BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8289_g1_i1 len=1658 path=[1:0-777 779:778-1657]

Length=1658
                                                                      Score     E

ref|XP_010657790.1|  PREDICTED: uncharacterized protein LOC100255874    642   0.0      
gb|KDP23221.1|  hypothetical protein JCGZ_23054                         630   0.0      
ref|XP_011075700.1|  PREDICTED: uncharacterized protein LOC105160...    620   0.0      
ref|XP_004228544.1|  PREDICTED: uncharacterized protein LOC101248126    614   0.0      
ref|XP_007049895.1|  Uncharacterized protein isoform 1                  613   0.0      
gb|KHG12981.1|  Gut esterase 1                                          612   0.0      
ref|XP_010249395.1|  PREDICTED: uncharacterized protein LOC104591937    612   0.0      
ref|XP_010112013.1|  hypothetical protein L484_004700                   612   0.0      
ref|XP_007222288.1|  hypothetical protein PRUPE_ppa005909mg             611   0.0      
ref|XP_008222304.1|  PREDICTED: uncharacterized protein LOC103322193    611   0.0      
emb|CDP19004.1|  unnamed protein product                                610   0.0      
ref|XP_009353471.1|  PREDICTED: uncharacterized protein LOC103944726    607   0.0      
ref|XP_002512715.1|  conserved hypothetical protein                     606   0.0      Ricinus communis
ref|XP_010530680.1|  PREDICTED: uncharacterized protein LOC104807194    604   0.0      
ref|XP_006423779.1|  hypothetical protein CICLE_v10028467mg             603   0.0      
ref|XP_006478569.1|  PREDICTED: uncharacterized protein LOC102625268    601   0.0      
ref|XP_008390242.1|  PREDICTED: uncharacterized protein LOC103452516    599   0.0      
ref|XP_004141151.1|  PREDICTED: uncharacterized protein LOC101208391    598   0.0      
ref|XP_002299369.2|  hypothetical protein POPTR_0001s12540g             597   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006395236.1|  hypothetical protein EUTSA_v10004270mg             595   0.0      
ref|XP_002303731.2|  hypothetical protein POPTR_0003s15700g             596   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004296988.1|  PREDICTED: uncharacterized protein LOC101304763    596   0.0      
ref|XP_008465170.1|  PREDICTED: uncharacterized protein LOC103502...    595   0.0      
ref|XP_006585864.1|  PREDICTED: uncharacterized protein LOC100820...    595   0.0      
ref|XP_011020951.1|  PREDICTED: uncharacterized protein LOC105123...    594   0.0      
emb|CDX85311.1|  BnaC07g26220D                                          594   0.0      
ref|XP_008369581.1|  PREDICTED: uncharacterized protein LOC103433127    593   0.0      
ref|XP_011004313.1|  PREDICTED: uncharacterized protein LOC105110835    593   0.0      
ref|XP_010438950.1|  PREDICTED: uncharacterized protein LOC104722481    591   0.0      
ref|XP_009359832.1|  PREDICTED: uncharacterized protein LOC103950360    591   0.0      
ref|XP_007156285.1|  hypothetical protein PHAVU_003G273800g             590   0.0      
ref|XP_006348531.1|  PREDICTED: uncharacterized protein LOC102599594    588   0.0      
gb|KFK32166.1|  hypothetical protein AALP_AA6G206200                    586   0.0      
ref|XP_011020950.1|  PREDICTED: uncharacterized protein LOC105123...    586   0.0      
emb|CDX86340.1|  BnaA06g30570D                                          583   0.0      
ref|XP_010924069.1|  PREDICTED: uncharacterized protein LOC105047005    583   0.0      
ref|XP_009151584.1|  PREDICTED: uncharacterized protein LOC103874911    581   0.0      
ref|XP_002863828.1|  hypothetical protein ARALYDRAFT_494828             581   0.0      
ref|NP_199597.1|  uncharacterized protein                               581   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442202.1|  PREDICTED: uncharacterized protein LOC104725...    580   0.0      
ref|XP_011075702.1|  PREDICTED: uncharacterized protein LOC105160...    575   0.0      
ref|XP_010044909.1|  PREDICTED: uncharacterized protein LOC104433748    579   0.0      
ref|XP_008799216.1|  PREDICTED: uncharacterized protein LOC103713...    577   0.0      
ref|XP_009404208.1|  PREDICTED: uncharacterized protein LOC103987...    572   0.0      
ref|XP_009404207.1|  PREDICTED: uncharacterized protein LOC103987...    575   0.0      
ref|XP_009804104.1|  PREDICTED: uncharacterized protein LOC104249384    572   0.0      
ref|XP_004975526.1|  PREDICTED: uncharacterized protein LOC101784...    572   0.0      
ref|XP_009595223.1|  PREDICTED: uncharacterized protein LOC104091560    569   0.0      
ref|XP_010921172.1|  PREDICTED: uncharacterized protein LOC105044838    569   0.0      
dbj|BAG90977.1|  unnamed protein product                                570   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAH66532.1|  H0502B11.12                                            568   0.0      Oryza sativa [red rice]
ref|XP_006652244.1|  PREDICTED: uncharacterized protein LOC102720039    568   0.0      
gb|AGT16017.1|  hypothetical protein SHCRBa_144_K17_F_300               567   0.0      
ref|XP_007049896.1|  Uncharacterized protein isoform 2                  562   0.0      
tpg|DAA37977.1|  TPA: hypothetical protein ZEAMMB73_620234              563   0.0      
ref|NP_001143628.1|  uncharacterized protein LOC100276346               561   0.0      Zea mays [maize]
dbj|BAJ93488.1|  predicted protein                                      557   0.0      
gb|AET03426.2|  plant/MCA23-20 protein                                  551   0.0      
ref|XP_006844779.1|  hypothetical protein AMTR_s00016p00259610          550   0.0      
ref|XP_010694545.1|  PREDICTED: uncharacterized protein LOC104907329    550   0.0      
ref|XP_003628950.1|  hypothetical protein MTR_8g070480                  546   0.0      
ref|XP_003579670.1|  PREDICTED: uncharacterized protein LOC100828...    543   0.0      
ref|XP_008799217.1|  PREDICTED: uncharacterized protein LOC103713...    540   0.0      
ref|XP_010239855.1|  PREDICTED: uncharacterized protein LOC100828...    539   0.0      
ref|XP_006585865.1|  PREDICTED: uncharacterized protein LOC100820...    530   0.0      
ref|XP_006280814.1|  hypothetical protein CARUB_v10026782mg             526   0.0      
gb|AFK40592.1|  unknown                                                 527   3e-180   
ref|XP_010482031.1|  PREDICTED: uncharacterized protein LOC104760...    520   6e-179   
ref|NP_001052711.2|  Os04g0405600                                       521   1e-177   Oryza sativa Japonica Group [Japonica rice]
gb|ABK24671.1|  unknown                                                 508   3e-172   Picea sitchensis
gb|KDO53197.1|  hypothetical protein CISIN_1g022589mg                   475   5e-162   
ref|XP_008465171.1|  PREDICTED: uncharacterized protein LOC103502...    467   1e-157   
gb|KEH20259.1|  plant/MCA23-20 protein                                  440   1e-146   
dbj|BAG95123.1|  unnamed protein product                                400   4e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001784379.1|  predicted protein                                  397   6e-129   
ref|XP_002973651.1|  hypothetical protein SELMODRAFT_54701              383   2e-125   
gb|KHG13493.1|  Gut esterase 1                                          380   3e-123   
ref|XP_002975706.1|  hypothetical protein SELMODRAFT_54706              376   1e-122   
gb|ACF88056.1|  unknown                                                 364   2e-119   Zea mays [maize]
ref|XP_010482032.1|  PREDICTED: uncharacterized protein LOC104760...    356   7e-116   
gb|EPS61771.1|  hypothetical protein M569_13024                         351   1e-113   
dbj|BAJ87176.1|  predicted protein                                      352   2e-113   
emb|CAE75962.1|  OJ000315_02.20                                         350   2e-113   Oryza sativa Japonica Group [Japonica rice]
gb|EYU26061.1|  hypothetical protein MIMGU_mgv1a0066432mg               348   3e-113   
ref|XP_004163621.1|  PREDICTED: uncharacterized LOC101208391            332   6e-107   
ref|XP_008778475.1|  PREDICTED: uncharacterized protein LOC103698260    324   6e-104   
ref|XP_002955324.1|  hypothetical protein VOLCADRAFT_106736             329   1e-102   
gb|EYU28586.1|  hypothetical protein MIMGU_mgv1a013293mg                310   8e-99    
ref|XP_001700332.1|  predicted protein                                  308   9e-95    Chlamydomonas reinhardtii
ref|XP_003054868.1|  predicted protein                                  280   1e-85    
emb|CAE04880.3|  OSJNBa0042I15.2                                        273   6e-84    Oryza sativa [red rice]
ref|XP_004170369.1|  PREDICTED: uncharacterized LOC101208391            269   7e-83    
gb|EYU26062.1|  hypothetical protein MIMGU_mgv1a0066431mg               259   2e-79    
gb|EMS62397.1|  hypothetical protein TRIUR3_11305                       258   3e-79    
tpg|DAA37972.1|  TPA: hypothetical protein ZEAMMB73_620234              248   1e-73    
ref|XP_001420690.1|  predicted protein                                  238   3e-68    Ostreococcus lucimarinus CCE9901
ref|XP_008800134.1|  PREDICTED: uncharacterized protein LOC103714604    227   1e-66    
gb|ACJ85338.1|  unknown                                                 225   5e-66    Medicago truncatula
gb|KFM23697.1|  hypothetical protein F751_3913                          230   2e-65    
emb|CEF99959.1|  Protein of unknown function DUF1350                    222   3e-62    
ref|XP_007512196.1|  predicted protein                                  221   2e-61    
ref|XP_003082420.1|  unnamed protein product                            221   1e-60    
ref|XP_002506841.1|  predicted protein                                  201   4e-53    Micromonas commoda
gb|EPS58155.1|  hypothetical protein M569_16662                         182   9e-51    
ref|WP_038083882.1|  hypothetical protein                               170   8e-45    
ref|WP_008312548.1|  Protein of unknown function (DUF1350)              169   8e-45    
ref|WP_039742939.1|  hypothetical protein                               167   6e-44    
ref|WP_015209766.1|  Protein of unknown function (DUF1350)              167   7e-44    
ref|WP_015133729.1|  hypothetical protein                               166   2e-43    
ref|WP_006098134.1|  hypothetical protein                               166   2e-43    
ref|WP_029636596.1|  hypothetical protein [                             166   2e-43    
ref|WP_016876506.1|  hypothetical protein                               164   9e-43    
ref|WP_008189302.1|  hypothetical protein                               164   1e-42    
ref|WP_019493662.1|  hypothetical protein                               164   1e-42    
ref|WP_015185539.1|  hypothetical protein                               164   1e-42    
ref|WP_039729397.1|  hypothetical protein                               164   1e-42    
ref|WP_016867445.1|  hypothetical protein                               163   2e-42    
ref|WP_026733578.1|  hypothetical protein                               163   2e-42    
ref|WP_017290052.1|  hypothetical protein                               163   2e-42    
ref|WP_015145994.1|  lysophospholipase                                  162   3e-42    
ref|WP_015192280.1|  protein of unknown function DUF1350                162   3e-42    
ref|WP_017320141.1|  hypothetical protein                               162   4e-42    
ref|WP_009756777.1|  MULTISPECIES: hypothetical protein                 160   3e-41    
ref|WP_012410095.1|  hypothetical protein                               159   4e-41    
ref|WP_017313575.1|  hypothetical protein                               159   5e-41    
ref|WP_026720015.1|  hypothetical protein                               159   6e-41    
ref|WP_007356948.1|  MULTISPECIES: hypothetical protein                 158   1e-40    
ref|WP_016949173.1|  hypothetical protein                               158   1e-40    
ref|WP_015131982.1|  hypothetical protein                               158   1e-40    
ref|WP_006197340.1|  hypothetical protein                               158   1e-40    
ref|WP_016861483.1|  hypothetical protein                               158   1e-40    
ref|WP_035994473.1|  hypothetical protein                               158   1e-40    
gb|AHJ27004.1|  Alpha/beta superfamily hydrolase                        158   2e-40    
ref|WP_035158236.1|  hypothetical protein                               157   2e-40    
ref|WP_015150549.1|  hypothetical protein                               158   2e-40    
ref|WP_015223151.1|  hypothetical protein                               157   3e-40    
ref|WP_004163605.1|  hypothetical protein                               156   5e-40    
ref|WP_002776659.1|  hypothetical protein                               156   6e-40    
ref|WP_002758145.1|  hypothetical protein                               155   9e-40    
ref|WP_004162891.1|  hypothetical protein                               155   9e-40    
ref|WP_009555768.1|  lysophospholipase                                  155   1e-39    
ref|WP_028084028.1|  hypothetical protein                               155   1e-39    
ref|WP_028090816.1|  hypothetical protein                               155   1e-39    
ref|WP_006454041.1|  hypothetical protein                               155   1e-39    
dbj|GAL91711.1|  alpha/beta superfamily hydrolase                       155   1e-39    
ref|WP_008197527.1|  hypothetical protein                               155   1e-39    
ref|WP_012306403.1|  hypothetical protein                               155   1e-39    
ref|WP_002781173.1|  hypothetical protein                               155   1e-39    
ref|WP_009545877.1|  MULTISPECIES: hypothetical protein                 155   2e-39    
ref|WP_002770150.1|  hypothetical protein                               155   2e-39    
ref|WP_016516086.1|  hypothetical protein                               155   2e-39    
ref|WP_018399137.1|  hypothetical protein                               155   2e-39    
ref|WP_030005997.1|  hypothetical protein                               155   2e-39    
ref|WP_002739518.1|  hypothetical protein                               155   2e-39    
ref|WP_017300676.1|  hypothetical protein                               154   3e-39    
ref|WP_017306309.1|  hypothetical protein                               154   3e-39    
ref|WP_010871849.1|  hypothetical protein                               155   3e-39    
ref|WP_002743906.1|  hypothetical protein                               154   4e-39    
ref|WP_012596770.1|  hypothetical protein                               154   5e-39    
ref|WP_036019398.1|  hypothetical protein                               153   5e-39    
ref|WP_015179499.1|  protein of unknown function DUF1350                153   6e-39    
gb|EKU98752.1|  Protein of unknown function (DUF1350)                   154   7e-39    
ref|WP_015784230.1|  hypothetical protein                               153   8e-39    
ref|WP_015118397.1|  hypothetical protein                               153   8e-39    
ref|WP_015172731.1|  hypothetical protein                               153   8e-39    
ref|WP_026789099.1|  MULTISPECIES: hypothetical protein                 152   1e-38    
ref|WP_008274448.1|  hypothetical protein                               152   1e-38    
ref|WP_006276087.1|  hypothetical protein                               152   1e-38    
ref|WP_024544945.1|  hypothetical protein                               152   2e-38    
gb|AIE73329.1|  hypothetical protein D082_08000                         152   2e-38    
ref|WP_027844439.1|  hypothetical protein                               152   2e-38    
ref|WP_017747160.1|  hypothetical protein                               151   3e-38    
gb|EWM26665.1|  Protein of unknown function DUF1350                     158   3e-38    
ref|WP_015079462.1|  hypothetical protein                               151   4e-38    
ref|WP_007308872.1|  hypothetical protein                               150   5e-38    
ref|WP_036003422.1|  hypothetical protein                               151   5e-38    
ref|WP_012626125.1|  hypothetical protein                               150   5e-38    
ref|WP_008233767.1|  Alpha/beta superfamily hydrolase                   151   6e-38    
ref|WP_017293802.1|  hypothetical protein                               151   6e-38    
ref|WP_013189824.1|  hypothetical protein                               150   9e-38    
ref|WP_011320424.1|  hypothetical protein                               150   1e-37    
ref|WP_006632016.1|  hypothetical protein                               150   1e-37    
ref|WP_026794363.1|  MULTISPECIES: hypothetical protein                 149   1e-37    
ref|WP_010995259.1|  hypothetical protein                               149   1e-37    
ref|WP_015196854.1|  hypothetical protein                               150   2e-37    
ref|WP_009344643.1|  hypothetical protein                               147   2e-37    
ref|WP_015956449.1|  hypothetical protein                               149   2e-37    
ref|WP_015220916.1|  hypothetical protein                               149   2e-37    
ref|WP_023076859.1|  hypothetical protein                               148   4e-37    
ref|WP_015153643.1|  hypothetical protein                               148   5e-37    
ref|WP_006512476.1|  Protein of unknown function (DUF1350)              148   5e-37    
ref|WP_007303252.1|  hypothetical protein                               147   5e-37    
ref|WP_023066259.1|  hypothetical protein                               147   7e-37    
ref|WP_017654812.1|  hypothetical protein                               147   1e-36    
ref|WP_039715982.1|  hypothetical protein                               147   1e-36    
ref|WP_022609397.1|  protein of unknown function (DUF1350)              146   2e-36    
ref|WP_009786598.1|  hypothetical protein                               146   2e-36    
ref|WP_027402875.1|  hypothetical protein                               145   3e-36    
ref|WP_015113353.1|  hypothetical protein                               145   3e-36    
ref|WP_019505096.1|  hypothetical protein                               144   1e-35    
ref|WP_036485540.1|  hypothetical protein                               144   1e-35    
ref|WP_015161844.1|  lysophospholipase                                  143   2e-35    
ref|XP_002296356.1|  hypothetical protein THAPS_263321                  146   3e-35    Thalassiosira pseudonana CCMP1335
ref|WP_015125554.1|  hypothetical protein                               142   4e-35    
ref|WP_013323275.1|  hypothetical protein                               142   5e-35    
ref|WP_011610702.1|  hypothetical protein                               142   5e-35    
ref|WP_011058307.1|  hypothetical protein                               142   7e-35    
ref|WP_010475100.1|  hypothetical protein                               141   1e-34    
ref|XP_005648902.1|  DUF1350-domain-containing protein                  142   1e-34    
ref|WP_012164272.1|  hypothetical protein                               141   1e-34    
ref|WP_009631704.1|  Protein of unknown function (DUF1350)              139   4e-34    
ref|WP_015212862.1|  protein of unknown function DUF1350                139   4e-34    
ref|WP_024125491.1|  protein of unknown function DUF1350                139   5e-34    
ref|WP_015201253.1|  hypothetical protein                               139   5e-34    
ref|WP_017720207.1|  hypothetical protein                               139   7e-34    
ref|WP_009626919.1|  protein of unknown function DUF1350                138   2e-33    
ref|XP_006843834.1|  hypothetical protein AMTR_s00007p00259840          140   3e-33    
emb|CDN15478.1|  Alpha/beta superfamily hydrolase                       135   1e-32    
ref|WP_037223030.1|  hypothetical protein                               135   1e-32    
ref|WP_006527615.1|  Protein of unknown function (DUF1350)              135   2e-32    
ref|WP_011242836.1|  hypothetical protein                               134   3e-32    
ref|WP_017315207.1|  hypothetical protein                               134   3e-32    
ref|WP_015137318.1|  hypothetical protein                               134   5e-32    
ref|WP_019502873.1|  hypothetical protein                               133   7e-32    
ref|XP_001772200.1|  predicted protein                                  134   2e-31    
ref|WP_015186847.1|  protein of unknown function DUF1350                132   2e-31    
ref|WP_039203247.1|  hypothetical protein                               131   2e-31    
ref|WP_036535177.1|  hypothetical protein                               130   9e-31    
ref|XP_010520502.1|  PREDICTED: uncharacterized protein LOC104799...    133   1e-30    
ref|XP_005832598.1|  hypothetical protein GUITHDRAFT_108494             132   2e-30    
ref|WP_015163841.1|  hypothetical protein                               129   3e-30    
ref|XP_010098402.1|  hypothetical protein L484_018635                   132   3e-30    
ref|WP_015229102.1|  hypothetical protein                               126   2e-29    
gb|EJK72521.1|  hypothetical protein THAOC_05941                        127   4e-29    
ref|WP_015227540.1|  hypothetical protein                               125   6e-29    
ref|XP_011082162.1|  PREDICTED: uncharacterized protein LOC105164...    128   7e-29    
ref|XP_005538618.1|  hypothetical protein, conserved                    127   8e-29    
ref|XP_011082159.1|  PREDICTED: uncharacterized protein LOC105164...    128   1e-28    
ref|XP_002516172.1|  conserved hypothetical protein                     127   1e-28    Ricinus communis
ref|XP_009399642.1|  PREDICTED: uncharacterized protein LOC103983983    127   1e-28    
ref|XP_010273902.1|  PREDICTED: uncharacterized protein LOC104609...    126   2e-28    
ref|XP_004498831.1|  PREDICTED: uncharacterized protein LOC101514791    126   2e-28    
ref|WP_006616796.1|  hypothetical protein                               123   3e-28    
ref|XP_004246026.1|  PREDICTED: uncharacterized protein LOC101256996    125   4e-28    
ref|XP_005704505.1|  hydrolase                                          125   6e-28    
ref|XP_006359942.1|  PREDICTED: uncharacterized protein LOC102601990    124   9e-28    
ref|WP_006622140.1|  MULTISPECIES: hypothetical protein                 121   1e-27    
ref|XP_008452805.1|  PREDICTED: uncharacterized protein LOC103493...    124   1e-27    
ref|XP_002308506.2|  hypothetical protein POPTR_0006s23430g             124   1e-27    Populus trichocarpa [western balsam poplar]
dbj|BAJ89705.1|  predicted protein                                      124   2e-27    
ref|XP_007012480.1|  Eukaryotic initiation factor 4F subunit p150...    123   2e-27    
ref|WP_015169598.1|  hypothetical protein                               120   3e-27    
gb|EYU37444.1|  hypothetical protein MIMGU_mgv1a007761mg                123   3e-27    
ref|XP_006474536.1|  PREDICTED: uncharacterized protein LOC102628...    122   4e-27    
ref|XP_010049295.1|  PREDICTED: uncharacterized protein LOC104437945    122   5e-27    
ref|XP_011019303.1|  PREDICTED: uncharacterized protein LOC105122...    122   7e-27    
ref|XP_007161117.1|  hypothetical protein PHAVU_001G044100g             122   8e-27    
ref|XP_008357240.1|  PREDICTED: uncharacterized protein LOC103420982    122   8e-27    
ref|XP_002176688.1|  predicted protein                                  118   9e-27    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_006419142.1|  hypothetical protein EUTSA_v10002575mg             121   1e-26    
ref|XP_011019302.1|  PREDICTED: uncharacterized protein LOC105122...    121   1e-26    
ref|XP_004292892.1|  PREDICTED: uncharacterized protein LOC101291795    121   1e-26    
ref|XP_003550228.1|  PREDICTED: uncharacterized protein LOC100799...    121   2e-26    
gb|KHG10073.1|  hypothetical protein F383_11193                         120   2e-26    
ref|WP_012953485.1|  hypothetical protein                               118   2e-26    
ref|XP_007012481.1|  Eukaryotic initiation factor 4F subunit p150...    120   3e-26    
ref|XP_010648409.1|  PREDICTED: uncharacterized protein LOC100257...    119   3e-26    
ref|XP_007222701.1|  hypothetical protein PRUPE_ppa006394mg             120   3e-26    
gb|KDP33999.1|  hypothetical protein JCGZ_07570                         120   4e-26    
ref|XP_008220605.1|  PREDICTED: uncharacterized protein LOC103320671    120   4e-26    
ref|WP_011433447.1|  hypothetical protein                               117   5e-26    
ref|XP_003631813.1|  PREDICTED: uncharacterized protein LOC100257...    119   6e-26    
ref|XP_002280415.2|  PREDICTED: uncharacterized protein LOC100257...    119   7e-26    Vitis vinifera
ref|XP_009359050.1|  PREDICTED: uncharacterized protein LOC103949663    119   8e-26    
gb|KEH39892.1|  DUF1350 family protein                                  119   8e-26    
emb|CDY70196.1|  BnaCnng67140D                                          118   1e-25    
ref|XP_005790157.1|  hypothetical protein EMIHUDRAFT_471491             118   1e-25    
ref|XP_010917422.1|  PREDICTED: uncharacterized protein LOC105042018    117   3e-25    
gb|EEC84632.1|  hypothetical protein OsI_31502                          117   3e-25    Oryza sativa Indica Group [Indian rice]
ref|XP_006291225.1|  hypothetical protein CARUB_v10017357mg             117   5e-25    
ref|WP_011429290.1|  hypothetical protein                               114   5e-25    
ref|NP_189940.1|  uncharacterized protein                               116   5e-25    
ref|XP_004956907.1|  PREDICTED: uncharacterized protein LOC101783707    116   7e-25    
ref|XP_002875610.1|  hypothetical protein ARALYDRAFT_484802             115   7e-25    
gb|KFK33852.1|  hypothetical protein AALP_AA5G068600                    115   8e-25    
ref|XP_004141354.1|  PREDICTED: uncharacterized protein LOC101217829    116   9e-25    
ref|XP_010503040.1|  PREDICTED: uncharacterized protein LOC104780235    115   1e-24    
ref|XP_008803399.1|  PREDICTED: uncharacterized protein LOC103716...    115   1e-24    
ref|XP_010425819.1|  PREDICTED: uncharacterized protein LOC104710862    115   1e-24    
ref|XP_009771682.1|  PREDICTED: uncharacterized protein LOC104222188    115   2e-24    
ref|XP_005769771.1|  hypothetical protein EMIHUDRAFT_464188             114   4e-24    
ref|XP_009123270.1|  PREDICTED: uncharacterized protein LOC103848032    113   5e-24    
ref|XP_009587509.1|  PREDICTED: uncharacterized protein LOC104085221    114   5e-24    
emb|CDY12330.1|  BnaA06g20140D                                          113   6e-24    
ref|WP_026099826.1|  hypothetical protein                               110   7e-24    
ref|XP_005843043.1|  hypothetical protein CHLNCDRAFT_141599             110   1e-23    
gb|ACN26758.1|  unknown                                                 113   1e-23    
ref|XP_010678418.1|  PREDICTED: uncharacterized protein LOC104893972    112   1e-23    
ref|XP_005535469.1|  hypothetical protein, conserved                    109   1e-23    
ref|XP_010520503.1|  PREDICTED: uncharacterized protein LOC104799...    111   3e-23    
gb|AII45472.1|  hypothetical protein KR49_03225                         107   1e-22    
ref|XP_003578164.2|  PREDICTED: uncharacterized protein LOC100826183    107   6e-22    
ref|WP_007102234.1|  alpha/beta hydrolase                               103   3e-21    
ref|XP_006419141.1|  hypothetical protein EUTSA_v10002575mg             103   4e-21    
ref|XP_005712181.1|  unnamed protein product                            105   5e-21    
ref|XP_002994171.1|  hypothetical protein SELMODRAFT_138301             102   1e-20    
ref|XP_005838589.1|  hypothetical protein GUITHDRAFT_53068              100   2e-20    
ref|XP_002946280.1|  hypothetical protein VOLCADRAFT_72563              102   2e-20    
emb|CBJ25447.1|  conserved unknown protein                              103   3e-20    
gb|EPS62086.1|  hypothetical protein M569_12706                       98.6    4e-20    
ref|WP_011619477.1|  alpha/beta hydrolase                               100   4e-20    
ref|XP_002965793.1|  hypothetical protein SELMODRAFT_84597              100   5e-20    
ref|WP_011127879.1|  alpha/beta hydrolase                             99.4    6e-20    
ref|WP_009789630.1|  alpha/beta hydrolase                             99.4    7e-20    
ref|WP_006852808.1|  alpha/beta hydrolase                             98.6    1e-19    
ref|XP_001698048.1|  hypothetical protein CHLREDRAFT_131630           99.4    1e-19    
gb|KEH39891.1|  DUF1350 family protein                                99.0    2e-19    
ref|WP_007097685.1|  alpha/beta hydrolase                             97.4    3e-19    
ref|WP_037979509.1|  alpha/beta hydrolase                             97.4    4e-19    
ref|XP_008452806.1|  PREDICTED: uncharacterized protein LOC103493...  99.4    4e-19    
ref|WP_011935760.1|  alpha/beta hydrolase                             97.1    4e-19    
ref|WP_011360106.1|  alpha/beta hydrolase                             96.7    7e-19    
ref|WP_038555406.1|  alpha/beta hydrolase                             95.9    1e-18    
gb|AII49651.1|  alpha/beta hydrolase                                  95.9    1e-18    
gb|KGG29846.1|  Alpha/beta hydrolase                                  95.9    1e-18    
ref|WP_036912228.1|  MULTISPECIES: alpha/beta hydrolase               95.5    2e-18    
ref|XP_005851960.1|  hypothetical protein CHLNCDRAFT_29389            96.3    2e-18    
gb|AHF63908.1|  hypothetical protein Syncc8109_1548                   95.1    2e-18    
ref|XP_010273904.1|  PREDICTED: uncharacterized protein LOC104609...  95.9    2e-18    
gb|EAQ75174.1|  hypothetical protein WH5701_08829                     94.7    2e-18    
ref|XP_006661270.1|  PREDICTED: uncharacterized protein LOC102719231  96.3    3e-18    
ref|WP_011364116.1|  alpha/beta hydrolase                             93.6    6e-18    
gb|EEE69781.1|  hypothetical protein OsJ_29498                        95.9    7e-18    
ref|WP_011826525.1|  alpha/beta hydrolase                             92.8    1e-17    
ref|WP_038004245.1|  alpha/beta hydrolase                             92.8    1e-17    
ref|WP_011129767.1|  alpha/beta hydrolase                             92.4    2e-17    
ref|XP_006601203.1|  PREDICTED: uncharacterized protein LOC100799...  92.4    7e-17    
ref|WP_006910519.1|  alpha/beta hydrolase                             89.7    1e-16    
ref|WP_038544504.1|  alpha/beta hydrolase                             89.4    2e-16    
ref|NP_974379.1|  uncharacterized protein                             89.4    3e-16    
ref|XP_002499980.1|  predicted protein                                90.5    4e-16    
ref|XP_008803400.1|  PREDICTED: uncharacterized protein LOC103716...  88.6    6e-16    
ref|WP_011124928.1|  MULTISPECIES: alpha/beta hydrolase               87.4    8e-16    
tpg|DAA61624.1|  TPA: putative DUF1350 domain containing protein      89.0    9e-16    
ref|XP_005535076.1|  hypothetical protein, conserved                  89.7    1e-15    
ref|XP_002460259.1|  hypothetical protein SORBIDRAFT_02g025580        86.3    2e-15    
ref|WP_032526916.1|  alpha/beta hydrolase                             85.9    2e-15    
ref|XP_003055182.1|  predicted protein                                85.5    3e-15    
emb|CDP15679.1|  unnamed protein product                              85.1    3e-15    
ref|WP_038026596.1|  hypothetical protein                             85.5    3e-15    
ref|WP_010316795.1|  alpha/beta hydrolase                             85.5    4e-15    
gb|EMT04279.1|  hypothetical protein F775_28729                       85.9    5e-15    
ref|WP_035829057.1|  alpha/beta hydrolase                             84.7    7e-15    
ref|WP_028951916.1|  alpha/beta hydrolase                             84.0    1e-14    
gb|EWM22766.1|  Protein of unknown function DUF1350                   86.7    1e-14    
ref|WP_010307893.1|  alpha/beta hydrolase                             83.2    1e-14    
gb|ABE11163.1|  conserved hypothetical protein                        82.8    3e-14    
ref|WP_025931619.1|  MULTISPECIES: alpha/beta hydrolase               82.8    3e-14    
ref|WP_032513646.1|  alpha/beta hydrolase                             82.4    3e-14    
ref|WP_025951877.1|  alpha/beta hydrolase                             82.0    5e-14    
ref|WP_011376176.1|  alpha/beta hydrolase                             81.6    6e-14    
gb|EAR18556.1|  hypothetical protein WH7805_01937                     81.3    6e-14    
ref|WP_025930042.1|  alpha/beta hydrolase                             81.6    7e-14    
ref|WP_025932411.1|  MULTISPECIES: alpha/beta hydrolase               81.6    7e-14    
ref|WP_025975339.1|  alpha/beta hydrolase                             81.6    7e-14    
ref|WP_025957643.1|  alpha/beta hydrolase                             81.3    1e-13    
ref|WP_015108069.1|  hypothetical protein                             80.9    1e-13    
emb|CBJ27680.1|  conserved unknown protein                            81.3    2e-13    
gb|AIQ94686.1|  Alpha/beta hydrolase                                  80.5    2e-13    
ref|WP_025934958.1|  alpha/beta hydrolase                             80.5    2e-13    
ref|WP_025894257.1|  MULTISPECIES: alpha/beta hydrolase               80.5    2e-13    
ref|WP_025939006.1|  alpha/beta hydrolase                             80.1    2e-13    
ref|WP_011932949.1|  alpha/beta hydrolase                             80.1    2e-13    
ref|WP_025952570.1|  alpha/beta hydrolase                             80.1    2e-13    
ref|WP_025969131.1|  alpha/beta hydrolase                             80.1    2e-13    
ref|WP_025893022.1|  alpha/beta hydrolase                             80.1    2e-13    
ref|WP_038655114.1|  alpha/beta hydrolase                             79.7    2e-13    
ref|WP_025934318.1|  MULTISPECIES: alpha/beta hydrolase               79.3    3e-13    
ref|WP_025938124.1|  alpha/beta hydrolase                             79.3    3e-13    
ref|WP_032519263.1|  alpha/beta hydrolase                             79.3    3e-13    
ref|WP_012007435.1|  alpha/beta hydrolase                             79.3    4e-13    
ref|WP_025914430.1|  alpha/beta hydrolase                             79.3    4e-13    
ref|WP_025890581.1|  alpha/beta hydrolase                             79.3    4e-13    
ref|WP_025926215.1|  alpha/beta hydrolase                             79.3    4e-13    
ref|WP_032522403.1|  alpha/beta hydrolase                             79.3    4e-13    
ref|WP_032517692.1|  alpha/beta hydrolase                             79.3    4e-13    
ref|WP_025971943.1|  alpha/beta hydrolase                             79.3    4e-13    
ref|WP_036917424.1|  MULTISPECIES: alpha/beta hydrolase               79.3    4e-13    
ref|WP_002805083.1|  alpha/beta hydrolase                             79.0    5e-13    
ref|WP_025925141.1|  MULTISPECIES: alpha/beta hydrolase               79.0    5e-13    
ref|WP_025906548.1|  MULTISPECIES: alpha/beta hydrolase               79.0    5e-13    
ref|WP_011818124.1|  alpha/beta hydrolase                             79.0    5e-13    
ref|WP_025955444.1|  alpha/beta hydrolase                             78.6    6e-13    
ref|WP_025933295.1|  alpha/beta hydrolase                             78.6    6e-13    
ref|WP_025941490.1|  alpha/beta hydrolase                             78.6    7e-13    
ref|WP_025928252.1|  MULTISPECIES: alpha/beta hydrolase               78.2    9e-13    
ref|WP_025881044.1|  MULTISPECIES: alpha/beta hydrolase               78.2    9e-13    
ref|WP_025887961.1|  MULTISPECIES: alpha/beta hydrolase               78.2    9e-13    
ref|WP_025970679.1|  alpha/beta hydrolase                             77.8    1e-12    
ref|WP_025936222.1|  alpha/beta hydrolase                             77.8    1e-12    
ref|WP_032515775.1|  alpha/beta hydrolase                             77.0    2e-12    
ref|WP_011862636.1|  alpha/beta hydrolase                             76.3    4e-12    
ref|WP_011132254.1|  alpha/beta hydrolase                             75.9    5e-12    
gb|KDO73689.1|  hypothetical protein CISIN_1g0173541mg                75.1    5e-12    
gb|ACU45239.1|  Arabidopsis hypothetical protein-like                 76.3    1e-11    
gb|ACU45284.1|  conserved hypothetical protein                        76.3    1e-11    
dbj|BAG99714.1|  unnamed protein product                              74.3    1e-11    
ref|WP_025973810.1|  alpha/beta hydrolase                             73.2    2e-11    
ref|WP_011293592.1|  alpha/beta hydrolase                             73.9    3e-11    
ref|WP_011819999.1|  alpha/beta hydrolase                             73.2    4e-11    
ref|WP_036907072.1|  alpha/beta hydrolase                             73.2    4e-11    
ref|YP_002048882.1|  hypothetical protein PCC_0222                    72.8    6e-11    
ref|WP_032523748.1|  alpha/beta hydrolase                             72.8    6e-11    
ref|WP_011823400.1|  alpha/beta hydrolase                             72.4    7e-11    
ref|XP_002296184.1|  hypothetical protein THAPS_263182                73.2    8e-11    
ref|WP_036921344.1|  alpha/beta hydrolase                             72.0    9e-11    
gb|KFF41012.1|  Protein of unknown function (DUF1350)                 68.6    2e-10    
ref|XP_002514054.1|  conserved hypothetical protein                   68.6    2e-10    
ref|WP_012195278.1|  alpha/beta hydrolase                             70.9    2e-10    
ref|XP_010455771.1|  PREDICTED: uncharacterized protein LOC104737...  68.9    2e-10    
ref|XP_002185238.1|  predicted protein                                72.4    3e-10    
ref|XP_001419617.1|  predicted protein                                70.9    7e-10    
ref|WP_036903306.1|  alpha/beta hydrolase                             67.8    2e-09    
emb|CBJ27681.1|  conserved unknown protein                            67.4    2e-09    
gb|EJK65603.1|  hypothetical protein THAOC_13520                      69.3    3e-09    
ref|XP_006452938.1|  hypothetical protein CICLE_v10010538mg           65.1    4e-09    
ref|XP_007510775.1|  predicted protein                                68.6    5e-09    
ref|XP_010455764.1|  PREDICTED: uncharacterized protein LOC104737...  64.3    1e-08    
ref|XP_003081342.1|  unnamed protein product                          66.6    2e-08    
ref|XP_005792836.1|  hypothetical protein EMIHUDRAFT_222892           63.9    8e-08    
ref|WP_023172131.1|  hypothetical protein                             63.2    9e-08    
ref|XP_002176418.1|  predicted protein                                64.3    1e-07    
ref|XP_008377523.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  58.5    1e-06    
dbj|BAJ87851.1|  predicted protein                                    57.4    4e-06    
gb|KGG12613.1|  Alpha/beta hydrolase                                  55.8    2e-05    
ref|XP_005768521.1|  hypothetical protein EMIHUDRAFT_245388           57.4    2e-05    
ref|WP_009556013.1|  Protein of unknown function (DUF1350)            53.5    4e-05    
ref|WP_035139769.1|  hypothetical protein                             54.3    8e-05    
ref|WP_012500432.1|  hypothetical protein                             55.5    9e-05    
ref|WP_035121807.1|  hypothetical protein                             53.5    1e-04    
ref|XP_002285982.1|  predicted protein                                55.1    1e-04    
ref|WP_006528976.1|  Protein of unknown function (DUF1350)            54.3    1e-04    
dbj|GAL94138.1|  hypothetical protein N44_02718                       53.9    2e-04    
ref|WP_012499802.1|  hypothetical protein                             53.5    2e-04    
ref|WP_015109521.1|  hypothetical protein                             53.5    2e-04    
ref|WP_006632810.1|  hypothetical protein                             53.1    3e-04    
ref|WP_002786287.1|  hypothetical protein                             52.4    5e-04    
ref|WP_002759163.1|  hypothetical protein                             52.4    5e-04    
ref|WP_025929287.1|  hypothetical protein                             49.7    5e-04    
ref|WP_024971056.1|  hypothetical protein                             52.4    5e-04    
ref|WP_006101678.1|  hypothetical protein                             52.4    5e-04    
ref|WP_035116145.1|  hypothetical protein                             52.0    6e-04    



