45   
ref|XP_003637508.1|  Actin-depolymerizing factor                        155   9e-45   
ref|XP_008357628.1|  PREDICTED: actin-depolymerizing factor 1-like      155   1e-44   
ref|XP_002439159.1|  hypothetical protein SORBIDRAFT_09g001500          155   1e-44   Sorghum bicolor [broomcorn]
ref|XP_009358343.1|  PREDICTED: actin-depolymerizing factor 1-like      155   1e-44   
ref|XP_009337572.1|  PREDICTED: actin-depolymerizing factor 1-like      155   1e-44   
ref|XP_008392560.1|  PREDICTED: actin-depolymerizing factor 7-like      154   1e-44   
ref|XP_010317604.1|  PREDICTED: actin-depolymerizing factor 12          154   1e-44   
ref|XP_006339034.1|  PREDICTED: actin-depolymerizing factor 1-like      154   1e-44   
ref|XP_010514926.1|  PREDICTED: actin-depolymerizing factor 1           154   1e-44   
ref|XP_002865909.1|  hypothetical protein ARALYDRAFT_495305             154   1e-44   
ref|XP_009420088.1|  PREDICTED: actin-depolymerizing factor 7-like      154   1e-44   
ref|XP_008439227.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    161   1e-44   
gb|EYU19548.1|  hypothetical protein MIMGU_mgv1a016233mg                154   1e-44   
emb|CDY50194.1|  BnaA03g47540D                                          157   2e-44   
ref|XP_010503215.1|  PREDICTED: actin-depolymerizing factor 1-like      154   2e-44   
ref|XP_008385142.1|  PREDICTED: actin-depolymerizing factor 1-like      154   2e-44   
ref|XP_011027144.1|  PREDICTED: actin-depolymerizing factor 1-like      154   2e-44   
ref|NP_001148445.1|  actin-depolymerizing factor                        154   2e-44   Zea mays [maize]
ref|XP_008447631.1|  PREDICTED: actin-depolymerizing factor 1-like      154   2e-44   
gb|EPS63340.1|  hypothetical protein M569_11446                         154   2e-44   
ref|XP_002528457.1|  actin depolymerizing factor, putative              154   2e-44   Ricinus communis
gb|EEC82036.1|  hypothetical protein OsI_26009                          154   2e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_010521323.1|  PREDICTED: actin-depolymerizing factor 7-like      154   2e-44   
gb|AAC13618.1|  Similar to actin binding protein; F6N23.12              154   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533658.1|  PREDICTED: actin-depolymerizing factor 8-like      154   2e-44   
ref|XP_009406977.1|  PREDICTED: actin-depolymerizing factor 2 iso...    154   2e-44   
ref|XP_010503214.1|  PREDICTED: actin-depolymerizing factor 2           154   2e-44   
gb|EMT14364.1|  Actin-depolymerizing factor 6                           154   2e-44   
ref|XP_009387944.1|  PREDICTED: zinc finger CCHC domain-containin...    160   2e-44   
gb|ABD63906.1|  actin depolymerizing factor 2                           154   2e-44   Gossypium hirsutum [American cotton]
ref|XP_011048781.1|  PREDICTED: uncharacterized protein LOC105142716    162   2e-44   
ref|XP_004503768.1|  PREDICTED: actin-depolymerizing factor 7-like      154   3e-44   
emb|CAL25339.1|  actin-depolymerizing factor                            154   3e-44   Platanus x hispanica [London plane tree]
gb|ABK26220.1|  unknown                                                 154   3e-44   Picea sitchensis
ref|XP_008647356.1|  PREDICTED: hypothetical protein isoform X1         154   3e-44   
emb|CDP06641.1|  unnamed protein product                                154   3e-44   
gb|ABK22764.1|  unknown                                                 154   3e-44   Picea sitchensis
gb|KDP28647.1|  hypothetical protein JCGZ_14418                         153   3e-44   
ref|XP_002468086.1|  hypothetical protein SORBIDRAFT_01g039300          153   3e-44   Sorghum bicolor [broomcorn]
ref|XP_008377508.1|  PREDICTED: actin-depolymerizing factor 7-lik...    153   4e-44   
ref|XP_003611106.1|  Actin depolymerizing factor                        153   4e-44   
ref|XP_010537182.1|  PREDICTED: actin-depolymerizing factor 7-lik...    153   4e-44   
ref|XP_009586917.1|  PREDICTED: actin-depolymerizing factor 1           153   4e-44   
ref|XP_009382377.1|  PREDICTED: actin-depolymerizing factor 1-like      153   5e-44   
ref|XP_011042674.1|  PREDICTED: actin-depolymerizing factor 2-lik...    153   5e-44   
gb|ACJ84058.1|  unknown                                                 153   5e-44   
gb|EPS73519.1|  actin-depolymerizing factor                             153   5e-44   
ref|XP_010040886.1|  PREDICTED: actin-depolymerizing factor 7-like      152   5e-44   
ref|XP_006281290.1|  hypothetical protein CARUB_v10027340mg             153   5e-44   
gb|ABD66508.1|  actin depolymerizing factor 6                           153   5e-44   
ref|NP_001240195.1|  uncharacterized protein LOC100795241               153   6e-44   
ref|XP_006353297.1|  PREDICTED: actin-depolymerizing factor 12-like     153   6e-44   
ref|XP_010558792.1|  PREDICTED: actin-depolymerizing factor 2-lik...    153   6e-44   
emb|CAJ38388.1|  actin-depolymerizing factor                            153   7e-44   
ref|XP_004157224.1|  PREDICTED: uncharacterized LOC101212555            160   7e-44   
ref|XP_010426028.1|  PREDICTED: actin-depolymerizing factor 1-like      152   7e-44   
ref|XP_002969368.1|  hypothetical protein SELMODRAFT_146459             153   7e-44   
ref|XP_009346958.1|  PREDICTED: actin-depolymerizing factor 1 iso...    152   7e-44   
ref|XP_004140838.1|  PREDICTED: uncharacterized protein LOC101212555    160   7e-44   
ref|XP_002877448.1|  hypothetical protein ARALYDRAFT_484979             152   8e-44   
ref|XP_010444761.1|  PREDICTED: actin-depolymerizing factor 12-like     152   8e-44   
ref|XP_010543331.1|  PREDICTED: actin-depolymerizing factor 1-like      152   8e-44   
ref|XP_006656880.1|  PREDICTED: actin-depolymerizing factor 6-like      153   8e-44   
ref|XP_010238336.1|  PREDICTED: actin-depolymerizing factor 9           152   8e-44   
gb|ACB32233.1|  actin-depolymerizing factor 1                           152   8e-44   
ref|XP_006341057.1|  PREDICTED: actin-depolymerizing factor 1-like      152   9e-44   
ref|XP_006657701.1|  PREDICTED: actin-depolymerizing factor 9-like      152   9e-44   
ref|XP_006292028.1|  hypothetical protein CARUB_v10018217mg             152   9e-44   
gb|EAY86979.1|  hypothetical protein OsI_08373                          152   1e-43   
gb|KFK33962.1|  hypothetical protein AALP_AA5G084200                    152   1e-43   
ref|XP_011024249.1|  PREDICTED: actin-depolymerizing factor 1-lik...    152   1e-43   
gb|ABD66505.1|  actin depolymerizing factor 3                           152   1e-43   
ref|XP_011094830.1|  PREDICTED: actin-depolymerizing factor 1 iso...    152   1e-43   
ref|NP_001059648.1|  Os07g0484200                                       152   1e-43   
ref|XP_004511586.1|  PREDICTED: actin-depolymerizing factor 7-lik...    152   1e-43   
ref|XP_002314194.1|  actin-depolymerizing factor 3 family protein       152   1e-43   
ref|XP_003524462.1|  PREDICTED: actin-depolymerizing factor 7-like      153   1e-43   
ref|XP_007009413.1|  Actin depolymerizing factor 4 isoform 1            160   1e-43   
ref|XP_004957704.1|  PREDICTED: actin-depolymerizing factor 2-like      152   1e-43   
ref|XP_010537181.1|  PREDICTED: actin-depolymerizing factor 7-lik...    152   1e-43   
emb|CBI22738.3|  unnamed protein product                                152   1e-43   
ref|XP_010096647.1|  Actin-depolymerizing factor 2                      152   1e-43   
ref|XP_010910431.1|  PREDICTED: actin-depolymerizing factor-like        152   1e-43   
ref|XP_009406976.1|  PREDICTED: actin-depolymerizing factor 7 iso...    152   1e-43   
ref|XP_002316301.1|  actin-depolymerizing factor family protein         152   1e-43   
ref|XP_010426027.1|  PREDICTED: actin-depolymerizing factor 2-like      152   2e-43   
ref|XP_004152385.1|  PREDICTED: actin-depolymerizing factor 7-like      151   2e-43   
gb|ABK21557.1|  unknown                                                 152   2e-43   
gb|ACU23570.1|  unknown                                                 152   2e-43   
ref|XP_009126640.1|  PREDICTED: actin-depolymerizing factor 4 iso...    152   2e-43   
ref|XP_008371032.1|  PREDICTED: actin-depolymerizing factor 1           151   2e-43   
ref|XP_010031003.1|  PREDICTED: actin-depolymerizing factor 2-like      151   2e-43   
ref|XP_003532683.1|  PREDICTED: actin-depolymerizing factor 7-like      151   2e-43   
gb|EMT04440.1|  Actin-depolymerizing factor 1                           151   2e-43   
gb|KCW50259.1|  hypothetical protein EUGRSUZ_J00048                     151   2e-43   
emb|CDP05195.1|  unnamed protein product                                151   2e-43   
ref|NP_568769.1|  actin depolymerizing factor 10                        151   2e-43   
gb|AET05009.2|  cofilin/actin-depolymerizing factor-like protein        151   2e-43   
ref|XP_002460700.1|  hypothetical protein SORBIDRAFT_02g033380          151   2e-43   
ref|XP_008376580.1|  PREDICTED: uncharacterized protein LOC103439...    158   2e-43   
gb|AAM61402.1|  actin depolymerizing factor-like                        151   2e-43   
ref|NP_851228.1|  actin depolymerizing factor 4                         151   2e-43   
ref|XP_010455704.1|  PREDICTED: actin-depolymerizing factor 3           151   2e-43   
gb|EYU25097.1|  hypothetical protein MIMGU_mgv11b015928mg               151   2e-43   
ref|NP_566882.1|  actin depolymerizing factor 2                         151   2e-43   
ref|XP_009150048.1|  PREDICTED: actin-depolymerizing factor 2           151   3e-43   
ref|XP_006281292.1|  hypothetical protein CARUB_v10027342mg             151   3e-43   
gb|KHN16833.1|  Actin-depolymerizing factor 7                           152   3e-43   
sp|Q9FVI2.1|ADF1_PETHY  RecName: Full=Actin-depolymerizing factor...    151   3e-43   
ref|XP_004306801.1|  PREDICTED: actin-depolymerizing factor 10-like     151   3e-43   
dbj|BAK05349.1|  predicted protein                                      151   3e-43   
gb|EPS60626.1|  hypothetical protein M569_14175                         151   3e-43   
gb|AAD09110.1|  actin depolymerizing factor 4                           151   3e-43   
ref|XP_007027089.1|  Actin depolymerizing factor 4 isoform 1            152   3e-43   
ref|XP_010514925.1|  PREDICTED: actin-depolymerizing factor 2-like      151   4e-43   
ref|XP_006590210.1|  PREDICTED: uncharacterized protein LOC100804471    158   4e-43   
ref|XP_010482597.1|  PREDICTED: actin-depolymerizing factor 12          150   4e-43   
ref|XP_006606908.1|  PREDICTED: uncharacterized protein LOC100783153    158   4e-43   
ref|XP_008377514.1|  PREDICTED: uncharacterized protein LOC103440...    157   4e-43   
ref|XP_004984753.1|  PREDICTED: actin-depolymerizing factor 7-lik...    150   4e-43   
emb|CDY38916.1|  BnaA03g12630D                                          158   4e-43   
ref|XP_010534301.1|  PREDICTED: actin-depolymerizing factor 1-like      150   4e-43   
ref|XP_006572866.1|  PREDICTED: uncharacterized protein LOC100795...    150   5e-43   
ref|XP_007160047.1|  hypothetical protein PHAVU_002G288100g             152   5e-43   
ref|XP_008369858.1|  PREDICTED: actin-depolymerizing factor 2-like      150   5e-43   
ref|XP_010245480.1|  PREDICTED: actin-depolymerizing factor 1-like      150   6e-43   
ref|XP_004246462.1|  PREDICTED: actin-depolymerizing factor 1           150   6e-43   
ref|XP_004511585.1|  PREDICTED: actin-depolymerizing factor 7-lik...    150   7e-43   
ref|XP_008233662.1|  PREDICTED: uncharacterized protein LOC103332693    159   8e-43   
ref|XP_006418975.1|  hypothetical protein EUTSA_v10002704mg             150   9e-43   
ref|XP_008387742.1|  PREDICTED: actin-depolymerizing factor 2-like      150   1e-42   
gb|KHN21743.1|  Actin-depolymerizing factor 7                           149   1e-42   
ref|XP_010455715.1|  PREDICTED: actin-depolymerizing factor 4           150   1e-42   
ref|XP_006436041.1|  hypothetical protein CICLE_v10033029mg             149   1e-42   
gb|ACN27286.1|  unknown                                                 149   1e-42   
ref|NP_190187.1|  actin depolymerizing factor 1                         149   1e-42   
ref|XP_009340028.1|  PREDICTED: uncharacterized protein LOC103932...    155   1e-42   
ref|NP_001105590.1|  actin-depolymerizing factor 2                      149   1e-42   
emb|CDY31586.1|  BnaA10g12850D                                          149   2e-42   
ref|XP_009612959.1|  PREDICTED: actin-depolymerizing factor 2-like      149   2e-42   
emb|CDY27075.1|  BnaA02g10950D                                          156   2e-42   
gb|KDO72931.1|  hypothetical protein CISIN_1g032504mg                   149   2e-42   
ref|XP_010442763.1|  PREDICTED: actin-depolymerizing factor 12-like     149   2e-42   
ref|XP_009775372.1|  PREDICTED: actin-depolymerizing factor 2-like      149   2e-42   
ref|NP_851227.1|  actin depolymerizing factor 3                         149   2e-42   
ref|XP_006491074.1|  PREDICTED: actin-depolymerizing factor 10-like     149   2e-42   
ref|XP_003630533.1|  Actin depolymerizing factor                        149   2e-42   
ref|XP_007206122.1|  hypothetical protein PRUPE_ppa013109mg             149   2e-42   
ref|XP_002452789.1|  hypothetical protein SORBIDRAFT_04g032550          149   2e-42   
ref|XP_009131961.1|  PREDICTED: actin-depolymerizing factor 4-like      149   2e-42   
ref|XP_009400269.1|  PREDICTED: actin-depolymerizing factor-like        149   2e-42   
ref|XP_006367965.1|  PREDICTED: actin-depolymerizing factor 2-like      149   3e-42   
emb|CAA18167.1|  actin depolymerizing factor-like protein               148   3e-42   
emb|CBI16177.3|  unnamed protein product                                148   3e-42   
ref|XP_006418977.1|  hypothetical protein EUTSA_v10002714mg             148   3e-42   
emb|CDX88731.1|  BnaA03g09180D                                          150   4e-42   
ref|XP_010111772.1|  Actin-depolymerizing factor 1                      148   4e-42   
emb|CDX86048.1|  BnaC03g55630D                                          149   4e-42   
emb|CDY09242.1|  BnaA02g06680D                                          149   4e-42   
emb|CDX99133.1|  BnaA06g18240D                                          149   5e-42   
ref|XP_009374667.1|  PREDICTED: actin-depolymerizing factor 2-lik...    148   5e-42   
ref|XP_002864656.1|  hypothetical protein ARALYDRAFT_496124             148   6e-42   
ref|XP_009601830.1|  PREDICTED: uncharacterized protein LOC104097027    156   6e-42   
ref|XP_010671964.1|  PREDICTED: actin-depolymerizing factor 7           147   6e-42   
gb|ACJ84098.1|  unknown                                                 147   7e-42   
gb|AFN53688.1|  putative actin-depolymerizing factor 12                 154   7e-42   
ref|XP_003570044.1|  PREDICTED: actin-depolymerizing factor 1           147   7e-42   
ref|XP_003594440.1|  Actin depolymerizing factor                        147   7e-42   
ref|XP_006418976.1|  hypothetical protein EUTSA_v10002704mg             147   8e-42   
gb|KDP44204.1|  hypothetical protein JCGZ_05671                         147   8e-42   
ref|XP_009371344.1|  PREDICTED: uncharacterized protein LOC103960584    155   8e-42   
ref|XP_008234462.1|  PREDICTED: uncharacterized protein LOC103333411    155   8e-42   
ref|NP_001078247.1|  actin depolymerizing factor 1                      147   9e-42   
ref|XP_004984752.1|  PREDICTED: actin-depolymerizing factor 7-lik...    148   9e-42   
ref|NP_001236448.1|  uncharacterized protein LOC100305514               147   9e-42   
ref|XP_004133872.1|  PREDICTED: actin-depolymerizing factor 10-like     147   1e-41   
ref|XP_003592288.1|  Actin depolymerizing factor                        156   1e-41   
ref|XP_004149045.1|  PREDICTED: actin-depolymerizing factor 2-lik...    147   1e-41   
gb|AES62539.2|  cofilin/actin-depolymerizing factor-like protein        156   1e-41   
gb|ACR34799.1|  unknown                                                 147   1e-41   
ref|XP_008668647.1|  PREDICTED: actin-depolymerizing factor 2 iso...    147   1e-41   
emb|CDP09013.1|  unnamed protein product                                147   1e-41   
ref|NP_001105463.1|  actin-depolymerizing factor 1                      147   1e-41   
ref|XP_002510785.1|  actin depolymerizing factor, putative              155   2e-41   
ref|XP_004309205.1|  PREDICTED: uncharacterized protein LOC101314811    154   2e-41   
emb|CDX94438.1|  BnaC01g17460D                                          146   2e-41   
emb|CAJ38384.1|  actin-depolymerizing factor                            146   2e-41   
emb|CDX90057.1|  BnaA10g00250D                                          146   2e-41   
ref|XP_006653969.1|  PREDICTED: actin-depolymerizing factor 7-like      146   3e-41   
ref|XP_007147534.1|  hypothetical protein PHAVU_006G132700g             146   3e-41   
gb|AFN53632.1|  actin-depolymerizing factor 12                          152   3e-41   
sp|Q0DLA3.2|ADF7_ORYSJ  RecName: Full=Actin-depolymerizing factor...    146   3e-41   
ref|XP_006292022.1|  hypothetical protein CARUB_v10018211mg             145   4e-41   
ref|XP_006586815.1|  PREDICTED: actin-depolymerizing factor 2-like      145   4e-41   
gb|EMT12807.1|  Actin-depolymerizing factor 7                           147   4e-41   
ref|XP_003569002.1|  PREDICTED: actin-depolymerizing factor 7           145   5e-41   
gb|AAR23800.1|  putative actin-depolymerizing factor 2                  145   6e-41   
ref|XP_011076485.1|  PREDICTED: uncharacterized protein C683.02c        152   7e-41   
gb|AEJ90198.1|  actin depolymerizing factor 1                           145   7e-41   
ref|XP_004486422.1|  PREDICTED: actin-depolymerizing factor 2-like      145   7e-41   
dbj|BAJ93061.1|  predicted protein                                      145   8e-41   
gb|AFS49701.1|  actin-depolymerizing factor 7                           145   9e-41   
ref|XP_010528350.1|  PREDICTED: actin-depolymerizing factor 1-like      144   9e-41   
ref|XP_009767744.1|  PREDICTED: actin-depolymerizing factor 7-lik...    144   9e-41   
ref|XP_006421922.1|  hypothetical protein CICLE_v10007087mg             144   9e-41   
ref|XP_008457551.1|  PREDICTED: actin-depolymerizing factor 2           144   1e-40   
ref|XP_008651860.1|  PREDICTED: actin-depolymerizing factor 1 iso...    144   1e-40   
gb|KFK27529.1|  hypothetical protein AALP_AA8G395300                    144   1e-40   
gb|KHN35014.1|  Actin-depolymerizing factor 7                           144   2e-40   
ref|XP_004960504.1|  PREDICTED: actin-depolymerizing factor 7-like      144   2e-40   
ref|XP_002511837.1|  actin depolymerizing factor, putative              143   2e-40   
emb|CDX91636.1|  BnaC02g15240D                                          143   2e-40   
ref|NP_001054456.1|  Os05g0113400                                       144   3e-40   
ref|XP_003629907.1|  Actin depolymerizing factor-like protein           144   3e-40   
emb|CDY00526.1|  BnaA10g07470D                                          143   3e-40   
gb|KCW50261.1|  hypothetical protein EUGRSUZ_J00048                     143   3e-40   
gb|ABK23520.1|  unknown                                                 143   3e-40   
ref|XP_004302775.1|  PREDICTED: actin-depolymerizing factor 3-lik...    143   4e-40   
gb|AFK48601.1|  unknown                                                 143   4e-40   
gb|EPS71217.1|  hypothetical protein M569_03542                         143   4e-40   
ref|NP_001236003.1|  uncharacterized protein LOC100527688               143   5e-40   
gb|ACG37280.1|  actin-depolymerizing factor 1                           143   5e-40   
emb|CDY52365.1|  BnaA08g31000D                                          142   6e-40   
emb|CDY31909.1|  BnaC09g28350D                                          142   8e-40   
ref|XP_007162541.1|  hypothetical protein PHAVU_001G160700g             142   8e-40   
gb|AFK34162.1|  unknown                                                 142   8e-40   
ref|XP_008793579.1|  PREDICTED: actin-depolymerizing factor 11 is...    142   9e-40   
gb|ABF60823.1|  actin depolymerizing factor                             142   9e-40   
ref|NP_001239657.1|  uncharacterized protein LOC100819975               142   1e-39   
ref|XP_008787346.1|  PREDICTED: actin-depolymerizing factor-like ...    142   1e-39   
ref|XP_004240356.1|  PREDICTED: actin-depolymerizing factor 2-like      142   1e-39   
ref|XP_009139339.1|  PREDICTED: actin-depolymerizing factor             142   1e-39   
ref|XP_008787347.1|  PREDICTED: actin-depolymerizing factor 11-li...    142   1e-39   
ref|XP_010105396.1|  Actin-depolymerizing factor 7                      141   2e-39   
ref|XP_004137944.1|  PREDICTED: actin-depolymerizing factor 2-like      142   2e-39   
ref|XP_009388955.1|  PREDICTED: actin-depolymerizing factor 11-like     141   3e-39   
gb|AFK34925.1|  unknown                                                 141   3e-39   
ref|XP_008343556.1|  PREDICTED: actin-depolymerizing factor 1-like      140   4e-39   
gb|AFK42408.1|  unknown                                                 140   5e-39   
ref|XP_007035112.1|  Actin depolymerizing factor 6                      140   6e-39   
ref|XP_009144237.1|  PREDICTED: actin-depolymerizing factor 6           140   6e-39   
ref|XP_007050307.1|  Actin depolymerizing factor 6 isoform 1            140   6e-39   
gb|ADE75680.1|  unknown                                                 140   7e-39   
gb|AFK39900.1|  unknown                                                 140   7e-39   
ref|XP_010089132.1|  Actin-depolymerizing factor 7                      139   1e-38   
ref|XP_011083023.1|  PREDICTED: actin-depolymerizing factor-like        139   1e-38   
emb|CDP00056.1|  unnamed protein product                                139   1e-38   
ref|XP_009603156.1|  PREDICTED: actin-depolymerizing factor             139   1e-38   
ref|XP_011024326.1|  PREDICTED: actin-depolymerizing factor 1-lik...    138   2e-38   
gb|AFK44911.1|  unknown                                                 139   2e-38   
ref|XP_009628017.1|  PREDICTED: actin-depolymerizing factor 7-like      138   2e-38   
gb|ABC49719.1|  actin depolymerizing factor-like protein                139   2e-38   
ref|XP_010906274.1|  PREDICTED: actin-depolymerizing factor-like ...    139   2e-38   
ref|XP_009408567.1|  PREDICTED: actin-depolymerizing factor 11-like     139   2e-38   
dbj|BAB10533.1|  actin depolymerizing factor-like                       138   3e-38   
gb|KCW50264.1|  hypothetical protein EUGRSUZ_J00048                     138   3e-38   
ref|XP_004307557.1|  PREDICTED: actin-depolymerizing factor 2-like      138   3e-38   
emb|CAB82824.1|  actin depolymerizing factor 2 (ADF2)                   138   3e-38   
ref|NP_568916.2|  actin depolymerizing factor 4                         138   3e-38   
gb|ABD66507.1|  actin depolymerizing factor 5                           138   3e-38   
gb|KFK31228.1|  hypothetical protein AALP_AA6G084900                    138   3e-38   
ref|XP_004981256.1|  PREDICTED: actin-depolymerizing factor 3-like      138   4e-38   
ref|XP_010111917.1|  Actin-depolymerizing factor 6                      138   4e-38   
gb|KCW88917.1|  hypothetical protein EUGRSUZ_A01245                     137   4e-38   
emb|CDY10786.1|  BnaA05g11500D                                          138   5e-38   
ref|XP_009346957.1|  PREDICTED: actin-depolymerizing factor 1 iso...    137   6e-38   