>ref|XP_010657790.1| PREDICTED: uncharacterized protein LOC100255874 [Vitis vinifera]
 emb|CBI29306.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/445 (76%), Positives = 367/445 (82%), Gaps = 13/445 (3%)
 Frame = -2

Query  1537  MSSWLCAPAPHIHFHPPYSDSAPLFHKRIRFS-MSQLF--IRNSNSGRC------KRIKV  1385
             M SWL  P PH+   P Y       H R  FS     F  + N  +G         RI  
Sbjct  1     MGSWLWTPLPHLA--PRYQPHLNPLHNRTSFSDFHHRFHSVSNRPAGWTPISLFQNRIYC  58

Query  1384  GSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKP  1205
              S  D+S   Q E +GIQ+Y  IERLLT+TVKQSQDAWG S DW EVEGAWVL P N+KP
Sbjct  59    NS--DDSGKKQSETTGIQVYSQIERLLTETVKQSQDAWGGSSDWSEVEGAWVLKPKNSKP  116

Query  1204  RLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCL  1025
             R +VHFVGGIF GAAPQLTYRLFLERL E+ ILVIATPYASGFDHFFIADEVQFKFDRCL
Sbjct  117   RSVVHFVGGIFVGAAPQLTYRLFLERLSERGILVIATPYASGFDHFFIADEVQFKFDRCL  176

Query  1024  RFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLV  845
             RFLQETVQDLP FGIGHSLGSVIHLLIGSRYAVQRSGN+LM+FNNKEAS+AIPLFSPVLV
Sbjct  177   RFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVQRSGNVLMAFNNKEASLAIPLFSPVLV  236

Query  844   PMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRE  665
             PMAQSIGP LSQIA+SPTVRLGAEMTLKQL  LSPPIMKQV+PLVEQLPPLYMDL+ GRE
Sbjct  237   PMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVIPLVEQLPPLYMDLVKGRE  296

Query  664   NFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLP  485
             +F P+PEETRRLIKSYYG+SRNLLIKFKDDTIDETS LAQ+L++DSAISS+LDMSIR LP
Sbjct  297   DFAPKPEETRRLIKSYYGVSRNLLIKFKDDTIDETSTLAQVLASDSAISSLLDMSIRLLP  356

Query  484   GDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEV  305
             GDHGLPL QALPDVPPAM DAVN+ GE LANL  GTPWET AKEVGNT GV+S ILRAE 
Sbjct  357   GDHGLPLQQALPDVPPAMADAVNRGGEFLANLTIGTPWETVAKEVGNTLGVDSKILRAEN  416

Query  304   SKELDLLVDVTTSWMVSNSGPRLLR  230
             SK+LD+LVDV TSW+ SN+GP+LLR
Sbjct  417   SKDLDMLVDVITSWLASNTGPKLLR  441



>gb|KDP23221.1| hypothetical protein JCGZ_23054 [Jatropha curcas]
Length=403

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/377 (84%), Positives = 343/377 (91%), Gaps = 0/377 (0%)
 Frame = -2

Query  1360  SNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVG  1181
             SNQ   SGIQLY  IERLLT+TV+QSQDAWG SKDW EVEGAWVL P  ++P+ +VHFVG
Sbjct  26    SNQSSSSGIQLYGQIERLLTETVRQSQDAWGGSKDWIEVEGAWVLKPRISRPKSVVHFVG  85

Query  1180  GIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQ  1001
             GIF GAAPQLTYRLFLERLVEK ILVIATPYASGFDHFFIADEVQFKFDRC RFLQETVQ
Sbjct  86    GIFVGAAPQLTYRLFLERLVEKGILVIATPYASGFDHFFIADEVQFKFDRCFRFLQETVQ  145

Query  1000  DLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGP  821
             DLP FG+GHSLGSVIHLLIGSRYAVQRSGN+LM+FNNKEAS+AIPLFSPVLVP+AQSIGP
Sbjct  146   DLPTFGVGHSLGSVIHLLIGSRYAVQRSGNVLMAFNNKEASLAIPLFSPVLVPVAQSIGP  205

Query  820   FLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEE  641
             FLSQ+A+SPTVRLGAEMTLKQL  LSPPIMKQVLPLVEQLPPLYMDL+ GRE+F P+PEE
Sbjct  206   FLSQVASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREDFSPKPEE  265

Query  640   TRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLH  461
             TRRLIKSYYGISRNLLIKFKDD IDETS LAQ+LS++SAISSMLDMSIR LPGDHGLPL 
Sbjct  266   TRRLIKSYYGISRNLLIKFKDDGIDETSTLAQVLSSESAISSMLDMSIRLLPGDHGLPLQ  325

Query  460   QALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLV  281
             QALPDVPPAM DAVN+  E LAN+  GTPWET AKEVGNT GV+S ILRAE+SK++DLLV
Sbjct  326   QALPDVPPAMADAVNRGSEFLANMTVGTPWETVAKEVGNTLGVDSKILRAEISKDIDLLV  385

Query  280   DVTTSWMVSNSGPRLLR  230
             DV T+WM SN+GP+LLR
Sbjct  386   DVITTWMSSNTGPKLLR  402



>ref|XP_011075700.1| PREDICTED: uncharacterized protein LOC105160133 isoform X1 [Sesamum 
indicum]
Length=434

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/436 (73%), Positives = 360/436 (83%), Gaps = 3/436 (1%)
 Frame = -2

Query  1537  MSSWLCAPAPHIHFHPPYSDSAPLFHKRIRFSMSQLFIRNSNSGRCKRIKVGSFNDNSTS  1358
             M++ +    PH+ F   ++DS       +RF  S   + N +SGR  RI   S    + +
Sbjct  1     MAACIWTGTPHLRFSSRHADSIS-SQSLVRFPQS--VVNNRSSGRRIRIYCSSDGGANPN  57

Query  1357  NQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGG  1178
             +QPE +GIQLYRDIER+L +TVKQ+QD WG S DW E+EGAWVL P N+K   IVHF+GG
Sbjct  58    SQPETTGIQLYRDIERVLMETVKQNQDGWGGSGDWSEIEGAWVLRPRNSKLTSIVHFIGG  117

Query  1177  IFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQD  998
             IF GAAPQLTYRLFLERL  K ILVIATPYASGFDHF IADEVQFKF+RCLR+LQETV+D
Sbjct  118   IFVGAAPQLTYRLFLERLANKGILVIATPYASGFDHFLIADEVQFKFERCLRYLQETVED  177

Query  997   LPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPF  818
             +P FGIGHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS+A+PLFSPVLVPMAQSIGPF
Sbjct  178   IPTFGIGHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVLVPMAQSIGPF  237

Query  817   LSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEET  638
             LSQIA+SPT+RLGAEMT KQ   LSP I+KQVLPLVEQLPPLYMDL  GRE F P+PEET
Sbjct  238   LSQIASSPTIRLGAEMTRKQFENLSPSILKQVLPLVEQLPPLYMDLAKGREEFSPKPEET  297

Query  637   RRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             RRLI+SYYGISRNLLIKFKDDTIDETS LAQ+LS+DSAISSMLDMSIR LPGDHGLPL Q
Sbjct  298   RRLIRSYYGISRNLLIKFKDDTIDETSTLAQVLSSDSAISSMLDMSIRLLPGDHGLPLQQ  357

Query  457   ALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVD  278
              LPDVPPAM DAVN+ GELLA L AGTPWE  AKEVG+TFG +S+I RA   KE+DLLVD
Sbjct  358   VLPDVPPAMADAVNRGGELLATLTAGTPWEAVAKEVGSTFGADSSIFRAYNPKEIDLLVD  417

Query  277   VTTSWMVSNSGPRLLR  230
             V T+W+ SNSGPRLLR
Sbjct  418   VITTWIASNSGPRLLR  433



>ref|XP_004228544.1| PREDICTED: uncharacterized protein LOC101248126 [Solanum lycopersicum]
Length=432

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/441 (72%), Positives = 368/441 (83%), Gaps = 17/441 (4%)
 Frame = -2

Query  1543  AGMSSWLCAPAPHIHFHPPYSDSAPLFHKR-IRFSMSQLFIRNSNSGRCKRIKVGSFNDN  1367
             A  ++W C+PA  I F   YSDS  L+++  IRF       RNS+  RC     GS N  
Sbjct  6     APKANWRCSPA--ISF---YSDSTKLYNRSSIRFYAGN---RNSSRIRCNLKATGSSN--  55

Query  1366  STSNQPERS-GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVH  1190
                NQPE S GIQLYRDIERLLT+TVKQSQD WG+S+DW E+EGAWVL P  +KP+L+VH
Sbjct  56    ---NQPETSTGIQLYRDIERLLTETVKQSQD-WGSSQDWDEIEGAWVLQPKTSKPKLVVH  111

Query  1189  FVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQE  1010
             F+GG+F GAAPQL+YRLFLERL +KD+LVIATPYASGFDHF+IADEVQFKFDRCLRFLQE
Sbjct  112   FIGGVFVGAAPQLSYRLFLERLRQKDVLVIATPYASGFDHFYIADEVQFKFDRCLRFLQE  171

Query  1009  TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQS  830
              VQDLP+FGIGHSLGSVIHLLIG+RYAV+R+GN+LM+FNNK+AS+A+PLFS VLVPM Q+
Sbjct  172   RVQDLPVFGIGHSLGSVIHLLIGARYAVKRNGNVLMAFNNKDASLAVPLFSSVLVPMMQN  231

Query  829   IGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPR  650
             +GP LSQIA+SPT+RLGAEMT+KQ+  LSP IMKQV PLVEQL PLY DLING+ENF PR
Sbjct  232   LGPVLSQIASSPTIRLGAEMTMKQIENLSPSIMKQVFPLVEQLTPLYTDLINGKENFTPR  291

Query  649   PEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGL  470
             PEET+RLI+SYYGISRNLL+KFKDDTIDETS LAQ+LS+ SAISSMLDMSIR+LPGDH L
Sbjct  292   PEETQRLIRSYYGISRNLLVKFKDDTIDETSTLAQVLSSGSAISSMLDMSIRTLPGDHAL  351

Query  469   PLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFG-VESNILRAEVSKEL  293
             PL QALP+ PP MTDAVN+S ELLANL AGTPWE   KEVGNT G V+S IL +  SK+L
Sbjct  352   PLQQALPNAPPGMTDAVNRSSELLANLTAGTPWENVTKEVGNTLGNVDSIILNSGNSKDL  411

Query  292   DLLVDVTTSWMVSNSGPRLLR  230
             D+LV+  TSWM SN+GP+LL+
Sbjct  412   DMLVETITSWMYSNTGPKLLQ  432



>ref|XP_007049895.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX94052.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=434

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/384 (79%), Positives = 342/384 (89%), Gaps = 0/384 (0%)
 Frame = -2

Query  1381  SFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPR  1202
             +++D +++NQ + S +QLY +IERLLT+TV+QSQ AWG S DW +VEGAWVL P ++KP+
Sbjct  50    NYDDPNSNNQKQPSSVQLYGEIERLLTETVRQSQGAWGGSSDWSQVEGAWVLQPKHSKPK  109

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
              +VHFVGGIF GAAPQLTYR FLERL EK +LVIATPYASGFDHFFIADEVQFKFDRCLR
Sbjct  110   SVVHFVGGIFVGAAPQLTYRWFLERLSEKGVLVIATPYASGFDHFFIADEVQFKFDRCLR  169

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
             FLQETV DLP FGIGHSLGSVIHLLIGSRYAVQRSGN+LM+FNNKEAS+AIPLFSPVLVP
Sbjct  170   FLQETVHDLPTFGIGHSLGSVIHLLIGSRYAVQRSGNVLMAFNNKEASLAIPLFSPVLVP  229

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             +AQSIGP LSQIA+SPT+R+GAEMTLKQ+   SPPIMKQVLPLVEQLPPLYMDL+ GRE+
Sbjct  230   VAQSIGPILSQIASSPTIRMGAEMTLKQIENFSPPIMKQVLPLVEQLPPLYMDLVKGRED  289

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F P+PEETRRLIKSYYGISRNLLIKFKDD+IDET  LAQ+LS+DSAISSMLDMSIR LPG
Sbjct  290   FSPKPEETRRLIKSYYGISRNLLIKFKDDSIDETPKLAQVLSSDSAISSMLDMSIRLLPG  349

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVS  302
             DHGLPL QALPDVPPAM DAVN+  E LANL  GTPWET AKEV NT G +S +LRAE+S
Sbjct  350   DHGLPLQQALPDVPPAMADAVNRGSEFLANLTVGTPWETVAKEVSNTLGTDSTVLRAEIS  409

Query  301   KELDLLVDVTTSWMVSNSGPRLLR  230
             K++ LLVDV TSWM SNSGP+LLR
Sbjct  410   KDIALLVDVITSWMASNSGPKLLR  433



>gb|KHG12981.1| Gut esterase 1 [Gossypium arboreum]
Length=435

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/384 (79%), Positives = 347/384 (90%), Gaps = 1/384 (0%)
 Frame = -2

Query  1381  SFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPR  1202
             +++D++ ++Q + S +QLYRDIERLLTDTV+QSQ AWG+S DW +VEGAW+L P  +KP+
Sbjct  52    NYDDSNRNSQTQSSSLQLYRDIERLLTDTVRQSQGAWGSSSDWSQVEGAWILKPKGSKPK  111

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
              +VHF+GGIF GAAPQLTYRLFLERL EK +LVIATPYASGFD+FFIADEVQFKFDRCLR
Sbjct  112   SVVHFIGGIFVGAAPQLTYRLFLERLSEKGVLVIATPYASGFDYFFIADEVQFKFDRCLR  171

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
             FLQETV DLP FGIGHSLGSVIHLLIGSRY +QRSGN+LM+FNNKEASVAIPLFSPVLVP
Sbjct  172   FLQETVHDLPTFGIGHSLGSVIHLLIGSRYGLQRSGNVLMAFNNKEASVAIPLFSPVLVP  231

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             MAQSIGPFLSQIA++PT+R+GAEMTLKQL +LSPPIMKQVLPLVEQLPPLYMDL+ GRE+
Sbjct  232   MAQSIGPFLSQIASTPTIRMGAEMTLKQLESLSPPIMKQVLPLVEQLPPLYMDLVKGRED  291

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F P+PEETR+LIKSYYGISRNLLIKFKDDTIDET  LAQ+LS++SAISSMLDMSIR LPG
Sbjct  292   FTPKPEETRQLIKSYYGISRNLLIKFKDDTIDETPNLAQVLSSESAISSMLDMSIRLLPG  351

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVS  302
             DHGLPL QALPDVPPAM DAVN+  E LANL+ GTPWET AKEV NTFGV+S ++RAE+S
Sbjct  352   DHGLPLQQALPDVPPAMADAVNRGSEFLANLSVGTPWETVAKEVSNTFGVDSPVVRAEIS  411

Query  301   KELDLLVDVTTSWMVSNSGPRLLR  230
             K++D+LVDV  SWM SNS  +LL+
Sbjct  412   KDVDILVDVIISWMASNSA-KLLK  434



>ref|XP_010249395.1| PREDICTED: uncharacterized protein LOC104591937 [Nelumbo nucifera]
Length=448

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/452 (71%), Positives = 360/452 (80%), Gaps = 19/452 (4%)
 Frame = -2

Query  1537  MSSWLCAPAPHIHFHP-----PY--------SDSAPLFHKRIRFSMSQLFIRNSNSGRCK  1397
             M++W  AP P +   P     P+         D +  FH R+ FS   L IR      C 
Sbjct  1     MANWFSAPRPSVASSPYPSKLPHIPCVRISRCDQSHDFH-RLPFS---LRIRLHRRSSCS  56

Query  1396  RIKVGSFN-DNSTSNQP-ERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLG  1223
              +   +F+  + TS +P E SG+QLY +IERL+T+T +QSQ  W TS DW E+EGAWVL 
Sbjct  57    SVANRTFHYTDDTSKKPRETSGVQLYSEIERLITETARQSQSGWRTSGDWSEIEGAWVLK  116

Query  1222  PINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQF  1043
             P N+KP  +VHF+GGIF GAAPQLTYRLFLERL EK  +VIATPYASGFDHF IADEVQF
Sbjct  117   PRNSKPTSVVHFIGGIFVGAAPQLTYRLFLERLSEKGAMVIATPYASGFDHFLIADEVQF  176

Query  1042  KFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPL  863
             KFDRCLRFLQE V DLP FGIGHSLGSVIHLLIGSRYA+QR+GN+LMSFNNKEAS+AIPL
Sbjct  177   KFDRCLRFLQEIVNDLPTFGIGHSLGSVIHLLIGSRYAIQRNGNVLMSFNNKEASLAIPL  236

Query  862   FSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMD  683
             FSPV++PMAQS GP LSQ  +SPTVRLGAEM +KQL  LSPPIMKQV PLVEQLPPLYMD
Sbjct  237   FSPVIIPMAQSFGPLLSQFTSSPTVRLGAEMAMKQLENLSPPIMKQVFPLVEQLPPLYMD  296

Query  682   LINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDM  503
             L+ GRE F P+PEET RL+KSYYGISRNLLIKFKDDTIDETS LAQ+LS+DSAISS+LDM
Sbjct  297   LVRGREEFSPKPEETHRLVKSYYGISRNLLIKFKDDTIDETSTLAQMLSSDSAISSLLDM  356

Query  502   SIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESN  323
             SIRSLPGDHGLPL QALPDVPPAM DAVN+ GE LANL AGT WE  AKEVGNT GV+S 
Sbjct  357   SIRSLPGDHGLPLKQALPDVPPAMADAVNRGGEFLANLTAGTAWEMVAKEVGNTLGVDST  416

Query  322   ILRAEVSKELDLLVDVTTSWMVSNSGPRLLRS  227
              LRAE+SK++DLLVDV TSWMVSNSG RLLRS
Sbjct  417   TLRAEISKDIDLLVDVITSWMVSNSGRRLLRS  448



>ref|XP_010112013.1| hypothetical protein L484_004700 [Morus notabilis]
 gb|EXC32358.1| hypothetical protein L484_004700 [Morus notabilis]
Length=438

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/439 (72%), Positives = 359/439 (82%), Gaps = 16/439 (4%)
 Frame = -2

Query  1504  IHFHPPYSDSAPLFHKR-IRFSMSQLFIRNS----NSGRCKRIKVGSFNDNSTSNQPERS  1340
             +H HPP+ +       R I FS S    R      ++ R  R ++   +D  T  QP  +
Sbjct  1     MHLHPPFHELQSQTQSRTIGFSYSAASRRGCGGVGHTYRRSRTRIYYNSDEPTRRQP--T  58

Query  1339  GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAA  1160
             GIQLY +IERLLTDTVKQSQD WG  +DW EVEGAWVL P +++P+ +VHFVGGIF GAA
Sbjct  59    GIQLYSEIERLLTDTVKQSQDGWGGLRDWTEVEGAWVLKPRSSEPKFVVHFVGGIFVGAA  118

Query  1159  PQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGI  980
             PQL YR FLERL +KD+LVIATPYASGFD+FFIADEVQFKFDRCLRFL++TV DLP FGI
Sbjct  119   PQLAYRFFLERLSQKDVLVIATPYASGFDYFFIADEVQFKFDRCLRFLRDTVSDLPTFGI  178

Query  979   GHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIAT  800
             GHSLGSVIHLLIGSRYAVQR+GN+LM+FNNKEAS AIPLFSPVLVPMAQS+GP LSQIA+
Sbjct  179   GHSLGSVIHLLIGSRYAVQRNGNVLMAFNNKEASSAIPLFSPVLVPMAQSVGPILSQIAS  238

Query  799   SPTVRLG---------AEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRP  647
             SPT+RLG         AEMTLKQLG LSPPIMKQVLPLVEQLPPLYMDL+NG+E+F P+P
Sbjct  239   SPTIRLGEMQNFLESVAEMTLKQLGNLSPPIMKQVLPLVEQLPPLYMDLVNGKEDFTPKP  298

Query  646   EETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLP  467
             EETRRLIKSYYGISRNLL+KFKDD+IDETS LAQ+LS++SAISSMLDMSIR LPGDH LP
Sbjct  299   EETRRLIKSYYGISRNLLVKFKDDSIDETSTLAQVLSSESAISSMLDMSIRLLPGDHALP  358

Query  466   LHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDL  287
             L QA+PDVPPAM DAVN+  E LANL+ GTPWET AKEVGNT G +S ILRAE+SK++DL
Sbjct  359   LQQAIPDVPPAMADAVNRGSEFLANLSVGTPWETVAKEVGNTLGTDSRILRAEISKDIDL  418

Query  286   LVDVTTSWMVSNSGPRLLR  230
             LVDV  SWM SN+G + LR
Sbjct  419   LVDVIASWMASNTGQKFLR  437



>ref|XP_007222288.1| hypothetical protein PRUPE_ppa005909mg [Prunus persica]
 gb|EMJ23487.1| hypothetical protein PRUPE_ppa005909mg [Prunus persica]
Length=438

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/418 (73%), Positives = 356/418 (85%), Gaps = 6/418 (1%)
 Frame = -2

Query  1465  FHKRIRFSMSQLFIRNSNSGRCKRIKV-GSFNDNSTSNQ-----PERSGIQLYRDIERLL  1304
             F+KR+         R SNS R  R ++  +++D++T  Q     P+ +GI+LY +IERLL
Sbjct  20    FNKRLLIQPQSRTFRLSNSHRHLRRRIYCNYDDDATKKQSQPQAPQPTGIKLYSEIERLL  79

Query  1303  TDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERL  1124
             T+TV+QSQ  W  S DW +VEGAWVL P  ++P+ +VHF+GGIF GAAPQLTYR+FLERL
Sbjct  80    TETVRQSQGRWAGSSDWTQVEGAWVLKPKTSEPKAVVHFIGGIFVGAAPQLTYRMFLERL  139

Query  1123  VEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLI  944
              E+ ILVIATPYASGFDHFFIADEVQFKFDRC RFL+ETVQDLP FGIGHSLGSVIHLLI
Sbjct  140   SERGILVIATPYASGFDHFFIADEVQFKFDRCYRFLKETVQDLPTFGIGHSLGSVIHLLI  199

Query  943   GSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTL  764
             GSRYAVQR+GN+LM+FNNKEAS A+PLFSPVLVP+AQ +GP LSQIA+SPTVR GAEMTL
Sbjct  200   GSRYAVQRNGNVLMAFNNKEASSAVPLFSPVLVPVAQGLGPILSQIASSPTVRFGAEMTL  259

Query  763   KQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKF  584
             KQ   LSPPIMKQVLPLVEQLPPLYMDL+ GRE+FVP+PEETRRLIKSYYGISRNLL+KF
Sbjct  260   KQFENLSPPIMKQVLPLVEQLPPLYMDLVKGREDFVPKPEETRRLIKSYYGISRNLLVKF  319

Query  583   KDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
             +DDTIDETS+LAQLLS+DSAISSMLDMSIR LPGDHGLPL QALPDVPPAM DAVN+  E
Sbjct  320   QDDTIDETSILAQLLSSDSAISSMLDMSIRLLPGDHGLPLQQALPDVPPAMADAVNRGSE  379

Query  403   LLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
             +LANL  GTPWET AKEVGN+ GV+S ILRAE+SK++ LLVDV  SW+ SN+GP+LL+
Sbjct  380   ILANLTVGTPWETVAKEVGNSLGVDSKILRAEISKDIGLLVDVVVSWIASNTGPKLLK  437



>ref|XP_008222304.1| PREDICTED: uncharacterized protein LOC103322193 [Prunus mume]
Length=438

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/419 (74%), Positives = 357/419 (85%), Gaps = 6/419 (1%)
 Frame = -2

Query  1465  FHKRIRFSMSQLFIRNSNSGRCKRIKV-GSFNDNSTSNQ-----PERSGIQLYRDIERLL  1304
             F+KR+         R SNS R  R ++  +++D++T  Q     P+ +GI+LY +IERLL
Sbjct  20    FNKRLLIQPQSRTFRLSNSHRHLRRRIYCNYDDDATKKQSQPQAPQPTGIKLYSEIERLL  79

Query  1303  TDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERL  1124
             T+TV+QSQ  W  S DW +VEGAWVL P  ++P+ +VHF+GGIF GAAPQLTYR+FLERL
Sbjct  80    TETVRQSQGRWPGSSDWTQVEGAWVLKPKTSEPKAVVHFIGGIFVGAAPQLTYRMFLERL  139

Query  1123  VEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLI  944
              E+ ILVIATPYASGFDHFFIADEVQFKFDRC RFL+ETVQDLP FGIGHSLGSVIHLLI
Sbjct  140   SERGILVIATPYASGFDHFFIADEVQFKFDRCYRFLKETVQDLPTFGIGHSLGSVIHLLI  199

Query  943   GSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTL  764
             GSRYAVQR+GN+LM+FNNKEAS A+PLFSPVLVP+AQ +GP LSQIA+SPTVR GAEMTL
Sbjct  200   GSRYAVQRNGNVLMAFNNKEASSAVPLFSPVLVPVAQGLGPILSQIASSPTVRFGAEMTL  259

Query  763   KQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKF  584
             KQ   LSPPIMKQVLPLVEQLPPLYMDL+ GRE+FVP+PEETRRLIKSYYGISRNLL+KF
Sbjct  260   KQFENLSPPIMKQVLPLVEQLPPLYMDLVKGREDFVPKPEETRRLIKSYYGISRNLLVKF  319

Query  583   KDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
             +DDTIDETS+LAQLLS+DSAISSMLDMSIR LPGDHGLPL QALPDVPPAM DAVN+  E
Sbjct  320   QDDTIDETSILAQLLSSDSAISSMLDMSIRLLPGDHGLPLQQALPDVPPAMADAVNRGSE  379

Query  403   LLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLRS  227
             +LANL  GTPWET AKEVGN+ GV+S ILRAE+SK++ LLVDV  SW+ SN+GP+LL+S
Sbjct  380   ILANLTVGTPWETVAKEVGNSLGVDSKILRAEISKDIGLLVDVVVSWIASNTGPKLLKS  438



>emb|CDP19004.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/390 (78%), Positives = 342/390 (88%), Gaps = 0/390 (0%)
 Frame = -2

Query  1399  KRIKVGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGP  1220
             +RI   + NDN   +  +++GIQLYRDIERLLT+TVKQSQ  W TS +W E+EGAWVL P
Sbjct  53    RRIYCSTANDNEARSSDKQTGIQLYRDIERLLTETVKQSQGDWRTSSNWSELEGAWVLRP  112

Query  1219  INTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFK  1040
              N+KP  IVHF+GGIF GAAPQLTYRLFLE L E+ ILVIATPYASGFDHF IADEVQFK
Sbjct  113   RNSKPVSIVHFIGGIFVGAAPQLTYRLFLESLAEEGILVIATPYASGFDHFLIADEVQFK  172

Query  1039  FDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLF  860
             FDRC R LQE  QDLP FGIGHSLGSVIHLLIGSRYAVQR+GN+LM+FNNKEAS+AIPLF
Sbjct  173   FDRCRRLLQEPEQDLPCFGIGHSLGSVIHLLIGSRYAVQRNGNVLMAFNNKEASIAIPLF  232

Query  859   SPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDL  680
             SPVLVPMAQSIGPFLSQ+A+SPT+RLGAEMTLKQL  LSPPIMKQVLPLVEQLPPLY +L
Sbjct  233   SPVLVPMAQSIGPFLSQVASSPTIRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYKEL  292

Query  679   INGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMS  500
             +NGRENF PRPEET+RLI+SYYGISRNLLIKFKDDTIDETSVLAQ+LS++SAISSMLDMS
Sbjct  293   VNGRENFTPRPEETKRLIRSYYGISRNLLIKFKDDTIDETSVLAQILSSESAISSMLDMS  352

Query  499   IRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNI  320
             IRSLPGDHGLPL QALPDVPPAM DAVN+ GE LA+L AGTPWET AKEV N+ G ++ +
Sbjct  353   IRSLPGDHGLPLQQALPDVPPAMADAVNRGGEFLASLTAGTPWETVAKEVSNSLGRDARL  412

Query  319   LRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
             +R E+SK++DLLV+V TSWM  N+  RLLR
Sbjct  413   VRPEMSKDMDLLVNVMTSWMKGNTSTRLLR  442



>ref|XP_009353471.1| PREDICTED: uncharacterized protein LOC103944726 [Pyrus x bretschneideri]
Length=442

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/444 (70%), Positives = 359/444 (81%), Gaps = 14/444 (3%)
 Frame = -2

Query  1534  SSWLCAPAPHIHFHPPYSDSAPLFHKRIRFSMSQLFIRNSNSGRCKRIKVGSFNDNSTSN  1355
             S W+ +P PH + HP  S     F KR+       F+  SNS R +R  +    D+ T+ 
Sbjct  3     SCWVRSPQPHPNLHPHQS-----FSKRLLIRPQSRFLSLSNSQRRRRSGICCNYDDETTR  57

Query  1354  QPER---------SGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPR  1202
             +  +         +GIQLY +IERLLT+TV+QSQ  W  + DW +VEGAWVL P N++P+
Sbjct  58    RQSQPPSPQGPQPTGIQLYSEIERLLTETVRQSQGRWDGTGDWNQVEGAWVLKPRNSEPK  117

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
              +VHF+GGIF GAAPQLTYR FLERL EK ILVIATPYASGFDHFFIADE QFKFDRC R
Sbjct  118   AVVHFIGGIFVGAAPQLTYRYFLERLSEKGILVIATPYASGFDHFFIADETQFKFDRCYR  177

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
             FL+E VQDLP FGIGHSLGSVIHLLIGSRYAVQR+GN+LM+FNNKEAS AIPLFSPVLVP
Sbjct  178   FLKEMVQDLPTFGIGHSLGSVIHLLIGSRYAVQRNGNVLMAFNNKEASSAIPLFSPVLVP  237

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             +AQ +GP LSQIA+SPTVRLGAEMTLKQ   LSPPIMKQVLPLVEQLPPLYMDL+ GRE+
Sbjct  238   VAQGLGPILSQIASSPTVRLGAEMTLKQFENLSPPIMKQVLPLVEQLPPLYMDLVKGRED  297

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F P+PEETRRL+KSYYGISRNLL+KFKDD IDETS LA+LLS+DSAIS+MLDMSIR LPG
Sbjct  298   FAPKPEETRRLVKSYYGISRNLLVKFKDDMIDETSTLAELLSSDSAISTMLDMSIRLLPG  357

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVS  302
             DHGLPL QALPDVPPAM DAVN+  E+LANL  GTPWET AKEVG+T+GV+S +LRAE S
Sbjct  358   DHGLPLQQALPDVPPAMADAVNRGSEMLANLTVGTPWETVAKEVGSTWGVDSKVLRAEAS  417

Query  301   KELDLLVDVTTSWMVSNSGPRLLR  230
             K++ LLVDV  +W+ SN+GP+LL+
Sbjct  418   KDIGLLVDVVAAWITSNTGPKLLK  441



>ref|XP_002512715.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50167.1| conserved hypothetical protein [Ricinus communis]
Length=441

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/445 (72%), Positives = 358/445 (80%), Gaps = 14/445 (3%)
 Frame = -2

Query  1537  MSSWLCAPAPHIHFHP------PYSDSAPLFHKRIRFSMSQLFIRNSNSGRCKRIKVGSF  1376
             M++ LC+   H H +         SD  P  H+R R  +  +        R  RI   ++
Sbjct  1     MANCLCSHQLHNHLNQFRNRFIGLSDHRP--HERRRCHL--VVADGPRHSRTARIYC-NY  55

Query  1375  NDNSTSNQPERS---GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKP  1205
             +D +    P  S   GI+LY  IERLLT+TV+QSQDAWG  KDW E+EGAWVL P ++ P
Sbjct  56    DDATRKPNPSSSSSSGIKLYGQIERLLTETVRQSQDAWGGLKDWTEIEGAWVLKPRSSPP  115

Query  1204  RLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCL  1025
             + +VHFVGGIF GAAPQLTYRLFLERL EK ILVIATPYASGFDHFFIADEVQFKFDRC 
Sbjct  116   KSVVHFVGGIFVGAAPQLTYRLFLERLAEKGILVIATPYASGFDHFFIADEVQFKFDRCF  175

Query  1024  RFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLV  845
             R LQETVQDLP FGIGHSLGSVIHLLIGSRYAVQR GN+LM+FNNKEAS AIPLFSPVLV
Sbjct  176   RALQETVQDLPTFGIGHSLGSVIHLLIGSRYAVQRGGNVLMAFNNKEASSAIPLFSPVLV  235

Query  844   PMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRE  665
             P+AQSIGPFLS+I +SPTVRLGAEMT KQL  LSPPIMKQVLPLVEQLPPLYMDL+ GRE
Sbjct  236   PVAQSIGPFLSEITSSPTVRLGAEMTFKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGRE  295

Query  664   NFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLP  485
             +F P+PEETRRLIKSYYGISRNLLIKFKDD IDETS LAQ+LS++SAISSMLDMSIR LP
Sbjct  296   DFSPKPEETRRLIKSYYGISRNLLIKFKDDAIDETSTLAQVLSSESAISSMLDMSIRLLP  355

Query  484   GDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEV  305
             GDHGLPL Q LPDVPPAM DAVN+  ELLANL  GTPWET AKEVG+T GV+S ILRAE 
Sbjct  356   GDHGLPLQQDLPDVPPAMADAVNRGSELLANLTVGTPWETVAKEVGSTLGVDSRILRAET  415

Query  304   SKELDLLVDVTTSWMVSNSGPRLLR  230
             SK+L LLVDV TSW+ SN+GPRLLR
Sbjct  416   SKDLHLLVDVITSWIASNTGPRLLR  440



>ref|XP_010530680.1| PREDICTED: uncharacterized protein LOC104807194 [Tarenaya hassleriana]
Length=449

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/390 (77%), Positives = 344/390 (88%), Gaps = 3/390 (1%)
 Frame = -2

Query  1381  SFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPR  1202
             S+ DN   ++P+ +GIQ+Y +IERLLTDTV+QSQ  WG S DW EVEG+WVL P N+KP+
Sbjct  61    SYEDND-KDRPQSTGIQVYGEIERLLTDTVRQSQGTWGGSSDWSEVEGSWVLKPRNSKPK  119

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
             ++VHF+GGIF GAAPQLTYRLFLERL EKDILVIATPY SGFDHFFIADEVQFKFDRC R
Sbjct  120   MVVHFIGGIFVGAAPQLTYRLFLERLAEKDILVIATPYPSGFDHFFIADEVQFKFDRCCR  179

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
              LQETVQDLP FG+GHSLGSVIHLLIGSRYAVQRSGN+LM+FNNKEAS+AIPLFSPVLVP
Sbjct  180   ALQETVQDLPSFGVGHSLGSVIHLLIGSRYAVQRSGNVLMAFNNKEASLAIPLFSPVLVP  239

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             MAQS+GP LSQIATSPTVR GAEMTLKQL  LSPPIMKQ+LPL+EQLPPLYMDL+NGRE+
Sbjct  240   MAQSLGPLLSQIATSPTVRRGAEMTLKQLENLSPPIMKQILPLMEQLPPLYMDLVNGRED  299

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F+P+PEETRRLIKSYYG+SRNLLIKFKDDTIDETS LAQ+LS +S+ISS LDMSIRSLPG
Sbjct  300   FIPKPEETRRLIKSYYGVSRNLLIKFKDDTIDETSTLAQVLSAESSISSKLDMSIRSLPG  359

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVS  302
             DHGLPL QALPDVPPAM DAVN+  ELLA++AAGTPWE+ AKEVG++ G++   LRA+ S
Sbjct  360   DHGLPLQQALPDVPPAMADAVNRGSELLASMAAGTPWESVAKEVGDSLGMDPTFLRADRS  419

Query  301   KELDLLVDVTTSWMVSNSG--PRLLRS*IR  218
             KEL  LVD  +SWM S++   P+LL+  I+
Sbjct  420   KELHQLVDSLSSWMASSADPTPKLLKKPIK  449



>ref|XP_006423779.1| hypothetical protein CICLE_v10028467mg [Citrus clementina]
 gb|ESR37019.1| hypothetical protein CICLE_v10028467mg [Citrus clementina]
Length=440

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/385 (79%), Positives = 339/385 (88%), Gaps = 1/385 (0%)
 Frame = -2

Query  1381  SFNDNSTSNQP-ERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKP  1205
             +++D+   NQP   SGIQLYRDIERLLT+TV+QSQ AWG S +W EVEGAWVL P ++KP
Sbjct  55    NYDDDRGRNQPPNSSGIQLYRDIERLLTETVQQSQGAWGGSANWSEVEGAWVLKPRSSKP  114

Query  1204  RLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCL  1025
               +VHF+GGIF GAAPQLTYRLFLERL EK I+VIATPYASGFD+F+IADEVQ K DRCL
Sbjct  115   WSVVHFIGGIFVGAAPQLTYRLFLERLSEKGIMVIATPYASGFDYFYIADEVQLKADRCL  174

Query  1024  RFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLV  845
             RFLQETVQDLP FGIGHSLGSVIHLLIGSRYAV R+GNILM+FNN+EASVAIPLFSPV V
Sbjct  175   RFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFV  234

Query  844   PMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRE  665
             PMAQSIGP LSQIA+SPTVRLGAEMTLKQL  LSPPIMKQVLPLVEQLPPLYMDL+ GRE
Sbjct  235   PMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGRE  294

Query  664   NFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLP  485
              F P+PEETRRLIKSYYGISRNLLIKFKDD+IDETS LAQ+LS+DSAISSMLDMSIR LP
Sbjct  295   EFTPKPEETRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLP  354

Query  484   GDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEV  305
             GDHGLPL QALPDVPPAM DAVN+  EL+ANL  GTPWET  KEV N+FGV+S ILRA++
Sbjct  355   GDHGLPLQQALPDVPPAMADAVNRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADI  414

Query  304   SKELDLLVDVTTSWMVSNSGPRLLR  230
             SK+++ LVDV +SWM SN   +LLR
Sbjct  415   SKDIEHLVDVISSWMASNRSTKLLR  439



>ref|XP_006478569.1| PREDICTED: uncharacterized protein LOC102625268 [Citrus sinensis]
Length=442

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/381 (80%), Positives = 334/381 (88%), Gaps = 0/381 (0%)
 Frame = -2

Query  1372  DNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIV  1193
             D   +  P  SGIQLYRDIERLLT+TV+QSQ AWG S +W EVEGAWVL P ++KP  +V
Sbjct  61    DRGRNQPPNSSGIQLYRDIERLLTETVQQSQGAWGGSANWSEVEGAWVLKPRSSKPWSVV  120

Query  1192  HFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQ  1013
             HF+GGIF GAAPQLTYRLFLERL EK I+VIATPYASGFD+F+IADEVQ K DRCLRFLQ
Sbjct  121   HFIGGIFVGAAPQLTYRLFLERLSEKGIMVIATPYASGFDYFYIADEVQLKADRCLRFLQ  180

Query  1012  ETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQ  833
             ETVQDLP FGIGHSLGSVIHLLIGSRYAV R+GNILM+FNN+EASVAIPLFSPV VPMAQ
Sbjct  181   ETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQ  240

Query  832   SIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVP  653
             SIGP LSQIA+SPTVRLGAEMTLKQL  LSPPIMKQVLPLVEQLPPLYMDL+ GRE F P
Sbjct  241   SIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTP  300

Query  652   RPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHG  473
             +PEETRRLIKSYYGISRNLLIKFKDD+IDETS LAQ+LS+DSAISSMLDMSIR LPGDHG
Sbjct  301   KPEETRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLPGDHG  360

Query  472   LPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKEL  293
             LPL QALPDVPPAM DAVN+  EL+ANL  GTPWET  KEV N+FGV+S ILRA++SK++
Sbjct  361   LPLQQALPDVPPAMADAVNRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADISKDI  420

Query  292   DLLVDVTTSWMVSNSGPRLLR  230
             + LVDV +SWM SN   +LLR
Sbjct  421   EHLVDVISSWMASNRSTKLLR  441



>ref|XP_008390242.1| PREDICTED: uncharacterized protein LOC103452516 [Malus domestica]
Length=442

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/444 (69%), Positives = 355/444 (80%), Gaps = 14/444 (3%)
 Frame = -2

Query  1534  SSWLCAPAPHIHFHPPYSDSAPLFHKRIRFSMSQLFIRNSNSGRCKRIKVGSFNDNSTSN  1355
             S W+ +P PH + HP  S     F KR+        +   NS R +R  +    D+ T+ 
Sbjct  3     SCWVRSPQPHPNLHPHQS-----FSKRLLIRQQSRVLSLPNSQRRRRSGICCNYDDETTR  57

Query  1354  QPER---------SGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPR  1202
             +  +         +GIQLY +IERLLT+TV+QSQ  W  + DW +VEGAWVL P N++P+
Sbjct  58    RQSQPPSPQGPQPTGIQLYSEIERLLTETVRQSQGRWDGTGDWNQVEGAWVLKPRNSEPK  117

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
              +VHF+GG+F GAAPQLTYRLFLERL EK ILVIATPYASGFDHFFIADE QFKFDRC R
Sbjct  118   AVVHFIGGVFVGAAPQLTYRLFLERLSEKGILVIATPYASGFDHFFIADETQFKFDRCYR  177

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
             FL+ETVQDLP FGIGHSLGSVIHLLIGSRYAVQR+GN+LM+FNNKEAS AIPLFSPVLVP
Sbjct  178   FLKETVQDLPTFGIGHSLGSVIHLLIGSRYAVQRNGNVLMAFNNKEASSAIPLFSPVLVP  237

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             +AQ +GP LSQIA+SPTVRLGAEMTLKQ   LSPPIMKQVLPLVEQLPPLYMDL+ GRE+
Sbjct  238   VAQGLGPILSQIASSPTVRLGAEMTLKQFENLSPPIMKQVLPLVEQLPPLYMDLVKGRED  297

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F P+PEET RL+KSYYGISRNLL+KFKDD IDETS LA+LLS+DSAI SMLDMSIR LPG
Sbjct  298   FAPKPEETXRLVKSYYGISRNLLVKFKDDMIDETSTLAELLSSDSAIXSMLDMSIRLLPG  357

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVS  302
             DHGLP  Q LPDVPPAM DAVN+  E+LANL  GTPWET AKEVG+T+GV+S +LRAE S
Sbjct  358   DHGLPXQQTLPDVPPAMADAVNRGSEMLANLTVGTPWETVAKEVGSTWGVDSKVLRAEAS  417

Query  301   KELDLLVDVTTSWMVSNSGPRLLR  230
             K++ LLVDV  +W+ SN+GP+LL+
Sbjct  418   KDVGLLVDVVAAWITSNTGPKLLK  441



>ref|XP_004141151.1| PREDICTED: uncharacterized protein LOC101208391 [Cucumis sativus]
 gb|KGN59777.1| hypothetical protein Csa_3G845440 [Cucumis sativus]
Length=440

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/434 (71%), Positives = 356/434 (82%), Gaps = 11/434 (3%)
 Frame = -2

Query  1507  HIHFHPPYSDSAP-LFHKRIRFSMSQLFI----RNSNSGRCKRIKVGSFNDNSTSNQPER  1343
             H H HP    S P L H+ +R+   +L I    R S     +R ++     +S + QP  
Sbjct  9     HTHRHP---HSHPVLHHQSLRYHKFKLPIALTGRQSRHQFIRRTRIKCNYQDSGNEQPPP  65

Query  1342  S---GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIF  1172
             S    +QLY DIERLLT+TV+QSQ+AWG  KDW EVEGAWVL P NT P+ +VHFVGGIF
Sbjct  66    STSTALQLYSDIERLLTETVRQSQEAWGGLKDWTEVEGAWVLKPRNTTPKYVVHFVGGIF  125

Query  1171  AGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLP  992
              GAAPQLTYRLFLERL EK I +IATPYASGFD+F IADEVQFKFDRC R   ++VQDLP
Sbjct  126   VGAAPQLTYRLFLERLSEKGIFIIATPYASGFDYFLIADEVQFKFDRCHRAFLDSVQDLP  185

Query  991   IFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLS  812
             IFG+GHSLGSVIHLLIGSRYAV+RSGN+LM+FNNKEAS A+PLFSPVLVPMAQS+GP LS
Sbjct  186   IFGVGHSLGSVIHLLIGSRYAVERSGNVLMAFNNKEASSAVPLFSPVLVPMAQSMGPLLS  245

Query  811   QIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRR  632
             QIA+SPT RLGAEMT+KQL  LSPPI+KQVLPLVEQLPPLYMDL+ GRE+F P+PEETRR
Sbjct  246   QIASSPTFRLGAEMTMKQLENLSPPIVKQVLPLVEQLPPLYMDLVRGREDFTPKPEETRR  305

Query  631   LIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
             ++KSYYGISRNLLIKFKDDTIDET +LAQLLS++SAISSMLDMS R+LPG+HGLPL Q L
Sbjct  306   IVKSYYGISRNLLIKFKDDTIDETLILAQLLSSESAISSMLDMSTRALPGNHGLPLQQGL  365

Query  451   PDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVT  272
             PD+PPAM DAVN+  EL +NL AGTPWET A+EVGNT GV+S IL+AE SK+L+LLV+V 
Sbjct  366   PDIPPAMADAVNRGSELFSNLTAGTPWETVAREVGNTLGVDSKILQAEASKDLNLLVEVV  425

Query  271   TSWMVSNSGPRLLR  230
             TSWM SN GP+LLR
Sbjct  426   TSWMSSNIGPKLLR  439



>ref|XP_002299369.2| hypothetical protein POPTR_0001s12540g [Populus trichocarpa]
 gb|EEE84174.2| hypothetical protein POPTR_0001s12540g [Populus trichocarpa]
Length=445

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/370 (80%), Positives = 326/370 (88%), Gaps = 0/370 (0%)
 Frame = -2

Query  1339  GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAA  1160
              IQLY  IERLLT+T +QSQD+WG S DW EVEGAW+L P  ++P+ IVHF+GG+F GAA
Sbjct  75    AIQLYNQIERLLTETARQSQDSWGGSNDWSEVEGAWILKPKGSRPKSIVHFIGGVFVGAA  134

Query  1159  PQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGI  980
             PQLTYRLFLERL EK ILVIATPYASGFD+FF ADEVQFKFDRC R LQETVQD+P FGI
Sbjct  135   PQLTYRLFLERLAEKGILVIATPYASGFDYFFTADEVQFKFDRCFRSLQETVQDIPTFGI  194

Query  979   GHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIAT  800
             GHSLGSVIHLLIGSRYAVQRSGNI M+FNNKEAS AIPLFSPVLVPMAQS+GPFLSQIA+
Sbjct  195   GHSLGSVIHLLIGSRYAVQRSGNIFMAFNNKEASAAIPLFSPVLVPMAQSLGPFLSQIAS  254

Query  799   SPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKS  620
             SPTVRLGAEMT+KQL +LSPPIMKQVLPLVEQLPPLYMDL+NGRE+F P+PEETRRLIKS
Sbjct  255   SPTVRLGAEMTMKQLESLSPPIMKQVLPLVEQLPPLYMDLVNGREDFSPKPEETRRLIKS  314

Query  619   YYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVP  440
             YYG+SRNLLIKFKDD IDET  LAQ+L +++AISSMLDMSIR LPGDHGLPL QA PDVP
Sbjct  315   YYGVSRNLLIKFKDDVIDETPTLAQVLGSEAAISSMLDMSIRVLPGDHGLPLQQAFPDVP  374

Query  439   PAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWM  260
             PAM DAVN+  EL ANL  GTPWE  AKEVG+T GV+S ILRA+ SK++D LVDV  SWM
Sbjct  375   PAMADAVNQGSELFANLTVGTPWENVAKEVGSTLGVDSRILRAQASKDVDNLVDVIISWM  434

Query  259   VSNSGPRLLR  230
              SNSGPRLLR
Sbjct  435   ASNSGPRLLR  444



>ref|XP_006395236.1| hypothetical protein EUTSA_v10004270mg [Eutrema salsugineum]
 gb|ESQ32522.1| hypothetical protein EUTSA_v10004270mg [Eutrema salsugineum]
Length=429

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/422 (73%), Positives = 354/422 (84%), Gaps = 7/422 (2%)
 Frame = -2

Query  1477  SAPLFHKRIRFSMSQLFIRNSNS------GRCKRIKVGSFNDNSTSNQPERSGIQLYRDI  1316
             ++P F  R RF       R+ +S       R  R    S+ +    ++P+ SGIQ+Y +I
Sbjct  8     TSPSFSPRRRFCSFSCSRRSLSSVLKLGKERVSRRVFCSYEEKD-RDRPQSSGIQVYGEI  66

Query  1315  ERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLF  1136
             ERLLT+TVKQSQ + G S DW EVEGAWVL P N+KP++IVHF+GGIF GAAPQLTYRLF
Sbjct  67    ERLLTETVKQSQRSSGGSSDWSEVEGAWVLKPRNSKPKMIVHFIGGIFVGAAPQLTYRLF  126

Query  1135  LERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVI  956
             LERL EKD+LVIATPYASGFDHF IADEVQFKFDRC R LQETVQDLP FGIGHSLGSVI
Sbjct  127   LERLAEKDVLVIATPYASGFDHFSIADEVQFKFDRCCRSLQETVQDLPSFGIGHSLGSVI  186

Query  955   HLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGA  776
             HLLIGSRYAVQRSGN+ M+FNNKEAS+AIPLFSPVLVPMAQS+GP LSQIATSPTVRLGA
Sbjct  187   HLLIGSRYAVQRSGNVFMAFNNKEASLAIPLFSPVLVPMAQSLGPLLSQIATSPTVRLGA  246

Query  775   EMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNL  596
             EMT KQL TLSPPIMKQ+LPLVEQLPPLYMDL+ GRE+F+P+PEETRRL++SYYGISRNL
Sbjct  247   EMTRKQLETLSPPIMKQILPLVEQLPPLYMDLVKGREDFIPKPEETRRLVRSYYGISRNL  306

Query  595   LIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVN  416
             LIKF+DDTIDETS+LAQ+L  +S+ISS LDMSIR+LPGDHGLPL QALPDVPPAM +AVN
Sbjct  307   LIKFEDDTIDETSILAQVLGVESSISSKLDMSIRTLPGDHGLPLQQALPDVPPAMAEAVN  366

Query  415   KSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRL  236
             +  E LAN+A GTPWE+ AKEVG + G +SNILRA++SK+L LLVD  TSWM SN GP+L
Sbjct  367   RGSEFLANIAVGTPWESMAKEVGGSLGKDSNILRADMSKDLALLVDAVTSWMASNMGPKL  426

Query  235   LR  230
             LR
Sbjct  427   LR  428



>ref|XP_002303731.2| hypothetical protein POPTR_0003s15700g [Populus trichocarpa]
 gb|EEE78710.2| hypothetical protein POPTR_0003s15700g [Populus trichocarpa]
Length=441

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/368 (80%), Positives = 326/368 (89%), Gaps = 0/368 (0%)
 Frame = -2

Query  1339  GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAA  1160
              IQLY  IERLLT+T +QSQD WG SKDW EVEG+WVL P +++P+ +VHF+GGIF GAA
Sbjct  74    AIQLYNQIERLLTETSRQSQDYWGGSKDWSEVEGSWVLKPKSSRPKSVVHFIGGIFVGAA  133

Query  1159  PQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGI  980
             PQLTYRLFLERL EK +LVIATPYASGFD+FFIADEVQFKFDRCLRFLQETVQD+P FGI
Sbjct  134   PQLTYRLFLERLAEKGVLVIATPYASGFDYFFIADEVQFKFDRCLRFLQETVQDVPTFGI  193

Query  979   GHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIAT  800
             GHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS AIPLFSPVLVP+AQS GPFLSQIA+
Sbjct  194   GHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASSAIPLFSPVLVPVAQSFGPFLSQIAS  253

Query  799   SPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKS  620
             SPTVRLGAEMT+KQL   SPPIMKQV PLVEQLPPLYMDL+NGRE+F P+PEETRRLIKS
Sbjct  254   SPTVRLGAEMTMKQLENFSPPIMKQVFPLVEQLPPLYMDLVNGREDFSPKPEETRRLIKS  313

Query  619   YYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVP  440
             YYGISRNLLIKF+DD IDETS+LAQ+LS+++AISSMLDMSIR LPGDHGLPL Q  PDVP
Sbjct  314   YYGISRNLLIKFRDDAIDETSMLAQVLSSEAAISSMLDMSIRMLPGDHGLPLQQVFPDVP  373

Query  439   PAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWM  260
             PAM DAVN+  EL ANL  GTPWET AKEVGNT G +S+ILRA  SK++D LV+V  SWM
Sbjct  374   PAMADAVNRGSELFANLTMGTPWETVAKEVGNTLGADSSILRARASKDVDQLVEVIISWM  433

Query  259   VSNSGPRL  236
              SNSGP+ 
Sbjct  434   ASNSGPKF  441



>ref|XP_004296988.1| PREDICTED: uncharacterized protein LOC101304763 [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/441 (69%), Positives = 358/441 (81%), Gaps = 8/441 (2%)
 Frame = -2

Query  1537  MSSWLCAPAPHIHFHPPYSDSAPLFHKRIRFSMSQLFIR--NSNSGRCKRIKVGSFNDN-  1367
             M+SW+ +    +H +P       L  KRI       F+R  NS+ G  +     +F+D  
Sbjct  1     MASWVRSA--QLHSYPGVHHHQSL-KKRIEIQQQGQFLRLPNSHRGHLRGRVFCNFDDEL  57

Query  1366  -STSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVH  1190
                 +QP+ +G+QLY +IERLLT+TV+QSQ  W  S DW +VEGAWVL P   KP  +VH
Sbjct  58    AKKESQPQPTGVQLYSEIERLLTETVRQSQGGWNDSSDWSQVEGAWVLKPKTLKPTAVVH  117

Query  1189  FVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQE  1010
             F+GGIF GAAPQLTYR FLERL EK ILVIATPY SGFDHFFIAD+VQFKFDRC RF ++
Sbjct  118   FIGGIFVGAAPQLTYRFFLERLAEKGILVIATPYPSGFDHFFIADQVQFKFDRCYRFFKD  177

Query  1009  TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQS  830
             T++DLPIFG+GHSLGSVIHLLIGSRYAVQR+GN+LM+FNN+EAS A+PLFSPVLVP+AQ 
Sbjct  178   TIEDLPIFGLGHSLGSVIHLLIGSRYAVQRNGNVLMAFNNREASYAVPLFSPVLVPVAQR  237

Query  829   IGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPR  650
             +GP LSQIA+SPT RLGAEMT++    LSPPIMKQVLPLVEQLPPLYM+L+NGRE+FVP+
Sbjct  238   LGPILSQIASSPTFRLGAEMTMRNFENLSPPIMKQVLPLVEQLPPLYMELVNGREDFVPK  297

Query  649   PEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGL  470
             PEETRRLIKSYYGISRNLL++FKDDTIDETS+LAQ+LS+DSAISSMLDMS R LPGDH L
Sbjct  298   PEETRRLIKSYYGISRNLLVRFKDDTIDETSILAQVLSSDSAISSMLDMSTRLLPGDHAL  357

Query  469   PLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVES-NILRAEVSKEL  293
             PL QA+PDVPPAM DAVN+  E+LANL  GTPWE+ AKEVGN+ GV+S  ILRAEV+K+L
Sbjct  358   PLQQAIPDVPPAMADAVNRGSEMLANLTVGTPWESVAKEVGNSLGVDSTKILRAEVAKDL  417

Query  292   DLLVDVTTSWMVSNSGPRLLR  230
             DLLVDV  SWM SN+GPRLL+
Sbjct  418   DLLVDVVASWMASNTGPRLLK  438



>ref|XP_008465170.1| PREDICTED: uncharacterized protein LOC103502836 isoform X1 [Cucumis 
melo]
Length=440

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/434 (71%), Positives = 354/434 (82%), Gaps = 11/434 (3%)
 Frame = -2

Query  1507  HIHFHPPYSDSAP-LFHKRIRFSMSQLFI----RNSNSGRCKRIKVGSFNDNSTSNQPER  1343
             H H HP    S P L H+  R+   +L I    R S     +R ++     +S + QP  
Sbjct  9     HTHRHP---HSHPVLHHQSQRYHKFKLPIALVGRQSRHQFIQRSRINCNYQDSGNEQPPP  65

Query  1342  S---GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIF  1172
             S    +QLY DIERLLT+TV+QSQ+AWG  KDW EVEGAWVL P NT P+ +VHFVGGIF
Sbjct  66    STSTALQLYSDIERLLTETVRQSQEAWGGLKDWTEVEGAWVLKPRNTTPKYVVHFVGGIF  125

Query  1171  AGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLP  992
              GAAPQLTYRLFLERL EK + +IATPYASGFD+F IADEVQFKFDRC R   ++VQDLP
Sbjct  126   VGAAPQLTYRLFLERLSEKGVFIIATPYASGFDYFLIADEVQFKFDRCHRAFLDSVQDLP  185

Query  991   IFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLS  812
              FGIGHSLGSVIHLLIGSRYAV+RSGN+LM+FNNKEAS A+PLFSPVLVPMAQS+GP LS
Sbjct  186   TFGIGHSLGSVIHLLIGSRYAVERSGNVLMAFNNKEASSAVPLFSPVLVPMAQSMGPLLS  245

Query  811   QIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRR  632
             QIA+SPT RLGAEMT+KQL  LSPPI+KQVLPLVEQLPPLYMDL+ GR++F P+PEETRR
Sbjct  246   QIASSPTFRLGAEMTMKQLENLSPPIVKQVLPLVEQLPPLYMDLVRGRQDFTPKPEETRR  305