>emb|CBI40336.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  348  SQGSSPSQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQ  169
            ++GSS S  H MANSASG+ V DECKLKF+ELKAKR  R+IVFKIDE  Q V+VEK+G+ 
Sbjct  107  TEGSSLSGGHNMANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSP  166

Query  168  QETHVDFTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             ET+ DFT SLPADECRYAVFD+DFTTDENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  167  DETYEDFTNSLPADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYAS  222



>ref|XP_011093147.1| PREDICTED: actin-depolymerizing factor 10-like [Sesamum indicum]
Length=139

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR FRYIVFKID+  Q V+VEK GN  E + DFT SL
Sbjct  1    MANSASGIAVNDECKLKFLELKAKRNFRYIVFKIDDTVQEVMVEKAGNHGENYEDFTNSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFDYDFTTDENC +SKIFFIAWSP+TA++R+KM+YAS
Sbjct  61   PANECRYAVFDYDFTTDENCHKSKIFFIAWSPDTARVRTKMLYAS  105



>ref|XP_002271495.1| PREDICTED: actin-depolymerizing factor 10 [Vitis vinifera]
 emb|CAN73839.1| hypothetical protein VITISV_012391 [Vitis vinifera]
Length=139

 Score =   174 bits (440),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR  R+IVFKIDE  Q V+VEK+G+  ET+ DFT SL
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNHRFIVFKIDERIQQVMVEKLGSPDETYEDFTNSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DFTTDENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_009771651.1| PREDICTED: actin-depolymerizing factor 12-like [Nicotiana sylvestris]
Length=137

 Score =   173 bits (439),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKFMELKAKR +RYIVFKI  E Q VVVEK+G Q ETH DF  SL
Sbjct  1    MANSASGIAVSDECKLKFMELKAKRNYRYIVFKI--EGQQVVVEKVGEQGETHEDFANSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P++ECRYAVFDYDFTTDEN Q+SKIFF+AWSPETA++RSKM+YAS
Sbjct  59   PSNECRYAVFDYDFTTDENVQKSKIFFVAWSPETARVRSKMLYAS  103



>ref|NP_171680.1| actin depolymerizing factor 11 [Arabidopsis thaliana]
 sp|Q9LQ81.1|ADF10_ARATH RecName: Full=Actin-depolymerizing factor 10; Short=ADF-10; Short=AtADF10 
[Arabidopsis thaliana]
 gb|AAF78408.1|AC009273_14 Contains similarity to actin depolymerizing factor 4 from Arabidopsis 
thaliana gb|AF102822. It contains cofilin/tropomyosin-type 
actin-binding proteins PF|00241. EST gb|AA720247 comes 
from this gene [Arabidopsis thaliana]
 gb|AAL62402.1| actin depolymerizing factor, putative [Arabidopsis thaliana]
 gb|AAM65844.1| Actin-depolymerizing factor like At1g01750 (ADF-like) [Arabidopsis 
thaliana]
 gb|AAN65137.1| actin depolymerizing factor, putative [Arabidopsis thaliana]
 gb|AEE27331.1| actin depolymerizing factor 11 [Arabidopsis thaliana]
Length=140

 Score =   172 bits (435),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V+++K+GN +ET+ DFT+S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYEDFTRSI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+DYDFTT ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PEDECRYAVYDYDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_010249803.1| PREDICTED: actin-depolymerizing factor [Nelumbo nucifera]
Length=139

 Score =   172 bits (435),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKF+ELKAKR +R+IVFKIDE+ Q V+VE++GN +E++ DFT  L
Sbjct  1    MANSASGMAVNDDCKLKFLELKAKRNYRFIVFKIDEKIQQVMVERLGNPEESYEDFTACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DFTTDENCQ+SKIFFIAWSP+T+K+RSKM+YAS
Sbjct  61   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRSKMLYAS  105



>ref|XP_009630108.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana tomentosiformis]
Length=137

 Score =   171 bits (434),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKFMELKAKR +RYIVFKI  E Q VVV+K+G Q ETH DF+ SL
Sbjct  1    MANSASGIAVSDECKLKFMELKAKRNYRYIVFKI--EGQQVVVDKVGEQGETHQDFSNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P++ECRYAVFDYD+TTDEN Q+SKIFF+AWSPETA++RSKM+YAS
Sbjct  59   PSNECRYAVFDYDYTTDENVQKSKIFFVAWSPETARVRSKMLYAS  103



>gb|KCW71635.1| hypothetical protein EUGRSUZ_E00162 [Eucalyptus grandis]
Length=139

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS+SG+ V DECKLKF+ELK KR +R+IVFKI+E+ Q V +EK+G+ +ET+ DF+ SL
Sbjct  1    MANSSSGMAVDDECKLKFLELKTKRIYRFIVFKIEEKIQQVTIEKLGSPEETYDDFSSSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DFTTDENCQ+SKIFFIAW+PET+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFTTDENCQKSKIFFIAWAPETSRVRSKMLYAS  105



>gb|KDO76170.1| hypothetical protein CISIN_1g046281mg, partial [Citrus sinensis]
Length=133

 Score =   169 bits (429),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS+SG+ V DECKLKF+ELKAKR +R+IVFKI+E+ Q V VEK+G   E++ DFT SL
Sbjct  1    MANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTTDENCQ+SKIFF+AWSP+T++IRSKM+YAS
Sbjct  61   PADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYAS  105



>ref|XP_006304638.1| hypothetical protein CARUB_v10011760mg [Capsella rubella]
 gb|EOA37536.1| hypothetical protein CARUB_v10011760mg [Capsella rubella]
Length=140

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V+++K+GN +ET+ DFT+S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYDDFTRSI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTT ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PEDECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_010479839.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
 ref|XP_010457085.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
 ref|XP_010474795.1| PREDICTED: actin-depolymerizing factor 10 [Camelina sativa]
Length=140

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +RYI+FKIDE+ Q V+++K+GN +ET+ DFT S+
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRYIIFKIDEKAQQVMIDKLGNPEETYDDFTGSI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTT ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PEDECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_010427310.1| PREDICTED: actin-depolymerizing factor 8 [Camelina sativa]
Length=141

 Score =   169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECK+KF+ELKAKR +R+IVFKIDE+ Q V +EK+GN +ET+ DFT S+
Sbjct  1    MANSASGMNVSDECKIKFLELKAKRTYRFIVFKIDEKAQQVEIEKLGNPEETYDDFTSSI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTT++NCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_009615468.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana tomentosiformis]
Length=140

 Score =   169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKF+ELKAKR  RYIVFKI+E  Q VVVEK+G Q ETH DF  SL
Sbjct  1    MANSASGIAVSDDCKLKFLELKAKRNHRYIVFKIEESVQQVVVEKVGGQAETHEDFANSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFDYD+TT+EN Q+S+IFF+AWSPETA++RSKM+YAS
Sbjct  61   PPNECRYAVFDYDWTTNENVQKSRIFFVAWSPETARVRSKMLYAS  105



>ref|XP_009111466.1| PREDICTED: actin-depolymerizing factor 8 [Brassica rapa]
Length=139

 Score =   169 bits (428),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECK+KFMELKAKR +RYIVFKIDE+ Q V +EK+GN QET+ DFT S+
Sbjct  1    MANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEKLGNPQETYDDFTNSI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYA++D+DFTT++NCQ+SKI+FIAWSP+T+++RSKM+YAS
Sbjct  61   PENECRYAIYDFDFTTEDNCQKSKIYFIAWSPDTSRVRSKMLYAS  105



>ref|XP_006341722.1| PREDICTED: actin-depolymerizing factor 10-like [Solanum tuberosum]
Length=139

 Score =   169 bits (428),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKL+F+ELKAKR  R++VFKIDE  Q VVVEK+G Q ETH DF  S+
Sbjct  1    MANSASGIAVSDECKLRFLELKAKRNHRFLVFKIDESVQQVVVEKVGGQAETHDDFANSM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P  ECRYAVFDYD+TTDEN Q+S+IFF+AWSPETA++RSKM+YAS
Sbjct  61   PPSECRYAVFDYDWTTDENVQKSRIFFVAWSPETARVRSKMLYAS  105



>ref|XP_008794195.1| PREDICTED: actin-depolymerizing factor-like [Phoenix dactylifera]
Length=139

 Score =   169 bits (427),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELK KR FR+I+FKIDE+ Q V VEK+G   E++ DFT SL
Sbjct  1    MANSASGMAVNDECKLKFLELKTKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+WSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYAS  105



>ref|XP_010327379.1| PREDICTED: actin-depolymerizing factor 10-like [Solanum lycopersicum]
Length=146

 Score =   169 bits (428),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKL+F+ELKAKR  RY+VFKIDE  Q VVVEK+G Q ETH DF  S+P
Sbjct  9    ANSASGIAVSDECKLRFLELKAKRNHRYLVFKIDESVQQVVVEKVGGQTETHDDFANSMP  68

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
              ECRYAVFDYD+TTDEN Q+S+IFF+AWSPETA++RSKM+YAS
Sbjct  69   PSECRYAVFDYDWTTDENVQKSRIFFVAWSPETARVRSKMLYAS  112



>emb|CDP08835.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 105/131 (80%), Gaps = 5/131 (4%)
 Frame = -3

Query  393  LIIYFAFSIISSNKLSQGSSPSQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKI  214
            +++Y +F I     LS G+S +     ANS SG+ V DECKLKF+ELKAKR +RYIVFKI
Sbjct  1    MMVYISFHIFPFLTLS-GNSLND----ANSVSGIAVHDECKLKFLELKAKRNYRYIVFKI  55

Query  213  DEETQVVVVEKMGNQQETHVDFTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPET  34
            D+ ++ V +EK+G+  ET+ DFT SLPAD+CRYAVFDYDFTT+ENC +SKI+FIAWSP+T
Sbjct  56   DDISKQVAIEKLGSHDETYEDFTNSLPADQCRYAVFDYDFTTEENCHKSKIYFIAWSPDT  115

Query  33   AKIRSKMVYAS  1
            +KIR+KMVYAS
Sbjct  116  SKIRAKMVYAS  126



>ref|XP_006476590.1| PREDICTED: actin-depolymerizing factor 1-like [Citrus sinensis]
Length=139

 Score =   169 bits (427),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS+SG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ Q V VEK+G   E++ DFT SL
Sbjct  1    MANSSSGMAVHDDCKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTTDENCQ+SKIFF+AWSP+T++IRSKM+YAS
Sbjct  61   PADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYAS  105



>ref|XP_002892045.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68304.1| hypothetical protein ARALYDRAFT_887267 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   169 bits (427),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKF+ELKAKR +R+IVFKIDE+ Q V+++K+GN +ET+ DFT+S+
Sbjct  1    MANSASGMHVSDDCKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYDDFTRSI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTT ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PEDECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_006339546.1| PREDICTED: actin-depolymerizing factor 12-like [Solanum tuberosum]
Length=137

 Score =   168 bits (426),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKFMELKAKR  RYIVFKID   Q VVVEK+G Q ETH DF  SL
Sbjct  1    MANSASGIAVSDECKLKFMELKAKRNHRYIVFKID--GQQVVVEKVGGQAETHDDFANSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFDYDFTT+EN Q+SKIFF+AWSPETA++RSKM+YAS
Sbjct  59   PPNECRYAVFDYDFTTNENVQKSKIFFVAWSPETARVRSKMLYAS  103



>ref|XP_010544380.1| PREDICTED: actin-depolymerizing factor 8 isoform X2 [Tarenaya 
hassleriana]
Length=139

 Score =   168 bits (426),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q VVV+K+GN +ET+ DFT S+
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRSYRFIVFKIDEKVQKVVVDKIGNPEETYDDFTSSM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DFTT +NCQ+SKIFFIAWSP+T+K+RSKM+YAS
Sbjct  61   PENECRYAVYDFDFTTKDNCQKSKIFFIAWSPDTSKVRSKMLYAS  105



>ref|XP_009793423.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana sylvestris]
Length=140

 Score =   168 bits (426),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKF+ELKAKR  RY+VFKI+E  Q VVVEK+G Q ETH DF  SL
Sbjct  1    MANSASGIAVSDDCKLKFLELKAKRNHRYLVFKIEESVQQVVVEKVGGQAETHDDFASSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFDYD+TT+EN Q+S+IFF+AWSPETA++RSKM+YAS
Sbjct  61   PPNECRYAVFDYDWTTNENVQKSRIFFVAWSPETARVRSKMLYAS  105



>ref|XP_007051847.1| Actin depolymerizing factor 11 [Theobroma cacao]
 gb|EOX96004.1| Actin depolymerizing factor 11 [Theobroma cacao]
Length=139

 Score =   168 bits (426),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS+SG+ + DECKLKF+ELKAKR  RYIVFKIDE+TQ V+VEK+G+   T+ DFT SL
Sbjct  1    MANSSSGMAMNDECKLKFLELKAKRNHRYIVFKIDEKTQQVIVEKLGSPGATYDDFTNSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFDY+FTT+ENCQ+SKIFF AWSP+T+++RSKM+YAS
Sbjct  61   PANECRYAVFDYNFTTNENCQKSKIFFFAWSPDTSRVRSKMLYAS  105



>ref|XP_009411533.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=169

 Score =   169 bits (428),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -3

Query  318  EMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKS  139
            E AN+ASG+ V DECKLKF+ELKAKR FR+IVFKIDE  Q V+V+K+G   E++ DFT S
Sbjct  30   EYANAASGMAVSDECKLKFLELKAKRNFRFIVFKIDERIQQVMVDKLGQPDESYDDFTAS  89

Query  138  LPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            LPADECRYAVFD+DF TDENCQ+SKIFFIAWSP+ A++RSKM+YAS
Sbjct  90   LPADECRYAVFDFDFVTDENCQKSKIFFIAWSPDAARVRSKMLYAS  135



>ref|XP_002872934.1| hypothetical protein ARALYDRAFT_490501 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49193.1| hypothetical protein ARALYDRAFT_490501 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   168 bits (426),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V +EK+GN +ET+ DFT ++
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSAI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTT++NCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_011091992.1| PREDICTED: actin-depolymerizing factor 10-like [Sesamum indicum]
Length=139

 Score =   168 bits (425),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +RYI+FKID+  Q V+VEK G+  ET+  FT SL
Sbjct  1    MANSASGIAVSDECKLKFLELKAKRNYRYIIFKIDDNVQQVMVEKAGDHAETYEHFTSSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P ++CRYAVFDYDFTTDENC +SKIFFIAWSP+TA++R+KM+YAS
Sbjct  61   PDNDCRYAVFDYDFTTDENCHKSKIFFIAWSPDTARVRTKMLYAS  105



>ref|XP_006439576.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
 gb|ESR52816.1| hypothetical protein CICLE_v10023304mg [Citrus clementina]
Length=140

 Score =   168 bits (425),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANS+SG+ V DECKLKF+ELKAKR +R+IVFKI+E+ Q V VEK+G   E++ DFT SLP
Sbjct  3    ANSSSGMAVHDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGEPNESYEDFTASLP  62

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            ADECRYAV+D+DFTTDENCQ+SKIFF+AWSP+T++IRSKM+YAS
Sbjct  63   ADECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRIRSKMLYAS  106



>ref|NP_567182.1| actin depolymerizing factor 8 [Arabidopsis thaliana]
 sp|Q570Y6.2|ADF8_ARATH RecName: Full=Actin-depolymerizing factor 8; Short=ADF-8; Short=AtADF8 
[Arabidopsis thaliana]
 gb|AAM63658.1| putative actin-depolymerizing factor [Arabidopsis thaliana]
 gb|ABD60702.1| At4g00680 [Arabidopsis thaliana]
 gb|AEE81918.1| actin depolymerizing factor 8 [Arabidopsis thaliana]
Length=140

 Score =   168 bits (425),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECK+KF+ELKAKR +R+IVFKIDE+ Q V +EK+GN +ET+ DFT S+
Sbjct  1    MANSASGMHVNDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSSI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTT++NCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_009384093.1| PREDICTED: actin-depolymerizing factor 1 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR FR+IVFKIDE  Q V+VEK+G   ET+ DF  S+
Sbjct  1    MANSASGMAVSDECKLKFLELKAKRNFRFIVFKIDERIQQVMVEKLGQPGETYDDFAASM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDE+CQ+SKIFFI+WSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDEHCQKSKIFFISWSPDTSRVRSKMLYAS  105



>ref|XP_002318237.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|EEE96457.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=137

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 95/105 (90%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+FKI  E+Q VVVEK+G+ +ET+ +F  SL
Sbjct  1    MANAASGMAVDDECKLKFLELKAKRNYRFIIFKI--ESQQVVVEKLGSPEETYEEFAASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFDYDFTT+ENCQ+SKIFFIAWSP+T++IRSKMVYAS
Sbjct  59   PADECRYAVFDYDFTTNENCQKSKIFFIAWSPDTSRIRSKMVYAS  103



>ref|XP_010419619.1| PREDICTED: actin-depolymerizing factor 8-like [Camelina sativa]
Length=141

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V +EK+GN +ET+ DFT  +
Sbjct  1    MANSASGMKVSDECKLKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSCI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTT++NCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_006363318.1| PREDICTED: actin-depolymerizing factor 7-like [Solanum tuberosum]
Length=137

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+FKID   Q VVVEK+GN +ET+ DFT +L
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRIYRFIIFKID--AQQVVVEKLGNPEETYEDFTNAL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF T+ENCQ+SKIFFIAWSP+T+K+R KMVYAS
Sbjct  59   PADECRYAVFDFDFVTNENCQKSKIFFIAWSPDTSKVRMKMVYAS  103



>ref|XP_009787751.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana sylvestris]
Length=139

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR  RYIVFKID+    VVVEK+G   ETH DF  +L
Sbjct  1    MANSASGIAVSDECKLKFLELKAKRDHRYIVFKIDDSGHQVVVEKVGRNDETHEDFANNL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFDYDFTT+EN Q+SKIFF+AW+PETA++RSKM+YAS
Sbjct  61   PPNECRYAVFDYDFTTNENVQKSKIFFVAWAPETARVRSKMLYAS  105



>ref|NP_001053519.1| Os04g0555700 [Oryza sativa Japonica Group]
 sp|Q7XSN9.2|ADF6_ORYSJ RecName: Full=Actin-depolymerizing factor 6; Short=ADF-6; Short=OsADF6 
[Oryza sativa Japonica Group]
 emb|CAE01864.2| OSJNBb0012E24.5 [Oryza sativa Japonica Group]
 dbj|BAF15433.1| Os04g0555700 [Oryza sativa Japonica Group]
 dbj|BAG91382.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF ELK+KR FR+I FKIDE TQ VVV+++G   +T+ DFT S+
Sbjct  1    MANSASGMAVGDECKLKFQELKSKRSFRFITFKIDERTQQVVVDRLGQPGDTYDDFTASM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA ECRYAVFD+DF TDENCQ+SKIFFI+WSP+T+K+RSKM+YAS
Sbjct  61   PASECRYAVFDFDFVTDENCQKSKIFFISWSPDTSKVRSKMLYAS  105



>ref|XP_010456252.1| PREDICTED: actin-depolymerizing factor 8-like [Camelina sativa]
Length=141

 Score =   167 bits (422),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECK+KF+ELKAKR +R+IVFKIDE+ Q V +EK+GN +ET+ DFT  +
Sbjct  1    MANSASGMNVSDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSCI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTT++NCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_006396264.1| hypothetical protein EUTSA_v10029050mg [Eutrema salsugineum]
 gb|ESQ37717.1| hypothetical protein EUTSA_v10029050mg [Eutrema salsugineum]
Length=141

 Score =   167 bits (422),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            +ANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE  Q V +EK+GN +ET+ DFT S+
Sbjct  3    LANSASGMNVSDECKLKFLELKAKRTYRFIVFKIDENAQQVQIEKLGNPEETYDDFTNSI  62

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DFTT++NCQ+SKIFFI+WSP+T+++RSKM+YAS
Sbjct  63   PENECRYAVYDFDFTTEDNCQKSKIFFISWSPDTSRVRSKMLYAS  107



>gb|KFK30636.1| hypothetical protein AALP_AA6G007700 [Arabis alpina]
Length=239

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +RYIVF IDE  Q V++EK+GN +ET+ DFT S+
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRTYRYIVFTIDETAQQVLIEKLGNPEETYDDFTNSM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DFTT++NCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PENECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>dbj|BAK06235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF +LKAKR FR+I FKI+E TQ VVV+++G   +T+ DFT S+
Sbjct  1    MANSASGMAVSDECKLKFQDLKAKRSFRFITFKINENTQQVVVDRVGQPGDTYADFTASM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+WSP+++++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWSPDSSRVRSKMLYAS  105



>gb|EYU32098.1| hypothetical protein MIMGU_mgv1a026462mg, partial [Erythranthe 
guttata]
Length=138

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKLKF+ELKAKR  RYIVFKID+  Q V+VEK+G Q ET+ DF  SLP
Sbjct  1    ANSASGIAVSDECKLKFLELKAKRNHRYIVFKIDDTVQQVMVEKVGTQAETYEDFANSLP  60

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             ++CRYAVFDYDFTTDENC++SKIFFIAWSP+ AK+R+KM+YAS
Sbjct  61   DNDCRYAVFDYDFTTDENCRKSKIFFIAWSPDIAKVRTKMLYAS  104



>ref|XP_010662752.1| PREDICTED: actin-depolymerizing factor 1 [Vitis vinifera]
Length=139

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR  R+IVFKI+E+ Q VVVEK+G+  E++  FT SL
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIEEKIQQVVVEKLGSPDESYDAFTSSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DFTTDENCQ+SKIFFIAW+P+T+++RSKM+YAS
Sbjct  61   PANECRYAVFDFDFTTDENCQKSKIFFIAWAPDTSRVRSKMLYAS  105



>ref|XP_008804935.1| PREDICTED: actin-depolymerizing factor isoform X2 [Phoenix dactylifera]
Length=139

 Score =   166 bits (421),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR FR+I+FKIDE+ Q V VEK+G   E++ DFT SL
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVSVEKLGQPDESYDDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DF TDENCQ+SKI FI+WSP+T+++RSKM+YAS
Sbjct  61   PANECRYAVFDFDFVTDENCQKSKIIFISWSPDTSRVRSKMLYAS  105



>gb|KCW46430.1| hypothetical protein EUGRSUZ_K00262 [Eucalyptus grandis]
Length=137

 Score =   166 bits (420),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKL+FMELKAKR +R+I+FKI  E Q VVVEK+GN +ET+ DF+ S 
Sbjct  1    MANAASGMAVSDECKLRFMELKAKRIYRFIIFKI--ENQQVVVEKVGNPEETYEDFSASF  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRY+VFD+DF T+ENCQ+SKIFFIAW+P+TAKIRSKMVYAS
Sbjct  59   PADECRYSVFDFDFITNENCQKSKIFFIAWAPDTAKIRSKMVYAS  103



>gb|AAL91667.1| pollen specific actin-depolymerizing factor 2 [Nicotiana tabacum]
Length=137

 Score =   166 bits (420),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V+DECKLKF+ELKAKR +R+IVFKI  E Q VVVEK+GN +E + DFT SL
Sbjct  1    MANAASGMAVLDECKLKFLELKAKRNYRFIVFKI--EGQQVVVEKLGNPEENYDDFTNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF T ENCQ+SKIFFIAWSP+T+K+R KMVYAS
Sbjct  59   PADECRYAVFDFDFITTENCQKSKIFFIAWSPDTSKVRMKMVYAS  103



>ref|XP_009595762.1| PREDICTED: actin-depolymerizing factor 10-like [Nicotiana tomentosiformis]
Length=139

 Score =   166 bits (420),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLK++ELKAKR  RYIVFKID+    VVVEK+G   ETH DF  +L
Sbjct  1    MANSASGIAVSDECKLKYLELKAKRDHRYIVFKIDDSGHQVVVEKVGRNDETHEDFANNL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFDYDFTT+EN Q+SKIFF+AW+PETA++RSKM+YAS
Sbjct  61   PPNECRYAVFDYDFTTNENVQKSKIFFVAWAPETARVRSKMLYAS  105



>ref|XP_011029243.1| PREDICTED: actin-depolymerizing factor isoform X2 [Populus euphratica]
Length=139

 Score =   166 bits (420),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKL+FMELKAKR  R+IVFKI+E+ Q VVVE +G  Q+++ DFT SL
Sbjct  1    MANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DFTTDEN Q+SKIFF+AWSP+T+KIRSKM+YAS
Sbjct  61   PANECRYAVYDFDFTTDENVQKSKIFFVAWSPDTSKIRSKMLYAS  105



>gb|AEZ00870.1| putative actin depolymerizing factor protein, partial [Elaeis 
guineensis]
Length=179

 Score =   167 bits (423),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SSNKLSQGSSPSQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVE  184
            SS+  S   +P    EMAN+ASG+ V D+CKLKF+ELKAKR  RYI+FKIDE+ + V+VE
Sbjct  25   SSSNPSAARAPIAFAEMANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVE  84

Query  183  KMGNQQETHVDFTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYA  4
            K+G    ++ DFT +LPADECRYA++D+DF T+ENCQ+SKIFFIAWSP+T+++RSKM+YA
Sbjct  85   KVGEPTLSYEDFTAALPADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYA  144

Query  3    S  1
            S
Sbjct  145  S  145



>ref|XP_004240732.1| PREDICTED: actin-depolymerizing factor 7 [Solanum lycopersicum]
Length=137

 Score =   166 bits (419),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I+FKID   Q VVVEK+GN +E++ DFT +L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRIYRFIIFKID--AQQVVVEKLGNPEESYEDFTNAL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF T+ENCQ+SKIFFIAWSPET+K+R KMVYAS
Sbjct  59   PADECRYAVFDFDFVTNENCQKSKIFFIAWSPETSKVRMKMVYAS  103



>ref|XP_010053689.1| PREDICTED: actin-depolymerizing factor [Eucalyptus grandis]
 gb|KCW78051.1| hypothetical protein EUGRSUZ_D02275 [Eucalyptus grandis]
Length=139

 Score =   165 bits (418),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR  R+IVFKIDE+ Q V VEK+G+ +ET+ DFT  +
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNHRFIVFKIDEKIQQVSVEKVGSPEETYDDFTACM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DF TDENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PANECRYAVFDFDFITDENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_004953378.1| PREDICTED: actin-depolymerizing factor 1-like [Setaria italica]
Length=139

 Score =   165 bits (418),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V DECKLKF+ELKAKR FR+IVFKI+E+ Q VVV+++G   E++ DFT  L
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGEPGESYEDFTACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+W+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYAS  105



>gb|AEW90956.1| actin depolymerizing factor 4-2 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=139

 Score =   165 bits (418),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V D+CKLKF ELKAKR FR+IVFKIDE+ Q VVV+++G + E++ DFT  L
Sbjct  1    MSNSASGMAVCDDCKLKFQELKAKRSFRFIVFKIDEKVQQVVVDRVGEKTESYDDFTACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+W+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYAS  105



>ref|NP_001047657.1| Os02g0663800 [Oryza sativa Japonica Group]
 sp|Q6EUH7.1|ADF1_ORYSJ RecName: Full=Actin-depolymerizing factor 1; Short=ADF-1; Short=OsADF1 
[Oryza sativa Japonica Group]
 dbj|BAD27692.1| putative actin-depolymerizing factor [Oryza sativa Japonica Group]
 dbj|BAF09571.1| Os02g0663800 [Oryza sativa Japonica Group]
 dbj|BAG91513.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   165 bits (418),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V DECKLKF+ELKAKR FR+IVFKI+E+ Q VVV+++G   E++ DFT  L
Sbjct  1    MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFTACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+W+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYAS  105



>ref|XP_010910598.1| PREDICTED: actin-depolymerizing factor [Elaeis guineensis]
Length=178

 Score =   166 bits (421),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS SG+ V DECKLKF+ELKAKR FR+IVFKIDE+ Q V VE++G   E++ DFT  L
Sbjct  40   MANSPSGIAVDDECKLKFLELKAKRNFRFIVFKIDEKIQQVTVERLGQPDESYDDFTACL  99

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFD+DF TDENCQ+SKIFFIAWSP+T+K+RSKMVYAS
Sbjct  100  PPNECRYAVFDFDFVTDENCQKSKIFFIAWSPDTSKVRSKMVYAS  144



>ref|XP_009770352.1| PREDICTED: actin-depolymerizing factor 7 [Nicotiana sylvestris]
Length=137

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V+DECKLKF+ELKAKR +R+IVFKI  E Q VVVEK+GN +E + DFT SL
Sbjct  1    MANAASGMAVLDECKLKFLELKAKRNYRFIVFKI--EGQQVVVEKLGNPEENYDDFTNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF T ENCQ+SKIFFIAWSP+T+K+R KM+YAS
Sbjct  59   PADECRYAVFDFDFITTENCQKSKIFFIAWSPDTSKVRMKMLYAS  103



>gb|EYU35082.1| hypothetical protein MIMGU_mgv1a015967mg [Erythranthe guttata]
Length=139

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS SG+ V DECKLKF+ELKAKR  RYIVFKID   Q VVVEK+G Q E++ DF  SL
Sbjct  1    MANSVSGIAVNDECKLKFLELKAKRNHRYIVFKIDNNVQQVVVEKVGPQGESYQDFADSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+DYDFTTDENC +SKI+FIAWSPE A +R+KM+YAS
Sbjct  61   PANECRYAVYDYDFTTDENCHKSKIYFIAWSPEGATVRTKMLYAS  105



>ref|XP_008393892.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
 ref|XP_008353979.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR FR+IVFKI+E+ Q V+VEK+G   E++ DF+ S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRNFRFIVFKIEEKIQQVIVEKLGGPDESYDDFSASM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTT+ENCQ+SKIFFIAW+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYAS  105



>gb|KGN50293.1| hypothetical protein Csa_5G165880 [Cucumis sativus]
Length=137

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+FKI  E Q VVVEK+G   ET+ DFT SL
Sbjct  1    MANAASGMAVRDECKLKFLELKAKRNYRFIIFKI--EQQEVVVEKLGQPDETYEDFTGSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFIAWSP+ +K+RSKMVYAS
Sbjct  59   PADECRYAVFDFDFITDENCQKSKIFFIAWSPDISKVRSKMVYAS  103



>ref|XP_002509779.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF51166.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS+SG+ V DECKLKF+ELKAKR +R+IVFKI+E+ Q V VEK+G  QE++ DFT SL
Sbjct  1    MANSSSGMAVNDECKLKFLELKAKRSYRFIVFKIEEKIQQVTVEKLGQPQESYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D DFTT+EN Q+SKIFF+AWSP+T+K+RSKM+YAS
Sbjct  61   PANECRYAVYDLDFTTNENVQKSKIFFVAWSPDTSKVRSKMLYAS  105