Query  631   LIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
             ++KSYYGISRNLLIKFKDDTIDET +LAQLLS++SAISSMLDMS R+LPG+HGLPL Q L
Sbjct  306   IVKSYYGISRNLLIKFKDDTIDETLILAQLLSSESAISSMLDMSTRALPGNHGLPLQQGL  365

Query  451   PDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVT  272
             PD+PPAM DAVN+  EL +NL AGTPWET AKEVGNT GV+S IL+AE SK+L+LLV+V 
Sbjct  366   PDIPPAMADAVNRGSELFSNLTAGTPWETVAKEVGNTLGVDSKILQAEASKDLNLLVEVV  425

Query  271   TSWMVSNSGPRLLR  230
             TSWM SN GP+LLR
Sbjct  426   TSWMSSNIGPKLLR  439



>ref|XP_006585864.1| PREDICTED: uncharacterized protein LOC100820080 isoform X1 [Glycine 
max]
 gb|KHN25786.1| hypothetical protein glysoja_044676 [Glycine soja]
Length=432

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/441 (68%), Positives = 354/441 (80%), Gaps = 15/441 (3%)
 Frame = -2

Query  1537  MSSWLCAPAPHIHFHPPYSDSAPLFHK-----RIRFSMSQLFIRNSNSGRCKRIKVGSFN  1373
             M++ LC P+  +      +DS  L  K     R RF  +      SN+          +N
Sbjct  1     MATSLCTPSYRVTLKLYGTDSHKLNAKPSVRYRRRFGTTTRICCTSNN----------YN  50

Query  1372  DNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIV  1193
             DN+   +P+   IQ+Y  IERLLTD+V+QSQD W  S DW EVEGAW+L P +++P  +V
Sbjct  51    DNNIQRRPQSEAIQVYSQIERLLTDSVRQSQDGWWGSPDWSEVEGAWILKPKSSEPNYVV  110

Query  1192  HFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQ  1013
             HF+GGIF GAAPQLTYR FLERL EK IL+IATPYASGFDHF IADEVQFKFDRC R LQ
Sbjct  111   HFIGGIFVGAAPQLTYRRFLERLSEKGILIIATPYASGFDHFLIADEVQFKFDRCYRTLQ  170

Query  1012  ETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQ  833
             ET+QDLPIFG+GHSLGSV+HLLIGSRYAVQRSGN+LM+FNNKEAS A+PLFSPV+VPMAQ
Sbjct  171   ETIQDLPIFGVGHSLGSVVHLLIGSRYAVQRSGNVLMAFNNKEASSAVPLFSPVIVPMAQ  230

Query  832   SIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVP  653
             +IGP LS I +SPT+R GAEMTLKQL  +SPPIMKQVLPLVEQLPPLYMDL+ GRE+F P
Sbjct  231   TIGPLLSDIFSSPTLRAGAEMTLKQLENVSPPIMKQVLPLVEQLPPLYMDLVKGREDFSP  290

Query  652   RPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHG  473
             +PEETRRLIKSYYGISRNLLIKF+DD IDETS LAQ+LS++SAISS+LDMSIR LPGDHG
Sbjct  291   KPEETRRLIKSYYGISRNLLIKFQDDLIDETSTLAQVLSSESAISSVLDMSIRKLPGDHG  350

Query  472   LPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKEL  293
             LPL QALP+VPPAM DAVN+  ELL+NL  GTPWE  AKEVGN+ G++S +LRAEVSK++
Sbjct  351   LPLQQALPNVPPAMADAVNRGSELLSNLTVGTPWEIVAKEVGNSLGMDSGVLRAEVSKDM  410

Query  292   DLLVDVTTSWMVSNSGPRLLR  230
             D+LVDV  +W+ SN+GP+LLR
Sbjct  411   DMLVDVIAAWIASNAGPKLLR  431



>ref|XP_011020951.1| PREDICTED: uncharacterized protein LOC105123144 isoform X2 [Populus 
euphratica]
Length=441

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/368 (80%), Positives = 325/368 (88%), Gaps = 0/368 (0%)
 Frame = -2

Query  1339  GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAA  1160
              IQLY  IERLLT+T +QSQD WG SKDW EVEG+WVL P +++P+ +VHF+GGIF GAA
Sbjct  74    AIQLYNQIERLLTETSRQSQDYWGGSKDWSEVEGSWVLKPKSSRPKSVVHFIGGIFVGAA  133

Query  1159  PQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGI  980
             PQLTYRLFLERL EK +LVIATPYASGFD+FFIADEVQFKFDRCLRFL+ETVQD+P +GI
Sbjct  134   PQLTYRLFLERLAEKGVLVIATPYASGFDYFFIADEVQFKFDRCLRFLEETVQDVPTYGI  193

Query  979   GHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIAT  800
             GHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS AIPLFSPVLVP+AQS GPFLSQIA+
Sbjct  194   GHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASSAIPLFSPVLVPVAQSFGPFLSQIAS  253

Query  799   SPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKS  620
             SPTVRLGAEMT+KQL   SPPIMKQV PLVEQLPPLYMDL+NGRE+F P+PEETRRLIKS
Sbjct  254   SPTVRLGAEMTMKQLENFSPPIMKQVFPLVEQLPPLYMDLVNGREDFSPKPEETRRLIKS  313

Query  619   YYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVP  440
             YYGISRNLLIKF+DD IDETS+LAQ+LS+++AISSMLDMSIR LPGDHGLPL Q  PDVP
Sbjct  314   YYGISRNLLIKFRDDAIDETSMLAQVLSSEAAISSMLDMSIRMLPGDHGLPLQQVFPDVP  373

Query  439   PAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWM  260
             PAM DAVN+  EL ANL  GTPWET AKEVGNT G  S+ILRA  SK++D LVDV  SWM
Sbjct  374   PAMADAVNRGSELFANLTMGTPWETVAKEVGNTLGTNSSILRARASKDVDQLVDVIISWM  433

Query  259   VSNSGPRL  236
              SNSGP+ 
Sbjct  434   ASNSGPKF  441



>emb|CDX85311.1| BnaC07g26220D [Brassica napus]
Length=431

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/400 (73%), Positives = 340/400 (85%), Gaps = 0/400 (0%)
 Frame = -2

Query  1426  IRNSNSGRCKRIKVGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKE  1247
             IR       +R+      +N+  ++P+ SGIQ+Y +IERLLT+TVKQSQ ++  + DW E
Sbjct  32    IRFDEERVSRRVFCSDNQENTNKDRPQPSGIQVYGEIERLLTETVKQSQSSFAGTADWSE  91

Query  1246  VEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHF  1067
             VEGAWVL P N+ P+++ HF+GGIF GAAPQLTYRLFLERL EKD+LVIATPYASGFDHF
Sbjct  92    VEGAWVLRPRNSNPKMVAHFIGGIFVGAAPQLTYRLFLERLAEKDVLVIATPYASGFDHF  151

Query  1066  FIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNK  887
              IADEVQFKFDRC R L E+VQDLP FGIGHSLGS+IHLLIGSRYAVQR+GN+ M+FNNK
Sbjct  152   AIADEVQFKFDRCCRSLHESVQDLPSFGIGHSLGSLIHLLIGSRYAVQRNGNVFMAFNNK  211

Query  886   EASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplve  707
             EAS+AIPLFSPVLVPMAQS+GP LSQ+ATSPTVRLGAEMT KQL TLSPPIMKQ+LPLVE
Sbjct  212   EASLAIPLFSPVLVPMAQSLGPLLSQVATSPTVRLGAEMTRKQLETLSPPIMKQILPLVE  271

Query  706   qlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDS  527
             QLPPLYMDL+ GRE+F+P+PEETRRLI+SYYGISRNLLIKF+DD+IDET +LAQ+L  +S
Sbjct  272   QLPPLYMDLVKGREDFIPKPEETRRLIRSYYGISRNLLIKFEDDSIDETPILAQVLGVES  331

Query  526   AISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVG  347
             +ISS LDMSIR+LPGDHGLPL QALPDVPPAM DAVN+  E LAN+A GTPWE+ AKEVG
Sbjct  332   SISSKLDMSIRTLPGDHGLPLQQALPDVPPAMADAVNRGSEFLANMAVGTPWESVAKEVG  391

Query  346   NTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLRS  227
              T G++S ILRA  SK+L  LVD  TSWM SN GP+LLRS
Sbjct  392   GTLGMDSKILRAYTSKDLAQLVDAITSWMASNMGPKLLRS  431



>ref|XP_008369581.1| PREDICTED: uncharacterized protein LOC103433127 [Malus domestica]
Length=442

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/444 (68%), Positives = 361/444 (81%), Gaps = 14/444 (3%)
 Frame = -2

Query  1534  SSWLCAPAPHIHFHPPYSDSAPLFHKRIRF-SMSQLFIRNSNSGRCKRIKVGSFNDNSTS  1358
             S W+ +P PH + HP  S     F KR+   S S++   +++  R +     +++D +T 
Sbjct  3     SCWVSSPQPHPNLHPHQS-----FSKRLLIQSQSRVLSLSNSQRRRRSRICCNYDDETTG  57

Query  1357  NQPER--------SGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPR  1202
              Q +         +GIQLY +IER+LT+TV+Q+Q  W  + DW +VEGAWVL P N++P+
Sbjct  58    RQSQPPIPQGPQPTGIQLYSEIERVLTETVRQAQGRWDGTGDWTQVEGAWVLKPRNSEPK  117

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
              +VHF+GGIF GAAPQLTYRLFLERL EK ILVIATPYASGFDHFFIADE Q KFDRC R
Sbjct  118   AVVHFIGGIFVGAAPQLTYRLFLERLSEKGILVIATPYASGFDHFFIADETQIKFDRCYR  177

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
             FL+ETVQDLP FGIGHSLGSVIHLLIGSRYAVQR+GN+LM+FNNKEAS  IPLFSPV+VP
Sbjct  178   FLKETVQDLPTFGIGHSLGSVIHLLIGSRYAVQRNGNVLMAFNNKEASSTIPLFSPVVVP  237

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             +AQ +GP L+QIA+SPT+RLGAEMTLKQ   LSPPIMKQVLPLVEQLPPLYMDL+NGRE+
Sbjct  238   VAQGLGPILAQIASSPTIRLGAEMTLKQFENLSPPIMKQVLPLVEQLPPLYMDLVNGRED  297

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F P+PEETRRL+KSYYGISRNLL+KF+DD IDETS LAQLL ++SAISSMLDMSIR LPG
Sbjct  298   FAPKPEETRRLVKSYYGISRNLLVKFRDDMIDETSTLAQLLISNSAISSMLDMSIRLLPG  357

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVS  302
             DHGLPL QALPDVPPAM DAVN+  E+LANL  GTPWET AKEVG+T+GV+S +LRAE S
Sbjct  358   DHGLPLQQALPDVPPAMADAVNRGSEMLANLTVGTPWETVAKEVGSTWGVDSKVLRAEAS  417

Query  301   KELDLLVDVTTSWMVSNSGPRLLR  230
             K+L LLVDV  SW+ SN+GP+LL+
Sbjct  418   KDLGLLVDVIASWITSNAGPKLLK  441



>ref|XP_011004313.1| PREDICTED: uncharacterized protein LOC105110835 [Populus euphratica]
Length=445

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/370 (80%), Positives = 323/370 (87%), Gaps = 0/370 (0%)
 Frame = -2

Query  1339  GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAA  1160
              IQLY  IERLLT+T +QSQD+WG SKDW EVEGAWVL P  ++P+ IVHF+GGIF GAA
Sbjct  75    AIQLYNQIERLLTETARQSQDSWGGSKDWTEVEGAWVLKPKGSRPKSIVHFIGGIFVGAA  134

Query  1159  PQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGI  980
             PQLTYRLFLERL EK ILVIATPYASGFD+FFIADEVQFKFDRC R LQETVQD+P FGI
Sbjct  135   PQLTYRLFLERLAEKGILVIATPYASGFDYFFIADEVQFKFDRCFRSLQETVQDIPTFGI  194

Query  979   GHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIAT  800
             GHSLGSVIHLLIGSRYAVQRSGNI M+FNNKEAS AIPLFSPVLVPMAQS+GPFLSQIA 
Sbjct  195   GHSLGSVIHLLIGSRYAVQRSGNIFMAFNNKEASAAIPLFSPVLVPMAQSLGPFLSQIAL  254

Query  799   SPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKS  620
             SPTVR GAEMT+KQL   SPPIMKQV PLVEQLPPLYMDL+NGRE+F P+PEETRRLIKS
Sbjct  255   SPTVRRGAEMTMKQLENFSPPIMKQVFPLVEQLPPLYMDLVNGREDFSPKPEETRRLIKS  314

Query  619   YYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVP  440
             YYG+SRNLLIKFKDD IDET  LAQ+L +++AISSMLDMSIR LPGDHGLPL QA PDVP
Sbjct  315   YYGVSRNLLIKFKDDVIDETPTLAQVLGSEAAISSMLDMSIRLLPGDHGLPLQQAFPDVP  374

Query  439   PAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWM  260
             PAM DAVN+  EL ANL  GTPWE  AKEVG+T GV+S ILRA+ SK++D LVDV  SWM
Sbjct  375   PAMADAVNQGSELFANLTVGTPWENVAKEVGSTLGVDSGILRAQASKDVDHLVDVIISWM  434

Query  259   VSNSGPRLLR  230
              SN+GPRLL+
Sbjct  435   ASNAGPRLLK  444



>ref|XP_010438950.1| PREDICTED: uncharacterized protein LOC104722481 [Camelina sativa]
Length=431

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/423 (72%), Positives = 357/423 (84%), Gaps = 4/423 (1%)
 Frame = -2

Query  1498  FHPPYSDSAPLFHKRIRFSMSQLFIRNSNSGRCKRIKVGSFNDNSTSNQPERSGIQLYRD  1319
             F P     + L H R R S+  +F  N    R  R  + S+ D S  ++P+ SGIQ+Y +
Sbjct  12    FSPRRRFCSSLSHSR-RQSLPSMF--NFGKKRISRRVICSY-DESNRDRPQSSGIQVYGE  67

Query  1318  IERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRL  1139
             IERLLT+TVKQSQ ++G S DW EVEGAWVL P N++P+++VHF+GGIF GAAPQLTYRL
Sbjct  68    IERLLTETVKQSQSSFGGSSDWSEVEGAWVLKPRNSRPKMVVHFIGGIFVGAAPQLTYRL  127

Query  1138  FLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSV  959
             FLERL EKD+LVIATPYASGFDHF IADEVQFKFDRC R LQETVQDLP FGIGHSLGSV
Sbjct  128   FLERLAEKDVLVIATPYASGFDHFNIADEVQFKFDRCCRSLQETVQDLPSFGIGHSLGSV  187

Query  958   IHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLG  779
             IHLLIGSRYAVQR+GN+ M+FNNKEAS+AIPLFSPVLVPMAQS+GP LSQIATSPT+RLG
Sbjct  188   IHLLIGSRYAVQRNGNVFMAFNNKEASLAIPLFSPVLVPMAQSLGPLLSQIATSPTIRLG  247

Query  778   AEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRN  599
             AEMT KQL TLSPPIMKQ+LPLVEQLPPLYMDL+ GRE+F+P+PEETRRLI+SYYGISRN
Sbjct  248   AEMTRKQLETLSPPIMKQILPLVEQLPPLYMDLVKGREDFIPKPEETRRLIRSYYGISRN  307

Query  598   LLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAV  419
             LLIKF+DD+IDETS+LAQ+L  +S+ISS LDMSIR+LPGDHGLPL QALPDVPP M +AV
Sbjct  308   LLIKFEDDSIDETSILAQVLGVESSISSKLDMSIRTLPGDHGLPLQQALPDVPPRMAEAV  367

Query  418   NKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPR  239
             N+  E LAN+A GTPWE+ AKEVG + G++S ILRA++SK+L +LVD  TSWM SN GP+
Sbjct  368   NRGSEFLANIAVGTPWESMAKEVGGSLGMDSKILRADMSKDLAVLVDAITSWMASNMGPK  427

Query  238   LLR  230
             LLR
Sbjct  428   LLR  430



>ref|XP_009359832.1| PREDICTED: uncharacterized protein LOC103950360 [Pyrus x bretschneideri]
Length=442

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/444 (69%), Positives = 359/444 (81%), Gaps = 14/444 (3%)
 Frame = -2

Query  1534  SSWLCAPAPHIHFHPPYSDSAPLFHKRIRFS-MSQLFIRNSNSGRCKRIKVGSFNDNSTS  1358
             S W+ +P PH + HP  S     F KR+     S++   +++  R +     +++D +T 
Sbjct  3     SCWVRSPQPHPNLHPHRS-----FSKRLLIQPQSRVLSLSNSQRRRRSRICCNYDDETTR  57

Query  1357  NQPER--------SGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPR  1202
              Q +         +GIQLY +IERLLT+TV+Q+Q  W  + DW +VEGAWVL P N++P+
Sbjct  58    RQSQPPSPQGPQPTGIQLYSEIERLLTETVRQAQGRWDGTGDWTQVEGAWVLKPRNSEPK  117

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
              +VHF+GGIF GAAPQLTYRLFLERL EK ILVIATPYASGFDHFFIADE QFKFDRC R
Sbjct  118   AVVHFIGGIFVGAAPQLTYRLFLERLSEKGILVIATPYASGFDHFFIADETQFKFDRCYR  177

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
             FL+ETVQDLP FGIGHSLGSVIHLLIGSRYAVQR+GN+LM+FNNKEAS  IPLFSPV+VP
Sbjct  178   FLKETVQDLPTFGIGHSLGSVIHLLIGSRYAVQRNGNVLMAFNNKEASSTIPLFSPVVVP  237

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             +AQ +GP LSQIA+SPT+RLGAEMTLKQ   LSPPIMKQVLPLVEQLPPLYMDL+NGRE 
Sbjct  238   VAQGLGPILSQIASSPTIRLGAEMTLKQFENLSPPIMKQVLPLVEQLPPLYMDLVNGREY  297

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F P+PEETRRL+KSYYGISRNLL+KF+DD IDETS LAQLL ++SAISSMLDMSIR LPG
Sbjct  298   FAPKPEETRRLVKSYYGISRNLLVKFRDDMIDETSTLAQLLISNSAISSMLDMSIRLLPG  357

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVS  302
             DHGLPL QALPDVPPAM DAVN+  E+LANL  GTPWET AKEVG+T+GV+S +LRAE S
Sbjct  358   DHGLPLQQALPDVPPAMADAVNRGSEMLANLTVGTPWETVAKEVGSTWGVDSKVLRAEAS  417

Query  301   KELDLLVDVTTSWMVSNSGPRLLR  230
             K+L LLVDV  SW+ SN+GP LL+
Sbjct  418   KDLGLLVDVIASWITSNAGPTLLK  441



>ref|XP_007156285.1| hypothetical protein PHAVU_003G273800g [Phaseolus vulgaris]
 gb|ESW28279.1| hypothetical protein PHAVU_003G273800g [Phaseolus vulgaris]
Length=433

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/426 (69%), Positives = 347/426 (81%), Gaps = 11/426 (3%)
 Frame = -2

Query  1474  APLFHKRIRFSMSQLFIRNSNSGRCKRIKVGSFNDNSTSN-----------QPERSGIQL  1328
             AP +  ++ F  +     N+ S    R + G+    S S+           +P+   IQ+
Sbjct  7     APTYSFKLNFYTAHSHRLNAKSSLHYRRRFGTTTTISCSSNNFNDDNNQQQRPQSEAIQV  66

Query  1327  YRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLT  1148
             Y  IERLLTD+V+QSQD W  S DW+EVEGAW+L P +++P  +VHF+GGIF GAAPQLT
Sbjct  67    YSQIERLLTDSVRQSQDGWWGSGDWREVEGAWILEPKSSRPNFVVHFIGGIFVGAAPQLT  126

Query  1147  YRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSL  968
             YR FLERL EK IL+IATPYASGFDHF IADEVQFKFDRC R LQET+QDLPIFG+GHSL
Sbjct  127   YRWFLERLSEKGILIIATPYASGFDHFLIADEVQFKFDRCYRRLQETIQDLPIFGVGHSL  186

Query  967   GSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTV  788
             GSV+HLLIGSRYAVQRSGN+LM+FNNKEAS A+PLFSPVLVPMAQ+ GP LS+I +SPT+
Sbjct  187   GSVVHLLIGSRYAVQRSGNVLMAFNNKEASSAVPLFSPVLVPMAQTFGPLLSEIFSSPTL  246

Query  787   RLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGI  608
             R+GAEMT KQLG +SPPIMKQVLPLVEQLPPLYMDL+ GRE F P+PEETRRLIKSYYGI
Sbjct  247   RVGAEMTFKQLGNVSPPIMKQVLPLVEQLPPLYMDLVKGREEFSPKPEETRRLIKSYYGI  306

Query  607   SRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMT  428
             SRNLLIKFKDD IDETS LAQ+LS++SAISS+LDMSIR L GDHGLPL QALPDVPPAM 
Sbjct  307   SRNLLIKFKDDLIDETSTLAQVLSSESAISSVLDMSIRKLAGDHGLPLQQALPDVPPAMA  366

Query  427   DAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNS  248
             DAVN+  ELL+NL  GTPWET AKEVGN+ G++S +LRAEVSK++D+LVDV  SW+ SN+
Sbjct  367   DAVNRGSELLSNLTVGTPWETVAKEVGNSLGMDSRVLRAEVSKDMDMLVDVIASWIASNA  426

Query  247   GPRLLR  230
             GP+LLR
Sbjct  427   GPKLLR  432



>ref|XP_006348531.1| PREDICTED: uncharacterized protein LOC102599594 [Solanum tuberosum]
Length=434

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/441 (72%), Positives = 369/441 (84%), Gaps = 15/441 (3%)
 Frame = -2

Query  1543  AGMSSWLCAPAPHIHFHPPYSDSAPLFHKR-IRFSMSQLFIRNSNSGRCKRIKVGSFNDN  1367
             A  ++WLC+PA  I F   YSDS   +++  IRF       R  +  RC     GS   +
Sbjct  6     APKANWLCSPA--ISF---YSDSTKYYNRSSIRFYPGN---RKFSRIRCNLKDTGS---S  54

Query  1366  STSNQPERS-GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVH  1190
             S++NQPE S GIQLYRDIERLLT+TVKQSQD WG+S+DW E+EGAWVL P  +KP+L+VH
Sbjct  55    SSNNQPETSTGIQLYRDIERLLTETVKQSQD-WGSSQDWDEIEGAWVLQPKTSKPKLVVH  113

Query  1189  FVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQE  1010
             FVGG+F GAAPQL+YRLFLERL +KD+LVIATPYASGFDHF+IADEVQFKFDRCLRFLQE
Sbjct  114   FVGGVFVGAAPQLSYRLFLERLRQKDVLVIATPYASGFDHFYIADEVQFKFDRCLRFLQE  173

Query  1009  TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQS  830
              VQDLP+FGIGHSLGSVIHLLIG+RYAV+R+GN+LM+FNNK+AS+A+PLFS VLVPM Q+
Sbjct  174   RVQDLPVFGIGHSLGSVIHLLIGARYAVKRNGNVLMAFNNKDASLAVPLFSSVLVPMMQN  233

Query  829   IGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPR  650
              GP LSQIA+SPT+RLGAEMT+KQ+  LSP IMKQV PLVEQL PLY DLING+ENF PR
Sbjct  234   FGPVLSQIASSPTIRLGAEMTMKQIENLSPSIMKQVFPLVEQLTPLYTDLINGKENFTPR  293

Query  649   PEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGL  470
             PEET+RLI+SYYGISRNLL+KFKDDTIDETS LAQ+LS+ SAISSMLDMSIR+LPGDH L
Sbjct  294   PEETQRLIRSYYGISRNLLVKFKDDTIDETSTLAQVLSSGSAISSMLDMSIRTLPGDHAL  353

Query  469   PLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFG-VESNILRAEVSKEL  293
             PL QALP+VPP MTDAVN+S ELLANL AGTPWE   KEVGNT G V+S IL +  SK+L
Sbjct  354   PLQQALPNVPPGMTDAVNRSSELLANLTAGTPWENVTKEVGNTLGNVDSIILNSGNSKDL  413

Query  292   DLLVDVTTSWMVSNSGPRLLR  230
             D+LV+  TSWM SN+GPRLL+
Sbjct  414   DMLVETITSWMYSNTGPRLLQ  434



>gb|KFK32166.1| hypothetical protein AALP_AA6G206200 [Arabis alpina]
Length=426

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/390 (74%), Positives = 333/390 (85%), Gaps = 0/390 (0%)
 Frame = -2

Query  1399  KRIKVGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGP  1220
             K  +V    +    ++P+ SGIQ+Y +IERLLT+TVKQSQ     S DW EVEGAWVL P
Sbjct  36    KERRVSCSYEEKERDRPQSSGIQVYGEIERLLTETVKQSQSNSAGSSDWSEVEGAWVLKP  95

Query  1219  INTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFK  1040
              N+KP+++ HFVGGIF GAAPQLTYRLFLERL +KD+LVIATPYASGFDHF IADEVQFK
Sbjct  96    RNSKPKMVAHFVGGIFVGAAPQLTYRLFLERLADKDVLVIATPYASGFDHFLIADEVQFK  155

Query  1039  FDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLF  860
             FDRC R+LQ+ V DLP FGIGHSLGSVIHLLIGSRYAVQRSGN+ M+FNNKEAS++IPL 
Sbjct  156   FDRCCRYLQDIVHDLPSFGIGHSLGSVIHLLIGSRYAVQRSGNVFMAFNNKEASLSIPLL  215

Query  859   SPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDL  680
             SPVLVPMAQ +GP LSQ+ATSPTVRLGAEMT KQL T SPPIMKQ+LPLVEQLPPLYMDL
Sbjct  216   SPVLVPMAQRLGPLLSQVATSPTVRLGAEMTRKQLETNSPPIMKQILPLVEQLPPLYMDL  275

Query  679   INGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMS  500
             + GRE+F+P+PEETRRLI+SYYGISRNLLIKF+DD+IDETS+LAQ+L  +S+ISS LDMS
Sbjct  276   VKGREDFIPKPEETRRLIRSYYGISRNLLIKFEDDSIDETSILAQVLGVESSISSKLDMS  335

Query  499   IRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNI  320
             IR+LPGDHGLPL Q LPDVPPAM D VN+  E LAN+A GTPWE+ AKEVG++ G +S I
Sbjct  336   IRTLPGDHGLPLQQTLPDVPPAMVDVVNRGSEFLANIAVGTPWESVAKEVGSSLGKDSKI  395

Query  319   LRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
             LRAE+SK+L LLVD  TSWM SN GP+LLR
Sbjct  396   LRAEMSKDLILLVDAVTSWMASNMGPKLLR  425



>ref|XP_011020950.1| PREDICTED: uncharacterized protein LOC105123144 isoform X1 [Populus 
euphratica]
Length=452

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/379 (77%), Positives = 325/379 (86%), Gaps = 11/379 (3%)
 Frame = -2

Query  1339  GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAA  1160
              IQLY  IERLLT+T +QSQD WG SKDW EVEG+WVL P +++P+ +VHF+GGIF GAA
Sbjct  74    AIQLYNQIERLLTETSRQSQDYWGGSKDWSEVEGSWVLKPKSSRPKSVVHFIGGIFVGAA  133

Query  1159  PQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGI  980
             PQLTYRLFLERL EK +LVIATPYASGFD+FFIADEVQFKFDRCLRFL+ETVQD+P +GI
Sbjct  134   PQLTYRLFLERLAEKGVLVIATPYASGFDYFFIADEVQFKFDRCLRFLEETVQDVPTYGI  193

Query  979   GHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIAT  800
             GHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS AIPLFSPVLVP+AQS GPFLSQIA+
Sbjct  194   GHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASSAIPLFSPVLVPVAQSFGPFLSQIAS  253

Query  799   SPTVRLG-----------AEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVP  653
             SPTVRLG           AEMT+KQL   SPPIMKQV PLVEQLPPLYMDL+NGRE+F P
Sbjct  254   SPTVRLGVRLYVSRIQSNAEMTMKQLENFSPPIMKQVFPLVEQLPPLYMDLVNGREDFSP  313

Query  652   RPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHG  473
             +PEETRRLIKSYYGISRNLLIKF+DD IDETS+LAQ+LS+++AISSMLDMSIR LPGDHG
Sbjct  314   KPEETRRLIKSYYGISRNLLIKFRDDAIDETSMLAQVLSSEAAISSMLDMSIRMLPGDHG  373

Query  472   LPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKEL  293
             LPL Q  PDVPPAM DAVN+  EL ANL  GTPWET AKEVGNT G  S+ILRA  SK++
Sbjct  374   LPLQQVFPDVPPAMADAVNRGSELFANLTMGTPWETVAKEVGNTLGTNSSILRARASKDV  433

Query  292   DLLVDVTTSWMVSNSGPRL  236
             D LVDV  SWM SNSGP+ 
Sbjct  434   DQLVDVIISWMASNSGPKF  452



>emb|CDX86340.1| BnaA06g30570D [Brassica napus]
Length=431

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/400 (73%), Positives = 340/400 (85%), Gaps = 0/400 (0%)
 Frame = -2

Query  1426  IRNSNSGRCKRIKVGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKE  1247
             IR       +R+      +N+  ++P+ SGIQ+Y +IERLLT+TVKQSQ +   S DW E
Sbjct  32    IRFDKELASRRVFCSYSQENNNKDRPQSSGIQVYGEIERLLTETVKQSQSSSAGSADWSE  91

Query  1246  VEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHF  1067
             +EGAWVL P N+ P+++ HF+GGIF GAAPQLTYRLFLERL EKD+LVIATPYASGFDHF
Sbjct  92    LEGAWVLRPRNSNPKMVAHFIGGIFVGAAPQLTYRLFLERLAEKDVLVIATPYASGFDHF  151

Query  1066  FIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNK  887
              IADEVQFKFDRC R L E+VQDLP FGIGHSLGS+IHLLIGSRYAVQR+GN+ M+FNNK
Sbjct  152   AIADEVQFKFDRCCRSLHESVQDLPSFGIGHSLGSLIHLLIGSRYAVQRNGNVFMAFNNK  211

Query  886   EASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplve  707
             EAS+AIPLFSPVLVPMAQS+GP LSQ+ATSPTVRLGAEMT KQL TLSPPIMKQ+LPLVE
Sbjct  212   EASLAIPLFSPVLVPMAQSLGPLLSQVATSPTVRLGAEMTRKQLETLSPPIMKQILPLVE  271

Query  706   qlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDS  527
             QLPPLYMDL+ GRE+F+P+PEETRRLI+SYYGISRNLLIKF+DD+IDET +LAQ+L  +S
Sbjct  272   QLPPLYMDLVKGREDFIPKPEETRRLIRSYYGISRNLLIKFEDDSIDETPILAQVLGVES  331

Query  526   AISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVG  347
             +ISS LDMSIR+LPGDHGLPL Q+LPDVPPAM DAVN+  E LAN+A GTPWE+ AKEVG
Sbjct  332   SISSKLDMSIRTLPGDHGLPLQQSLPDVPPAMADAVNRGSEFLANMAVGTPWESVAKEVG  391

Query  346   NTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLRS  227
              T G++S ILRA  SK+L  LVD TTSWM SN GP+LLRS
Sbjct  392   GTLGMDSKILRAYTSKDLAQLVDATTSWMASNMGPKLLRS  431



>ref|XP_010924069.1| PREDICTED: uncharacterized protein LOC105047005 [Elaeis guineensis]
Length=437

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/382 (76%), Positives = 330/382 (86%), Gaps = 6/382 (2%)
 Frame = -2

Query  1375  NDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLI  1196
             +D+ST+      GIQLY  IERL+T+T K SQD WG S DW E+EGAWVL P   +P  +
Sbjct  61    DDDSTT------GIQLYSQIERLITETAKLSQDGWGASGDWNEIEGAWVLKPKIARPTSV  114

Query  1195  VHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFL  1016
             VHFVGGIF GAAPQLTYR FLE L  K  LV+ATP+ASGFDHF IADEVQFKFDRCLR L
Sbjct  115   VHFVGGIFVGAAPQLTYRFFLECLANKGALVVATPFASGFDHFLIADEVQFKFDRCLRSL  174

Query  1015  QETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMA  836
             Q+TV +LPIFGIGHSLGSVIHLLIGSRYAV+R+GN+LM+FNNKEAS+AIPLFSPV+VPMA
Sbjct  175   QDTVNELPIFGIGHSLGSVIHLLIGSRYAVERTGNVLMAFNNKEASLAIPLFSPVIVPMA  234