>ref|XP_002448300.1| hypothetical protein SORBIDRAFT_06g024870 [Sorghum bicolor]
 gb|EES12628.1| hypothetical protein SORBIDRAFT_06g024870 [Sorghum bicolor]
Length=139

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF ELK+KR FR+I FKI+E+TQ VVV+++G   +++ DFT S+
Sbjct  1    MANSASGMAVSDECKLKFQELKSKRSFRFITFKINEQTQQVVVDRLGQPGDSYDDFTGSM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P  ECRYAVFD+DFTTDENCQ+SKIFFI+WSP+T+K+RSKM+YAS
Sbjct  61   PDSECRYAVFDFDFTTDENCQKSKIFFISWSPDTSKVRSKMLYAS  105



>ref|XP_008437023.1| PREDICTED: actin-depolymerizing factor 7 [Cucumis melo]
Length=137

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+FKI  E Q VVVEK+G   ET+ DFT SL
Sbjct  1    MANAASGMAVRDECKLKFLELKAKRNYRFIIFKI--EQQEVVVEKLGRPDETYEDFTGSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFIAWSP+ +K+RSKMVYAS
Sbjct  59   PADECRYAVFDFDFITDENCQKSKIFFIAWSPDISKVRSKMVYAS  103



>ref|XP_002322471.2| hypothetical protein POPTR_0015s13080g [Populus trichocarpa]
 gb|EEF06598.2| hypothetical protein POPTR_0015s13080g [Populus trichocarpa]
Length=137

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 94/105 (90%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+FKI  E+Q VVVEK+G+ +ET+ +F  SL
Sbjct  1    MANAASGMAVDDECKLKFLELKAKRNYRFIIFKI--ESQQVVVEKLGSPEETYEEFAASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFDYDF T+ENCQ+SKIFFIAWSP+T+++RSKMVYAS
Sbjct  59   PADECRYAVFDYDFITNENCQKSKIFFIAWSPDTSRVRSKMVYAS  103



>gb|AEP25120.1| actin depolymerising factor [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AIT97057.1| actin-depolymerizing factor 11 [Triticum aestivum]
Length=139

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V DECKLKF ELKAKR FR+IVFKI+E+ Q VVV+++G + E++ DFT  L
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKTESYDDFTACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+W+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYAS  105



>gb|AGW22223.1| actin-depolymerizing factor 4 [Triticum aestivum]
Length=139

 Score =   164 bits (416),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V DECKLKF ELKAKR FR+IVFKI+E+ Q VVV+++G + E++ DFT  L
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKTESYDDFTACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+W+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYAS  105



>emb|CDY38025.1| BnaCnng08860D [Brassica napus]
Length=176

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  339  SSPSQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQET  160
            S   Q   MANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V++E +GN ++T
Sbjct  29   SDHQQAENMANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIEMVGNPEKT  88

Query  159  HVDFTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            + DFTK +P +ECRYAV+D+DFTT ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  89   YDDFTKCMPENECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYAS  141



>ref|XP_007143417.1| hypothetical protein PHAVU_007G070500g [Phaseolus vulgaris]
 gb|ESW15411.1| hypothetical protein PHAVU_007G070500g [Phaseolus vulgaris]
Length=138

 Score =   164 bits (415),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V+DECKLKF+ELKAKR FR+IVFKI  E   VVVEK+G+  ET+ DFT SL
Sbjct  1    MANAASGMAVLDECKLKFLELKAKRNFRFIVFKI--ENYEVVVEKLGSPTETYEDFTASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DFTT+ENCQ+SKIFFIAW+P+T+K+R KMVYAS
Sbjct  59   PANECRYAVFDFDFTTNENCQKSKIFFIAWAPDTSKVREKMVYAS  103



>ref|XP_009386059.1| PREDICTED: actin-depolymerizing factor [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   164 bits (415),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR FR+IVFKIDE+ Q V+VEK+G   E++ DFT   
Sbjct  1    MANSASGMAVNDECKLKFLELKAKRNFRFIVFKIDEKIQQVMVEKLGRPDESYDDFTACF  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFD+DF TDENCQ+SKIFFIAWSP+++K+RSKM+YAS
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFIAWSPDSSKVRSKMLYAS  105



>emb|CDY51146.1| BnaA09g51810D [Brassica napus]
Length=352

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = -3

Query  330  SQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVD  151
            S HH+ ANSASG+ V DECK+KFMELKAKR +RYIVFKIDE+ Q V +EK+GN QET+ D
Sbjct  67   SAHHK-ANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEKLGNPQETYDD  125

Query  150  FTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            FT S+P +ECRYA++D+DFTT++NCQ+SKI+FIAWSP+T+++RSKM+YAS
Sbjct  126  FTNSIPENECRYAIYDFDFTTEDNCQKSKIYFIAWSPDTSRVRSKMLYAS  175



>ref|XP_006285474.1| hypothetical protein CARUB_v10006893mg [Capsella rubella]
 gb|EOA18372.1| hypothetical protein CARUB_v10006893mg [Capsella rubella]
Length=137

 Score =   164 bits (414),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELK+KR +R+IVF+ID   Q VVVEK+GN +ET+ DFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIVFRID--GQQVVVEKLGNPEETYDDFTASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DFTT ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PADECRYAVFDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_007040194.1| Actin depolymerizing factor 8 [Theobroma cacao]
 gb|EOY24695.1| Actin depolymerizing factor 8 [Theobroma cacao]
Length=139

 Score =   164 bits (414),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECK KF+ELKAKR +R+IVFKI+E+ Q VVVEK+G   +++ D + SL
Sbjct  1    MANSASGMAVNDECKRKFLELKAKRSYRFIVFKIEEKIQQVVVEKLGGPSDSYDDLSASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DFTTDENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PANECRYAVYDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|NP_001151716.1| LOC100285352 [Zea mays]
 gb|ACG44105.1| actin-depolymerizing factor [Zea mays]
 tpg|DAA36509.1| TPA: actin-depolymerizing factor [Zea mays]
Length=139

 Score =   164 bits (414),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF ELK+KR FR+I FKI+E+TQ VVV+++G   +T+ DFT S+
Sbjct  1    MANSASGMAVSDECKLKFQELKSKRSFRFITFKINEQTQQVVVDRLGQPGDTYDDFTGSM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P  ECRYAVFD+DFTTDENCQ+SKI FI+WSP+T+++RSKM+YAS
Sbjct  61   PESECRYAVFDFDFTTDENCQKSKILFISWSPDTSRVRSKMLYAS  105



>ref|XP_010544379.1| PREDICTED: actin-depolymerizing factor 8 isoform X1 [Tarenaya 
hassleriana]
Length=177

 Score =   165 bits (417),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q VVV+K+GN +ET+ DFT S+P
Sbjct  40   ANSASGMHVNDECKLKFLELKAKRSYRFIVFKIDEKVQKVVVDKIGNPEETYDDFTSSMP  99

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             +ECRYAV+D+DFTT +NCQ+SKIFFIAWSP+T+K+RSKM+YAS
Sbjct  100  ENECRYAVYDFDFTTKDNCQKSKIFFIAWSPDTSKVRSKMLYAS  143



>ref|XP_009131962.1| PREDICTED: actin-depolymerizing factor 3 [Brassica rapa]
Length=139

 Score =   164 bits (414),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IV+KI+E+ + VVVEK+G   ++H DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYA+FD+DF T ENCQ+SKIFFIAWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYAS  105



>ref|XP_002298043.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011029242.1| PREDICTED: actin-depolymerizing factor isoform X1 [Populus euphratica]
 gb|EEE82848.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=141

 Score =   164 bits (414),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKL+FMELKAKR  R+IVFKI+E+ Q VVVE +G  Q+++ DFT SLP
Sbjct  4    ANSASGMAVDDECKLRFMELKAKRSHRFIVFKIEEKIQQVVVETLGEPQQSYDDFTASLP  63

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            A+ECRYAV+D+DFTTDEN Q+SKIFF+AWSP+T+KIRSKM+YAS
Sbjct  64   ANECRYAVYDFDFTTDENVQKSKIFFVAWSPDTSKIRSKMLYAS  107



>gb|AEW90955.1| actin depolymerizing factor 4-1 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=139

 Score =   164 bits (414),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V D+CKLKF ELKAKR FR+IVFKI+E+ Q VVV+++G + E++ DFT  L
Sbjct  1    MSNSASGMAVCDQCKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKNESYDDFTACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+W+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYAS  105



>ref|XP_006418454.1| hypothetical protein EUTSA_v10009057mg [Eutrema salsugineum]
 gb|ESQ36807.1| hypothetical protein EUTSA_v10009057mg [Eutrema salsugineum]
Length=140

 Score =   164 bits (414),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V+++ +GN +ET+ DFTK +
Sbjct  1    MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDMVGNPEETYDDFTKCM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DFTT ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PENECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_009599636.1| PREDICTED: actin-depolymerizing factor 7 [Nicotiana tomentosiformis]
Length=137

 Score =   163 bits (413),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V+DECKLKF+ELK KR +R+IVFKI  E Q VVVEK+GN +E + DFT SL
Sbjct  1    MANAASGMAVLDECKLKFLELKTKRNYRFIVFKI--EGQQVVVEKLGNPEENYDDFTNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD DF T ENCQ+SKIFFIAWSP+T+K+R KMVYAS
Sbjct  59   PADECRYAVFDLDFITTENCQKSKIFFIAWSPDTSKVRMKMVYAS  103



>gb|ADI78873.1| actin-depolymerizing factor [Hevea brasiliensis]
Length=139

 Score =   163 bits (413),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F+ELKAKR +RYIVFKI+E+ + V+VEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRYIVFKIEEKAKQVIVEKLGEPTQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>gb|KHG23104.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   163 bits (413),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +RYIVFKI+E+ + VVVEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVFKIEEKQKQVVVEKLGEPSQSYDDFTSSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>dbj|BAK04382.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=139

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V DECKLKF ELKAKR FR+IVFKI+E+ Q VVV+++G + E++ DF   L
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINEKVQQVVVDRVGEKNESYDDFAACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+W+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYAS  105



>ref|XP_010253266.1| PREDICTED: actin-depolymerizing factor 2 [Nelumbo nucifera]
Length=139

 Score =   163 bits (413),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   E++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTESYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_010922979.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=256

 Score =   167 bits (422),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -3

Query  363  SSNKLSQGSSPSQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVE  184
            SS+  S   +P    EMAN+ASG+ V D+CKLKF+ELKAKR  RYI+FKIDE+ + V+VE
Sbjct  102  SSSNPSAARAPIAFAEMANAASGMAVNDDCKLKFLELKAKRTHRYIIFKIDEKLKQVIVE  161

Query  183  KMGNQQETHVDFTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYA  4
            K+G    ++ DFT +LPADECRYA++D+DF T+ENCQ+SKIFFIAWSP+T+++RSKM+YA
Sbjct  162  KVGEPTLSYEDFTAALPADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYA  221

Query  3    S  1
            S
Sbjct  222  S  222



>sp|P30175.1|ADF_LILLO RecName: Full=Actin-depolymerizing factor; Short=ADF [Lilium 
longiflorum]
 emb|CAA78483.1| actin depolymerizing factor [Lilium longiflorum]
Length=139

 Score =   163 bits (412),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS+SG+ V DECKLKFMELKAKR FR+IVFKI+E+ Q V VE++G   E++ DFT+ L
Sbjct  1    MANSSSGMAVDDECKLKFMELKAKRNFRFIVFKIEEKVQQVTVERLGQPNESYDDFTECL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFD+DF TDENCQ+SKIFFI+WSP+T+++RSKM+YAS
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYAS  105



>ref|XP_006436042.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 ref|XP_006486066.1| PREDICTED: actin-depolymerizing factor 2-like [Citrus sinensis]
 gb|ESR49282.1| hypothetical protein CICLE_v10033029mg [Citrus clementina]
 gb|KDO67706.1| hypothetical protein CISIN_1g032498mg [Citrus sinensis]
Length=139

 Score =   163 bits (412),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++ +FT SL
Sbjct  1    MANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSDSYENFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF TDENCQ+SKI FIAWSP+T+K+RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTDENCQKSKIIFIAWSPDTSKVRSKMIYAS  105



>gb|KDP25456.1| hypothetical protein JCGZ_20612 [Jatropha curcas]
Length=139

 Score =   162 bits (411),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKF ELKAKR +R+IVFKI+E  Q V VEK+G  Q+++ DFT SL
Sbjct  1    MANSASGMAVHDDCKLKFQELKAKRSYRFIVFKIEEGIQQVTVEKLGKPQQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DFTT+EN Q+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PANECRYAVFDFDFTTNENVQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_007038697.1| Actin depolymerizing factor 7 [Theobroma cacao]
 gb|EOY23198.1| Actin depolymerizing factor 7 [Theobroma cacao]
Length=137

 Score =   162 bits (411),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVFKI  + Q VVV+K+G+ QET+ DF  SL
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNYRFIVFKI--QDQQVVVDKVGSPQETYDDFQASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF T ENCQ+SKIFFIAWSP+T+K+RSKMVYAS
Sbjct  59   PADECRYAVFDFDFITSENCQKSKIFFIAWSPDTSKVRSKMVYAS  103



>ref|XP_006413292.1| hypothetical protein EUTSA_v10026532mg [Eutrema salsugineum]
 gb|ESQ54745.1| hypothetical protein EUTSA_v10026532mg [Eutrema salsugineum]
Length=137

 Score =   162 bits (411),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECK KF+ELK+KR +R+I+F+ID   Q VVVEK+GN QET+ DFT SL
Sbjct  1    MANAASGMAVEDECKRKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPQETYDDFTASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DFTT ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PADECRYAVFDFDFTTTENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_010260094.1| PREDICTED: actin-depolymerizing factor 2-like [Nelumbo nucifera]
Length=139

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_007206123.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
 ref|XP_008223136.1| PREDICTED: actin-depolymerizing factor 2 [Prunus mume]
 gb|EMJ07322.1| hypothetical protein PRUPE_ppa013110mg [Prunus persica]
Length=139

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG  V D+CKLKF+ELKAKR +R+IVFKI+EE + V+VEK+G   E++ +FT SL
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIEEEQKQVIVEKLGEPAESYENFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_002867603.1| actin binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43862.1| actin binding protein [Arabidopsis lyrata subsp. lyrata]
Length=137

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELK+KR +R+I+F+ID   Q VVVEK+GN +ET+ DFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPEETYGDFTASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DF TDENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PANECRYAVFDFDFITDENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>gb|KGN57376.1| hypothetical protein Csa_3G182120 [Cucumis sativus]
Length=137

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELK KR +R+I+FKI  E Q VVVEK+G+ +ET+ DF+ ++
Sbjct  1    MANAASGMAVRDECKLKFLELKTKRNYRFIIFKI--ENQEVVVEKLGSPEETYDDFSAAI  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DFTTDENCQ+SKIFFIAWSP+T+K+R+KMVYAS
Sbjct  59   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRNKMVYAS  103



>ref|XP_006647644.1| PREDICTED: actin-depolymerizing factor 1-like [Oryza brachyantha]
Length=139

 Score =   162 bits (411),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V DECKLKF +LKAKR FR+IVFKI+E+ Q VVV+++G   E++ DF+  L
Sbjct  1    MSNSASGMAVCDECKLKFQDLKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFSACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+WSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYAS  105



>ref|XP_006843593.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
 gb|ERN05268.1| hypothetical protein AMTR_s00007p00126220 [Amborella trichopoda]
Length=139

 Score =   162 bits (410),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D CKL+F+ELK KR  R+IVFKIDE+ Q V+VEK+G   +T+ DF  SL
Sbjct  1    MANSASGMAVHDNCKLRFLELKTKRSHRFIVFKIDEKIQQVMVEKLGQPNDTYDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAVFD+DF TDENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PPDECRYAVFDFDFVTDENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_011080987.1| PREDICTED: actin-depolymerizing factor-like [Sesamum indicum]
Length=139

 Score =   162 bits (410),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKL+F++LKAKR +R+I+FKI+E+ Q VVVEK+G  +E + DF+ SL
Sbjct  1    MANSASGMSVHDECKLRFLDLKAKRNYRFIIFKIEEKIQQVVVEKLGQPEEGYEDFSSSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DF TDENCQ+SKIFFIAWSP+T+++RSKMVYAS
Sbjct  61   PDNECRYAVYDFDFITDENCQKSKIFFIAWSPDTSRVRSKMVYAS  105



>ref|XP_009120511.1| PREDICTED: actin-depolymerizing factor 3-like [Brassica rapa]
Length=139

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR FR+IV+KI+E+ + VVVEK+G   ++H DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF T E+CQ+SKIFF+AWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYAS  105



>ref|XP_004496563.1| PREDICTED: actin-depolymerizing factor 7-like [Cicer arietinum]
Length=137

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+IVFKI  E Q VVVEK+G  +ET+ DF  SL
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRNYRFIVFKI--ENQEVVVEKLGGPEETYEDFNASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P+DECRYAVFD+DFTT+ENCQ+SKIFFIAWSP+ +K+R KMVYAS
Sbjct  59   PSDECRYAVFDFDFTTNENCQKSKIFFIAWSPDISKVRHKMVYAS  103



>ref|XP_007144457.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
 gb|AGV54234.1| actin-depolymerizing factor [Phaseolus vulgaris]
 gb|ESW16451.1| hypothetical protein PHAVU_007G157800g [Phaseolus vulgaris]
Length=139

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +RYIV+KI+E+ + VVVEK+G     + DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRYIVYKIEEKQKQVVVEKLGEPANGYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+SKIFFIAWSP++A++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSKIFFIAWSPDSARVRSKMIYAS  105



>ref|XP_008244913.1| PREDICTED: actin-depolymerizing factor 10 [Prunus mume]
Length=139

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKF+ELKAKR  R+IVFKI+E+ Q V+VEK+G   E++ DF  S+
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFASSM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTT+ENCQ+SKIFFIAW+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYAS  105



>ref|XP_011084418.1| PREDICTED: actin-depolymerizing factor 7 [Sesamum indicum]
Length=137

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+I+FKI  E Q VVVEK+G+  E++ DFT SL
Sbjct  1    MANSASGMAVDDECKLKFLELKAKRNYRFIIFKI--EGQQVVVEKLGSPDESYEDFTASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P+DECRYAVFD+DFTT+ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PSDECRYAVFDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_002303579.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011022717.1| PREDICTED: actin-depolymerizing factor 1-like [Populus euphratica]
 gb|EEE78558.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D CKL+F+ELKAKR  R+IVFKI+E+TQ VVVE +G  Q+++ DFT SL
Sbjct  1    MANSASGMAVNDGCKLRFLELKAKRSHRFIVFKIEEKTQQVVVETLGEPQQSYDDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTTDEN Q+SKIFF+AWSP+ +KIRSKM+YAS
Sbjct  61   PIDECRYAVYDFDFTTDENVQKSKIFFVAWSPDASKIRSKMLYAS  105