Query  835   QSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFV  656
             QS GP LSQ+ +SPT+R GAEM +KQL  LSPP+M+QVLPLVEQLPPLYMDL+ GRE+F 
Sbjct  235   QSFGPVLSQLTSSPTIRRGAEMAMKQLQNLSPPMMRQVLPLVEQLPPLYMDLVKGREDFT  294

Query  655   PRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDH  476
             P+PEETRRLIKSYYGISRNLLIKFKDDTIDETS LAQ+LS++SAISS+LDMSIRS+PGDH
Sbjct  295   PKPEETRRLIKSYYGISRNLLIKFKDDTIDETSTLAQVLSSESAISSLLDMSIRSIPGDH  354

Query  475   GLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKE  296
             GLPL QA PDVPPAM DAVN+ GELL NL AGTPWE  AKEVGNT GV+S ILRA++SK+
Sbjct  355   GLPLQQAFPDVPPAMADAVNRGGELLVNLTAGTPWEAVAKEVGNTLGVDSGILRAQISKD  414

Query  295   LDLLVDVTTSWMVSNSGPRLLR  230
             +++LVDV TSWM SNSGP+LLR
Sbjct  415   VNMLVDVITSWMASNSGPKLLR  436



>ref|XP_009151584.1| PREDICTED: uncharacterized protein LOC103874911 [Brassica rapa]
Length=431

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/400 (73%), Positives = 339/400 (85%), Gaps = 0/400 (0%)
 Frame = -2

Query  1426  IRNSNSGRCKRIKVGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKE  1247
             IR       +R+      +N+  ++P+ SGIQ+Y +IERLLT+TVKQSQ +   S DW E
Sbjct  32    IRFDKELASRRVFCSYSQENNNKDRPQSSGIQVYGEIERLLTETVKQSQSSSAGSADWSE  91

Query  1246  VEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHF  1067
             +EGAWVL P N+ P+++ HF+GGIF GAAPQLTYRLFLERL EKD+LVIATPYASGFDHF
Sbjct  92    LEGAWVLRPRNSNPKMVAHFIGGIFVGAAPQLTYRLFLERLAEKDVLVIATPYASGFDHF  151

Query  1066  FIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNK  887
              IADEVQFKFDRC R L E+VQDLP FGIGHSLGS+IHLLIGSRYAVQR+GN+ M+FNNK
Sbjct  152   AIADEVQFKFDRCCRSLHESVQDLPSFGIGHSLGSLIHLLIGSRYAVQRNGNVFMAFNNK  211

Query  886   EASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplve  707
             EAS+AIPLFSPVLVPMAQS+GP LSQ+ATSPTVRLGAEMT KQL TLSPPIMKQ+LPLVE
Sbjct  212   EASLAIPLFSPVLVPMAQSLGPLLSQVATSPTVRLGAEMTRKQLETLSPPIMKQILPLVE  271

Query  706   qlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDS  527
             QLPPLYMDL+ GRE+F+P+PEETRRLI+SYYGISRNLLIKF+DD+IDET +LAQ+L  +S
Sbjct  272   QLPPLYMDLVKGREDFIPKPEETRRLIRSYYGISRNLLIKFEDDSIDETPILAQVLGVES  331

Query  526   AISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVG  347
             +ISS LDMSIR+LPGDHGLPL Q+LPDVPPAM DAVN+  E LAN+A GTPWE+ AKEVG
Sbjct  332   SISSKLDMSIRTLPGDHGLPLQQSLPDVPPAMADAVNRGSEFLANMAVGTPWESVAKEVG  391

Query  346   NTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLRS  227
              T G++S ILRA  SK+L  LVD  TSWM SN GP+LLRS
Sbjct  392   GTLGMDSKILRAYTSKDLAQLVDAITSWMASNMGPKLLRS  431



>ref|XP_002863828.1| hypothetical protein ARALYDRAFT_494828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40087.1| hypothetical protein ARALYDRAFT_494828 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/392 (75%), Positives = 341/392 (87%), Gaps = 1/392 (0%)
 Frame = -2

Query  1405  RCKRIKVGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVL  1226
             R  R  + S+ +N   ++ + +GIQLY +IERLLT+TVKQSQ + G S DW EVEGAWVL
Sbjct  38    RVSRRVLCSYEEND-RDRTQSTGIQLYGEIERLLTETVKQSQSSSGGSADWSEVEGAWVL  96

Query  1225  GPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQ  1046
              P N+KP+++VHF+GGIF GAAPQLTYRLFLERL EKDILVIATPYASGFDHF IADEVQ
Sbjct  97    KPRNSKPKMVVHFIGGIFVGAAPQLTYRLFLERLAEKDILVIATPYASGFDHFNIADEVQ  156

Query  1045  FKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIP  866
             FKFDRC R LQE VQDLP FGIGHSLGSVIHLLIGSRYAVQR+GN+ M+FNNKEAS+AIP
Sbjct  157   FKFDRCCRSLQEIVQDLPSFGIGHSLGSVIHLLIGSRYAVQRNGNVFMAFNNKEASLAIP  216

Query  865   LFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYM  686
             LFSPVLVPMAQ +GP LSQ+ATSPT+RLGAEMT KQL TLSPPIMKQ+LPLVEQLPPLYM
Sbjct  217   LFSPVLVPMAQRLGPLLSQMATSPTIRLGAEMTRKQLETLSPPIMKQILPLVEQLPPLYM  276

Query  685   DLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLD  506
             DL+ GRE+F+P+PEETRRL++SYYGISRNLLIKF+DD+IDETS+LAQ+L  +S+ISS LD
Sbjct  277   DLVKGREDFIPKPEETRRLVRSYYGISRNLLIKFEDDSIDETSILAQVLGVESSISSKLD  336

Query  505   MSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVES  326
             MSIR+LPGDHGLPL QALPDVPP M +AVN+  E LAN+A GTPWE+ AKEVG + G++S
Sbjct  337   MSIRTLPGDHGLPLQQALPDVPPGMVEAVNRGSEFLANIAVGTPWESMAKEVGGSLGMDS  396

Query  325   NILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
              ILRA++SK+L LLVD  TSWM SN GP+LLR
Sbjct  397   KILRADMSKDLALLVDAITSWMASNMGPKLLR  428



>ref|NP_199597.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB11333.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL25574.1| AT5g47860/MCA23_20 [Arabidopsis thaliana]
 gb|AAM98279.1| At5g47860/MCA23_20 [Arabidopsis thaliana]
 gb|AED95581.1| uncharacterized protein AT5G47860 [Arabidopsis thaliana]
Length=431

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/390 (74%), Positives = 340/390 (87%), Gaps = 0/390 (0%)
 Frame = -2

Query  1399  KRIKVGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGP  1220
             +R+   S  ++   ++ + +GIQ+Y +IERLLT+TVK SQ + G S DW EVEGAWVL P
Sbjct  41    RRVFCSSKENDINRDRNQSTGIQVYGEIERLLTETVKNSQSSSGGSSDWSEVEGAWVLKP  100

Query  1219  INTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFK  1040
              N+KP+++VHF+GGIF GAAPQLTYRLFLERL EKD+LVIATPYASGFDHF IADEVQFK
Sbjct  101   RNSKPKMVVHFIGGIFVGAAPQLTYRLFLERLAEKDVLVIATPYASGFDHFNIADEVQFK  160

Query  1039  FDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLF  860
             +DRC R LQE VQDLP FGIGHSLGSVIHLLIGSRYAVQR+GN+ M+FNNKEAS+AIPLF
Sbjct  161   YDRCCRSLQEEVQDLPSFGIGHSLGSVIHLLIGSRYAVQRNGNVFMAFNNKEASLAIPLF  220

Query  859   SPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDL  680
             SPVLVPMAQS+GP LSQ+ATSPT+RLGAEMT KQL TLSPPIMKQ+LPLVEQLPPLYMDL
Sbjct  221   SPVLVPMAQSLGPLLSQVATSPTIRLGAEMTRKQLETLSPPIMKQILPLVEQLPPLYMDL  280

Query  679   INGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMS  500
             + GRE+FVP+PEETRRLI+SYYGISRNLLIKF+DD+IDETS+LAQ+L  +S+ISS LDMS
Sbjct  281   VKGREDFVPKPEETRRLIRSYYGISRNLLIKFEDDSIDETSILAQVLGVESSISSKLDMS  340

Query  499   IRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNI  320
             IR+LPGDHGLPL QALPDVPP M +AVN+  E LAN+A GTPWE+ AKEVG + G++S I
Sbjct  341   IRTLPGDHGLPLQQALPDVPPGMAEAVNRGSEFLANIAVGTPWESMAKEVGGSLGMDSKI  400

Query  319   LRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
             LRA++SK+L  LVD  TSWM+SN GP+LLR
Sbjct  401   LRADMSKDLAQLVDAITSWMISNMGPKLLR  430



>ref|XP_010442202.1| PREDICTED: uncharacterized protein LOC104725271 isoform X1 [Camelina 
sativa]
 ref|XP_010442203.1| PREDICTED: uncharacterized protein LOC104725271 isoform X2 [Camelina 
sativa]
Length=431

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/426 (71%), Positives = 354/426 (83%), Gaps = 13/426 (3%)
 Frame = -2

Query  1477  SAPLFHKRIRF----------SMSQLFIRNSNSGRCKRIKVGSFNDNSTSNQPERSGIQL  1328
             ++P F  R RF          S+  +F  N  + R  R    S+ D    ++P+ SGIQ+
Sbjct  8     ASPSFSPRRRFCSSLSNSRRQSLPSMF--NFGNKRISRRVFCSY-DERNRDRPQTSGIQV  64

Query  1327  YRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLT  1148
             Y +IERLLT+TVKQSQ + G S DW EVEGAWVL P N+KP+++VHF+GGIF GAAPQLT
Sbjct  65    YGEIERLLTETVKQSQSSSGGSSDWSEVEGAWVLKPRNSKPKMVVHFIGGIFVGAAPQLT  124

Query  1147  YRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSL  968
             YRLFLERL EKD+LVIATPYASGFDHF IADEVQFKFDRC R LQETVQDLP FGIGHSL
Sbjct  125   YRLFLERLAEKDVLVIATPYASGFDHFNIADEVQFKFDRCCRSLQETVQDLPSFGIGHSL  184

Query  967   GSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTV  788
             GSVIHLLIGSRYAV+R+GN+ M+FNNKEAS+AIPLFSPVLVPMAQS+GP LSQIATSPT+
Sbjct  185   GSVIHLLIGSRYAVKRNGNVFMAFNNKEASLAIPLFSPVLVPMAQSLGPLLSQIATSPTI  244

Query  787   RLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGI  608
             RLGAEMT KQL TLSPPIMKQ+LPLVEQLPPLYMDL+ GRE+F+P+PEETRRLI+SYYGI
Sbjct  245   RLGAEMTRKQLETLSPPIMKQILPLVEQLPPLYMDLVKGREDFIPKPEETRRLIRSYYGI  304

Query  607   SRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMT  428
             SRNLLIKF+DD+IDETS+LAQ+L  +S+ISS LDMSIR+LPGDHGLPL QALPDVPP M 
Sbjct  305   SRNLLIKFEDDSIDETSILAQVLGVESSISSKLDMSIRTLPGDHGLPLQQALPDVPPRMA  364

Query  427   DAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNS  248
             +AVN+  E LAN+A GTPWE+ AKEVG + G++S ILRA++SK+L +LVD  TSWM S+ 
Sbjct  365   EAVNRGSEFLANIAVGTPWESMAKEVGGSLGMDSKILRADMSKDLAVLVDAITSWMASSM  424

Query  247   GPRLLR  230
             G +LL+
Sbjct  425   GSKLLK  430



>ref|XP_011075702.1| PREDICTED: uncharacterized protein LOC105160133 isoform X2 [Sesamum 
indicum]
Length=359

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/357 (81%), Positives = 316/357 (89%), Gaps = 0/357 (0%)
 Frame = -2

Query  1300  DTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLV  1121
             +TVKQ+QD WG S DW E+EGAWVL P N+K   IVHF+GGIF GAAPQLTYRLFLERL 
Sbjct  2     ETVKQNQDGWGGSGDWSEIEGAWVLRPRNSKLTSIVHFIGGIFVGAAPQLTYRLFLERLA  61

Query  1120  EKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIG  941
              K ILVIATPYASGFDHF IADEVQFKF+RCLR+LQETV+D+P FGIGHSLGSVIHLLIG
Sbjct  62    NKGILVIATPYASGFDHFLIADEVQFKFERCLRYLQETVEDIPTFGIGHSLGSVIHLLIG  121

Query  940   SRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLK  761
             SRYAVQRSGNILM+FNNKEAS+A+PLFSPVLVPMAQSIGPFLSQIA+SPT+RLGAEMT K
Sbjct  122   SRYAVQRSGNILMAFNNKEASLAVPLFSPVLVPMAQSIGPFLSQIASSPTIRLGAEMTRK  181

Query  760   QLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFK  581
             Q   LSP I+KQVLPLVEQLPPLYMDL  GRE F P+PEETRRLI+SYYGISRNLLIKFK
Sbjct  182   QFENLSPSILKQVLPLVEQLPPLYMDLAKGREEFSPKPEETRRLIRSYYGISRNLLIKFK  241

Query  580   DDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGEL  401
             DDTIDETS LAQ+LS+DSAISSMLDMSIR LPGDHGLPL Q LPDVPPAM DAVN+ GEL
Sbjct  242   DDTIDETSTLAQVLSSDSAISSMLDMSIRLLPGDHGLPLQQVLPDVPPAMADAVNRGGEL  301

Query  400   LANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
             LA L AGTPWE  AKEVG+TFG +S+I RA   KE+DLLVDV T+W+ SNSGPRLLR
Sbjct  302   LATLTAGTPWEAVAKEVGSTFGADSSIFRAYNPKEIDLLVDVITTWIASNSGPRLLR  358



>ref|XP_010044909.1| PREDICTED: uncharacterized protein LOC104433748 [Eucalyptus grandis]
 gb|KCW87030.1| hypothetical protein EUGRSUZ_B03577 [Eucalyptus grandis]
Length=465

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/375 (78%), Positives = 337/375 (90%), Gaps = 2/375 (1%)
 Frame = -2

Query  1348  ERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFA  1169
             + +GI+LY +IER+LT+TV+QSQ+AWG + DW ++EG+WVL P +++P  +VHF+GGIF 
Sbjct  90    QSTGIRLYSEIERVLTETVRQSQNAWGITGDWSQIEGSWVLKPRHSQPNAVVHFIGGIFV  149

Query  1168  GAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPI  989
             GAAPQLTYRLFLERL EK ILVIATPY SGFDHFFIADEVQFKFDRC R+LQ+ V DLP 
Sbjct  150   GAAPQLTYRLFLERLAEKGILVIATPYPSGFDHFFIADEVQFKFDRCHRYLQDIVHDLPT  209

Query  988   FGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQ  809
             FGIGHSLGSVIHLLIGSRYAVQR+GNILM+FNNKEAS+AIPLFSPVLVP+AQS+GPFLSQ
Sbjct  210   FGIGHSLGSVIHLLIGSRYAVQRNGNILMAFNNKEASLAIPLFSPVLVPVAQSLGPFLSQ  269

Query  808   IATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRL  629
             IA+SPTVRLGAEMT+KQL  LSPPIMKQVLPLVEQLPPLYMDL+ GRE+F P+PEETRRL
Sbjct  270   IASSPTVRLGAEMTIKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREDFSPKPEETRRL  329

Query  628   IKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALP  449
             IKSYYGISRNLLIKFKDD+IDETS LAQ+LS++SAISSMLDMSIR LPGDHGLPL QALP
Sbjct  330   IKSYYGISRNLLIKFKDDSIDETSTLAQVLSSESAISSMLDMSIRLLPGDHGLPLQQALP  389

Query  448   DVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVE--SNILRAEVSKELDLLVDV  275
             DVPPAM DAVN+  E L NL  GTPWET AKE+GNT GV+  S ILRA++SK++D+LVDV
Sbjct  390   DVPPAMADAVNRGSEFLTNLTVGTPWETVAKEMGNTLGVDPRSKILRAQISKDVDVLVDV  449

Query  274   TTSWMVSNSGPRLLR  230
              TSW+ SN+GP+LLR
Sbjct  450   VTSWIASNTGPKLLR  464



>ref|XP_008799216.1| PREDICTED: uncharacterized protein LOC103713938 isoform X1 [Phoenix 
dactylifera]
Length=437

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/394 (72%), Positives = 330/394 (84%), Gaps = 5/394 (1%)
 Frame = -2

Query  1396  RIKVGSFNDNSTSNQP-----ERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAW  1232
             R ++  +    T  +P       +GIQLY  IER++T+T KQSQD WG S DW E+EG W
Sbjct  43    RRRIACYAGEPTRQRPPGDDDSTAGIQLYSQIERIITETAKQSQDGWGASGDWNEIEGCW  102

Query  1231  VLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADE  1052
             +L P N KP  +VHFVGGIF GAAPQLTYR FLERL +K  LV+ATP+ASGFD+FFIADE
Sbjct  103   ILKPKNAKPTSVVHFVGGIFVGAAPQLTYRYFLERLSDKGALVVATPFASGFDYFFIADE  162

Query  1051  VQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVA  872
             VQFKFDRCLRFLQ+TV DLP FGIGHSLGSVIHLLIGSRYA+QRSGN+LM+FNN+EAS+ 
Sbjct  163   VQFKFDRCLRFLQDTVNDLPTFGIGHSLGSVIHLLIGSRYAIQRSGNVLMAFNNQEASLT  222

Query  871   IPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppL  692
             IPLFSPV+VPMAQS GPFLSQ+ +SPT+RLGAEM  KQL  LSPP M+QV+PLVEQLPPL
Sbjct  223   IPLFSPVIVPMAQSFGPFLSQLTSSPTIRLGAEMAKKQLENLSPPFMRQVIPLVEQLPPL  282

Query  691   YMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSM  512
             YMDL+ GRE+F P+PEETRRLIKSYYGISRNLLIKFKDD IDETS LA++LS++S ISS+
Sbjct  283   YMDLVKGREDFTPKPEETRRLIKSYYGISRNLLIKFKDDKIDETSTLARVLSSESVISSL  342

Query  511   LDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGV  332
             LDMSIRS+PGDHGLPL Q  PDVPPAM DAVN+ GELL NL+AGTPWE  AKEVGN+ GV
Sbjct  343   LDMSIRSIPGDHGLPLQQVFPDVPPAMADAVNRGGELLVNLSAGTPWEAAAKEVGNSLGV  402

Query  331   ESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
             +  I RA++SK++++LVDV  SWM SNSGP+LLR
Sbjct  403   DPVIPRAQLSKDVNMLVDVIASWMASNSGPKLLR  436



>ref|XP_009404208.1| PREDICTED: uncharacterized protein LOC103987592 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=389

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/371 (75%), Positives = 320/371 (86%), Gaps = 0/371 (0%)
 Frame = -2

Query  1342  SGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGA  1163
             +GIQLY  IERL+T+T +QSQDAWG S DW E+EGAWVL P +  P+ +VHFVGGIF GA
Sbjct  18    TGIQLYSQIERLITETARQSQDAWGGSGDWSEIEGAWVLKPKSRTPKAVVHFVGGIFVGA  77

Query  1162  APQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFG  983
             APQLTYRLFLERL  +  LV+ATP+ASGFDHF IADEVQFKFDRC+RFLQ++V DLP FG
Sbjct  78    APQLTYRLFLERLSTRGALVVATPFASGFDHFLIADEVQFKFDRCIRFLQDSVNDLPTFG  137

Query  982   IGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIA  803
             +GHSLGSVIHLLIGSRYA+QR GNILM+FNNKEAS AIPLFSPV+VPMAQS GP LSQ+ 
Sbjct  138   VGHSLGSVIHLLIGSRYAIQRCGNILMAFNNKEASSAIPLFSPVIVPMAQSFGPLLSQLT  197

Query  802   TSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIK  623
             +SP++R GAEM +KQLG LSPPIMKQVLPLVEQLPPLYMDL+NGRE+F P+PEETRRL+K
Sbjct  198   SSPSLRRGAEMAMKQLGNLSPPIMKQVLPLVEQLPPLYMDLVNGREDFSPKPEETRRLVK  257

Query  622   SYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDV  443
             SYYG+SRNLLIKFKDDTIDET  LAQLLS  SAISS LDMS+R +PGDHGLPL Q LPD+
Sbjct  258   SYYGVSRNLLIKFKDDTIDETPTLAQLLSGGSAISSQLDMSVRLMPGDHGLPLQQVLPDI  317

Query  442   PPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSW  263
             PP M DAVN+ GE+L+NL  GTPWE  A+EV NT G +S I+RA++SK++D LVD+ TSW
Sbjct  318   PPTMADAVNRGGEILSNLTVGTPWEAVAREVSNTLGTDSGIVRAQISKDIDALVDLMTSW  377

Query  262   MVSNSGPRLLR  230
             M SNS PRL+R
Sbjct  378   MDSNSDPRLIR  388



>ref|XP_009404207.1| PREDICTED: uncharacterized protein LOC103987592 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=468

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/371 (75%), Positives = 320/371 (86%), Gaps = 0/371 (0%)
 Frame = -2

Query  1342  SGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGA  1163
             +GIQLY  IERL+T+T +QSQDAWG S DW E+EGAWVL P +  P+ +VHFVGGIF GA
Sbjct  97    TGIQLYSQIERLITETARQSQDAWGGSGDWSEIEGAWVLKPKSRTPKAVVHFVGGIFVGA  156

Query  1162  APQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFG  983
             APQLTYRLFLERL  +  LV+ATP+ASGFDHF IADEVQFKFDRC+RFLQ++V DLP FG
Sbjct  157   APQLTYRLFLERLSTRGALVVATPFASGFDHFLIADEVQFKFDRCIRFLQDSVNDLPTFG  216

Query  982   IGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIA  803
             +GHSLGSVIHLLIGSRYA+QR GNILM+FNNKEAS AIPLFSPV+VPMAQS GP LSQ+ 
Sbjct  217   VGHSLGSVIHLLIGSRYAIQRCGNILMAFNNKEASSAIPLFSPVIVPMAQSFGPLLSQLT  276

Query  802   TSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIK  623
             +SP++R GAEM +KQLG LSPPIMKQVLPLVEQLPPLYMDL+NGRE+F P+PEETRRL+K
Sbjct  277   SSPSLRRGAEMAMKQLGNLSPPIMKQVLPLVEQLPPLYMDLVNGREDFSPKPEETRRLVK  336

Query  622   SYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDV  443
             SYYG+SRNLLIKFKDDTIDET  LAQLLS  SAISS LDMS+R +PGDHGLPL Q LPD+
Sbjct  337   SYYGVSRNLLIKFKDDTIDETPTLAQLLSGGSAISSQLDMSVRLMPGDHGLPLQQVLPDI  396

Query  442   PPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSW  263
             PP M DAVN+ GE+L+NL  GTPWE  A+EV NT G +S I+RA++SK++D LVD+ TSW
Sbjct  397   PPTMADAVNRGGEILSNLTVGTPWEAVAREVSNTLGTDSGIVRAQISKDIDALVDLMTSW  456

Query  262   MVSNSGPRLLR  230
             M SNS PRL+R
Sbjct  457   MDSNSDPRLIR  467



>ref|XP_009804104.1| PREDICTED: uncharacterized protein LOC104249384 [Nicotiana sylvestris]
Length=432

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/443 (71%), Positives = 363/443 (82%), Gaps = 21/443 (5%)
 Frame = -2

Query  1543  AGMSSWLCAPAPHIHFHPPYSDSAPLFHKR--IRF-SMSQLFIRNSNSGRCKRIKVGSFN  1373
             A  +SW     P +     YSDS   F  R  IRF      + RNSN  RC      +  
Sbjct  6     APKASW-----PIVQLPSRYSDSRN-FQNRSSIRFYDFHHKYNRNSNRIRC------NLK  53

Query  1372  DNSTSNQPERS-GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLI  1196
             DN   NQPE S GIQLYRDIERLLT+TVKQSQ  WG+S+DW E+EGAWVL P  +KP+L+
Sbjct  54    DN---NQPETSTGIQLYRDIERLLTETVKQSQ-GWGSSQDWDEIEGAWVLRPKTSKPKLV  109

Query  1195  VHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFL  1016
             VHFVGG+F GAAPQL+YRLFLERL + D+LVIATPYASGFDHF+IADEVQFKFDRCLRFL
Sbjct  110   VHFVGGVFVGAAPQLSYRLFLERLSQMDVLVIATPYASGFDHFYIADEVQFKFDRCLRFL  169

Query  1015  QETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMA  836
             Q+ VQDLP+FGIGHSLGSVIHLLIGSRYAV+++GN+LM+FNNK+AS+A+P FS VL PM 
Sbjct  170   QDRVQDLPVFGIGHSLGSVIHLLIGSRYAVKKNGNVLMAFNNKDASLAVPFFSSVLAPMM  229

Query  835   QSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFV  656
             Q+IGP LS IA+SPT+RLGAEMT+KQ+  LSP I+KQV PLVEQLPPLYMDLI G++NF 
Sbjct  230   QNIGPVLSDIASSPTIRLGAEMTMKQIENLSPSIVKQVFPLVEQLPPLYMDLIKGKDNFT  289

Query  655   PRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDH  476
             PRPEET+RLI+SYYGISRNLLIKFKDDTIDETS LAQ+LS+ SAISSMLDMSIRSLPGDH
Sbjct  290   PRPEETQRLIRSYYGISRNLLIKFKDDTIDETSTLAQVLSSGSAISSMLDMSIRSLPGDH  349

Query  475   GLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFG-VESNILRAEVSK  299
              LPL QALPDVPP MTDAVN+SGELLANL AGTPWE+ AKEVGNT G V+S +L +  SK
Sbjct  350   ALPLQQALPDVPPGMTDAVNRSGELLANLTAGTPWESVAKEVGNTLGNVDSILLSSGNSK  409

Query  298   ELDLLVDVTTSWMVSNSGPRLLR  230
             +LDLLV+  TSWM+SNS PRLL+
Sbjct  410   DLDLLVETITSWMLSNSSPRLLQ  432



>ref|XP_004975526.1| PREDICTED: uncharacterized protein LOC101784110 isoform X1 [Setaria 
italica]
Length=449

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/378 (73%), Positives = 323/378 (85%), Gaps = 0/378 (0%)
 Frame = -2

Query  1363  TSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFV  1184
             TS  P    IQLY  IER++T+  KQS++ WG++ DW EVEGAWVL P +++P  +VHFV
Sbjct  71    TSASPSDGSIQLYSQIERVITEAAKQSREGWGSTGDWTEVEGAWVLRPKSSEPSFVVHFV  130

Query  1183  GGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETV  1004
             GGIF GAAPQ+TYR FLE+L ++  LVIATPYASGFDHFFIADEVQFKFDRCLR L E +
Sbjct  131   GGIFVGAAPQITYRFFLEQLADRGALVIATPYASGFDHFFIADEVQFKFDRCLRNLDEPI  190

Query  1003  QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIG  824
              DLP FG+GHSLGSVIH+LIGSRYAVQRSGN+LMSFNNKEAS AIPLFSPV+VPMAQS G
Sbjct  191   NDLPTFGVGHSLGSVIHMLIGSRYAVQRSGNVLMSFNNKEASSAIPLFSPVIVPMAQSFG  250

Query  823   PFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPE  644
             P LSQ+ + PT+R GAE  +KQL  LSPP++KQ+LPL++QLPPLYMDLI GRE+F+P+PE
Sbjct  251   PILSQLTSYPTIRFGAETAIKQLENLSPPVVKQLLPLLQQLPPLYMDLIKGREDFIPKPE  310

Query  643   ETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPL  464
             ETRRLIKSYYGISRNLLIKFKDD IDETS+LAQ+LS+++AISS+LDMSIRSLPGDH LPL
Sbjct  311   ETRRLIKSYYGISRNLLIKFKDDQIDETSILAQVLSSEAAISSLLDMSIRSLPGDHSLPL  370

Query  463   HQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLL  284
              Q LPDVPPAM DAVN+ GELLANL AGTPWE  AKEVG T G +S ILRA++SK+++ L
Sbjct  371   QQVLPDVPPAMADAVNRGGELLANLTAGTPWEAVAKEVGTTLGTDSGILRAQISKDVETL  430

Query  283   VDVTTSWMVSNSGPRLLR  230
             VDV  SW+ SNSGPRLLR
Sbjct  431   VDVIVSWISSNSGPRLLR  448



>ref|XP_009595223.1| PREDICTED: uncharacterized protein LOC104091560 [Nicotiana tomentosiformis]
Length=433

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/445 (71%), Positives = 362/445 (81%), Gaps = 24/445 (5%)
 Frame = -2

Query  1543  AGMSSWLCAPAPHIHFHPPYSDSAPLFHKR---IRF--SMSQLFIRNSNSGRCKRIKVGS  1379
             A  +SW C+P         YSDS   F  R   IRF         RNSN  RC      +
Sbjct  6     APKASWRCSPISL------YSDSR-TFQNRSSSIRFYHDFPHNHNRNSNRIRC------N  52

Query  1378  FNDNSTSNQPERS-GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPR  1202
               DN   NQPE + GIQLYRDIERLLT+TVKQSQ  WG+++DW E+EGAWVL P  +KP+
Sbjct  53    LKDN---NQPETTTGIQLYRDIERLLTETVKQSQ-GWGSTQDWDEIEGAWVLRPKTSKPK  108

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
             L+VHFVGG+F GAAPQL+YRLFLERL + D LVIATPYASGFDHF+IADEVQFKFDRCLR
Sbjct  109   LVVHFVGGVFVGAAPQLSYRLFLERLSQMDALVIATPYASGFDHFYIADEVQFKFDRCLR  168

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
             FLQE V+DLPIFGIGHSLGSVIHLLIGSRYAV+++GN+LM+FNNK+AS+A+PLFS VL P
Sbjct  169   FLQERVEDLPIFGIGHSLGSVIHLLIGSRYAVKKNGNVLMAFNNKDASLAVPLFSSVLAP  228

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             M Q+IGP LS IA+SPT+RLGAEMT+KQ+  LSP I+KQV PLVEQLPPLYMDLI G+EN
Sbjct  229   MIQNIGPVLSDIASSPTIRLGAEMTMKQIENLSPSIVKQVFPLVEQLPPLYMDLIKGKEN  288

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F PRPEET+RLI+SYYGISRNLLIKFKDDTIDETS LAQ+LS+ SAISSMLDMSIRSLPG
Sbjct  289   FTPRPEETQRLIRSYYGISRNLLIKFKDDTIDETSTLAQVLSSGSAISSMLDMSIRSLPG  348

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFG-VESNILRAEV  305
             DH LPL QALPDVPP MTDAVN+SGELLANL AGTPWE+ AKEVGNT G V+S +L +  
Sbjct  349   DHALPLQQALPDVPPGMTDAVNRSGELLANLTAGTPWESVAKEVGNTLGNVDSILLSSGN  408

Query  304   SKELDLLVDVTTSWMVSNSGPRLLR  230
             SK+LD LV+  TSWM+SNS PRLL+
Sbjct  409   SKDLDQLVETITSWMLSNSSPRLLQ  433



>ref|XP_010921172.1| PREDICTED: uncharacterized protein LOC105044838 [Elaeis guineensis]
Length=438

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/395 (70%), Positives = 330/395 (84%), Gaps = 6/395 (2%)
 Frame = -2

Query  1396  RIKVGSFNDNSTSNQPE-----RSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAW  1232
             R ++  + D  T  +P       +GIQLY  IERL+T+T K+SQD WG S DW E+EGAW
Sbjct  43    RRRIACYADEPTRKRPSGHDDSTAGIQLYSQIERLITETAKRSQDGWGASGDWNEIEGAW  102

Query  1231  VLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADE  1052
             VL P N KP  +VHFVGGIF GAAPQLTYR FLERL  K  LV+ATP+ASGFD+F IAD+
Sbjct  103   VLKPKNAKPTSVVHFVGGIFVGAAPQLTYRFFLERLSNKGALVVATPFASGFDYFLIADD  162

Query  1051  VQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVA  872
             VQFKFDRCL+FLQ+TV DLP FGIGHSLGSVIHLLIGSRYAVQRSGN+LM+FNN++AS+A
Sbjct  163   VQFKFDRCLQFLQDTVNDLPTFGIGHSLGSVIHLLIGSRYAVQRSGNVLMAFNNQKASLA  222

Query  871   IPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppL  692
             IP FSPV+VP+AQS  P LSQ+ +SPT+RLGAEM +KQL  LSPPIM+QV+PLVEQLPP 
Sbjct  223   IPFFSPVIVPVAQSFSPLLSQLTSSPTIRLGAEMAMKQLENLSPPIMRQVIPLVEQLPPF  282

Query  691   YMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSM  512
             YMDL+ G+E+F P+PEETRRLIKSYYGISRNLLIKFKDD IDETS LA++LS++  IS++
Sbjct  283   YMDLVKGKEDFTPKPEETRRLIKSYYGISRNLLIKFKDDKIDETSTLARILSSECVISTL  342

Query  511   LDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANL-AAGTPWETFAKEVGNTFG  335
             LDMSIRS+PGDHGLPL Q  PDVPPAM DAVN+ GELL NL +AGTPWE  AKEVGN+ G
Sbjct  343   LDMSIRSMPGDHGLPLQQVFPDVPPAMADAVNRGGELLVNLVSAGTPWEAVAKEVGNSLG  402

Query  334   VESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
             V+S I+RA++SK +++LVDV TSWM SNSGP+LL+
Sbjct  403   VDSGIVRAQISKHVNMLVDVITSWMASNSGPKLLQ  437



>dbj|BAG90977.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE60942.1| hypothetical protein OsJ_14693 [Oryza sativa Japonica Group]
Length=457

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/380 (73%), Positives = 322/380 (85%), Gaps = 0/380 (0%)
 Frame = -2

Query  1366  STSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHF  1187
             S    P    IQLY  IER++T+  KQS++ WG++ DW E+EGAWVL P + +P  +VHF
Sbjct  78    SAPPAPSEGSIQLYSQIERVITEAAKQSREGWGSTGDWTEIEGAWVLKPKSQEPSFVVHF  137

Query  1186  VGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQET  1007
             VGGIF GAAPQ+TYR FLERL +K  LVIATPYASGFDHFFIADEVQFKFDRCLR + E 
Sbjct  138   VGGIFVGAAPQITYRFFLERLADKGALVIATPYASGFDHFFIADEVQFKFDRCLRNMVEP  197

Query  1006  VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSI  827
             V DLP FG+GHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS+A+PLFSPV+VPMAQS 
Sbjct  198   VNDLPTFGVGHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVIVPMAQSF  257

Query  826   GPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRP  647
             GP  SQ+ + PT+R GAE  +KQL  LSPP++KQ+LPLV+QLPPLYMDL+ GRE FVP+P
Sbjct  258   GPIFSQLTSYPTLRFGAEAAIKQLENLSPPVVKQLLPLVQQLPPLYMDLVKGREEFVPKP  317

Query  646   EETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLP  467
             EETRRL+KSYYGISRNLLIKFKDD IDETS+LAQ+LS++SAISS+LDMSIRSLPGDHGLP
Sbjct  318   EETRRLVKSYYGISRNLLIKFKDDQIDETSILAQVLSSESAISSLLDMSIRSLPGDHGLP  377

Query  466   LHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDL  287
             L Q LPDVPPAM DAVN+ GELL NLA GTPWE  AKEVG+T G +S +LRA++SK+++ 
Sbjct  378   LQQVLPDVPPAMADAVNRGGELLTNLATGTPWEAVAKEVGSTLGADSGVLRAQISKDVNT  437

Query  286   LVDVTTSWMVSNSGPRLLRS  227
             LVDV  SW+ SNSGPRLLRS
Sbjct  438   LVDVIVSWIESNSGPRLLRS  457



>emb|CAH66532.1| H0502B11.12 [Oryza sativa Indica Group]
 gb|EEC77228.1| hypothetical protein OsI_15775 [Oryza sativa Indica Group]
Length=457

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/380 (73%), Positives = 321/380 (84%), Gaps = 0/380 (0%)
 Frame = -2

Query  1366  STSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHF  1187
             S    P    IQLY  IER++T+  KQS++ WG++ DW E+EGAWVL P + +P  +VHF
Sbjct  78    SAPPAPSEGSIQLYSQIERVITEAAKQSREGWGSTGDWTEIEGAWVLKPKSQEPSFVVHF  137

Query  1186  VGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQET  1007
             VGGIF GAAPQ+TYR FLERL +K  LVIATPYASGFDHFFIADEVQFKFDRCLR + E 
Sbjct  138   VGGIFVGAAPQITYRFFLERLADKGALVIATPYASGFDHFFIADEVQFKFDRCLRNMVEP  197

Query  1006  VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSI  827
             V DLP FG+GHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS+A+PLFSPV+VPMAQS 
Sbjct  198   VNDLPTFGVGHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVIVPMAQSF  257

Query  826   GPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRP  647
             GP  SQ+ + PT+R GAE  +KQL  LSPP++KQ+LPLV+QLPPLYMDL+ GRE FVP+P
Sbjct  258   GPIFSQLTSYPTLRFGAEAAIKQLENLSPPVVKQLLPLVQQLPPLYMDLVKGREEFVPKP  317

Query  646   EETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLP  467
             EETRRL+KSYYGISRNLLIKFKDD IDETS+LAQ+LS++SAISS+LDMSIRSLPGDHGLP
Sbjct  318   EETRRLVKSYYGISRNLLIKFKDDQIDETSILAQVLSSESAISSLLDMSIRSLPGDHGLP  377

Query  466   LHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDL  287
             L Q LPDVPPAM DAVN+  ELL NLA GTPWE  AKEVG+T G +S +LRA++SK+++ 
Sbjct  378   LQQVLPDVPPAMADAVNRGSELLTNLATGTPWEAVAKEVGSTLGADSGVLRAQISKDVNT  437

Query  286   LVDVTTSWMVSNSGPRLLRS  227
             LVDV  SW+ SNSGPRLLRS
Sbjct  438   LVDVIVSWIESNSGPRLLRS  457



>ref|XP_006652244.1| PREDICTED: uncharacterized protein LOC102720039 [Oryza brachyantha]
Length=456

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/370 (75%), Positives = 318/370 (86%), Gaps = 0/370 (0%)
 Frame = -2

Query  1336  IQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             IQLY  IER++T+  KQS++ WG++ DW E+EGAWVL P + KP  +VHFVGGIF GAAP
Sbjct  87    IQLYSQIERVITEAAKQSREGWGSTGDWTEIEGAWVLKPKSQKPSFVVHFVGGIFVGAAP  146

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIG  977
             Q+TYR FLERL +K  LVIATPYASGFDHFFIADEVQFKFDRCLR L E V DLP FG+G
Sbjct  147   QITYRFFLERLADKGALVIATPYASGFDHFFIADEVQFKFDRCLRNLVEPVNDLPTFGVG  206

Query  976   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATS  797
             HSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS+A+PLFSPV+VPMAQS GP  SQ+ + 
Sbjct  207   HSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVIVPMAQSFGPIFSQLTSY  266

Query  796   PTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSY  617
             PT+R GAE  +KQL  LSPP++KQ+LPLV+QLPPLYMDL+ GRE F+P+PEETRRLIKSY
Sbjct  267   PTIRFGAEAAIKQLENLSPPVVKQLLPLVQQLPPLYMDLVKGREEFIPKPEETRRLIKSY  326

Query  616   YGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPP  437
             YGISRNLLIKFKDD IDETS+LAQ+LS++SAISS+LDMSIRSLPGDHGLPL Q LPDVPP
Sbjct  327   YGISRNLLIKFKDDQIDETSILAQVLSSESAISSLLDMSIRSLPGDHGLPLQQILPDVPP  386

Query  436   AMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMV  257
             AM DAVN+ GELL NLA GTPWE  AKEVG T G +  +LRA++SK+++ LVDV  SW+ 
Sbjct  387   AMADAVNRGGELLTNLATGTPWEAVAKEVGTTLGADPGVLRAQISKDVNTLVDVIVSWIE  446

Query  256   SNSGPRLLRS  227
             SNSGPRLLRS
Sbjct  447   SNSGPRLLRS  456



>gb|AGT16017.1| hypothetical protein SHCRBa_144_K17_F_300 [Saccharum hybrid cultivar 
R570]
Length=452

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/369 (74%), Positives = 317/369 (86%), Gaps = 0/369 (0%)
 Frame = -2

Query  1336  IQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             IQLY  IER++T+  KQS++ WG++ DW EVEGAWVL P +++P  +VHFVGGIF GAAP
Sbjct  83    IQLYSQIERVITEAAKQSREGWGSTGDWTEVEGAWVLRPKSSEPSFVVHFVGGIFVGAAP  142

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIG  977
             Q+TYR FLE L  +  LVIATPYASGFDHFFIADEVQFKFDRCLR L E V DLP FG+G
Sbjct  143   QITYRFFLECLANRGALVIATPYASGFDHFFIADEVQFKFDRCLRNLDEPVNDLPTFGVG  202

Query  976   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATS  797
             HSLGSVIH+LIGSRYAVQRSGN+LMSFNNKEAS AIPLFSPV+VPMAQS GP LSQ+ + 
Sbjct  203   HSLGSVIHMLIGSRYAVQRSGNVLMSFNNKEASSAIPLFSPVIVPMAQSFGPILSQLTSY  262

Query  796   PTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSY  617
             PT+R GAE  +KQL  LSPP++KQ+LPL++QLPPLYMDL+ GRE+F+P+PEETRRLIKSY
Sbjct  263   PTIRFGAEAAIKQLENLSPPVVKQLLPLLQQLPPLYMDLVQGREDFIPKPEETRRLIKSY  322

Query  616   YGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPP  437
             YGISRNLLIKFKDD IDETS LAQ+LS+++AISS+LDMSIRSLPGDHGLPL Q LPDVPP
Sbjct  323   YGISRNLLIKFKDDQIDETSTLAQVLSSEAAISSLLDMSIRSLPGDHGLPLQQILPDVPP  382

Query  436   AMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMV  257
             AM DAVN+ GELLANL  GTPWE  AKEVG T G +S ILRA++SK+++ LVDV  SW+ 
Sbjct  383   AMADAVNRGGELLANLTTGTPWEAVAKEVGTTLGTDSGILRAQISKDVETLVDVIASWIS  442

Query  256   SNSGPRLLR  230
             SNSGPRLLR
Sbjct  443   SNSGPRLLR  451



>ref|XP_007049896.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX94053.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=404

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/349 (80%), Positives = 312/349 (89%), Gaps = 0/349 (0%)
 Frame = -2

Query  1381  SFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPR  1202
             +++D +++NQ + S +QLY +IERLLT+TV+QSQ AWG S DW +VEGAWVL P ++KP+
Sbjct  50    NYDDPNSNNQKQPSSVQLYGEIERLLTETVRQSQGAWGGSSDWSQVEGAWVLQPKHSKPK  109

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
              +VHFVGGIF GAAPQLTYR FLERL EK +LVIATPYASGFDHFFIADEVQFKFDRCLR
Sbjct  110   SVVHFVGGIFVGAAPQLTYRWFLERLSEKGVLVIATPYASGFDHFFIADEVQFKFDRCLR  169

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
             FLQETV DLP FGIGHSLGSVIHLLIGSRYAVQRSGN+LM+FNNKEAS+AIPLFSPVLVP
Sbjct  170   FLQETVHDLPTFGIGHSLGSVIHLLIGSRYAVQRSGNVLMAFNNKEASLAIPLFSPVLVP  229

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             +AQSIGP LSQIA+SPT+R+GAEMTLKQ+   SPPIMKQVLPLVEQLPPLYMDL+ GRE+
Sbjct  230   VAQSIGPILSQIASSPTIRMGAEMTLKQIENFSPPIMKQVLPLVEQLPPLYMDLVKGRED  289

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F P+PEETRRLIKSYYGISRNLLIKFKDD+IDET  LAQ+LS+DSAISSMLDMSIR LPG
Sbjct  290   FSPKPEETRRLIKSYYGISRNLLIKFKDDSIDETPKLAQVLSSDSAISSMLDMSIRLLPG  349

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFG  335
             DHGLPL QALPDVPPAM DAVN+  E LANL  GTPWET AKEV NT G
Sbjct  350   DHGLPLQQALPDVPPAMADAVNRGSEFLANLTVGTPWETVAKEVSNTLG  398



>tpg|DAA37977.1| TPA: hypothetical protein ZEAMMB73_620234 [Zea mays]
Length=451

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/369 (74%), Positives = 314/369 (85%), Gaps = 0/369 (0%)
 Frame = -2

Query  1336  IQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             IQLY  IER++T+  KQS++ WG++ DW EVEG+WVL P + +P  +VHFVGGIF GAAP
Sbjct  82    IQLYSQIERVITEAAKQSREGWGSTGDWTEVEGSWVLRPKSLEPSFVVHFVGGIFVGAAP  141

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIG  977
             Q+TYR FLE L  +  LVIATPYASGFDHFFIADEVQFKFDRCLR L E V DLP FG+G
Sbjct  142   QITYRFFLECLANRGALVIATPYASGFDHFFIADEVQFKFDRCLRNLDEPVNDLPTFGVG  201

Query  976   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATS  797
             HSLGSVIH+LIGSRYAVQRSGN+LMSFNNKEAS AIPLFSPV+VPMAQS GP  SQ+A+ 
Sbjct  202   HSLGSVIHMLIGSRYAVQRSGNVLMSFNNKEASSAIPLFSPVIVPMAQSFGPIFSQLASY  261

Query  796   PTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSY  617
             PT+R GAE  +KQL  LSPP++KQ+LPL++QLPPLYMDLI GRE+F+P+PEETRRLIKSY
Sbjct  262   PTIRFGAEAAIKQLENLSPPVVKQLLPLLQQLPPLYMDLIKGREDFIPKPEETRRLIKSY  321

Query  616   YGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPP  437
             YGISRNLLIKFKDD IDETS LAQ+LS+++AISS+LDMSIRSLPGDHGLPL Q LPDVPP
Sbjct  322   YGISRNLLIKFKDDQIDETSTLAQVLSSEAAISSLLDMSIRSLPGDHGLPLQQVLPDVPP  381

Query  436   AMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMV  257
             AM DAVN+ GELL NL  GTPWE  AKEVG T G +S ILRA++SK+++ LVDV  SW  
Sbjct  382   AMADAVNRGGELLTNLTTGTPWEAVAKEVGTTLGTDSGILRAQISKDVETLVDVIASWTS  441

Query  256   SNSGPRLLR  230
             SNSGPRLLR
Sbjct  442   SNSGPRLLR  450



>ref|NP_001143628.1| uncharacterized protein LOC100276346 [Zea mays]
 gb|ACG33661.1| hypothetical protein [Zea mays]
Length=451

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/369 (74%), Positives = 314/369 (85%), Gaps = 0/369 (0%)
 Frame = -2

Query  1336  IQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             IQLY  IER++T+  KQS++ WG++ DW EVEG+WVL P + +P  +VHFVGGIF GAAP
Sbjct  82    IQLYSQIERVITEAAKQSREGWGSTGDWTEVEGSWVLRPKSLEPSFVVHFVGGIFVGAAP  141

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIG  977
             Q+TYR FLE L  +  LVIATPYASGFDHFFIADEVQFKFDRCLR L E V DLP FG+G
Sbjct  142   QITYRFFLECLANRGALVIATPYASGFDHFFIADEVQFKFDRCLRNLDEPVNDLPTFGVG  201

Query  976   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATS  797
             HSLGSVIH+LIGSRYAVQRSGN+LMSFNNKEAS AIPLFSPV+VPM+QS GP  SQ+A+ 
Sbjct  202   HSLGSVIHMLIGSRYAVQRSGNVLMSFNNKEASSAIPLFSPVIVPMSQSFGPIFSQLASY  261

Query  796   PTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSY  617
             PT+R GAE  +KQL  LSPP++KQ+LPL++QLPPLYMDLI GRE+F+P+PEETRRLIKSY
Sbjct  262   PTIRFGAEAAIKQLENLSPPVVKQLLPLLQQLPPLYMDLIKGREDFIPKPEETRRLIKSY  321

Query  616   YGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPP  437
             YGISRNLLIKFKDD IDETS LAQ+LS+++AISS+LDMSIRSLPGDHGLPL Q LPDVPP
Sbjct  322   YGISRNLLIKFKDDQIDETSTLAQVLSSEAAISSLLDMSIRSLPGDHGLPLQQVLPDVPP  381

Query  436   AMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMV  257
             AM DAVN+ GELL NL  GTPWE  AKEVG T G +S ILRA++SK+++ LVDV  SW  
Sbjct  382   AMADAVNRGGELLTNLTTGTPWEAVAKEVGTTLGTDSGILRAQISKDVETLVDVIASWTS  441

Query  256   SNSGPRLLR  230
             SNSGPRLLR
Sbjct  442   SNSGPRLLR  450



>dbj|BAJ93488.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/370 (72%), Positives = 317/370 (86%), Gaps = 0/370 (0%)
 Frame = -2

Query  1336  IQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             IQLY  IE+++T+  KQS   W ++ DW E+EGAWVL P +++P  +VHF+GGIF GAAP
Sbjct  83    IQLYSQIEKVITEAAKQSNQGWSSTGDWTEIEGAWVLRPKSSEPAFVVHFIGGIFVGAAP  142

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIG  977
             Q+TYR FLERL +K  LVIATPYASGFDHFFIAD+VQFKFDRCLR L E V DLP FG+G
Sbjct  143   QVTYRYFLERLADKGALVIATPYASGFDHFFIADQVQFKFDRCLRNLVEPVNDLPTFGVG  202

Query  976   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATS  797
             HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEAS+AIPLFSPV+VPMAQS GP LSQ+ +S
Sbjct  203   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASLAIPLFSPVIVPMAQSFGPILSQLTSS  262

Query  796   PTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSY  617
             PT+R GAE  +KQ+  L PP++KQ+LPL++QLPPLYMDL+ GRE+F+P+PEETRRLIKSY
Sbjct  263   PTIRFGAEAAIKQIENLGPPVVKQLLPLIQQLPPLYMDLVKGREDFIPKPEETRRLIKSY  322

Query  616   YGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPP  437
             YGISRNLLIKF+DD IDETS++AQ+LS++SAISS+LDMSIRSLPGDHGLPL Q LPDVPP
Sbjct  323   YGISRNLLIKFEDDQIDETSIIAQVLSSESAISSLLDMSIRSLPGDHGLPLQQVLPDVPP  382

Query  436   AMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMV  257
              M DAV++ GELLANL  GTPWE  AKEVG TFG +S +LR +V ++++ LVDV  SW+ 
Sbjct  383   GMADAVSRGGELLANLTTGTPWEAVAKEVGTTFGTDSGVLRTQVPEDVNALVDVIASWVA  442

Query  256   SNSGPRLLRS  227
             SNSGP+LLRS
Sbjct  443   SNSGPKLLRS  452



>gb|AET03426.2| plant/MCA23-20 protein [Medicago truncatula]
Length=444

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/365 (76%), Positives = 317/365 (87%), Gaps = 2/365 (1%)
 Frame = -2

Query  1318  IERLLTDTVKQSQDAW-GTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYR  1142
             IERL+T +  QSQDAW G+S DW +VEG+W+L P ++KP  +VHFVGGIF GAAPQLTYR
Sbjct  79    IERLVTTSASQSQDAWWGSSSDWTQVEGSWILKPKSSKPNFVVHFVGGIFVGAAPQLTYR  138

Query  1141  LFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGS  962
              FLERL EK +L+IATPYASGFDHF IADEVQFKFDRC R L ETV+DLPIFG+GHSLGS
Sbjct  139   WFLERLSEKGVLIIATPYASGFDHFLIADEVQFKFDRCYRTLDETVKDLPIFGVGHSLGS  198

Query  961   VIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRL  782
             ++HLLIGSRYAVQRSGN+LM+FNNKEAS +IPLFSPVLVPMAQ+  P LS I +SPT+R 
Sbjct  199   LVHLLIGSRYAVQRSGNVLMAFNNKEASSSIPLFSPVLVPMAQNFAPLLSDIFSSPTLRA  258

Query  781   GAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISR  602
             GAEMTLKQL  +SPPIMKQVLPLVEQLPPLYMDL  GRE F P+PEETRRLIKSYYG+SR
Sbjct  259   GAEMTLKQLQNVSPPIMKQVLPLVEQLPPLYMDLAKGREEFTPKPEETRRLIKSYYGVSR  318

Query  601   NLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDA  422
             NLLIKF DD+ID+T  LAQ+LS++SAISS+LDMSIR LPGDH LPL QALPDVPPAM DA
Sbjct  319   NLLIKFNDDSIDDTPTLAQVLSSESAISSVLDMSIRKLPGDHVLPLQQALPDVPPAMADA  378

Query  421   VNKSGELLANLAAGTPWETFAKEVGNTFGVES-NILRAEVSKELDLLVDVTTSWMVSNSG  245
             VN+  ELL+NL  GTPWET AKEVGNT G++S NILRA+VSKE+D+LVDV +SW+ SN G
Sbjct  379   VNRGSELLSNLTVGTPWETVAKEVGNTLGMDSTNILRAQVSKEMDILVDVISSWIASNVG  438

Query  244   PRLLR  230
             P++LR
Sbjct  439   PKILR  443



>ref|XP_006844779.1| hypothetical protein AMTR_s00016p00259610 [Amborella trichopoda]
 gb|ERN06454.1| hypothetical protein AMTR_s00016p00259610 [Amborella trichopoda]
Length=399

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/359 (75%), Positives = 311/359 (87%), Gaps = 0/359 (0%)
 Frame = -2

Query  1309  LLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLE  1130
             L+TDT KQS   WGTS DW E+EGAWVL P +++P  IVHFVGGIF GAAPQ+TYRLFLE
Sbjct  39    LMTDTAKQSYGGWGTSGDWSEIEGAWVLKPRSSRPTSIVHFVGGIFVGAAPQITYRLFLE  98

Query  1129  RLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHL  950
             RL EK +LV+ATP+ASGFDHFFIAD+VQFKFDRCLRFLQ +V +LPIFG+GHSLGSVIHL
Sbjct  99    RLSEKGVLVVATPFASGFDHFFIADDVQFKFDRCLRFLQGSVNELPIFGVGHSLGSVIHL  158

Query  949   LIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEM  770
             LIGSRYAV R GN+ M+FNNKEAS+AIP+FSPV+VPMAQS GP LSQ+ +SPTVR GAEM
Sbjct  159   LIGSRYAVNRCGNVFMAFNNKEASLAIPMFSPVIVPMAQSFGPVLSQLTSSPTVRYGAEM  218

Query  769   TLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLI  590
              +KQL +LSPPI+KQVLPLVEQLPPLYMDL+ GRE F+P+P+ETRRLIKSYYGISRNLL+
Sbjct  219   AMKQLESLSPPILKQVLPLVEQLPPLYMDLVKGREEFIPKPDETRRLIKSYYGISRNLLV  278

Query  589   KFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKS  410
             KFKDD IDET VLAQ+LS++SAISS LDMSIR+LPGDHGLPL Q  P+VPPAM DAVNK 
Sbjct  279   KFKDDNIDETPVLAQVLSSESAISSGLDMSIRTLPGDHGLPLQQVFPEVPPAMADAVNKG  338

Query  409   GELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLL  233
             GELLANLA GTPWET A+EVG + G ES +LR +  K++D LVDV  SWM  +SGPRLL
Sbjct  339   GELLANLAVGTPWETVAREVGTSLGAESQVLRTQNVKDVDQLVDVIASWMQLHSGPRLL  397



>ref|XP_010694545.1| PREDICTED: uncharacterized protein LOC104907329 [Beta vulgaris 
subsp. vulgaris]
Length=434

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/436 (66%), Positives = 334/436 (77%), Gaps = 2/436 (0%)
 Frame = -2

Query  1537  MSSWLCAPAPHIHFHPPYSDSAPLFHKRIRFSMSQLFIRNSNSGRCKRIKVGSFNDNSTS  1358
             M    C  A  +H  P +S S       I   +  +   +    R   +   S    S +
Sbjct  1     MDVACCISASRLHKIPLFSSS--FLQTPISLLLQPIHRISFKRLRSAPVYCNSEPPTSLT  58

Query  1357  NQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGG  1178
                + + IQ+YRD ERL+T+ VKQSQD+ G + +W EVEGAWVL P N++P  +VHF+GG
Sbjct  59    RTSDSTAIQVYRDFERLITEVVKQSQDSLGGASNWSEVEGAWVLEPRNSRPWSVVHFIGG  118

Query  1177  IFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQD  998
             IF GAAPQL YRLFLERL EK IL+IATPYASGFDH  IADEVQFKFDRCLR L+ET+  
Sbjct  119   IFVGAAPQLAYRLFLERLCEKGILIIATPYASGFDHSSIADEVQFKFDRCLRSLRETIDK  178

Query  997   LPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPF  818
             LP FGIGHSLGSV+HLLIGSRYAVQR+GNILM+FNNK+ S AIPLFSP+ +PM QS+GP 
Sbjct  179   LPTFGIGHSLGSVVHLLIGSRYAVQRNGNILMAFNNKDPSQAIPLFSPIFLPMTQSMGPL  238

Query  817   LSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEET  638
             LSQIA++ T+RLGAE TLKQL  LSPPIMKQVLPL EQLPPLYMDL  GRENF P+PEET
Sbjct  239   LSQIASAETIRLGAETTLKQLENLSPPIMKQVLPLFEQLPPLYMDLAKGRENFSPKPEET  298

Query  637   RRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             RRLIK+YYGI+RNLLIKFKDD IDETSVLAQ+L+ DSAISSMLDMSIR++PGDHG PL Q
Sbjct  299   RRLIKTYYGINRNLLIKFKDDIIDETSVLAQVLTVDSAISSMLDMSIRTVPGDHGTPLQQ  358

Query  457   ALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVD  278
             ALPDVPPAM DAVN+  ELL+NL AGTPWET AK+V    G++S ILRAE SK+L+ LVD
Sbjct  359   ALPDVPPAMADAVNRGSELLSNLIAGTPWETVAKDVSTLLGMDSQILRAESSKDLEHLVD  418

Query  277   VTTSWMVSNSGPRLLR  230
             V +SWM S+  P L R
Sbjct  419   VVSSWMSSSIVPELPR  434



>ref|XP_003628950.1| hypothetical protein MTR_8g070480 [Medicago truncatula]
Length=447

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/368 (75%), Positives = 317/368 (86%), Gaps = 5/368 (1%)
 Frame = -2

Query  1318  IERLLTDTVKQSQDAW-GTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYR  1142
             IERL+T +  QSQDAW G+S DW +VEG+W+L P ++KP  +VHFVGGIF GAAPQLTYR
Sbjct  79    IERLVTTSASQSQDAWWGSSSDWTQVEGSWILKPKSSKPNFVVHFVGGIFVGAAPQLTYR  138

Query  1141  LFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGS  962
              FLERL EK +L+IATPYASGFDHF IADEVQFKFDRC R L ETV+DLPIFG+GHSLGS
Sbjct  139   WFLERLSEKGVLIIATPYASGFDHFLIADEVQFKFDRCYRTLDETVKDLPIFGVGHSLGS  198

Query  961   VIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRL  782
             ++HLLIGSRYAVQRSGN+LM+FNNKEAS +IPLFSPVLVPMAQ+  P LS I +SPT+R 
Sbjct  199   LVHLLIGSRYAVQRSGNVLMAFNNKEASSSIPLFSPVLVPMAQNFAPLLSDIFSSPTLRA  258

Query  781   G---AEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYG  611
             G   AEMTLKQL  +SPPIMKQVLPLVEQLPPLYMDL  GRE F P+PEETRRLIKSYYG
Sbjct  259   GVSIAEMTLKQLQNVSPPIMKQVLPLVEQLPPLYMDLAKGREEFTPKPEETRRLIKSYYG  318

Query  610   ISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAM  431
             +SRNLLIKF DD+ID+T  LAQ+LS++SAISS+LDMSIR LPGDH LPL QALPDVPPAM
Sbjct  319   VSRNLLIKFNDDSIDDTPTLAQVLSSESAISSVLDMSIRKLPGDHVLPLQQALPDVPPAM  378

Query  430   TDAVNKSGELLANLAAGTPWETFAKEVGNTFGVES-NILRAEVSKELDLLVDVTTSWMVS  254
              DAVN+  ELL+NL  GTPWET AKEVGNT G++S NILRA+VSKE+D+LVDV +SW+ S
Sbjct  379   ADAVNRGSELLSNLTVGTPWETVAKEVGNTLGMDSTNILRAQVSKEMDILVDVISSWIAS  438

Query  253   NSGPRLLR  230
             N GP++LR
Sbjct  439   NVGPKILR  446



>ref|XP_003579670.1| PREDICTED: uncharacterized protein LOC100828249 isoform X2 [Brachypodium 
distachyon]
Length=451

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/370 (72%), Positives = 316/370 (85%), Gaps = 0/370 (0%)
 Frame = -2

Query  1336  IQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             IQLY  IER++T+  KQS + WG++ DW E+EGAWVL P +++P  +VHF+GGIF GAAP
Sbjct  82    IQLYSQIERVITEAAKQSSEGWGSTGDWTEIEGAWVLRPKSSEPSFVVHFIGGIFVGAAP  141

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIG  977
             Q+TYR FLERL +K  LVIATPYASGFDHFFIADEVQFKFDRCLR L E V DLP FG+G
Sbjct  142   QVTYRFFLERLADKGALVIATPYASGFDHFFIADEVQFKFDRCLRNLVEPVNDLPTFGVG  201

Query  976   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATS  797
             HSLGSVIHLLIGSRYAVQR+GNILM+FNNKEAS A+PLFSPV+VPMAQS GP LSQ+ +S
Sbjct  202   HSLGSVIHLLIGSRYAVQRNGNILMAFNNKEASQAVPLFSPVIVPMAQSFGPILSQLTSS  261

Query  796   PTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSY  617
             PT+R GAE  +KQL  L PP++KQ+LPL++QLPPLYMDL  GRE F+P+PEETRRLIKSY
Sbjct  262   PTIRFGAEAAIKQLENLGPPVVKQLLPLIQQLPPLYMDLAKGREEFIPKPEETRRLIKSY  321

Query  616   YGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPP  437
             YGISRNLLIKFKDD IDETS+LAQ+LS++S+ISS+LDMSIRSLPGDHG+PL Q LPDVPP
Sbjct  322   YGISRNLLIKFKDDQIDETSILAQVLSSESSISSLLDMSIRSLPGDHGMPLQQVLPDVPP  381

Query  436   AMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMV  257
              M DAVN+ GELLANL  GTPWE  AKE+G TFG +S ILR ++ ++++ LVDV  SW+ 
Sbjct  382   GMADAVNRGGELLANLTTGTPWEAVAKELGTTFGTDSGILRTQIPEDVNALVDVIISWIA  441

Query  256   SNSGPRLLRS  227
             SNSGP+LLRS
Sbjct  442   SNSGPKLLRS  451



>ref|XP_008799217.1| PREDICTED: uncharacterized protein LOC103713938 isoform X2 [Phoenix 
dactylifera]
Length=423

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/394 (68%), Positives = 316/394 (80%), Gaps = 19/394 (5%)
 Frame = -2

Query  1396  RIKVGSFNDNSTSNQP-----ERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAW  1232
             R ++  +    T  +P       +GIQLY  IER++T+T KQSQD WG S DW E+EG W
Sbjct  43    RRRIACYAGEPTRQRPPGDDDSTAGIQLYSQIERIITETAKQSQDGWGASGDWNEIEGCW  102

Query  1231  VLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADE  1052
             +L P N KP  +VHFVGGIF GAAPQLTYR FLERL +K  LV+ATP+ASGFD+FFIADE
Sbjct  103   ILKPKNAKPTSVVHFVGGIFVGAAPQLTYRYFLERLSDKGALVVATPFASGFDYFFIADE  162

Query  1051  VQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVA  872
             VQFKFDRCLRFLQ+TV DLP FGIGHSLGSVIHLLIGSRYA+QRSGN+LM+FNN+EAS+ 
Sbjct  163   VQFKFDRCLRFLQDTVNDLPTFGIGHSLGSVIHLLIGSRYAIQRSGNVLMAFNNQEASLT  222

Query  871   IPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppL  692
             IPLFSPV+VPMAQS GPFLSQ+ +SPT+RLGAEM  KQL  LSPP M+QV+PLVEQLPPL
Sbjct  223   IPLFSPVIVPMAQSFGPFLSQLTSSPTIRLGAEMAKKQLENLSPPFMRQVIPLVEQLPPL  282