>ref|XP_007218574.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
 gb|EMJ19773.1| hypothetical protein PRUPE_ppa013108mg [Prunus persica]
Length=139

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKF+ELKAKR  R+IVFKI+E+ Q V+VEK+G   E++ DF  S+
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNHRFIVFKIEEKIQQVIVEKVGGPDESYDDFAASM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTT+ENCQ+SKIFFIAW+P+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFTTNENCQKSKIFFIAWAPDTSRVRSKMLYAS  105



>ref|XP_007027090.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
 gb|EOY07592.1| Actin depolymerizing factor 4 isoform 2, partial [Theobroma cacao]
Length=173

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  330  SQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVD  151
            +   EMAN+ASG+ V DECKLKF+ELKAKR +R+IVFKI+E+ + V+VEK+G   +++ D
Sbjct  30   TNRKEMANAASGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAQSYED  89

Query  150  FTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            F KSLPADECRYAV+D+DF T EN Q+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  90   FAKSLPADECRYAVYDFDFLTPENVQKSRIFFIAWSPDTSRVRSKMIYAS  139



>ref|XP_010672167.1| PREDICTED: actin-depolymerizing factor 10 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKFMELKAKR  R+IVFKI+E+ Q V+VEK+GN  ET+ DF  +L
Sbjct  1    MANAASGMAVNDECKLKFMELKAKRNHRFIVFKIEEKQQQVMVEKIGNPDETYEDFANAL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+DYDFTT +NCQ+SKIFF AWSP+ +++RSKM+YAS
Sbjct  61   PANECRYAVYDYDFTTKDNCQKSKIFFFAWSPDASRVRSKMLYAS  105



>ref|XP_006400899.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
 gb|ESQ42352.1| hypothetical protein EUTSA_v10014975mg [Eutrema salsugineum]
Length=139

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IV+KI+E+ + V+VEK+G   ++H DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPGQSHDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYA+FD+DF T ENCQ+SKIFF+AWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAIFDFDFVTAENCQKSKIFFVAWSPDTARVRSKMIYAS  105



>gb|KDP22276.1| hypothetical protein JCGZ_26107 [Jatropha curcas]
Length=137

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKF+ELKAKR +R+I FKI  E Q V+++K+G  Q+T+ DFT SL
Sbjct  1    MANSASGMAVHDDCKLKFLELKAKRNYRFITFKI--EDQQVIIDKLGTPQQTYDDFTASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DFTTDENCQ+SKIFFIAWSP+T+++R KMVYAS
Sbjct  59   PANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSRVRMKMVYAS  103



>ref|XP_009593022.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana tomentosiformis]
 ref|XP_009801697.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana sylvestris]
Length=139

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + V+VEK+G   E++ DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPAESYEDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRY VFD+DF T+E CQ+SKIFFIAWSP+TAK+RSKM+YAS
Sbjct  61   PADECRYTVFDFDFVTEEGCQKSKIFFIAWSPDTAKVRSKMIYAS  105



>ref|NP_194289.2| actin depolymerizing factor 7 [Arabidopsis thaliana]
 sp|Q67ZM4.1|ADF7_ARATH RecName: Full=Actin-depolymerizing factor 7; Short=ADF-7; Short=AtADF7 
[Arabidopsis thaliana]
 dbj|BAD43856.1| actin depolymerizing factor - like protein [Arabidopsis thaliana]
 gb|AEE85080.1| actin depolymerizing factor 7 [Arabidopsis thaliana]
Length=137

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELK+KR +R+I+F+ID   Q VVVEK+GN  ET+ DFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGNPDETYDDFTASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DF TDENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PANECRYAVFDFDFITDENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_002284292.1| PREDICTED: actin-depolymerizing factor 2 [Vitis vinifera]
Length=139

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IV+KI+E+ + VVVEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_007016496.1| Actin depolymerizing factor 4 [Theobroma cacao]
 gb|EOY34115.1| Actin depolymerizing factor 4 [Theobroma cacao]
Length=139

 Score =   161 bits (408),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPTQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>gb|ABD66504.1| actin depolymerizing factor 8 [Gossypium hirsutum]
 gb|AAY88048.2| actin depolymerizing factor [Gossypium hirsutum]
 gb|KHG23444.1| Actin-depolymerizing factor 2 [Gossypium arboreum]
Length=139

 Score =   161 bits (408),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++  FT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTDSYEAFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF TDENCQ+S+IFFIAWSP+T+K+RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYAS  105



>ref|XP_008438059.1| PREDICTED: actin-depolymerizing factor 7-like [Cucumis melo]
Length=139

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS+SG+ V DECKLKF++LKAKR +R+IVFKI+E+ Q V VEK+G   ET+ DFT S+
Sbjct  1    MANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVEKVGGPDETYDDFTASI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DFTT+ENCQ+SKI+FIAWSP++++IRSKM+YAS
Sbjct  61   PANECRYAVYDFDFTTEENCQKSKIYFIAWSPDSSRIRSKMLYAS  105



>gb|EYU18949.1| hypothetical protein MIMGU_mgv1a015984mg [Erythranthe guttata]
Length=139

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKFMELKAKR  R+IV+KI+E+ + V+VEK+G   ET+ DFT SL
Sbjct  1    MANSASGMAVHDDCKLKFMELKAKRTHRFIVYKIEEKQKQVMVEKLGEPIETYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF T+E+ Q+SKIFFIAWSP+TAK+RSKM+YAS
Sbjct  61   PADECRYAVFDFDFVTEESVQKSKIFFIAWSPDTAKVRSKMIYAS  105



>ref|XP_010433613.1| PREDICTED: actin-depolymerizing factor 7-like [Camelina sativa]
 ref|XP_010438859.1| PREDICTED: actin-depolymerizing factor 7-like [Camelina sativa]
Length=137

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELK+KR +R+IVF+ID   Q VVVEK+G  +ET+ DFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIVFRID--GQQVVVEKLGKPEETYDDFTASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DFTT ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PADECRYAVFDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>gb|KHG06644.1| Actin-depolymerizing factor 1 [Gossypium arboreum]
Length=139

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPSQSYDDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>gb|ADV04049.1| actin depolymerizing factor 4 [Hevea brasiliensis]
Length=139

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + V+VEK+G    ++ DFT SL
Sbjct  1    MANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTNSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+D+ TDENCQ+S+I FIAWSP+T+K+RSKM+YAS
Sbjct  61   PADECRYAVYDFDYVTDENCQKSRIVFIAWSPDTSKVRSKMIYAS  105



>emb|CDY07204.1| BnaCnng02190D [Brassica napus]
Length=271

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECK+KFMELKAKR +RYIVFKIDE+ Q V +EK+GN +ET+ DF  S+P
Sbjct  9    ANSASGMHVNDECKVKFMELKAKRTYRYIVFKIDEKAQEVQIEKLGNPEETYDDFANSIP  68

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             +ECRYA++D+DFTT++NCQ+SKI+FIAWSP+T+++RSKM+YAS
Sbjct  69   ENECRYAIYDFDFTTEDNCQKSKIYFIAWSPDTSRVRSKMLYAS  112



>ref|XP_006424770.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488280.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Citrus 
sinensis]
 gb|ESR38010.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 gb|KDO72932.1| hypothetical protein CISIN_1g032504mg [Citrus sinensis]
Length=139

 Score =   161 bits (408),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + V+VEK+G   +T+ DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+DYDF T ENCQ+S+IFFIAWSP+TA++RSKM+YAS
Sbjct  61   PAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYAS  105



>ref|XP_010047513.1| PREDICTED: actin-depolymerizing factor 2 [Eucalyptus grandis]
Length=139

 Score =   161 bits (407),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>gb|KHN05922.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=139

 Score =   161 bits (407),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +RYIVFKI+E+++ V+VEK+G+    + +F  SL
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRYIVFKIEEKSKQVIVEKLGDPANGYDEFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_010535543.1| PREDICTED: actin-depolymerizing factor 4 [Tarenaya hassleriana]
Length=139

 Score =   160 bits (406),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F+ELKAKR +R+IV+KI+E+ + V+VEK+G   +T+ DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVYKIEEQQKQVIVEKVGEPAQTYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYA+FD+DF T ENCQ+SKIFFIAWSP+TA++RSKM+YAS
Sbjct  61   PANECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYAS  105



>gb|EPS69954.1| hypothetical protein M569_04811 [Genlisea aurea]
Length=184

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKL F+ELKA+R +RY+VFKID+  Q V VEK G   E + DFT SLP
Sbjct  47   ANSASGIAVSDECKLTFLELKARRTYRYVVFKIDDNVQQVTVEKAGEHSENYDDFTNSLP  106

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             ++CRYAV+DYDFTTDENC++SKIFFIAWSP+ AK+R+KM+YAS
Sbjct  107  DNDCRYAVYDYDFTTDENCRKSKIFFIAWSPDVAKVRTKMLYAS  150



>gb|KFK27528.1| hypothetical protein AALP_AA8G395200 [Arabis alpina]
Length=139

 Score =   160 bits (406),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IV+KI+E+ + VVVEK+G   ++H DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKVGEPGQSHDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYA+FD+DF T ENCQ+SKIFFIAWSP+TA++RSKM+YAS
Sbjct  61   PANECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYAS  105



>emb|CDX71068.1| BnaC03g11520D [Brassica napus]
Length=164

 Score =   161 bits (408),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            AN+ASG+ V D+CKLKF+ELKAKR +R+IV+KI+E+ + VVVEK+G   ++H DF  SLP
Sbjct  27   ANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLP  86

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            ADECRYA+FD+DF T ENCQ+SKIFFIAWSP+TA++RSKM+YAS
Sbjct  87   ADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYAS  130



>ref|XP_010448409.1| PREDICTED: actin-depolymerizing factor 7 [Camelina sativa]
Length=137

 Score =   160 bits (406),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELK+KR +R+IVF+ID   Q VVVEK+G   ET+ DFT SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIVFRID--GQQVVVEKLGKPDETYDDFTASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DFTT ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PADECRYAVFDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>gb|KHN26651.1| Actin-depolymerizing factor 7, partial [Glycine soja]
Length=136

 Score =   160 bits (405),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 93/104 (89%), Gaps = 2/104 (2%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            AN+ASG+ V+DECKLKF+ELKAKR +R+IVFKI  E   VVVEK+G+ +ET+ DF+ SLP
Sbjct  1    ANAASGMAVIDECKLKFLELKAKRNYRFIVFKI--ENYEVVVEKLGSPEETYDDFSASLP  58

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            A+ECRYAVFD+DFTT+ENCQ+SKIFFIAW+P+T+K+R KMVYAS
Sbjct  59   ANECRYAVFDFDFTTNENCQKSKIFFIAWAPDTSKVREKMVYAS  102



>emb|CDX88730.1| BnaA03g09190D [Brassica napus]
Length=154

 Score =   161 bits (407),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            AN+ASG+ V D+CKLKF+ELKAKR +R+IV+KI+E+ + VVVEK+G   ++H DF  SLP
Sbjct  17   ANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASLP  76

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            ADECRYA+FD+DF T ENCQ+SKIFFIAWSP+TA++RSKM+YAS
Sbjct  77   ADECRYAIFDFDFVTAENCQKSKIFFIAWSPDTARVRSKMIYAS  120



>emb|CDX80216.1| BnaC09g35260D [Brassica napus]
Length=252

 Score =   164 bits (415),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR FR+IV+KI+E+ + VVVEK+G   ++H DF  SL
Sbjct  114  MANAASGMAVHDDCKLKFLELKAKRTFRFIVYKIEEQQKQVVVEKLGEPGQSHDDFAASL  173

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF T E+CQ+SKIFF+AWSP+TA++RSKM+YAS
Sbjct  174  PADECRYAVFDFDFVTAESCQKSKIFFVAWSPDTARVRSKMIYAS  218



>gb|EMS51874.1| Actin-depolymerizing factor 6 [Triticum urartu]
Length=305

 Score =   166 bits (419),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  318  EMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKS  139
            E ANSASG+ V DECKLKF ELKAKR FR+I FKI+E+TQ VVV+++G   ET+ DFT +
Sbjct  166  EEANSASGMAVSDECKLKFQELKAKRSFRFITFKINEQTQQVVVDRVGQPGETYADFTAT  225

Query  138  LPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            +PADECRYAVFD+DF TDENCQ+SKIFFI+WSP+T+++RSKM+YAS
Sbjct  226  IPADECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYAS  271



>ref|XP_010529845.1| PREDICTED: actin-depolymerizing factor 2-like [Tarenaya hassleriana]
Length=139

 Score =   160 bits (406),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ SG+ V DECKLKF+ELKAKR +R+IVFKI+E+ + V+VEK+G   +++ DFT SL
Sbjct  1    MANAVSGMAVHDECKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPSQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>gb|ABX79380.1| actin-depolymerizing factor [Gossypium barbadense]
Length=139

 Score =   160 bits (406),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++  FT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPIDSYEAFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF TDENCQ+S+IFFIAWSP+T+K+RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTDENCQKSRIFFIAWSPDTSKVRSKMIYAS  105



>ref|XP_008463478.1| PREDICTED: actin-depolymerizing factor 2 isoform X1 [Cucumis 
melo]
 ref|XP_008463479.1| PREDICTED: actin-depolymerizing factor 2 isoform X2 [Cucumis 
melo]
Length=139

 Score =   160 bits (406),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F++LKAKR +R+IVFKI+E+ + VVVEK+G   E++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVVVEKLGEPSESYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+I FIAWSP+T+K+RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIIFIAWSPDTSKVRSKMIYAS  105



>ref|XP_004142738.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus]
 ref|XP_004156722.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis sativus]
 gb|KGN51280.1| hypothetical protein Csa_5G512870 [Cucumis sativus]
Length=139

 Score =   160 bits (406),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F++LKAKR +R+IVFKI+E+ + VVVEK+G   E++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLDLKAKRTYRFIVFKIEEKQKQVVVEKLGKPSESYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+I FIAWSP+T+K+RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIIFIAWSPDTSKVRSKMIYAS  105



>ref|XP_010555668.1| PREDICTED: actin-depolymerizing factor 7 [Tarenaya hassleriana]
Length=137

 Score =   160 bits (405),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 94/105 (90%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+I+F+ID   Q VVVEK+G+ +ET+ DF +SL
Sbjct  1    MANSASGMAVDDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEETYDDFAESL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DFTT+ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PANECRYAVYDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_009118832.1| PREDICTED: actin-depolymerizing factor 10 isoform X2 [Brassica 
rapa]
Length=140

 Score =   160 bits (405),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V++E +GN ++T+ DFTK +
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIEMVGNPEKTYDDFTKCM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DFT  ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PENECRYAVYDFDFTPPENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_010908104.1| PREDICTED: zinc finger CCHC domain-containing protein 9-like 
[Elaeis guineensis]
Length=355

 Score =   167 bits (422),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            +ANSASG+ V DECKLKF+ELKAKR FR+I+FKIDE+ Q V VEK+G   E++ DFT SL
Sbjct  217  LANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVTVEKLGQPDESYDDFTASL  276

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DF TDENCQ+SKIFFI+WSP+T+++RSKM+YAS
Sbjct  277  PANECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYAS  321



>ref|XP_009591841.1| PREDICTED: actin-depolymerizing factor 2-like [Nicotiana tomentosiformis]
Length=127

 Score =   160 bits (404),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR  R+I++KI+E+ + VVVEK+G   E++ DFT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIIYKIEEKQKQVVVEKLGEPTESYEDFTAGL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTT+EN Q+SKIFFIAWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFTTEENVQKSKIFFIAWSPDTARVRSKMIYAS  105



>gb|KGN56524.1| hypothetical protein Csa_3G122480 [Cucumis sativus]
Length=139

 Score =   160 bits (405),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANS+SG+ V DECKLKF++LKAKR +R+IVFKI+E+ Q V V+K+G   ET+ DFT S+
Sbjct  1    MANSSSGMAVHDECKLKFLDLKAKRKYRFIVFKIEEKMQQVTVDKVGGPDETYDDFTASI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+DY+FTT+ENCQ+SKI+FIAWSP++++IRSKM+YAS
Sbjct  61   PANECRYAVYDYNFTTNENCQKSKIYFIAWSPDSSRIRSKMLYAS  105



>ref|XP_009119731.1| PREDICTED: actin-depolymerizing factor 10-like [Brassica rapa]
Length=140

 Score =   160 bits (405),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V ++ +GN +ET+  FTK +
Sbjct  1    MANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVTIDMVGNPEETYDSFTKCM  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DFTT ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PENECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_009397611.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   160 bits (405),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR FR+IVF+I+E+ Q V+VEK+G  ++++ D   SL
Sbjct  1    MANSASGMAVSDECKLKFLELKAKRSFRFIVFRIEEKIQRVMVEKLGQPEQSYDDLAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P D+CRYAVFD DF TDENCQ+SKIFFI+WSP+T+++R+KM+YAS
Sbjct  61   PPDDCRYAVFDLDFITDENCQKSKIFFISWSPDTSRVRNKMLYAS  105



>ref|XP_010669849.1| PREDICTED: actin-depolymerizing factor 4-like [Beta vulgaris 
subsp. vulgaris]
Length=139

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELK KR +R+I+FKI+E+ + V+VEK+G   E++ DFT S+
Sbjct  1    MANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFTASI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAW+P+TAK+RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWAPDTAKVRSKMIYAS  105



>ref|XP_009414703.1| PREDICTED: actin-depolymerizing factor-like [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR FR+IVFKI+E+ Q V VEK+G   +++ D T SL
Sbjct  1    MANSASGMAVHDECKLKFLELKAKRNFRFIVFKINEKLQQVTVEKLGQPDDSYDDLTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFD+DF TDENCQ+SKIFFI+W+P+ +K+RSKM+YAS
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFISWAPDASKVRSKMLYAS  105



>ref|XP_009793756.1| PREDICTED: actin-depolymerizing factor 7-like [Nicotiana sylvestris]
Length=137

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ SG+ V DECKLKF+ELKAKR +R+I+FKID   Q VVVEK+G+ +E++ DF+ SL
Sbjct  1    MANAVSGMAVQDECKLKFLELKAKRNYRFIIFKID--GQEVVVEKLGSPEESYEDFSNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD DF T+ENCQ+SKIFFIAWSPET+++R KMVYAS
Sbjct  59   PADECRYAVFDLDFITNENCQKSKIFFIAWSPETSRVRMKMVYAS  103



>ref|XP_009421345.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   159 bits (403),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKIDE+ + V+VE +G    T+ DFT SL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVETLGEPNLTYDDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYA++D+DF T+ENCQ+SKIFFIAWSP+TA++RSKM+YAS
Sbjct  61   PTNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTARVRSKMLYAS  105