Query  691   YMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSM  512
             YMDL+ GRE+F P+PEETRRL              FKDD IDETS LA++LS++S ISS+
Sbjct  283   YMDLVKGREDFTPKPEETRRL--------------FKDDKIDETSTLARVLSSESVISSL  328

Query  511   LDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGV  332
             LDMSIRS+PGDHGLPL Q  PDVPPAM DAVN+ GELL NL+AGTPWE  AKEVGN+ GV
Sbjct  329   LDMSIRSIPGDHGLPLQQVFPDVPPAMADAVNRGGELLVNLSAGTPWEAAAKEVGNSLGV  388

Query  331   ESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
             +  I RA++SK++++LVDV  SWM SNSGP+LLR
Sbjct  389   DPVIPRAQLSKDVNMLVDVIASWMASNSGPKLLR  422



>ref|XP_010239855.1| PREDICTED: uncharacterized protein LOC100828249 isoform X1 [Brachypodium 
distachyon]
Length=452

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/371 (72%), Positives = 316/371 (85%), Gaps = 1/371 (0%)
 Frame = -2

Query  1336  IQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             IQLY  IER++T+  KQS + WG++ DW E+EGAWVL P +++P  +VHF+GGIF GAAP
Sbjct  82    IQLYSQIERVITEAAKQSSEGWGSTGDWTEIEGAWVLRPKSSEPSFVVHFIGGIFVGAAP  141

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIG  977
             Q+TYR FLERL +K  LVIATPYASGFDHFFIADEVQFKFDRCLR L E V DLP FG+G
Sbjct  142   QVTYRFFLERLADKGALVIATPYASGFDHFFIADEVQFKFDRCLRNLVEPVNDLPTFGVG  201

Query  976   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATS  797
             HSLGSVIHLLIGSRYAVQR+GNILM+FNNKEAS A+PLFSPV+VPMAQS GP LSQ+ +S
Sbjct  202   HSLGSVIHLLIGSRYAVQRNGNILMAFNNKEASQAVPLFSPVIVPMAQSFGPILSQLTSS  261

Query  796   PTVRLG-AEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKS  620
             PT+R G AE  +KQL  L PP++KQ+LPL++QLPPLYMDL  GRE F+P+PEETRRLIKS
Sbjct  262   PTIRFGQAEAAIKQLENLGPPVVKQLLPLIQQLPPLYMDLAKGREEFIPKPEETRRLIKS  321

Query  619   YYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVP  440
             YYGISRNLLIKFKDD IDETS+LAQ+LS++S+ISS+LDMSIRSLPGDHG+PL Q LPDVP
Sbjct  322   YYGISRNLLIKFKDDQIDETSILAQVLSSESSISSLLDMSIRSLPGDHGMPLQQVLPDVP  381

Query  439   PAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWM  260
             P M DAVN+ GELLANL  GTPWE  AKE+G TFG +S ILR ++ ++++ LVDV  SW+
Sbjct  382   PGMADAVNRGGELLANLTTGTPWEAVAKELGTTFGTDSGILRTQIPEDVNALVDVIISWI  441

Query  259   VSNSGPRLLRS  227
              SNSGP+LLRS
Sbjct  442   ASNSGPKLLRS  452



>ref|XP_006585865.1| PREDICTED: uncharacterized protein LOC100820080 isoform X2 [Glycine 
max]
Length=404

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/441 (62%), Positives = 328/441 (74%), Gaps = 43/441 (10%)
 Frame = -2

Query  1537  MSSWLCAPAPHIHFHPPYSDSAPLFHK-----RIRFSMSQLFIRNSNSGRCKRIKVGSFN  1373
             M++ LC P+  +      +DS  L  K     R RF  +      SN+          +N
Sbjct  1     MATSLCTPSYRVTLKLYGTDSHKLNAKPSVRYRRRFGTTTRICCTSNN----------YN  50

Query  1372  DNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIV  1193
             DN+   +P+   IQ+Y  IERLLTD+V+QSQD W  S DW EVEGAW+L P +++P  +V
Sbjct  51    DNNIQRRPQSEAIQVYSQIERLLTDSVRQSQDGWWGSPDWSEVEGAWILKPKSSEPNYVV  110

Query  1192  HFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQ  1013
             HF+GGIF GAAPQLTYR FLERL EK IL+IATPYASGFDHF IADEVQFKFDRC R LQ
Sbjct  111   HFIGGIFVGAAPQLTYRRFLERLSEKGILIIATPYASGFDHFLIADEVQFKFDRCYRTLQ  170

Query  1012  ETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQ  833
             ET+QDLPIFG+GHSLGSV+HLLIGSRYAVQRSGN+LM+FNNKEAS A+PLFSPV+VPMAQ
Sbjct  171   ETIQDLPIFGVGHSLGSVVHLLIGSRYAVQRSGNVLMAFNNKEASSAVPLFSPVIVPMAQ  230

Query  832   SIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVP  653
             +IGP LS I +SPT+R GAEMTLKQL  +SPPIMKQVLPLVEQLPPLYMDL+ GRE+F P
Sbjct  231   TIGPLLSDIFSSPTLRAGAEMTLKQLENVSPPIMKQVLPLVEQLPPLYMDLVKGREDFSP  290

Query  652   RPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHG  473
             +PEETRRL+                            LS++SAISS+LDMSIR LPGDHG
Sbjct  291   KPEETRRLV----------------------------LSSESAISSVLDMSIRKLPGDHG  322

Query  472   LPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKEL  293
             LPL QALP+VPPAM DAVN+  ELL+NL  GTPWE  AKEVGN+ G++S +LRAEVSK++
Sbjct  323   LPLQQALPNVPPAMADAVNRGSELLSNLTVGTPWEIVAKEVGNSLGMDSGVLRAEVSKDM  382

Query  292   DLLVDVTTSWMVSNSGPRLLR  230
             D+LVDV  +W+ SN+GP+LLR
Sbjct  383   DMLVDVIAAWIASNAGPKLLR  403



>ref|XP_006280814.1| hypothetical protein CARUB_v10026782mg [Capsella rubella]
 gb|EOA13712.1| hypothetical protein CARUB_v10026782mg [Capsella rubella]
Length=325

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/324 (80%), Positives = 294/324 (91%), Gaps = 0/324 (0%)
 Frame = -2

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
             ++VHF+GGIF GAAPQLTYRLFLERL EKD+LVIATPYASGFDHF IADEVQFKFDRC R
Sbjct  1     MVVHFIGGIFVGAAPQLTYRLFLERLAEKDVLVIATPYASGFDHFNIADEVQFKFDRCCR  60

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
              LQETVQDLP FGIGHSLGSVIHLLIGSRYAVQR+GN+ M+FNNKEAS+AIPLFSPVLVP
Sbjct  61    SLQETVQDLPSFGIGHSLGSVIHLLIGSRYAVQRNGNVFMAFNNKEASLAIPLFSPVLVP  120

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             MAQS+GP LSQIATSPT+RLGAEMT KQL TLSPPIMKQ+LPLVEQLPPLYMDL+ GRE+
Sbjct  121   MAQSLGPLLSQIATSPTIRLGAEMTRKQLETLSPPIMKQILPLVEQLPPLYMDLVKGRED  180

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F+P+PEETRRLI+SYYGISRNLLIKFKDD+IDETS+LAQ+L  +S+ISS LDMS+R+LPG
Sbjct  181   FIPKPEETRRLIRSYYGISRNLLIKFKDDSIDETSILAQVLGVESSISSKLDMSLRTLPG  240

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVS  302
             DHGLPL QALPDVPP M +AVN+  E LAN+A GTPWE+ AKEVG + G++S ILRA++S
Sbjct  241   DHGLPLQQALPDVPPRMAEAVNRGSEFLANIAVGTPWESMAKEVGGSLGMDSKILRADMS  300

Query  301   KELDLLVDVTTSWMVSNSGPRLLR  230
             K+L LLVD  TSWM SN GP+LLR
Sbjct  301   KDLALLVDAITSWMASNMGPKLLR  324



>gb|AFK40592.1| unknown [Medicago truncatula]
Length=439

 Score =   527 bits (1358),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 266/348 (76%), Positives = 302/348 (87%), Gaps = 2/348 (1%)
 Frame = -2

Query  1318  IERLLTDTVKQSQDAW-GTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYR  1142
             IERL+T +  QSQDAW G+S DW +VEG+W+L P ++KP  +VHFVGGIF GAAPQLTYR
Sbjct  79    IERLVTTSASQSQDAWWGSSSDWTQVEGSWILKPKSSKPNFVVHFVGGIFVGAAPQLTYR  138

Query  1141  LFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGS  962
              FLERL EK +L+IATPYASGFDHF IADEVQFKFDRC R L ETV+DLPIFG+GHSLGS
Sbjct  139   WFLERLSEKGVLIIATPYASGFDHFLIADEVQFKFDRCYRTLDETVKDLPIFGVGHSLGS  198

Query  961   VIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRL  782
             ++HLLIGSRYAVQRSGN+LM+FNNKEAS +IPLFSPVLVPMAQ+  P LS I +SPT+R 
Sbjct  199   LVHLLIGSRYAVQRSGNVLMAFNNKEASSSIPLFSPVLVPMAQNFAPLLSDIFSSPTLRA  258

Query  781   GAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISR  602
             GAEMTLKQL  +SPPIMKQVLPLVEQLPPLYMDL  GRE F P+PEETRRLIKSYYG SR
Sbjct  259   GAEMTLKQLQNVSPPIMKQVLPLVEQLPPLYMDLAKGREEFTPKPEETRRLIKSYYGASR  318

Query  601   NLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDA  422
             NLLIKF DD+ID+T  LAQ+LS++SAISS+LDMSIR LPGDH LPL QALPDVPPAM DA
Sbjct  319   NLLIKFNDDSIDDTPTLAQVLSSESAISSVLDMSIRKLPGDHVLPLQQALPDVPPAMADA  378

Query  421   VNKSGELLANLAAGTPWETFAKEVGNTFGVES-NILRAEVSKELDLLV  281
             VN+  ELL+NL  GTPWET AKEVGNT G++S NILRA+VSKE+D+LV
Sbjct  379   VNRGSELLSNLTVGTPWETVAKEVGNTLGMDSTNILRAQVSKEMDILV  426



>ref|XP_010482031.1| PREDICTED: uncharacterized protein LOC104760770 isoform X1 [Camelina 
sativa]
Length=325

 Score =   520 bits (1338),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 257/324 (79%), Positives = 293/324 (90%), Gaps = 0/324 (0%)
 Frame = -2

Query  1201  LIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR  1022
             ++VHF+GGIF GAAPQLTYRLFLERL EKD+LVIATPYASGFDHF IADEVQFKFDRC R
Sbjct  1     MVVHFIGGIFVGAAPQLTYRLFLERLAEKDVLVIATPYASGFDHFNIADEVQFKFDRCCR  60

Query  1021  FLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVP  842
              LQETVQDLP FGIGHSLGSVIHLLIGSRYAVQR+GN+ M+FNNKEAS+AIPLFSPVLVP
Sbjct  61    SLQETVQDLPSFGIGHSLGSVIHLLIGSRYAVQRNGNVFMAFNNKEASLAIPLFSPVLVP  120

Query  841   MAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGREN  662
             MAQS+GP LSQIATSPT+RLGAEMT KQL TLSPPIMKQ+LPLVEQLPPLYMDL+ GRE+
Sbjct  121   MAQSLGPLLSQIATSPTIRLGAEMTRKQLETLSPPIMKQILPLVEQLPPLYMDLVKGRED  180

Query  661   FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
             F+P+PEETRRLI+SYYGISRNLLIKF+DD+IDETS+LAQ+L  +S+ISS LDMSIR+LPG
Sbjct  181   FIPKPEETRRLIRSYYGISRNLLIKFEDDSIDETSILAQVLGVESSISSKLDMSIRTLPG  240

Query  481   DHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVS  302
             DHGLPL QALPDVPP M +AVN+  E LAN+A GTPWE+ AKEVG + G++S ILRA++S
Sbjct  241   DHGLPLQQALPDVPPRMAEAVNRGSEFLANIAVGTPWESMAKEVGGSLGMDSKILRADMS  300

Query  301   KELDLLVDVTTSWMVSNSGPRLLR  230
             K+L +LVD  TSWM SN G +LL+
Sbjct  301   KDLAVLVDAITSWMASNMGSKLLK  324



>ref|NP_001052711.2| Os04g0405600 [Oryza sativa Japonica Group]
 dbj|BAF14625.2| Os04g0405600 [Oryza sativa Japonica Group]
Length=447

 Score =   521 bits (1342),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 255/354 (72%), Positives = 293/354 (83%), Gaps = 0/354 (0%)
 Frame = -2

Query  1366  STSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHF  1187
             S    P    IQLY  IER++T+  KQS++ WG++ DW E+EGAWVL P + +P  +VHF
Sbjct  78    SAPPAPSEGSIQLYSQIERVITEAAKQSREGWGSTGDWTEIEGAWVLKPKSQEPSFVVHF  137

Query  1186  VGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQET  1007
             VGGIF GAAPQ+TYR FLERL +K  LVIATPYASGFDHFFIADEVQFKFDRCLR + E 
Sbjct  138   VGGIFVGAAPQITYRFFLERLADKGALVIATPYASGFDHFFIADEVQFKFDRCLRNMVEP  197

Query  1006  VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSI  827
             V DLP FG+GHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS+A+PLFSPV+VPMAQS 
Sbjct  198   VNDLPTFGVGHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVIVPMAQSF  257

Query  826   GPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRP  647
             GP  SQ+ + PT+R GAE  +KQL  LSPP++KQ+LPLV+QLPPLYMDL+ GRE FVP+P
Sbjct  258   GPIFSQLTSYPTLRFGAEAAIKQLENLSPPVVKQLLPLVQQLPPLYMDLVKGREEFVPKP  317

Query  646   EETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLP  467
             EETRRL+KSYYGISRNLLIKFKDD IDETS+LAQ+LS++SAISS+LDMSIRSLPGDHGLP
Sbjct  318   EETRRLVKSYYGISRNLLIKFKDDQIDETSILAQVLSSESAISSLLDMSIRSLPGDHGLP  377

Query  466   LHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEV  305
             L Q LPDVPPAM DAVN+ GELL NLA GTPWE  AKEVG        +L A +
Sbjct  378   LQQVLPDVPPAMADAVNRGGELLTNLATGTPWEAVAKEVGTGGAQYCTVLSANL  431



>gb|ABK24671.1| unknown [Picea sitchensis]
Length=472

 Score =   508 bits (1309),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 255/397 (64%), Positives = 316/397 (80%), Gaps = 3/397 (1%)
 Frame = -2

Query  1435  QLFIRNSNSGRCKRIKVGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKD  1256
             Q+  R     + K+ K G F   +++   E   I+LY  IERL+T+T +QSQD WG + +
Sbjct  72    QIGYRQHTIQKKKKRKEG-FLALASNEDSEPKAIELYGQIERLITNTARQSQDTWGATGN  130

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+E+EGAWVL P  T P  ++HFVGGIF GAAPQ+TYRLFLERL  +  LV+ATP+ASGF
Sbjct  131   WEEIEGAWVLRPNKTNPIAVIHFVGGIFVGAAPQITYRLFLERLSMRGFLVVATPFASGF  190

Query  1075  DHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSF  896
             DH  IADEVQFKFDR  RFLQ  VQDLP FG+GHSLG+VIHLLIG+RYAVQR+GN+ M+F
Sbjct  191   DHLRIADEVQFKFDRSFRFLQGDVQDLPTFGVGHSLGTVIHLLIGARYAVQRTGNVFMAF  250

Query  895   NNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlp  716
             NNKEAS+AIPLFSPV+VPMAQS GP L+Q+ +S T+R GAE+ LKQL  LSPP++KQVLP
Sbjct  251   NNKEASLAIPLFSPVIVPMAQSFGPVLAQLTSSRTIRRGAEIALKQLENLSPPLLKQVLP  310

Query  715   lveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLS  536
             LVEQLPPLY DL+NGRE+F PRPEETRRLIKSYYG+SRNLL+KFKDDTIDET VL+Q+LS
Sbjct  311   LVEQLPPLYFDLVNGREDFTPRPEETRRLIKSYYGVSRNLLVKFKDDTIDETPVLSQILS  370

Query  535   TDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAK  356
              +SA+SS LDMS+R+LPGDH LPL Q  P+VP AM DAV + GE+LANLA GTPWET AK
Sbjct  371   FESAVSSSLDMSVRTLPGDHSLPLQQVFPEVPSAMADAVTRGGEILANLATGTPWETVAK  430

Query  355   EVGNTFGVESNI--LRAEVSKELDLLVDVTTSWMVSN  251
             +VG + G ++    LR ++ ++++ LVD  T W++S+
Sbjct  431   DVGISLGTDTKARGLRQQIIQDIEQLVDEITIWVMSS  467



>gb|KDO53197.1| hypothetical protein CISIN_1g022589mg [Citrus sinensis]
 gb|KDO53198.1| hypothetical protein CISIN_1g022589mg [Citrus sinensis]
 gb|KDO53199.1| hypothetical protein CISIN_1g022589mg [Citrus sinensis]
Length=294

 Score =   475 bits (1223),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 241/293 (82%), Positives = 264/293 (90%), Gaps = 0/293 (0%)
 Frame = -2

Query  1108  LVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYA  929
             +VIATPYASGFD+F+IADEVQ K DRCLRFLQETVQDLP FGIGHSLGSVIHLLIGSRYA
Sbjct  1     MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYA  60

Query  928   VQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGT  749
             V R+GNILM+FNN+EASVAIPLFSPV VPMAQSIGP LSQIA+SPTVRLGAEMTLKQL  
Sbjct  61    VPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLEN  120

Query  748   LSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTI  569
             LSPPIMKQVLPLVEQLPPLYMDL+ GRE F P+PEETRRLIKSYYGISRNLLIKFKDD+I
Sbjct  121   LSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSI  180

Query  568   DETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANL  389
             DETS LAQ+LS+DSAISSMLDMSIR LPGDHGLPL QALPDVPPAM DAVN+  EL+ANL
Sbjct  181   DETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANL  240

Query  388   AAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
               GTPWET  KEV N+FGV+S ILRA++SK+++ LVDV +SWM SN   +LLR
Sbjct  241   TIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNRSTKLLR  293



>ref|XP_008465171.1| PREDICTED: uncharacterized protein LOC103502836 isoform X2 [Cucumis 
melo]
Length=375

 Score =   467 bits (1202),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 235/310 (76%), Positives = 271/310 (87%), Gaps = 0/310 (0%)
 Frame = -2

Query  1159  PQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGI  980
             P  +  L L   +E+ + +IATPYASGFD+F IADEVQFKFDRC R   ++VQDLP FGI
Sbjct  65    PSTSTALQLYSDIERGVFIIATPYASGFDYFLIADEVQFKFDRCHRAFLDSVQDLPTFGI  124

Query  979   GHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIAT  800
             GHSLGSVIHLLIGSRYAV+RSGN+LM+FNNKEAS A+PLFSPVLVPMAQS+GP LSQIA+
Sbjct  125   GHSLGSVIHLLIGSRYAVERSGNVLMAFNNKEASSAVPLFSPVLVPMAQSMGPLLSQIAS  184

Query  799   SPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKS  620
             SPT RLGAEMT+KQL  LSPPI+KQVLPLVEQLPPLYMDL+ GR++F P+PEETRR++KS
Sbjct  185   SPTFRLGAEMTMKQLENLSPPIVKQVLPLVEQLPPLYMDLVRGRQDFTPKPEETRRIVKS  244

Query  619   YYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVP  440
             YYGISRNLLIKFKDDTIDET +LAQLLS++SAISSMLDMS R+LPG+HGLPL Q LPD+P
Sbjct  245   YYGISRNLLIKFKDDTIDETLILAQLLSSESAISSMLDMSTRALPGNHGLPLQQGLPDIP  304

Query  439   PAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWM  260
             PAM DAVN+  EL +NL AGTPWET AKEVGNT GV+S IL+AE SK+L+LLV+V TSWM
Sbjct  305   PAMADAVNRGSELFSNLTAGTPWETVAKEVGNTLGVDSKILQAEASKDLNLLVEVVTSWM  364

Query  259   VSNSGPRLLR  230
              SN GP+LLR
Sbjct  365   SSNIGPKLLR  374



>gb|KEH20259.1| plant/MCA23-20 protein [Medicago truncatula]
Length=400

 Score =   440 bits (1132),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 222/290 (77%), Positives = 252/290 (87%), Gaps = 1/290 (0%)
 Frame = -2

Query  1318  IERLLTDTVKQSQDAW-GTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYR  1142
             IERL+T +  QSQDAW G+S DW +VEG+W+L P ++KP  +VHFVGGIF GAAPQLTYR
Sbjct  79    IERLVTTSASQSQDAWWGSSSDWTQVEGSWILKPKSSKPNFVVHFVGGIFVGAAPQLTYR  138

Query  1141  LFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGS  962
              FLERL EK +L+IATPYASGFDHF IADEVQFKFDRC R L ETV+DLPIFG+GHSLGS
Sbjct  139   WFLERLSEKGVLIIATPYASGFDHFLIADEVQFKFDRCYRTLDETVKDLPIFGVGHSLGS  198

Query  961   VIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRL  782
             ++HLLIGSRYAVQRSGN+LM+FNNKEAS +IPLFSPVLVPMAQ+  P LS I +SPT+R 
Sbjct  199   LVHLLIGSRYAVQRSGNVLMAFNNKEASSSIPLFSPVLVPMAQNFAPLLSDIFSSPTLRA  258

Query  781   GAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISR  602
             GAEMTLKQL  +SPPIMKQVLPLVEQLPPLYMDL  GRE F P+PEETRRLIKSYYG+SR
Sbjct  259   GAEMTLKQLQNVSPPIMKQVLPLVEQLPPLYMDLAKGREEFTPKPEETRRLIKSYYGVSR  318

Query  601   NLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
             NLLIKF DD+ID+T  LAQ+LS++SAISS+LDMSIR LPGDH LPL Q L
Sbjct  319   NLLIKFNDDSIDDTPTLAQVLSSESAISSVLDMSIRKLPGDHVLPLQQVL  368



>dbj|BAG95123.1| unnamed protein product [Oryza sativa Japonica Group]
Length=264

 Score =   400 bits (1028),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 200/262 (76%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -2

Query  1012  ETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQ  833
             E V DLP FG+GHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS+A+PLFSPV+VPMAQ
Sbjct  3     EPVNDLPTFGVGHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVIVPMAQ  62

Query  832   SIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVP  653
             S GP  SQ+ + PT+R GAE  +KQL  LSPP++KQ+LPLV+QLPPLYMDL+ GRE FVP
Sbjct  63    SFGPIFSQLTSYPTLRFGAEAAIKQLENLSPPVVKQLLPLVQQLPPLYMDLVKGREEFVP  122

Query  652   RPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHG  473
             +PEETRRL+KSYYGISRNLLIKFKDD IDETS+LAQ+LS++SAISS+LDMSIRSLPGDHG
Sbjct  123   KPEETRRLVKSYYGISRNLLIKFKDDQIDETSILAQVLSSESAISSLLDMSIRSLPGDHG  182

Query  472   LPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKEL  293
             LPL Q LPDVPPAM DAVN+ GELL NLA GTPWE  AKEVG+T G +S +LRA++SK++
Sbjct  183   LPLQQVLPDVPPAMADAVNRGGELLTNLATGTPWEAVAKEVGSTLGADSGVLRAQISKDV  242

Query  292   DLLVDVTTSWMVSNSGPRLLRS  227
             + LVDV  SW+ SNSGPRLLRS
Sbjct  243   NTLVDVIVSWIESNSGPRLLRS  264



>ref|XP_001784379.1| predicted protein [Physcomitrella patens]
 gb|EDQ50784.1| predicted protein [Physcomitrella patens]
Length=464

 Score =   397 bits (1020),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 269/384 (70%), Gaps = 11/384 (3%)
 Frame = -2

Query  1357  NQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGG  1178
             N  ++  +QLY  IER++ DT K++         W++++GAWVL P   +   ++HF+GG
Sbjct  77    NDNQKESLQLYGQIERVIADTAKRTSGGNMDPGRWQDIQGAWVLTPSRKEAVAVMHFIGG  136

Query  1177  IFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQET---  1007
             +F GA PQLTYRLFLERL E+  +++ATPYASGFDH  IADE QFKFDRC+R L +    
Sbjct  137   VFVGATPQLTYRLFLERLCERGFVIVATPYASGFDHLRIADEAQFKFDRCMRALMDDSKY  196

Query  1006  ---VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMA  836
                V++LP++G+GHSLG++ HLLIG+RYAVQR GN+++SFNN+ AS AIP  SP++ PM 
Sbjct  197   RPLVENLPVYGVGHSLGALTHLLIGARYAVQRKGNVIISFNNRSASDAIPFLSPMVAPMT  256

Query  835   QSIGPFLSQIATSPTVRLGAEMTL---KQLGTLSPPIMKqvlplveqlppLYMDLINGRE  665
             Q++GP L+Q+ +SP VRLGAE+ L   K+ G +SPP++KQVLP +EQL PLY D  NG++
Sbjct  257   QNLGPLLAQLTSSPAVRLGAEVALSRLKEFGNVSPPVVKQVLPFLEQLLPLYEDFANGKD  316

Query  664   NFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLP  485
              F P P ET RLIKSYYG+ RNLLIKFKDDTIDET  LAQ+L   SA+S+ LD+++R+LP
Sbjct  317   QFTPAPGETDRLIKSYYGVQRNLLIKFKDDTIDETPRLAQILVQKSAVSAFLDLTLRALP  376

Query  484   GDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEV  305
             GDH  P  Q  P++P  +T  +N+  E+ +++AAGTPW   AK  G     +   LR+E 
Sbjct  377   GDHARPCLQVFPELPDELTSTLNRGTEMFSSIAAGTPWADLAKGFGTNPAAQR--LRSET  434

Query  304   SKELDLLVDVTTSWMVSNSGPRLL  233
                ++ LVD    W+ ++   R L
Sbjct  435   IANIESLVDEIAIWVSASPKDRPL  458



>ref|XP_002973651.1| hypothetical protein SELMODRAFT_54701, partial [Selaginella moellendorffii]
 gb|EFJ25311.1| hypothetical protein SELMODRAFT_54701, partial [Selaginella moellendorffii]
Length=333

 Score =   383 bits (984),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 263/333 (79%), Gaps = 3/333 (1%)
 Frame = -2

Query  1246  VEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHF  1067
             ++GAW+L P    P  +VHFVGG+F GAAPQ+TYRLFLERL E+  L+IATP+ASGFDH 
Sbjct  1     LQGAWILRPSKGDPVGVVHFVGGVFVGAAPQITYRLFLERLAERGFLIIATPFASGFDHL  60

Query  1066  FIADEVQFKFDRCLRFLQE-TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNN  890
              IADE QFKFDRC+R L+E +++ LP FG+GHSLG+++HLLIGSRYAV+R+GN+LMSFNN
Sbjct  61    KIADETQFKFDRCIRALKEQSLESLPSFGVGHSLGALVHLLIGSRYAVERAGNVLMSFNN  120

Query  889   KEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplv  710
             K A  AIPLFSPV VPMAQ++GP L+QI+ SPTVR GAEM  +QL TLSPP++KQ+LPLV
Sbjct  121   KGAKQAIPLFSPVAVPMAQNLGPLLTQISNSPTVRFGAEMAKRQLETLSPPLVKQILPLV  180

Query  709   eqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTD  530
             EQLP LYM+L NG+E+F P  E+  RLI+SYYGI RNLL++FKDD IDET  LA++LS+ 
Sbjct  181   EQLPSLYMELANGKEDFTPTVEDATRLIRSYYGIRRNLLVRFKDDVIDETPELAKILSSS  240

Query  529   SAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEV  350
             SA+S  LD+S+R+L GDH  PL Q  P+VP  M DAV +  +LLA+LA GT +E  AKEV
Sbjct  241   SAVSMNLDLSVRTLSGDHARPLQQVFPEVPGVMADAVTRGSDLLASLAVGTLFEGVAKEV  300

Query  349   GNTFGVE--SNILRAEVSKELDLLVDVTTSWMV  257
             G TFG +  S  LR ++ ++++ LV+   +WM+
Sbjct  301   GQTFGSDPASQRLRQQLLEDIENLVEEIAAWML  333



>gb|KHG13493.1| Gut esterase 1 [Gossypium arboreum]
Length=416

 Score =   380 bits (977),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/252 (77%), Positives = 219/252 (87%), Gaps = 2/252 (1%)
 Frame = -2

Query  1384  GSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKP  1205
             GS  +N T  QP  + +QLYRD ERLLT+TV+QSQ AWG S DW +VEGAWVL P + KP
Sbjct  90    GSNRNNQT--QPSSNSVQLYRDFERLLTETVRQSQSAWGGSSDWSQVEGAWVLKPKDLKP  147

Query  1204  RLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCL  1025
             + +VHFVGGIF GAAPQLTYRLFLERL EK +LVIATPYASGFD+FFIADEVQ KFDRCL
Sbjct  148   KSVVHFVGGIFVGAAPQLTYRLFLERLSEKGVLVIATPYASGFDYFFIADEVQSKFDRCL  207

Query  1024  RFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLV  845
             RFLQET  DLP FGIGHSLGSVIHLLIGSRYA+ RSGN+LM+FNN+EAS+A+   SPVLV
Sbjct  208   RFLQETGHDLPTFGIGHSLGSVIHLLIGSRYAIPRSGNVLMAFNNQEASLALSWLSPVLV  267

Query  844   PMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRE  665
             PMAQSIGPFLSQIA+SPT+R+GAEMTLKQ+ +LSPPIMKQVLPLVEQLPPLYMDL  GRE
Sbjct  268   PMAQSIGPFLSQIASSPTIRMGAEMTLKQIESLSPPIMKQVLPLVEQLPPLYMDLAKGRE  327

Query  664   NFVPRPEETRRL  629
             +F P+PEE +RL
Sbjct  328   DFSPKPEEAQRL  339


 Score =   119 bits (299),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  457  ALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVD  278
            ALPDVPPAM DAVN+ GELL NL+AGTPWET AKEV NT GVES+I+RAE+SK+++ LV+
Sbjct  340  ALPDVPPAMADAVNRGGELLVNLSAGTPWETVAKEVSNTLGVESSIIRAEISKDMNNLVE  399

Query  277  VTTSWMVSNSGPRLLR  230
            V TSWM SNSG +L R
Sbjct  400  VITSWMASNSGTKLFR  415



>ref|XP_002975706.1| hypothetical protein SELMODRAFT_54706, partial [Selaginella moellendorffii]
 gb|EFJ23335.1| hypothetical protein SELMODRAFT_54706, partial [Selaginella moellendorffii]
Length=333

 Score =   376 bits (965),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 206/333 (62%), Positives = 264/333 (79%), Gaps = 3/333 (1%)
 Frame = -2

Query  1246  VEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHF  1067
             ++GAW+L P    P  +VHFVGG+F GAAPQ+TYRLFLERL E+  L+IATP+ASGFDH 
Sbjct  1     LQGAWILRPSKGDPVGVVHFVGGVFVGAAPQITYRLFLERLAERGFLIIATPFASGFDHL  60

Query  1066  FIADEVQFKFDRCLRFLQE-TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNN  890
              IADE QFKFDRC+R L+E +++ LP FG+GHSLG+++HLLIGSRYAV+R+GN+LMSFNN
Sbjct  61    KIADETQFKFDRCIRALKEQSLESLPSFGVGHSLGALVHLLIGSRYAVERAGNVLMSFNN  120

Query  889   KEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplv  710
             K A  AIPLFSPV VPMAQ++GP L+QI+ SPTVR GAEM  +QL TLSPP++KQ+LPLV
Sbjct  121   KGAKQAIPLFSPVAVPMAQNLGPLLTQISNSPTVRFGAEMAKRQLETLSPPLVKQILPLV  180

Query  709   eqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTD  530
             EQLP LYM+L NG+E+F P  E+  RLI+SYYGI RNLL++FKDD IDET  LA++LS+ 
Sbjct  181   EQLPSLYMELANGKEDFTPTVEDATRLIRSYYGIRRNLLVRFKDDVIDETPELAKILSSS  240

Query  529   SAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEV  350
             SA+S  LD+S+R+L GDH  PL Q  P+VP  M DAV +  +LLA+LAAGT +E  AKEV
Sbjct  241   SAVSMSLDLSVRTLSGDHARPLQQVFPEVPGVMADAVTRGSDLLASLAAGTLFEGVAKEV  300