>ref|XP_011030201.1| PREDICTED: uncharacterized protein LOC105129717 [Populus euphratica]
Length=296

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = -3

Query  318  EMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKS  139
            ++AN+ASG+ V DECKLKF+ELKAKR +R+I+FKI  E+Q VVVEK+G+ +ET+ +F  S
Sbjct  159  DIANAASGMAVDDECKLKFLELKAKRNYRFIIFKI--ESQQVVVEKLGSPEETYEEFAAS  216

Query  138  LPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            LPADECRYAVFDYDFTT+ENCQ+SKIFFIAWSP+T++IRSKMVYAS
Sbjct  217  LPADECRYAVFDYDFTTNENCQKSKIFFIAWSPDTSRIRSKMVYAS  262



>gb|KGN58886.1| hypothetical protein Csa_3G734880 [Cucumis sativus]
Length=139

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++ DF KSL
Sbjct  1    MANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P+DECRYA++D+DF T+ENCQ+S+IFFIAWSP+++++RSKM+YAS
Sbjct  61   PSDECRYAIYDFDFVTEENCQKSRIFFIAWSPDSSRVRSKMIYAS  105



>ref|XP_006846080.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
 gb|ERN07755.1| hypothetical protein AMTR_s00012p00089320 [Amborella trichopoda]
Length=139

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +RY+VFKI+E+ + V+VEK+G   + +  FT SL
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYVVFKIEEKLKQVIVEKLGEPTDGYEAFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DF T+ENCQ+SKIFFIAWSP+ AK+RSKM+YAS
Sbjct  61   PANECRYAVYDFDFVTEENCQKSKIFFIAWSPDIAKVRSKMLYAS  105



>ref|XP_010669850.1| PREDICTED: actin-depolymerizing factor 4 [Beta vulgaris subsp. 
vulgaris]
Length=139

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELK KR +R+I+FKI+E+ + V+VEK+G   E++ DF  S+
Sbjct  1    MANAASGMAVDDQCKLKFLELKTKRTYRFIIFKIEEKQKQVIVEKVGEPSESYEDFAASI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAWSP+TAK+RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTAKVRSKMIYAS  105



>ref|XP_006365713.1| PREDICTED: actin-depolymerizing factor 2-like [Solanum tuberosum]
Length=143

 Score =   159 bits (403),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I++KI+E+ + VVVEK+G   E++ DF   L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVVVEKLGEPTESYEDFAAGL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYAS  105



>ref|XP_006424771.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
 ref|XP_006488279.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Citrus 
sinensis]
 gb|ESR38011.1| hypothetical protein CICLE_v10029538mg [Citrus clementina]
Length=141

 Score =   159 bits (402),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            AN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + V+VEK+G   +T+ DF  SLP
Sbjct  4    ANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLP  63

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            A+ECRYAV+DYDF T ENCQ+S+IFFIAWSP+TA++RSKM+YAS
Sbjct  64   AEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYAS  107



>ref|XP_002533101.1| actin depolymerizing factor, putative [Ricinus communis]
 gb|EEF29273.1| actin depolymerizing factor, putative [Ricinus communis]
Length=139

 Score =   159 bits (402),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F+ELKAKR +R+IVFKI+E+ + V+VEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPAQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_009137539.1| PREDICTED: actin-depolymerizing factor-like [Brassica rapa]
Length=136

 Score =   159 bits (402),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 3/105 (3%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D CKLKF+ELK KR +R+I+F+ID   Q VVVEK+GN QET+ DFT SL
Sbjct  1    MANAASGMAVEDNCKLKFLELK-KRTYRFIIFRID--GQQVVVEKLGNPQETYDDFTNSL  57

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD DFTT+ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  58   PADECRYAVFDLDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYAS  102



>ref|XP_008442569.1| PREDICTED: actin-depolymerizing factor 2-like [Cucumis melo]
Length=139

 Score =   159 bits (402),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++ DF KSL
Sbjct  1    MANAASGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P+DECRYA++D+DF T+ENCQ+S+IFFIAWSP+++++RSKM+YAS
Sbjct  61   PSDECRYAIYDFDFVTEENCQKSRIFFIAWSPDSSRVRSKMIYAS  105



>gb|EYU26572.1| hypothetical protein MIMGU_mgv1a015955mg [Erythranthe guttata]
Length=139

 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F+ELKAKR  R+IVFKI+E+ + V+VEK+G   E++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRSHRFIVFKIEEKQKQVIVEKVGEPNESYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRY V+D+DF T ENCQ+SKIFFIAWSP+TA+IR+KM+YAS
Sbjct  61   PADECRYTVYDFDFVTAENCQKSKIFFIAWSPDTARIRNKMIYAS  105



>gb|AFK48761.1| unknown [Lotus japonicus]
Length=139

 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ SG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G     + DFT SL
Sbjct  1    MANAVSGMAVDDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKLGEPANGYDDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_010920670.1| PREDICTED: actin-depolymerizing factor 7 [Elaeis guineensis]
Length=139

 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I+FKI+E+ + ++VEK+G    ++ DFT SL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIEEKLKQIIVEKVGEPTLSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYA++D+DF T+ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_004236758.1| PREDICTED: actin-depolymerizing factor 2 [Solanum lycopersicum]
Length=143

 Score =   159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I++KI+E+ + V+VEK+G   E++ DF   L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKQVIVEKLGEPTESYEDFAAGL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFMTEENCQKSRIFFIAWSPDTARVRSKMIYAS  105



>ref|XP_008776502.1| PREDICTED: actin-depolymerizing factor 7 [Phoenix dactylifera]
Length=139

 Score =   159 bits (401),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I+FKI+E+ + V+VEK+G    ++ DFT +L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIEEKLKQVIVEKLGEPTLSYEDFTAAL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DF T+ENCQ+SKIFFIAWSP+T+K+RSKM+YAS
Sbjct  61   PANECRYAVYDFDFVTEENCQKSKIFFIAWSPDTSKVRSKMLYAS  105



>ref|XP_008788089.1| PREDICTED: actin-depolymerizing factor 7-like [Phoenix dactylifera]
Length=139

 Score =   159 bits (401),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR  R+I+FKIDE+ + V+VEK+G    ++ DFT +L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTHRFIIFKIDEKLKQVIVEKVGEPTMSYEDFTAAL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYA++D+DF T+ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>gb|KHG18554.1| Actin-depolymerizing factor [Gossypium arboreum]
Length=139

 Score =   159 bits (401),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECK++F+ELKAKR +R+IVFKI+E  Q V+VEK+G  +E + DF+  L
Sbjct  1    MANSASGMAVNDECKMRFLELKAKRSYRFIVFKIEENIQQVMVEKLGGPKEKYDDFSACL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFD+DFTTDEN Q+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PHNECRYAVFDFDFTTDENVQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_006401834.1| hypothetical protein EUTSA_v10014982mg [Eutrema salsugineum]
 gb|ESQ43287.1| hypothetical protein EUTSA_v10014982mg [Eutrema salsugineum]
Length=137

 Score =   158 bits (400),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+F+ID   Q VVVEK+G+ +E + DF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTT ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PADECRYAVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_010937681.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=139

 Score =   158 bits (400),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I+FKIDE+ + V+VEK+G    ++ DFT +L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKLKQVIVEKVGEPTLSYEDFTANL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYA++D+DF T+ENCQ+SKIFFIAWSP+++++RSKM+YAS
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDSSRVRSKMLYAS  105



>gb|KDP35600.1| hypothetical protein JCGZ_09038 [Jatropha curcas]
Length=139

 Score =   158 bits (400),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + V+VEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKVGEPNQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAWSP+ +++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDASRVRSKMIYAS  105



>ref|XP_009118831.1| PREDICTED: actin-depolymerizing factor 10 isoform X1 [Brassica 
rapa]
Length=145

 Score =   159 bits (401),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V++E +GN ++T+ DFTK +P
Sbjct  7    ANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIEMVGNPEKTYDDFTKCMP  66

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             +ECRYAV+D+DFT  ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  67   ENECRYAVYDFDFTPPENCQKSKIFFIAWSPDTSRVRSKMLYAS  110



>gb|ABD66503.1| actin depolymerizing factor 7 [Gossypium hirsutum]
Length=139

 Score =   158 bits (400),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECK KF+ELKAKR +R+IVFKI+E  Q +VVEK+G  ++++     SL
Sbjct  1    MANSASGMAVNDECKTKFLELKAKRNYRFIVFKIEENLQQIVVEKVGAPKDSYEKLCSSL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P+DECRYAV+D+DFTTDENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PSDECRYAVYDFDFTTDENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_011077447.1| PREDICTED: actin-depolymerizing factor 1-like [Sesamum indicum]
Length=173

 Score =   159 bits (403),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 103/130 (79%), Gaps = 4/130 (3%)
 Frame = -3

Query  390  IIYFAFSIISSNKLSQGSSPSQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKID  211
            ++ F + + S +  S   +P    EMAN+ASG+ V D+CKL+F+ELKAKR +R+I+FKI+
Sbjct  14   LLLFFYIVFSWSPRSLPEAP----EMANAASGMAVHDDCKLRFLELKAKRTYRFIIFKIE  69

Query  210  EETQVVVVEKMGNQQETHVDFTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETA  31
            E+ + VVVEK+G   +++ DFT SLP DECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+
Sbjct  70   EKQKQVVVEKVGEPTQSYDDFTASLPVDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTS  129

Query  30   KIRSKMVYAS  1
            +IR+KM+YAS
Sbjct  130  RIRNKMIYAS  139



>ref|XP_011016059.1| PREDICTED: actin-depolymerizing factor 2-like [Populus euphratica]
Length=139

 Score =   158 bits (400),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+IV+KI+EE + V+VEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRFIVYKIEEEQKQVIVEKLGEPAQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+EN Q+S+IFFIAW P+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWCPDTSRVRSKMIYAS  105



>ref|NP_001238519.1| uncharacterized protein LOC100499953 [Glycine max]
 gb|ACU14320.1| unknown [Glycine max]
Length=139

 Score =   158 bits (400),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + V+VEK+G     + DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_009389157.1| PREDICTED: actin-depolymerizing factor 1-like [Musa acuminata 
subsp. malaccensis]
Length=143

 Score =   158 bits (400),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKLKF+ELKAKR FR+IVFKI+E+ Q V VE++G   E++ D T SLP
Sbjct  6    ANSASGMAVSDECKLKFLELKAKRNFRFIVFKIEEKIQQVKVERLGQPGESYDDLTASLP  65

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             D+CRYAVFD+DF TDENCQ+SKIFFI+WSP+T+++R+KM+YAS
Sbjct  66   DDDCRYAVFDFDFITDENCQKSKIFFISWSPDTSRVRNKMLYAS  109



>ref|XP_006843087.1| hypothetical protein AMTR_s00140p00036970 [Amborella trichopoda]
 gb|ERN04762.1| hypothetical protein AMTR_s00140p00036970 [Amborella trichopoda]
Length=139

 Score =   158 bits (399),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+C+ +F+ELKAKR +R+IVFKI+E+ Q V VEK+G   +T+ DF  SL
Sbjct  1    MANSASGMAVNDDCQQRFLELKAKRSYRFIVFKIEEKIQQVTVEKIGMPNDTYDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFD+DF TDENCQ+SKIFFIAWSP+T+K+RSKM+YAS
Sbjct  61   PPNECRYAVFDFDFVTDENCQKSKIFFIAWSPDTSKVRSKMLYAS  105



>ref|XP_009600590.1| PREDICTED: actin-depolymerizing factor 2 [Nicotiana tomentosiformis]
 ref|XP_009798392.1| PREDICTED: actin-depolymerizing factor 2 [Nicotiana sylvestris]
Length=143

 Score =   158 bits (400),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR  R+I++KI+E+ + VVVEK+G   E++ DFT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIIYKIEEKQKQVVVEKLGEPTESYEDFTAGL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTT+EN Q+S+IFFIAWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFTTEENVQKSRIFFIAWSPDTARVRSKMIYAS  105



>ref|XP_002299887.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 ref|XP_006387927.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 ref|XP_011000286.1| PREDICTED: actin-depolymerizing factor 2 [Populus euphratica]
 gb|ABK92579.1| unknown [Populus trichocarpa]
 gb|ABK96321.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE84692.1| hypothetical protein POPTR_0001s24330g [Populus trichocarpa]
 gb|ERP46841.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   158 bits (399),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IV+KI+E+ + V+VEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPAQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+EN Q+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_009342975.1| PREDICTED: actin-depolymerizing factor 7 [Pyrus x bretschneideri]
 ref|XP_009349340.1| PREDICTED: actin-depolymerizing factor 7 [Pyrus x bretschneideri]
Length=138

 Score =   158 bits (399),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = -3

Query  315  MANS-ASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKS  139
            M+N+ ASG+ V DECKLKF+ELKAKR +R+IVFKID+  Q VVVEK+G+  ET+ DF  S
Sbjct  1    MSNAKASGMAVNDECKLKFVELKAKRNYRFIVFKIDK--QEVVVEKVGSPDETYEDFAAS  58

Query  138  LPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            LPADECRYAVFD+DFTT ENCQ+SKIFFIAWSPET+K+R KMVYAS
Sbjct  59   LPADECRYAVFDFDFTTAENCQKSKIFFIAWSPETSKVRMKMVYAS  104



>ref|XP_010909358.1| PREDICTED: actin-depolymerizing factor 7-like [Elaeis guineensis]
Length=139

 Score =   158 bits (399),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I++KI+E+ + V+VEK+G    ++ DFT +L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIYKIEEKLKQVIVEKVGEPTLSYEDFTAAL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYA++D+DF T+ENCQ+SKIFFIAWSP+T+K+RSKM+YAS
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSKVRSKMLYAS  105



>ref|XP_007218573.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica]
 gb|EMJ19772.1| hypothetical protein PRUPE_ppa013105mg [Prunus persica]
Length=139

 Score =   158 bits (399),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+IV+KI+E+ + V+VEK+G   +++ DF+ SL
Sbjct  1    MANAASGMAVHDECKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKVGEPADSYEDFSASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+D+ T+ENCQ+S+I FIAWSP+T+K+RSKM+YAS
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIIFIAWSPDTSKVRSKMIYAS  105



>gb|EYU36258.1| hypothetical protein MIMGU_mgv1a015971mg [Erythranthe guttata]
Length=139

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V D+CKLKFMELK KR  R+IVFKI+E+ + V+VEK+G   +T+ DFT +L
Sbjct  1    MANSASGMAVHDDCKLKFMELKTKRTHRFIVFKIEEKQKQVLVEKLGEPVQTYEDFTANL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF TDEN  +S+IFFIAWSP+TAK+RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTDENVPKSRIFFIAWSPDTAKVRSKMIYAS  105



>ref|XP_009132530.1| PREDICTED: actin-depolymerizing factor 12-like [Brassica rapa]
Length=137

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+F+ID   Q VVVEK+G+ +E + DF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DFTT+ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PANECRYAVYDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_007158489.1| hypothetical protein PHAVU_002G156700g [Phaseolus vulgaris]
 gb|ESW30483.1| hypothetical protein PHAVU_002G156700g [Phaseolus vulgaris]
Length=137

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D CKLKF ELKAKR +RYI FKI  E Q VVV+K+G   ET+ DF  SL
Sbjct  1    MANAASGMAVNDSCKLKFQELKAKRIYRYITFKI--EQQEVVVDKIGGSTETYDDFQASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DFTTDENCQ+SKIFF+AWSP+T+++R KMVYAS
Sbjct  59   PGDECRYAVYDFDFTTDENCQKSKIFFVAWSPDTSRVRMKMVYAS  103



>ref|XP_009767736.1| PREDICTED: actin-depolymerizing factor 7-like isoform X2 [Nicotiana 
sylvestris]
Length=137

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELK+KR +RYI+FKI  E+Q VVVEK+G  +E++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKSKRNYRYIIFKI--ESQQVVVEKLGGTEESYEDFTNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRY VFD+DF T ENCQ+SKIFFIAW P+T+K+R KMVYAS
Sbjct  59   PADECRYTVFDFDFITTENCQKSKIFFIAWFPDTSKVRMKMVYAS  103



>ref|XP_006445079.1| hypothetical protein CICLE_v10023747mg, partial [Citrus clementina]
 gb|ESR58319.1| hypothetical protein CICLE_v10023747mg, partial [Citrus clementina]
Length=138

 Score =   158 bits (399),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            AN+ SG+ V DECKLKF+ELKAKR  R+IVFKIDE+ Q V VE++G+ Q ++ DFTKSLP
Sbjct  1    ANAVSGMAVHDECKLKFLELKAKRNHRFIVFKIDEKIQQVTVERVGSPQASYEDFTKSLP  60

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            ADECR+AVFD+DFTT EN Q+SKIFFIAW+P+ +++RSKMVYAS
Sbjct  61   ADECRHAVFDFDFTTSENVQKSKIFFIAWAPDASRVRSKMVYAS  104



>ref|XP_006490391.1| PREDICTED: actin-depolymerizing factor 7-like [Citrus sinensis]
Length=137

 Score =   157 bits (398),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKFMELKAKR +R+I+FKID   Q VVVEK+G+  +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFMELKAKRNYRFIIFKID--NQQVVVEKLGSPGDSYDDFTTSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+SKIFFIAWSP+ +K+RSKMVYAS
Sbjct  59   PADECRYAVYDFDFITHENCQKSKIFFIAWSPDPSKVRSKMVYAS  103



>ref|XP_009388628.1| PREDICTED: actin-depolymerizing factor 7 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   157 bits (398),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKIDE+ + VVVEK+G     + DF+ SL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVVVEKVGEPTLGYDDFSASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAVFD+DF T+ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PTNECRYAVFDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>gb|AAL91666.1| pollen specific actin-depolymerizing factor 1 [Nicotiana tabacum]
Length=137

 Score =   157 bits (398),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ SG+ V DECKLKF+ELK KR +R+I+FKID   Q VVVEK+G+ +E++ DF  SL
Sbjct  1    MANAVSGMAVQDECKLKFLELKTKRNYRFIIFKID--GQEVVVEKLGSPEESYEDFANSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD DF T+ENCQ+SKIFFIAWSPET+++R KMVYAS
Sbjct  59   PADECRYAVFDLDFITNENCQKSKIFFIAWSPETSRVRMKMVYAS  103



>ref|XP_003538360.1| PREDICTED: actin-depolymerizing factor 7-like isoform X1 [Glycine 
max]
Length=137

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F ELKAKR +R+I FKI  E Q VVV+K+G   E++ DF  SL
Sbjct  1    MANAASGMAVHDDCKLRFQELKAKRVYRFITFKI--EQQQVVVDKIGESTESYDDFQASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTTDENCQ+SKIFFIAWSP+T+K+R KMVYAS
Sbjct  59   PADECRYAVYDFDFTTDENCQKSKIFFIAWSPDTSKVRMKMVYAS  103



>ref|XP_002273958.2| PREDICTED: actin-depolymerizing factor 1-like [Vitis vinifera]
 emb|CBI32606.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  318  EMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKS  139
            +MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++ DFT S
Sbjct  50   KMANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPAQSYEDFTAS  109

Query  138  LPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            LPADECRYAV+D+DF T+ENCQ+S+IFFIAW P+++++RSKM+YAS
Sbjct  110  LPADECRYAVYDFDFVTEENCQKSRIFFIAWCPDSSRVRSKMIYAS  155



>ref|XP_010553292.1| PREDICTED: actin-depolymerizing factor 1 [Tarenaya hassleriana]
Length=139

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELK+KR +R+IV+KI+E+ + V+VEK+G   +++ DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKSKRTYRFIVYKIEEKQKQVIVEKLGEPSQSYEDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTSENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_004495011.1| PREDICTED: actin-depolymerizing factor 2-like [Cicer arietinum]
Length=139

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +RYI++KI+E+ + VVV+K+G     + DFT +L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKLGEPANGYDDFTANL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAW P+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWCPDTSRVRSKMIYAS  105



>ref|XP_010055150.1| PREDICTED: actin-depolymerizing factor 8 [Eucalyptus grandis]
Length=132

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -3

Query  294  VGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLPADECRY  115
            + V DECKLKF+ELK KR +R+IVFKI+E+ Q V +EK+G+ +ET+ DF+ SLPADECRY
Sbjct  1    MAVDDECKLKFLELKTKRIYRFIVFKIEEKIQQVTIEKLGSPEETYDDFSSSLPADECRY  60

Query  114  AVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            AVFD+DFTTDENCQ+SKIFFIAW+PET+++RSKM+YAS
Sbjct  61   AVFDFDFTTDENCQKSKIFFIAWAPETSRVRSKMLYAS  98



>emb|CDY15154.1| BnaC05g00330D [Brassica napus]
Length=150

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKLKF+ELKAKR +R+IVFKIDE+ Q V ++ +GN +ET+  FTK +P
Sbjct  12   ANSASGMHVNDECKLKFLELKAKRNYRFIVFKIDEKAQQVTIDMVGNPEETYDSFTKCMP  71

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             +ECRYAV+D+DFTT ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  72   ENECRYAVYDFDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYAS  115



>ref|XP_007218580.1| hypothetical protein PRUPE_ppa013189mg [Prunus persica]
 gb|EMJ19779.1| hypothetical protein PRUPE_ppa013189mg [Prunus persica]
Length=135

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = -3

Query  306  SASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLPAD  127
            +ASG+ V DECKLKF+ELKAKR  RYI+FKI  E Q VVVEK+G ++ET+ DF  SLPAD
Sbjct  2    AASGMAVSDECKLKFLELKAKRNHRYIIFKI--EIQQVVVEKVGTKEETYDDFAASLPAD  59

Query  126  ECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            ECRYAVFD+DFTT ENCQ+SKIFFIAWSP+T+K+R KMVYAS
Sbjct  60   ECRYAVFDFDFTTVENCQKSKIFFIAWSPDTSKVRMKMVYAS  101



>ref|XP_004172071.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Cucumis 
sativus]
Length=138

 Score =   157 bits (397),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            AN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + VVVEK+G   +++ DF KSLP
Sbjct  1    ANAASGIAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAKSLP  60

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            +DECRYA++D+DF T+ENCQ+S+IFFIAWSP+++++RSKM+YAS
Sbjct  61   SDECRYAIYDFDFVTEENCQKSRIFFIAWSPDSSRVRSKMIYAS  104



>gb|KHN48988.1| Actin-depolymerizing factor 2 [Glycine soja]
Length=154

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -3

Query  318  EMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKS  139
            E+AN+ASG+ V D+CKLKF+ELKAKR +R+IVFKI+E+ + V+VEK+G     + DF  S
Sbjct  15   EVANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPANGYDDFAAS  74

Query  138  LPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            LPADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  75   LPADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  120



>emb|CDX92721.1| BnaC07g39790D [Brassica napus]
Length=179

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 91/109 (83%), Gaps = 3/109 (3%)
 Frame = -3

Query  327  QHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDF  148
            Q    AN+ASG+ V D CKLKF+ELK KR +R+I+F+ID   Q VVVEK+GN QET+ DF
Sbjct  40   QKQWFANAASGMAVEDNCKLKFLELK-KRTYRFIIFRID--GQQVVVEKLGNPQETYDDF  96

Query  147  TKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            T SLPADECRYAVFD DFTT+ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  97   TNSLPADECRYAVFDLDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYAS  145



>gb|ACR38016.1| unknown [Zea mays]
 gb|AFW63299.1| actin-depolymerizing factor [Zea mays]
Length=139

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V DECKLKF ELKAKR FR+IVFKI+E  Q VVV+++G   E++  FT   
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINENVQQVVVDRLGGPGESYDAFTACF  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DF TDENCQ+SKIFFI+W+P+T+++RSKM+YAS
Sbjct  61   PANECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYAS  105



>ref|XP_010038440.1| PREDICTED: uncharacterized protein LOC104426974 [Eucalyptus grandis]
Length=427

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 94/106 (89%), Gaps = 2/106 (2%)
 Frame = -3

Query  318  EMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKS  139
            +MAN+ASG+ V DECKL+FMELKAKR +R+I+FKI  E Q VVVEK+GN +ET+ DF+ S
Sbjct  290  KMANAASGMAVSDECKLRFMELKAKRIYRFIIFKI--ENQQVVVEKVGNPEETYEDFSAS  347

Query  138  LPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             PADECRY+VFD+DF T+ENCQ+SKIFFIAW+P+TAKIRSKMVYAS
Sbjct  348  FPADECRYSVFDFDFITNENCQKSKIFFIAWAPDTAKIRSKMVYAS  393



>ref|XP_002314195.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|EEE88150.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IV+KI+EE + V+VEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEEQKQVIVEKLGEPAQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+EN Q+S+IFFIAW P+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIFFIAWCPDTSRVRSKMIYAS  105



>ref|XP_008804936.1| PREDICTED: zinc finger CCHC domain-containing protein 9 isoform 
X3 [Phoenix dactylifera]
Length=351

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -3

Query  360  SNKLSQGSSPSQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEK  181
             NK S      Q    ANSASG+ V DECKLKF+ELKAKR FR+I+FKIDE+ Q V VEK
Sbjct  198  GNKNSASFVGQQRTGKANSASGMAVNDECKLKFLELKAKRNFRFIIFKIDEKIQQVSVEK  257

Query  180  MGNQQETHVDFTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            +G   E++ DFT SLPA+ECRYAVFD+DF TDENCQ+SKI FI+WSP+T+++RSKM+YAS
Sbjct  258  LGQPDESYDDFTASLPANECRYAVFDFDFVTDENCQKSKIIFISWSPDTSRVRSKMLYAS  317



>ref|XP_008376578.1| PREDICTED: actin-depolymerizing factor 7 isoform X1 [Malus domestica]
Length=134

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 88/101 (87%), Gaps = 2/101 (2%)
 Frame = -3

Query  303  ASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLPADE  124
            ASG+ V DECKLKF+ELKAKR +R+IVFKID+  Q VVVEK+G+  ET+ DF  SLPADE
Sbjct  2    ASGMAVNDECKLKFVELKAKRNYRFIVFKIDK--QEVVVEKVGSPDETYEDFAASLPADE  59

Query  123  CRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            CRYAVFD+DFTT ENCQ+SKIFFIAWSPET+K+R KMVYAS
Sbjct  60   CRYAVFDFDFTTAENCQKSKIFFIAWSPETSKVRMKMVYAS  100



>ref|XP_010031001.1| PREDICTED: actin-depolymerizing factor 2-like [Eucalyptus grandis]
 gb|KCW50260.1| hypothetical protein EUGRSUZ_J00048 [Eucalyptus grandis]
Length=139

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IV+KI+E+ + V+VEK+G    ++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIVYKIEEKQKQVIVEKLGEPTNSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+D+ T+ENCQ+S+I FIAWSP+T+K+R+KM+YAS
Sbjct  61   PADECRYAVYDFDYVTEENCQKSRIIFIAWSPDTSKVRNKMIYAS  105



>gb|KFK26837.1| hypothetical protein AALP_AA8G300400 [Arabis alpina]
Length=137

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+F+ID   Q VVVEK+G+ +E + DF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DFTT ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PANECRYAVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|NP_001148898.1| actin-depolymerizing factor [Zea mays]
 gb|ACG33344.1| actin-depolymerizing factor [Zea mays]
Length=139

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+NSASG+ V DECKLKF ELKAKR FR+IVFKI+E  Q VVV+++G   E++  FT   
Sbjct  1    MSNSASGMAVCDECKLKFQELKAKRSFRFIVFKINENVQQVVVDRLGEPGESYDAFTACF  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DF TDENCQ+SKIFFI+W+P+T+++RSKM+YAS
Sbjct  61   PANECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYAS  105



>ref|XP_009127248.1| PREDICTED: actin-depolymerizing factor 12 [Brassica rapa]
Length=137

 Score =   156 bits (395),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+F+ID   Q VVVEK+G+ +E + DF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DFTT ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PANECRYAVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_009767730.1| PREDICTED: uncharacterized protein LOC104218842 isoform X1 [Nicotiana 
sylvestris]
Length=285

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 2/106 (2%)
 Frame = -3

Query  318  EMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKS  139
            E AN+ASG+ V D+CKLKF+ELK+KR +RYI+FKI  E+Q VVVEK+G  +E++ DFT S
Sbjct  148  EQANAASGMAVHDDCKLKFLELKSKRNYRYIIFKI--ESQQVVVEKLGGTEESYEDFTNS  205

Query  138  LPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            LPADECRY VFD+DF T ENCQ+SKIFFIAW P+T+K+R KMVYAS
Sbjct  206  LPADECRYTVFDFDFITTENCQKSKIFFIAWFPDTSKVRMKMVYAS  251



>ref|XP_009106793.1| PREDICTED: actin-depolymerizing factor 7 [Brassica rapa]
Length=137

 Score =   156 bits (395),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 92/105 (88%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELK+KR +R+I+F+ID   Q VVVEK+G+ +E + DF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKSKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAVFD+DFTT ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PANECRYAVFDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_004142080.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 ref|XP_004169676.1| PREDICTED: actin-depolymerizing factor 1-like [Cucumis sativus]
 gb|KGN54230.1| hypothetical protein Csa_4G294380 [Cucumis sativus]
Length=139

 Score =   156 bits (395),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELK+KR  R+IVFKI+E+ + VVVEK+G   +++ DF  SL
Sbjct  1    MANAASGMAVNDECKLKFLELKSKRTHRFIVFKIEEKLKQVVVEKLGGPSQSYEDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+DF T+ENCQ+S+IFFIAWSP+ +K+RSKM+YAS
Sbjct  61   PANECRYAVYDFDFVTEENCQKSRIFFIAWSPDDSKVRSKMIYAS  105



>ref|XP_004249528.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum lycopersicum]
Length=139

 Score =   156 bits (395),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL F+ELK KR  R+IVFKI+E+ + VVVEK+G   +++ DF +SL
Sbjct  1    MANAASGMAVHDDCKLTFLELKTKRTHRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAESL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTARVRSKMIYAS  105



>ref|XP_011000294.1| PREDICTED: actin-depolymerizing factor 2-like [Populus euphratica]
Length=139

 Score =   156 bits (395),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R IVFKI+E+ + V+VEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKLKQVIVEKLGEPAQSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T EN Q+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFMTAENVQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_007211217.1| hypothetical protein PRUPE_ppa013153mg [Prunus persica]
 gb|EMJ12416.1| hypothetical protein PRUPE_ppa013153mg [Prunus persica]
Length=137

 Score =   156 bits (395),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I+FKI  E Q +V++K+G   E++ DFT S 
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRNYRFILFKI--EQQQIVIDKLGEPNESYDDFTSSF  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DFTT+ENCQ+SKIFFIAWSP+++K+R KMVYAS
Sbjct  59   PADECRYAVFDFDFTTEENCQKSKIFFIAWSPDSSKVRMKMVYAS  103



>gb|ABK94603.1| unknown [Populus trichocarpa]
Length=139

 Score =   156 bits (395),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR  R+IVFKI+E+ + V+VEK+G   +++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+D+ TDENCQ+S+I F+AWSP+T+++RSKM+YAS
Sbjct  61   PANECRYAVYDFDYVTDENCQKSRIVFVAWSPDTSRVRSKMIYAS  105



>ref|XP_009357677.1| PREDICTED: actin-depolymerizing factor 1 [Pyrus x bretschneideri]
Length=139

 Score =   156 bits (395),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKA+R +R+IV+KI+E+   VVVEK+G   +++ DF+ SL
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVVVEKLGEPTDSYEDFSASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+D+ T+ENCQ+S+I F+AWSP+TAK+RSKM+YAS
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIVFVAWSPDTAKVRSKMIYAS  105



>ref|XP_002284029.1| PREDICTED: actin-depolymerizing factor 2-like isoform X1 [Vitis 
vinifera]
 ref|XP_002284040.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010658601.1| PREDICTED: actin-depolymerizing factor 2-like isoform X2 [Vitis 
vinifera]
Length=139

 Score =   156 bits (394),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R IVF+I+E+ + V+VEK+G   +++ DF  SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFQIEEKQKQVIVEKVGEPTQSYEDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>gb|ADV02778.1| actin depolymerizing factor 1 [Ipomoea batatas]
Length=139

 Score =   156 bits (394),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F+ELKAKR  R+IVFKI+E+ + V+VEK+G    ++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVIVEKVGEPARSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DF T ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PTDECRYAVYDFDFVTAENCQKSKIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_004294586.1| PREDICTED: actin-depolymerizing factor 2-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=139

 Score =   156 bits (394),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG  V D+CKLKF++LKAKR +R+IVFKI+E+ + VVVEK+G   +++ +FT SL
Sbjct  1    MANAASGFAVDDDCKLKFLDLKAKRTYRFIVFKIEEKLKQVVVEKLGEPAQSYEEFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+++R+KM+YAS
Sbjct  61   PADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRNKMIYAS  105



>gb|EEE61469.1| hypothetical protein OsJ_15732 [Oryza sativa Japonica Group]
Length=403

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKLKF ELK+KR FR+I FKIDE TQ VVV+++G   +T+ DFT S+P
Sbjct  266  ANSASGMAVGDECKLKFQELKSKRSFRFITFKIDERTQQVVVDRLGQPGDTYDDFTASMP  325

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            A ECRYAVFD+DF TDENCQ+SKIFFI+WSP+T+K+RSKM+YAS
Sbjct  326  ASECRYAVFDFDFVTDENCQKSKIFFISWSPDTSKVRSKMLYAS  369



>gb|EAY95118.1| hypothetical protein OsI_16935 [Oryza sativa Indica Group]
Length=403

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            ANSASG+ V DECKLKF ELK+KR FR+I FKIDE TQ VVV+++G   +T+ DFT S+P
Sbjct  266  ANSASGMAVGDECKLKFQELKSKRSFRFITFKIDERTQQVVVDRLGQPGDTYDDFTASMP  325

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            A ECRYAVFD+DF TDENCQ+SKIFFI+WSP+T+K+RSKM+YAS
Sbjct  326  ASECRYAVFDFDFVTDENCQKSKIFFISWSPDTSKVRSKMLYAS  369



>gb|AEJ88268.1| putative actin-depolymerizing factor [Wolffia arrhiza]
Length=139

 Score =   156 bits (394),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR  R+IVFKIDE+ + V+VEK+G    T+ DF  SL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTHRFIVFKIDEKQKQVIVEKIGEPALTYEDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYA++D+DF T ENCQ+SKIFFIAWSP+TA++RSKM+YAS
Sbjct  61   PDNECRYAIYDFDFVTSENCQKSKIFFIAWSPDTARVRSKMLYAS  105



>ref|XP_009353719.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
 ref|XP_009338379.1| PREDICTED: actin-depolymerizing factor 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338380.1| PREDICTED: actin-depolymerizing factor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=139

 Score =   155 bits (393),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG  V D+CKLKF+ELKAKR +R+IVFKIDE+   V+VEK+G   E++ DFT +L
Sbjct  1    MANAASGFAVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DF T ENCQ+S+IFFI WSP+TA++R+KM+YAS
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIGWSPDTARVRNKMIYAS  105



>ref|XP_010227222.1| PREDICTED: uncharacterized protein LOC100826202 [Brachypodium 
distachyon]
Length=496

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECK KF ELKAKR FR+I FK++E TQ VVV+++G   ET+ DFT S+
Sbjct  358  MANSASGMAVSDECKHKFQELKAKRSFRFITFKVNENTQQVVVDRVGQPGETYADFTASI  417

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DF TDENCQ+SKIFFI+WSP+T+++RSKM+YAS
Sbjct  418  PADECRYAVFDFDFVTDENCQKSKIFFISWSPDTSRVRSKMLYAS  462



>ref|XP_009109200.1| PREDICTED: actin-depolymerizing factor-like [Brassica rapa]
Length=136

 Score =   155 bits (393),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (87%), Gaps = 3/105 (3%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D CKLKF+ELK KR  R+I+F+ID   Q VVVEK+G+ QET+ DFT SL
Sbjct  1    MANAASGMAVEDNCKLKFLELK-KRTHRFIIFRID--GQQVVVEKLGSPQETYDDFTASL  57

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAVFD+DFTT+ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  58   PADECRYAVFDFDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYAS  102



>sp|Q9FVI1.1|ADF2_PETHY RecName: Full=Actin-depolymerizing factor 2; Short=ADF-2 [Petunia 
x hybrida]
 gb|AAG16974.1|AF183904_1 actin-depolymerizing factor 2 [Petunia x hybrida]
 gb|AAK72616.1| actin-depolymerizing factor 2 [Petunia x hybrida]
Length=143

 Score =   156 bits (394),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I++KI+E+ + VVVEK+G   E++ DFT  L
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKEVVVEKLGEPTESYEDFTAGL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T EN Q+S+IFFIAWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFMTKENHQKSRIFFIAWSPDTARVRSKMIYAS  105



>ref|XP_008343560.1| PREDICTED: actin-depolymerizing factor 1 [Malus domestica]
Length=139

 Score =   155 bits (393),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKA+R +R+IV+KI+E+   V+VEK+G   +++ DF+ SL
Sbjct  1    MANAASGMAVHDECKLKFLELKARRTYRFIVYKIEEKQNGVIVEKLGEPTDSYEDFSASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+D+ T+ENCQ+S+I F+AWSP+TAK+RSKM+YAS
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIVFVAWSPDTAKVRSKMIYAS  105



>gb|KDP29838.1| hypothetical protein JCGZ_18413 [Jatropha curcas]
Length=139

 Score =   155 bits (393),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR  R+IVFKI+E+ + VVVEK+G    ++ DFT SL
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVVVEKLGEPANSYEDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+EN Q+S+I FIAWSP+T+K+RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENVQKSRIVFIAWSPDTSKVRSKMIYAS  105



>ref|XP_011094831.1| PREDICTED: actin-depolymerizing factor 1 isoform X2 [Sesamum 
indicum]
Length=139

 Score =   155 bits (393),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F+ELKAKR  R+IVFKI+E+ + VVVEK+G   + + DFT SL
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEKQKQVVVEKVGEPTQNYDDFTASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PVDECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRSKMIYAS  105



>gb|AFK45315.1| unknown [Lotus japonicus]
Length=137

 Score =   155 bits (392),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF ELKA+R +R+IVFKI  E Q VVVEK+G   E + DF  SL
Sbjct  1    MANAASGMAVQDECKLKFQELKARRAYRFIVFKI--EKQQVVVEKLGEPTENYDDFQASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV D+DFTT+ENCQ+SKIFFIAWSP+ +K+R KMVYAS
Sbjct  59   PADECRYAVHDFDFTTEENCQKSKIFFIAWSPDISKVRMKMVYAS  103



>gb|AAT42170.1| putative actin depolymerizing factor [Sorghum bicolor]
Length=463

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF ELK+KR FR+I FKI+E+TQ VVV+++G   +++ DFT S+
Sbjct  325  MANSASGMAVSDECKLKFQELKSKRSFRFITFKINEQTQQVVVDRLGQPGDSYDDFTGSM  384

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P  ECRYAVFD+DFTTDENCQ+SKIFFI+WSP+T+K+RSKM+YAS
Sbjct  385  PDSECRYAVFDFDFTTDENCQKSKIFFISWSPDTSKVRSKMLYAS  429



>gb|AFK35836.1| unknown [Lotus japonicus]
Length=137

 Score =   155 bits (392),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF ELKA+R +R+IVFKI  E Q V+VEK+G   E + DF  SL
Sbjct  1    MANAASGMAVQDECKLKFQELKARRAYRFIVFKI--EKQQVMVEKLGEPTENYDDFQASL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTT+ENCQ+SKIFFIAWSP+ +++R KMVYAS
Sbjct  59   PADECRYAVYDFDFTTEENCQKSKIFFIAWSPDISRVRMKMVYAS  103



>ref|XP_002311154.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
 gb|EEE88521.2| hypothetical protein POPTR_0008s05210g [Populus trichocarpa]
Length=218

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  324  HHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFT  145
              +MAN+ASG+ V D+CKLKF+ELKAKR  R+IVFKI+E+ + V+VEK+G   +++ DFT
Sbjct  77   REKMANAASGMAVHDDCKLKFLELKAKRTHRFIVFKIEEKQKQVIVEKLGKPTDSYEDFT  136

Query  144  KSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             SLPA+ECRYAV+D+D+ TDENCQ+S+I F+AWSP+T+++RSKM+YAS
Sbjct  137  ASLPANECRYAVYDFDYVTDENCQKSRIVFVAWSPDTSRVRSKMIYAS  184



>ref|XP_008385227.1| PREDICTED: actin-depolymerizing factor 1-like, partial [Malus 
domestica]
Length=147

 Score =   155 bits (393),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  336  SPSQHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETH  157
            S    +E AN+ASG  V D+CKLKF+ELKAKR +R+IVFKIDE+   V+VEK+G   E++
Sbjct  2    SSVSSYEQANAASGFXVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGXPAESY  61

Query  156  VDFTKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
             DFT +LP +ECRYAV+D+DF T ENCQ+S+IFFI WSP+TA++R+KM+YAS
Sbjct  62   EDFTANLPDNECRYAVYDFDFVTAENCQKSRIFFIGWSPDTARVRNKMIYAS  113



>ref|XP_009416252.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416253.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   155 bits (392),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKIDE+ + VVV+K+G     + DF  +L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKQKEVVVDKVGEPSSNYDDFAAAL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYA++D+DF T+ENCQ+SKIFFIAWSP+++++RSKM+YAS
Sbjct  61   PTDECRYAIYDFDFVTEENCQKSKIFFIAWSPDSSRVRSKMLYAS  105



>gb|KHG04895.1| Actin-depolymerizing factor 10 -like protein [Gossypium arboreum]
Length=132

 Score =   155 bits (391),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -3

Query  288  VVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLPADECRYAV  109
            V D+CKLKF+ELKAKR +R+IV+KIDE+TQ V+V+K+G  QET+ DFT SLP  ECRYAV
Sbjct  3    VNDDCKLKFLELKAKRNYRFIVYKIDEQTQQVIVDKLGGPQETYEDFTNSLPEHECRYAV  62

Query  108  FDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            FDYDFTTDENCQ+SKIFF AWSP+ +++RSKM+YAS
Sbjct  63   FDYDFTTDENCQKSKIFFFAWSPDGSRVRSKMLYAS  98



>ref|XP_002299888.1| actin-depolymerizing factor family protein [Populus trichocarpa]
 gb|ABK93478.1| unknown [Populus trichocarpa]
 gb|ABK93508.1| unknown [Populus trichocarpa]
 gb|ABK93744.1| unknown [Populus trichocarpa]
 gb|ABK93767.1| unknown [Populus trichocarpa]
 gb|EEE84693.1| actin-depolymerizing factor family protein [Populus trichocarpa]
Length=139

 Score =   155 bits (392),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R IVFKI+E+ + V+VEK+G   +++ DFT S+
Sbjct  1    MANAASGMAVHDDCKLKFLELKAKRTYRSIVFKIEEKLKQVIVEKLGEPAQSYEDFTASI  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T EN Q+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFMTAENVQKSRIFFIAWSPDTSRVRSKMIYAS  105



>ref|XP_009404611.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   155 bits (392),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+I+FKIDE+ + V+VEK+G    T+ DFT +L
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKQKQVIVEKLGEPNLTYDDFTATL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYA++D+DF  +ENCQ+SKI FIAWSP+T+++RSKM+YAS
Sbjct  61   PTNECRYAIYDFDFVNEENCQKSKIIFIAWSPDTSRVRSKMLYAS  105



>ref|XP_006590525.1| PREDICTED: actin-depolymerizing factor 7-like isoform X2 [Glycine 
max]
Length=143

 Score =   155 bits (392),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 88/104 (85%), Gaps = 2/104 (2%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            AN+ASG+ V D+CKL+F ELKAKR +R+I FKI  E Q VVV+K+G   E++ DF  SLP
Sbjct  8    ANAASGMAVHDDCKLRFQELKAKRVYRFITFKI--EQQQVVVDKIGESTESYDDFQASLP  65

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            ADECRYAV+D+DFTTDENCQ+SKIFFIAWSP+T+K+R KMVYAS
Sbjct  66   ADECRYAVYDFDFTTDENCQKSKIFFIAWSPDTSKVRMKMVYAS  109



>ref|XP_004294585.1| PREDICTED: actin-depolymerizing factor 2-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=147

 Score =   155 bits (392),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  321  HEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTK  142
            ++ AN+ASG  V D+CKLKF++LKAKR +R+IVFKI+E+ + VVVEK+G   +++ +FT 
Sbjct  7    YDQANAASGFAVDDDCKLKFLDLKAKRTYRFIVFKIEEKLKQVVVEKLGEPAQSYEEFTA  66

Query  141  SLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            SLPADECRYAV+D+DF T ENCQ+S+IFFIAWSP+T+++R+KM+YAS
Sbjct  67   SLPADECRYAVYDFDFVTAENCQKSRIFFIAWSPDTSRVRNKMIYAS  113



>emb|CBI31711.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   157 bits (397),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R IVF+I+E+ + V+VEK+G   +++ DF  SL
Sbjct  64   MANAASGMAVHDDCKLKFLELKAKRTYRSIVFQIEEKQKQVIVEKVGEPTQSYEDFAASL  123

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+T+++RSKM+YAS
Sbjct  124  PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTSRVRSKMIYAS  168



>ref|XP_009419950.1| PREDICTED: actin-depolymerizing factor 4 [Musa acuminata subsp. 
malaccensis]
Length=139

 Score =   155 bits (391),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            M+N+ASG+ V D+CKLKF+ELKAKR +R+I+FKIDE+ + V+V+K+G     + DF  SL
Sbjct  1    MSNAASGMAVNDDCKLKFLELKAKRTYRFIIFKIDEKQKQVIVDKLGEPTLAYEDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYA++D+DF T+ENCQ+SKIFFIAWSP+ A++R+KM+YAS
Sbjct  61   PADECRYAIYDFDFVTEENCQKSKIFFIAWSPDIARVRNKMLYAS  105



>ref|XP_003637508.1| Actin-depolymerizing factor [Medicago truncatula]
 gb|AFK41269.1| unknown [Medicago truncatula]
 gb|KEH42380.1| cofilin/actin-depolymerizing factor-like protein [Medicago truncatula]
Length=139

 Score =   155 bits (391),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +RYI++KI+E+ + VVV+K+G+    + DFT +L
Sbjct  1    MANAASGMAVNDECKLKFLELKAKRTYRYIIYKIEEKQKQVVVDKVGDPANGYDDFTANL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAW P+ +++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWCPDISRVRSKMIYAS  105



>ref|XP_008357628.1| PREDICTED: actin-depolymerizing factor 1-like [Malus domestica]
Length=139

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG  V D+CKLKF+ELKAKR +R+IVFKIDE+   V+VEK+G   E++ DFT +L
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGEPAESYEDFTANL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DF T ENCQ+S+IFF+ WSP+TA++R+KM+YAS
Sbjct  61   PDNECRYAVYDFDFVTVENCQKSRIFFVGWSPDTARVRNKMIYAS  105



>ref|XP_002439159.1| hypothetical protein SORBIDRAFT_09g001500 [Sorghum bicolor]
 gb|EES17589.1| hypothetical protein SORBIDRAFT_09g001500 [Sorghum bicolor]
Length=139

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CK +F+ELKAKR  R+I++KIDE+ ++VVVE++G     + DF  SL
Sbjct  1    MANAASGMAVDDDCKRRFLELKAKRTHRFIIYKIDEKKKMVVVEQVGEPVLNYDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYA+FDYDF T+ENCQ+SKIFFIAWSP+TA++RSKM+YAS
Sbjct  61   PANECRYAIFDYDFVTEENCQKSKIFFIAWSPDTARVRSKMIYAS  105



>ref|XP_009358343.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG  V D+CKLKF+ELKAKR +R+IVFKIDE+   V+VEK+G   E++ DFT +L
Sbjct  1    MANAASGFAVNDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGQPAESYEDFTANL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DF T ENCQ+S+IFF+ WSP+TA++R+KM+YAS
Sbjct  61   PDNECRYAVYDFDFVTVENCQKSRIFFVGWSPDTARVRNKMIYAS  105



>ref|XP_009337572.1| PREDICTED: actin-depolymerizing factor 1-like [Pyrus x bretschneideri]
Length=139

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ SG+ V DECKLKF+ELKAKR +R+IV+KI+E+   V+VEK+G   +++ DF+ SL
Sbjct  1    MANARSGMAVHDECKLKFLELKAKRTYRFIVYKIEEKQNEVIVEKLGEPTDSYEDFSASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PA+ECRYAV+D+D+ T+ENCQ+S+I F+AWSP+TAK+RSKM+YAS
Sbjct  61   PANECRYAVYDFDYVTEENCQKSRIIFVAWSPDTAKVRSKMIYAS  105



>ref|XP_008392560.1| PREDICTED: actin-depolymerizing factor 7-like [Malus domestica]
Length=137

 Score =   154 bits (390),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+F+ELKAKR +R+I++KI  E Q +V++K+G   E++ DFT S 
Sbjct  1    MANAASGMAVHDDCKLRFLELKAKRSYRFILYKI--EQQQIVIDKLGEPNESYEDFTASF  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DFTT+ENCQ+SKIFFIAWSP+T+K+R KMVYAS
Sbjct  59   PADECRYAVYDFDFTTEENCQKSKIFFIAWSPDTSKVRMKMVYAS  103



>ref|XP_010317604.1| PREDICTED: actin-depolymerizing factor 12 [Solanum lycopersicum]
Length=137

 Score =   154 bits (390),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ SG  V DECKLKF+ELKAKR +R+I+FKID   Q VVVEK+G+ +E++ +FT SL
Sbjct  1    MANAVSGTAVQDECKLKFLELKAKRNYRFIIFKID--GQEVVVEKLGSPEESYDNFTNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P DECRYAVFD+DFTT+EN Q+SKIFFIAWSPE++ +R KMVYAS
Sbjct  59   PPDECRYAVFDFDFTTNENIQKSKIFFIAWSPESSTVRMKMVYAS  103



>ref|XP_006339034.1| PREDICTED: actin-depolymerizing factor 1-like [Solanum tuberosum]
Length=139

 Score =   154 bits (390),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL F ELK KR  R+IVFKI+E+ + VVVEK+G   +++ DF +SL
Sbjct  1    MANAASGMAVHDDCKLTFFELKTKRSHRFIVFKIEEKQKQVVVEKVGEPTQSYEDFAESL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYAV+D+DF T+ENCQ+S+IFFIAWSP+TA++RSKM+YAS
Sbjct  61   PADECRYAVYDFDFVTEENCQKSRIFFIAWSPDTARVRSKMIYAS  105



>ref|XP_010514926.1| PREDICTED: actin-depolymerizing factor 1 [Camelina sativa]
Length=139

 Score =   154 bits (390),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+FMELKAKR  R+IV+KI+E+ + VVVEK+G   +T+ DF  SL
Sbjct  1    MANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKQKQVVVEKVGEPIQTYDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYA++D+DF T ENCQ+SKIFFIAW P+ AK+RSKM+YAS
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYAS  105



>ref|XP_002865909.1| hypothetical protein ARALYDRAFT_495305 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006281622.1| hypothetical protein CARUB_v10027750mg [Capsella rubella]
 gb|EFH42168.1| hypothetical protein ARALYDRAFT_495305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA14520.1| hypothetical protein CARUB_v10027750mg [Capsella rubella]
Length=137

 Score =   154 bits (390),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V DECKLKF+ELKAKR +R+I+F+ID   Q VVVEK+G+ +E + DF+ SL
Sbjct  1    MANAASGMAVEDECKLKFLELKAKRNYRFIIFRID--GQQVVVEKLGSPEENYDDFSNSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DFTT ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  59   PPNECRYAVYDFDFTTAENCQKSKIFFIAWSPDSSRVRMKMVYAS  103



>ref|XP_009420088.1| PREDICTED: actin-depolymerizing factor 7-like [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   154 bits (390),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKLKF+ELKAKR +R+IVFKIDE+ + V+VEK+G     + DF  SL
Sbjct  1    MANAASGMAVNDDCKLKFLELKAKRTYRFIVFKIDEKLKQVIVEKVGEPTLGYDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYA++D+DF T+ENCQ+SKIFFIAWSP+T+++RSKM+YAS
Sbjct  61   PNNECRYAIYDFDFVTEENCQKSKIFFIAWSPDTSRVRSKMLYAS  105



>ref|XP_008439227.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103484078 
[Cucumis melo]
Length=386

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 94/104 (90%), Gaps = 2/104 (2%)
 Frame = -3

Query  312  ANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSLP  133
            AN+ASG+ V DECKLKF+ELKAKR +R+I+FKI  E Q VVVEK+G+ +ET+ DFT ++P
Sbjct  251  ANAASGMAVRDECKLKFLELKAKRNYRFIIFKI--ENQEVVVEKLGSPEETYDDFTAAIP  308

Query  132  ADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            A+ECRYAVFD+DFTTDENCQ+SKIFFIAWSP+T+K+R+KMVYAS
Sbjct  309  ANECRYAVFDFDFTTDENCQKSKIFFIAWSPDTSKVRNKMVYAS  352



>gb|EYU19548.1| hypothetical protein MIMGU_mgv1a016233mg [Erythranthe guttata]
Length=129

 Score =   154 bits (389),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MANSASG+ V DECKLKF+ELKAKR +R+IVF+I  E Q VVV+K+G   E++ DFT SL
Sbjct  1    MANSASGMAVEDECKLKFLELKAKRNYRFIVFRI--EGQQVVVDKLGCPDESYEDFTSSL  58

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P+DECRYAVFD+DF T ENCQ+SKIFFIAWSP+T+ +R KMVYAS
Sbjct  59   PSDECRYAVFDFDFITTENCQKSKIFFIAWSPDTSIVRMKMVYAS  103



>emb|CDY50194.1| BnaA03g47540D [Brassica napus]
Length=213

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 91/109 (83%), Gaps = 3/109 (3%)
 Frame = -3

Query  327  QHHEMANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDF  148
            Q    AN+ASG+ V D CKLKF+ELK KR +R+I+F+ID   Q VVVEK+GN QET+ DF
Sbjct  74   QKQWFANAASGMAVEDNCKLKFLELK-KRTYRFIIFRID--GQQVVVEKLGNPQETYDDF  130

Query  147  TKSLPADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            T SLPADECRYAVFD DFTT+ENCQ+SKIFFIAWSP+++++R KMVYAS
Sbjct  131  TNSLPADECRYAVFDLDFTTNENCQKSKIFFIAWSPDSSRVRMKMVYAS  179



>ref|XP_010503215.1| PREDICTED: actin-depolymerizing factor 1-like [Camelina sativa]
Length=139

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG+ V D+CKL+FMELKAKR  R+IV+KI+E+ + VVVEK+G   +T+ DF  SL
Sbjct  1    MANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKLKQVVVEKVGEPIQTYDDFAASL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            PADECRYA++D+DF T ENCQ+SKIFFIAW P+ AK+RSKM+YAS
Sbjct  61   PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYAS  105



>ref|XP_008385142.1| PREDICTED: actin-depolymerizing factor 1-like [Malus domestica]
Length=132

 Score =   154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = -3

Query  315  MANSASGVGVVDECKLKFMELKAKRCFRYIVFKIDEETQVVVVEKMGNQQETHVDFTKSL  136
            MAN+ASG  V D+CKLKF+ELKAKR +R+IVFKIDE+   V+VEK+G   E++ DFT +L
Sbjct  1    MANAASGFXVDDDCKLKFLELKAKRTYRFIVFKIDEKKNEVIVEKLGXPAESYEDFTANL  60

Query  135  PADECRYAVFDYDFTTDENCQRSKIFFIAWSPETAKIRSKMVYAS  1
            P +ECRYAV+D+DF T ENCQ+S+IFFI WSP+TA++R+KM+YAS
Sbjct  61   PDNECRYAVYDFDFVTAENCQKSRIFFIGWSPDTARVRNKMIYAS  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508381126058