Query  349   GNTFGVE--SNILRAEVSKELDLLVDVTTSWMV  257
             G TFG +  S  LR ++ ++++ LV+   +WM+
Sbjct  301   GQTFGSDPASQRLRQQLLEDIENLVEEIAAWML  333



>gb|ACF88056.1| unknown [Zea mays]
 gb|ACL52660.1| unknown [Zea mays]
 tpg|DAA37978.1| TPA: hypothetical protein ZEAMMB73_620234 [Zea mays]
 tpg|DAA37979.1| TPA: hypothetical protein ZEAMMB73_620234 [Zea mays]
Length=242

 Score =   364 bits (935),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/241 (76%), Positives = 210/241 (87%), Gaps = 0/241 (0%)
 Frame = -2

Query  952  LLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAE  773
            +LIGSRYAVQRSGN+LMSFNNKEAS AIPLFSPV+VPMAQS GP  SQ+A+ PT+R GAE
Sbjct  1    MLIGSRYAVQRSGNVLMSFNNKEASSAIPLFSPVIVPMAQSFGPIFSQLASYPTIRFGAE  60

Query  772  MTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLL  593
              +KQL  LSPP++KQ+LPL++QLPPLYMDLI GRE+F+P+PEETRRLIKSYYGISRNLL
Sbjct  61   AAIKQLENLSPPVVKQLLPLLQQLPPLYMDLIKGREDFIPKPEETRRLIKSYYGISRNLL  120

Query  592  IKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNK  413
            IKFKDD IDETS LAQ+LS+++AISS+LDMSIRSLPGDHGLPL Q LPDVPPAM DAVN+
Sbjct  121  IKFKDDQIDETSTLAQVLSSEAAISSLLDMSIRSLPGDHGLPLQQVLPDVPPAMADAVNR  180

Query  412  SGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLL  233
             GELL NL  GTPWE  AKEVG T G +S ILRA++SK+++ LVDV  SW  SNSGPRLL
Sbjct  181  GGELLTNLTTGTPWEAVAKEVGTTLGTDSGILRAQISKDVETLVDVIASWTSSNSGPRLL  240

Query  232  R  230
            R
Sbjct  241  R  241



>ref|XP_010482032.1| PREDICTED: uncharacterized protein LOC104760770 isoform X2 [Camelina 
sativa]
Length=271

 Score =   356 bits (914),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 213/238 (89%), Gaps = 0/238 (0%)
 Frame = -2

Query  943  GSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTL  764
            GSRYAVQR+GN+ M+FNNKEAS+AIPLFSPVLVPMAQS+GP LSQIATSPT+RLGAEMT 
Sbjct  33   GSRYAVQRNGNVFMAFNNKEASLAIPLFSPVLVPMAQSLGPLLSQIATSPTIRLGAEMTR  92

Query  763  KQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKF  584
            KQL TLSPPIMKQ+LPLVEQLPPLYMDL+ GRE+F+P+PEETRRLI+SYYGISRNLLIKF
Sbjct  93   KQLETLSPPIMKQILPLVEQLPPLYMDLVKGREDFIPKPEETRRLIRSYYGISRNLLIKF  152

Query  583  KDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
            +DD+IDETS+LAQ+L  +S+ISS LDMSIR+LPGDHGLPL QALPDVPP M +AVN+  E
Sbjct  153  EDDSIDETSILAQVLGVESSISSKLDMSIRTLPGDHGLPLQQALPDVPPRMAEAVNRGSE  212

Query  403  LLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
             LAN+A GTPWE+ AKEVG + G++S ILRA++SK+L +LVD  TSWM SN G +LL+
Sbjct  213  FLANIAVGTPWESMAKEVGGSLGMDSKILRADMSKDLAVLVDAITSWMASNMGSKLLK  270



>gb|EPS61771.1| hypothetical protein M569_13024, partial [Genlisea aurea]
Length=281

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/276 (66%), Positives = 215/276 (78%), Gaps = 1/276 (0%)
 Frame = -2

Query  1450  RFSMSQLFIRNSNSGRCKRIKVGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAW  1271
             RF  S   +   +S    RI   S ND     + E +GIQLYRDIER+LT+T +QSQ+  
Sbjct  7     RFGRSVSVLGGVSSHHRTRIYFSSDNDVG-RKRSESTGIQLYRDIERILTETARQSQEGR  65

Query  1270  GTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATP  1091
             G S DW E+EGAWVL P +     IVHFVGGIF GAAPQLTYRLFLERL  K IL+IATP
Sbjct  66    GASADWTEIEGAWVLRPKHGNATSIVHFVGGIFVGAAPQLTYRLFLERLANKGILIIATP  125

Query  1090  YASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             YASGFDHF IADE  FKF+RCLR L+++V  LP FGIGHSLGSVIHLLIGSRYAVQR GN
Sbjct  126   YASGFDHFLIADEAHFKFERCLRSLEDSVDGLPTFGIGHSLGSVIHLLIGSRYAVQRRGN  185

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             +LM+FN KEAS+A+PLFSPVLVP+AQ +GPF  Q+A++PT+RLGAEMT KQ   L P I 
Sbjct  186   VLMAFNRKEASLAVPLFSPVLVPVAQRLGPFFQQLASNPTIRLGAEMTRKQFENLGPSIF  245

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIK  623
             KQ+LPLV+QLPPLYMDL NGRE+F P+PEETR+L++
Sbjct  246   KQILPLVDQLPPLYMDLANGREDFSPKPEETRKLVR  281



>dbj|BAJ87176.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=323

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/237 (72%), Positives = 203/237 (86%), Gaps = 0/237 (0%)
 Frame = -2

Query  1336  IQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             IQLY  IE+++T+  KQS   W ++ DW E+EGAWVL P +++P  +VHF+GGIF GAAP
Sbjct  81    IQLYSQIEKVITEAAKQSNQGWSSTGDWTEIEGAWVLRPKSSEPAFVVHFIGGIFVGAAP  140

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIG  977
             Q+TYR FLERL +K  LVIATPYASGFDHFFIAD+VQFKFDRCLR L E V DLP FG+G
Sbjct  141   QVTYRYFLERLADKGALVIATPYASGFDHFFIADQVQFKFDRCLRNLVEPVNDLPTFGVG  200

Query  976   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATS  797
             HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEAS+AIPLFSPV+VPMAQS GP LSQ+ +S
Sbjct  201   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASLAIPLFSPVIVPMAQSFGPILSQLTSS  260

Query  796   PTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLI  626
             PT+R GAE  +KQ+  L PP++KQ+LPL++QLPPLYMDL+ GRE+F+P+PEETRRL+
Sbjct  261   PTIRFGAEAAIKQIENLGPPVVKQLLPLIQQLPPLYMDLVKGREDFIPKPEETRRLV  317



>emb|CAE75962.1| OJ000315_02.20 [Oryza sativa Japonica Group]
Length=286

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 178/236 (75%), Positives = 202/236 (86%), Gaps = 0/236 (0%)
 Frame = -2

Query  1012  ETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQ  833
             E V DLP FG+GHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS+A+PLFSPV+VPMAQ
Sbjct  3     EPVNDLPTFGVGHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVIVPMAQ  62

Query  832   SIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVP  653
             S GP  SQ+ + PT+R GAE  +KQL  LSPP++KQ+LPLV+QLPPLYMDL+ GRE FVP
Sbjct  63    SFGPIFSQLTSYPTLRFGAEAAIKQLENLSPPVVKQLLPLVQQLPPLYMDLVKGREEFVP  122

Query  652   RPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHG  473
             +PEETRRL+KSYYGISRNLLIKFKDD IDETS+LAQ+LS++SAISS+LDMSIRSLPGDHG
Sbjct  123   KPEETRRLVKSYYGISRNLLIKFKDDQIDETSILAQVLSSESAISSLLDMSIRSLPGDHG  182

Query  472   LPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEV  305
             LPL Q LPDVPPAM DAVN+ GELL NLA GTPWE  AKEVG        +L A +
Sbjct  183   LPLQQVLPDVPPAMADAVNRGGELLTNLATGTPWEAVAKEVGTGGAQYCTVLSANL  238



>gb|EYU26061.1| hypothetical protein MIMGU_mgv1a0066432mg, partial [Erythranthe 
guttata]
Length=252

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 186/215 (87%), Gaps = 2/215 (1%)
 Frame = -2

Query  1417  SNSGRCKRIKVGSFNDNS--TSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEV  1244
             SN    +RI V S +D    ++NQ E +GIQLYRDIER+LT+T KQSQ  WG S DW E+
Sbjct  38    SNRSSARRIAVCSSSDGGGKSTNQTETTGIQLYRDIERILTETAKQSQVGWGGSGDWSEI  97

Query  1243  EGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFF  1064
             EGAWVL P N+K   IVHF+GGIF GAAPQLTYRLFLERL +K ILVIATPYASGFDHF 
Sbjct  98    EGAWVLRPKNSKSTAIVHFIGGIFVGAAPQLTYRLFLERLADKGILVIATPYASGFDHFL  157

Query  1063  IADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKE  884
             IADEVQFKF+RCLR+LQETV+D+P FGIGHSLGSV+HLLIGSRYAVQR+GNILM+FNNKE
Sbjct  158   IADEVQFKFERCLRYLQETVEDIPTFGIGHSLGSVVHLLIGSRYAVQRNGNILMAFNNKE  217

Query  883   ASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLG  779
             AS+AIPLFSPVLVPMAQSIGPFLSQIA+SPT+RLG
Sbjct  218   ASLAIPLFSPVLVPMAQSIGPFLSQIASSPTIRLG  252



>ref|XP_004163621.1| PREDICTED: uncharacterized LOC101208391 [Cucumis sativus]
Length=246

 Score =   332 bits (852),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = -2

Query  892  NKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlpl  713
            ++EAS A+PLFSPVLVPMAQS+GP LSQIA+SPT RLGAEMT+KQL  LSPPI+KQVLPL
Sbjct  25   SQEASSAVPLFSPVLVPMAQSMGPLLSQIASSPTFRLGAEMTMKQLENLSPPIVKQVLPL  84

Query  712  veqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLST  533
            VEQLPPLYMDL+ GRE+F P+PEETRR++KSYYGISRNLLIKFKDDTIDET +LAQLLS+
Sbjct  85   VEQLPPLYMDLVRGREDFTPKPEETRRIVKSYYGISRNLLIKFKDDTIDETLILAQLLSS  144

Query  532  DSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKE  353
            +SAISSMLDMS R+LPG+HGLPL Q LPD+PPAM DAVN+  EL +NL AGTPWET A+E
Sbjct  145  ESAISSMLDMSTRALPGNHGLPLQQGLPDIPPAMADAVNRGSELFSNLTAGTPWETVARE  204

Query  352  VGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
            VGNT GV+S IL+AE SK+L+LLV+V TSWM SN GP+LLR
Sbjct  205  VGNTLGVDSKILQAEASKDLNLLVEVVTSWMSSNIGPKLLR  245



>ref|XP_008778475.1| PREDICTED: uncharacterized protein LOC103698260 [Phoenix dactylifera]
Length=235

 Score =   324 bits (831),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = -2

Query  889  KEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplv  710
            +EAS+AIPLFSPV+VPMAQS GP LSQ+ +SPT+R GAEM LKQL  LSPPIM+QVLPLV
Sbjct  15   QEASLAIPLFSPVIVPMAQSFGPVLSQLTSSPTIRHGAEMALKQLENLSPPIMRQVLPLV  74

Query  709  eqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTD  530
            EQLPPLYMDL+ GRE+F P+PEETRRLI+SYYGISRNLLIKFKDDTIDETS L Q+LS++
Sbjct  75   EQLPPLYMDLLKGREDFTPKPEETRRLIRSYYGISRNLLIKFKDDTIDETSTLEQVLSSE  134

Query  529  SAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEV  350
            SAISS+LDMSIRS+PGDHGLPL Q  PD PP M DAVN+ GELL NL AGTPWE  AK+V
Sbjct  135  SAISSLLDMSIRSIPGDHGLPLQQVFPDAPPGMADAVNRGGELLVNLTAGTPWEAVAKDV  194

Query  349  GNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLR  230
            GNT GV+S ILRA++SK++++LVDV  SWM SNSGP+LL+
Sbjct  195  GNTMGVDSGILRAQLSKDVNMLVDVIASWMASNSGPKLLQ  234



>ref|XP_002955324.1| hypothetical protein VOLCADRAFT_106736 [Volvox carteri f. nagariensis]
 gb|EFJ43624.1| hypothetical protein VOLCADRAFT_106736 [Volvox carteri f. nagariensis]
Length=473

 Score =   329 bits (844),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 261/406 (64%), Gaps = 24/406 (6%)
 Frame = -2

Query  1387  VGSFNDNSTSNQPERSGIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTK  1208
             VGS  + +T +   R+   ++ +IE ++  T   +Q   G   DW+EVEG +VL P + +
Sbjct  47    VGSTINGATPSNLPRTVPSIFSNIESMIQTTFNSTQP--GQRNDWREVEGCYVLFPPSGR  104

Query  1207  P-RLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDR  1031
             P   + HF+GG F GAAPQ+TYRLFLE L  +DILV+ATPY++ FDH  IADE QFKFDR
Sbjct  105   PPAAVAHFLGGPFVGAAPQMTYRLFLEALANRDILVVATPYSTSFDHLRIADESQFKFDR  164

Query  1030  CLRFLQETV--QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFS  857
              +R L  ++    LP +G+GHSLG +IHLLI +RYAVQRSGN+LMS+NN+ AS  IPL +
Sbjct  165   AIRALAPSLPSTSLPTYGVGHSLGGLIHLLISARYAVQRSGNVLMSYNNRPASDVIPLLT  224

Query  856   PVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLI  677
             P++VP A+ IGP ++Q+A SP +R   E   + +  LSP I++QVLPLVEQL P+Y+D  
Sbjct  225   PLIVPSARVIGPLVNQLAASP-IRSTVENITETVKGLSPSIVRQVLPLVEQLAPIYLDAA  283

Query  676   NGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSI  497
              G+  F+P PEETR LI++YYG+SRN+L++FKDD +D+T+ L QLL   SA+  +LD+++
Sbjct  284   QGKYEFLPTPEETRMLIRTYYGVSRNMLLRFKDDHMDDTNNLVQLLQGSSAVGEVLDLAV  343

Query  496   RSLPGDHGLPLHQALPDVPPAM----TDAVNKSGELLANLA----------AGTPWETFA  359
             R+LPGDH  P+ QA+ D+PP +      AV  +GE L  LA          A  P E  +
Sbjct  344   RTLPGDHLRPMQQAIVDLPPEVARLAAGAVESTGEALGRLASVATQLGVQQATVPLEELS  403

Query  358   KEVGNTFGVESNILRAEVSKELDLLVDVTTSWM----VSNSGPRLL  233
             + V     +    +   V+  +  L D   +WM    V+ SG R L
Sbjct  404   RGVVGMSAMFGGQVGGPVTDSMQSLADEVAAWMGSGAVAMSGTRAL  449



>gb|EYU28586.1| hypothetical protein MIMGU_mgv1a013293mg [Erythranthe guttata]
Length=224

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 167/236 (71%), Positives = 189/236 (80%), Gaps = 16/236 (7%)
 Frame = -2

Query  934  YAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQL  755
            YAVQR+GNILM+FNNKEAS+AIPLFSPVLVPMAQS                 AEMT KQ 
Sbjct  5    YAVQRNGNILMAFNNKEASLAIPLFSPVLVPMAQS----------------NAEMTRKQF  48

Query  754  GTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDD  575
              LSP I+KQVLPLVE L PLYMDL  GR+ F PRPEET+RLI+SYYGISRNLLIKFKDD
Sbjct  49   ENLSPSILKQVLPLVEHLSPLYMDLAKGRDEFSPRPEETQRLIRSYYGISRNLLIKFKDD  108

Query  574  TIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLA  395
            TIDETS LAQ+LS++SAISSMLDMSIRSLPGDHGLPL Q +PDVPP M DAVN+ GELLA
Sbjct  109  TIDETSRLAQVLSSESAISSMLDMSIRSLPGDHGLPLQQVMPDVPPGMADAVNRGGELLA  168

Query  394  NLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPRLLRS  227
             L+AGTPWE+ AKEVG+TF  +S I R+E +K++DLLVD   SW+ SN+  RLLRS
Sbjct  169  TLSAGTPWESVAKEVGSTFTTDSRIFRSENTKDIDLLVDTIASWIASNASARLLRS  224



>ref|XP_001700332.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98174.1| predicted protein [Chlamydomonas reinhardtii]
Length=443

 Score =   308 bits (789),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 228/329 (69%), Gaps = 14/329 (4%)
 Frame = -2

Query  1381  SFNDNSTSNQPERSGI-QLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTK-  1208
             + N   T+++P  SG+  ++ +IE ++           G   DW+EVEG +VL P + + 
Sbjct  54    TVNGAPTTSRPGVSGVPAIFTNIESMI----------QGQRNDWREVEGCYVLFPPSGRT  103

Query  1207  PRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRC  1028
             P  + HF+G  F GAAPQ+ YRLFLE L  +DILVIATPY++ FDH  IADE QF+FDR 
Sbjct  104   PSAVAHFLGEAFVGAAPQMAYRLFLEALANRDILVIATPYSTSFDHLRIADEAQFRFDRA  163

Query  1027  LRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVL  848
             +R L      LP +G+GH LGS+I LLI +RYAVQR+GN+LM +NN+ A+  IPL SP++
Sbjct  164   VRALGPATATLPTYGVGHGLGSLIQLLICARYAVQRAGNVLMCYNNRPAADTIPLLSPLI  223

Query  847   VPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGR  668
             VP A+ +GP ++QIA SP VR   E   + +  LSP +++QVLPL+EQL PLY+D   G+
Sbjct  224   VPSARVLGPIINQIAASP-VRTTVESISETVKGLSPSLVRQVLPLLEQLAPLYLDAAAGK  282

Query  667   ENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSL  488
               F+P PEETR L+++YYG+SRN+L++FKDD++D+T+ L QLL   S++  +LD+++R+L
Sbjct  283   AEFLPTPEETRMLVRTYYGVSRNMLLRFKDDSLDDTNNLVQLLQGSSSVGEVLDLTVRTL  342

Query  487   PGDHGLPLHQALPDVPPAMTDAVNKSGEL  401
             PGDH  PLHQA  D+PP +   V  SG L
Sbjct  343   PGDHLRPLHQAFVDLPPDLA-VVGVSGML  370



>ref|XP_003054868.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60120.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=326

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 216/301 (72%), Gaps = 8/301 (3%)
 Frame = -2

Query  1267  TSKDWKEVEGAWVLGPINTKPRL-IVHFVGGIFAGAAPQLTYRLFLERLVEK-DILVIAT  1094
             +++ WKE+EGAWVL P N +  + +VHF+GG F GA+PQLTYRL LE L  + D+ ++AT
Sbjct  27    SARGWKELEGAWVLPPPNGRAAVGVVHFIGGAFVGASPQLTYRLLLESLSARGDLTIVAT  86

Query  1093  PYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAV-QRS  917
             PYA GFDH  +ADE+QF FDRC+R L +    LP++G+GHS+G+++H LIGSRY +  R 
Sbjct  87    PYAIGFDHLRLADEIQFVFDRCVRSLGKEYDTLPVYGVGHSMGALMHALIGSRYKLPDRV  146

Query  916   GNILMSFNNKEASVAIPLFSPVLVPMAQS---IGPFLSQIATSPTVRLGAEMTLKQLGTL  746
             GN+L+SFNNK A+ A+PLF+PV+ P  Q+   + P  + I++SP +R  A      L   
Sbjct  147   GNVLISFNNKPATDAVPLFTPVVAPGLQARSNLSPLFNGISSSP-LRAPARAIDASLRAR  205

Query  745   SPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTID  566
             +PP+++++LP+++QL P+++++ NG   FVP+P++++ L++ YY + RNLL++F+DDTID
Sbjct  206   APPVVRELLPVLDQLEPVFLEVANGANEFVPKPDDSKDLVRKYYAVKRNLLLRFRDDTID  265

Query  565   ETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL-PDVPPAMTDAVNKSGELLANL  389
             ET VLA  L+  +AIS  LD+S++SL GDH  P  Q +  DVPP +   + ++G L++ +
Sbjct  266   ETGVLASTLTDGAAISESLDLSVKSLAGDHVRPCRQDVGADVPPELASPLIETGNLISGV  325

Query  388   A  386
             A
Sbjct  326   A  326



>emb|CAE04880.3| OSJNBa0042I15.2 [Oryza sativa Japonica Group]
Length=236

 Score =   273 bits (697),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/236 (60%), Positives = 158/236 (67%), Gaps = 50/236 (21%)
 Frame = -2

Query  1012  ETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQ  833
             E V DLP FG+GHSLGSVIHLLIGSRYAVQRSGNILM+FNNKEAS+A+PLFSPV+VPMAQ
Sbjct  3     EPVNDLPTFGVGHSLGSVIHLLIGSRYAVQRSGNILMAFNNKEASLAVPLFSPVIVPMAQ  62

Query  832   SIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVP  653
             S GP  SQ+ + PT+R G                                          
Sbjct  63    SFGPIFSQLTSYPTLRFG------------------------------------------  80

Query  652   RPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHG  473
                     +KSYYGISRNLLIKFKDD IDETS+LAQ+LS++SAISS+LDMSIRSLPGDHG
Sbjct  81    --------VKSYYGISRNLLIKFKDDQIDETSILAQVLSSESAISSLLDMSIRSLPGDHG  132

Query  472   LPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEV  305
             LPL Q LPDVPPAM DAVN+ GELL NLA GTPWE  AKEVG        +L A +
Sbjct  133   LPLQQVLPDVPPAMADAVNRGGELLTNLATGTPWEAVAKEVGTGGAQYCTVLSANL  188



>ref|XP_004170369.1| PREDICTED: uncharacterized LOC101208391, partial [Cucumis sativus]
Length=220

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 160/215 (74%), Gaps = 11/215 (5%)
 Frame = -2

Query  1507  HIHFHPPYSDSAP-LFHKRIRFSMSQLFI----RNSNSGRCKRIKVGSFNDNSTSNQPER  1343
             H H HP    S P L H+ +R+   +L I    R S     +R ++     +S + QP  
Sbjct  9     HTHRHP---HSHPVLHHQSLRYHKFKLPIALTGRQSRHQFIRRTRIKCNYQDSGNEQPPP  65

Query  1342  S---GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIF  1172
             S    +QLY DIERLLT+TV+QSQ+AWG  KDW EVEGAWVL P NT P+ +VHFVGGIF
Sbjct  66    STSTALQLYSDIERLLTETVRQSQEAWGGLKDWTEVEGAWVLKPRNTTPKYVVHFVGGIF  125

Query  1171  AGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLP  992
              GAAPQLTYRLFLERL EK I +IATPYASGFD+F IADEVQFKFDRC R   ++VQDLP
Sbjct  126   VGAAPQLTYRLFLERLSEKGIFIIATPYASGFDYFLIADEVQFKFDRCHRAFLDSVQDLP  185

Query  991   IFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNK  887
             IFG+GHSLGSVIHLLIGSRYAV+RSGN+LM+FNNK
Sbjct  186   IFGVGHSLGSVIHLLIGSRYAVERSGNVLMAFNNK  220



>gb|EYU26062.1| hypothetical protein MIMGU_mgv1a0066431mg, partial [Erythranthe 
guttata]
Length=184

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  778  AEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRN  599
            AEMT KQ   LSP I+KQVLPLVEQL PLYMDL  GR+ F PRPEET+RLI+SYYGISRN
Sbjct  1    AEMTRKQFENLSPSILKQVLPLVEQLSPLYMDLAKGRDEFSPRPEETQRLIRSYYGISRN  60

Query  598  LLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAV  419
            LLIKFKDDTIDETS LAQ+LS++SAISSMLDMSIRSLPGDHGLPL Q +PDVPP M DAV
Sbjct  61   LLIKFKDDTIDETSRLAQVLSSESAISSMLDMSIRSLPGDHGLPLQQVMPDVPPGMADAV  120

Query  418  NKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPR  239
            N+ GELLA L+AGTPWE+ AKEVG+TF  +S I R+E +K++DLLVD   SW+ SN+G R
Sbjct  121  NRGGELLATLSAGTPWESVAKEVGSTFTTDSRIFRSENTKDIDLLVDTIASWIASNAGAR  180

Query  238  LLRS  227
            LLRS
Sbjct  181  LLRS  184



>gb|EMS62397.1| hypothetical protein TRIUR3_11305 [Triticum urartu]
Length=185

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  778  AEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRN  599
            AE  +KQ+  L PP++KQ+LPL++QLPPLYMDL+ GRE+F+P+PEETRRLIKSYYGISRN
Sbjct  2    AEAAIKQIENLGPPVVKQLLPLIQQLPPLYMDLVKGREDFIPKPEETRRLIKSYYGISRN  61

Query  598  LLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAV  419
            LL+KF+DD IDETS++AQ+LS++SAISS LDMSIRSLPGDHGLPL Q LPDVPP M DAV
Sbjct  62   LLVKFEDDQIDETSIIAQVLSSESAISSQLDMSIRSLPGDHGLPLQQVLPDVPPGMADAV  121

Query  418  NKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMVSNSGPR  239
            ++ GELLANL  GTPWE  AKEVG TFG +S +LR +V ++++ LVDV  SW+ SNSGP+
Sbjct  122  SRGGELLANLTTGTPWEAVAKEVGTTFGTDSGVLRTQVPEDVNALVDVIVSWVASNSGPK  181

Query  238  LLRS  227
            LLRS
Sbjct  182  LLRS  185



>tpg|DAA37972.1| TPA: hypothetical protein ZEAMMB73_620234 [Zea mays]
 tpg|DAA37973.1| TPA: hypothetical protein ZEAMMB73_620234 [Zea mays]
 tpg|DAA37974.1| TPA: hypothetical protein ZEAMMB73_620234 [Zea mays]
 tpg|DAA37975.1| TPA: hypothetical protein ZEAMMB73_620234 [Zea mays]
 tpg|DAA37976.1| TPA: hypothetical protein ZEAMMB73_620234 [Zea mays]
Length=287

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = -2

Query  1336  IQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             IQLY  IER++T+  KQS++ WG++ DW EVEG+WVL P + +P  +VHFVGGIF GAAP
Sbjct  82    IQLYSQIERVITEAAKQSREGWGSTGDWTEVEGSWVLRPKSLEPSFVVHFVGGIFVGAAP  141

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIG  977
             Q+TYR FLE L  +  LVIATPYASGFDHFFIADEVQFKFDRCLR L E V DLP FG+G
Sbjct  142   QITYRFFLECLANRGALVIATPYASGFDHFFIADEVQFKFDRCLRNLDEPVNDLPTFGVG  201

Query  976   HSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLF  860
             HSLGSVIH+LIGSRYAVQRSGN+LMSFNNK A   I  F
Sbjct  202   HSLGSVIHMLIGSRYAVQRSGNVLMSFNNKVAFCTISFF  240



>ref|XP_001420690.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98983.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=437

 Score =   238 bits (608),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 145/356 (41%), Positives = 212/356 (60%), Gaps = 31/356 (9%)
 Frame = -2

Query  1255  WKEVEGAWVLGP-INTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEK-DILVIATPYAS  1082
             W  V+ AW L P    + + +VHF GG F GA+PQ+TY  F ERLVE+ +++VIATP   
Sbjct  89    WTRVDDAWALAPRAGVEAKAVVHFCGGAFVGASPQVTYGEFCERLVERGEVVVIATPVQL  148

Query  1081  GFDHFFIADEVQFKFDRCLRFLQETVQ---DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             G DH  +ADE   K++R  R L++T+    DLP++G+GHSLG+++ +LIGSRY  +R GN
Sbjct  149   GLDHLRVADEAWQKYERASRALRKTMDGFDDLPVYGVGHSLGALVTVLIGSRYETKRRGN  208

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             +LMSFNNK A+ AIPLF+ +  P  Q + P L     SP +R        QL  L+PP++
Sbjct  209   VLMSFNNKPATDAIPLFAELFAPGLQGLSPILDAAQKSP-LRALQRNADAQLRELAPPLV  267

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
             K++LP+++ L P+ +++ +GR  F P PEE+ +L++ YY + +NLLIKF DDTIDETS L
Sbjct  268   KELLPILDTLEPVILEVADGRAEFTPTPEESAKLVRKYYAVRKNLLIKFTDDTIDETSAL  327

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALP-DVPPAMTDAVNKSGELLANL-----  389
             A  L+   A    +D+++R+  GDH  PL +    DVP  + +A  + GE+LA       
Sbjct  328   AATLAGAVAAED-IDLTVRTRKGDHVFPLWRDTGIDVPDEVYEAAEQGGEILAAFGDAFG  386

Query  388   --AAGTPW----------ETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWMV  257
               A  +P            T AKE  +  GV+ N +       ++ LVD   +WM 
Sbjct  387   IKADSSPLGVLREGFDRARTQAKEARSAPGVDENRIL------MNALVDDVVNWMA  436



>ref|XP_008800134.1| PREDICTED: uncharacterized protein LOC103714604 [Phoenix dactylifera]
Length=233

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 141/185 (76%), Gaps = 5/185 (3%)
 Frame = -2

Query  1396  RIKVGSFNDNSTSNQPERS-----GIQLYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAW  1232
             R ++    D+ T  +P  S     GIQLY  IERL+ +T KQSQ  WGTS DW E+EGAW
Sbjct  42    RRRIACNTDDPTRKRPPGSDDSTTGIQLYPQIERLIIETAKQSQHGWGTSGDWNEIEGAW  101

Query  1231  VLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADE  1052
             VL P   +P  +VHFVGG+F GAAPQLTYR FLE L  +  LV+ATP+ASGFDHF IADE
Sbjct  102   VLKPKIARPTSVVHFVGGVFVGAAPQLTYRFFLECLSNRGALVVATPFASGFDHFLIADE  161

Query  1051  VQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSFNNKEASVA  872
             VQFKF RCLRFLQ+TV DLPIFGIGHSLGSVIHLLIGSRYAV+R+GN+LM+FNNK  +  
Sbjct  162   VQFKFARCLRFLQDTVNDLPIFGIGHSLGSVIHLLIGSRYAVERTGNVLMAFNNKVITRT  221

Query  871   IPLFS  857
             + +FS
Sbjct  222   LMVFS  226



>gb|ACJ85338.1| unknown [Medicago truncatula]
Length=221

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = -2

Query  1318  IERLLTDTVKQSQDAW-GTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYR  1142
             IERL+T +  QSQDAW G+S DW +VEG+W+L P ++KP  +VHFVGGIF GAAPQLTYR
Sbjct  79    IERLVTTSASQSQDAWWGSSSDWTQVEGSWILKPKSSKPNFVVHFVGGIFVGAAPQLTYR  138

Query  1141  LFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGS  962
              FLERL EK +L+IATPYASGFDHF IADEVQFKFDRC R L ETV+DLPIFG+GHSLGS
Sbjct  139   WFLERLSEKGVLIIATPYASGFDHFLIADEVQFKFDRCYRTLDETVKDLPIFGVGHSLGS  198

Query  961   VIHLLIGSRYAVQRSGN  911
             ++HLLIGSRYAVQRSG 
Sbjct  199   LVHLLIGSRYAVQRSGK  215



>gb|KFM23697.1| hypothetical protein F751_3913 [Auxenochlorella protothecoides]
Length=405

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 192/323 (59%), Gaps = 28/323 (9%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+EV GAWVL P   +P ++VHFVGG F GAAPQL YR FLE L  +  +VIATP+ +GF
Sbjct  17    WREVAGAWVLNPPGNEPSVVVHFVGGAFVGAAPQLAYRPFLEALAARGAVVIATPFHTGF  76

Query  1075  DHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSF  896
             DH  +ADEV F + R L+ L    Q LP +G+GHSLGS++ LL+ SRY VQ +GNILMSF
Sbjct  77    DHTRVADEVHFMYQRALKALGPRAQRLPTYGVGHSLGSLLQLLLASRYVVQPAGNILMSF  136

Query  895   NNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlp  716
             NNK  + AIPLFS  + P +Q IGP LSQ+A SP +R   E  L  L + SP +++Q+ P
Sbjct  137   NNKPVTDAIPLFSGYIAPGSQFIGPLLSQLAASP-LRSSLEGFLASLKSQSPDVVRQLTP  195

Query  715   lveqlppLYMDLINGRENFVPRPEETRRLIKS-----------------YYGISRNLLIK  587
             ++EQL P+Y D+  G   FVP P E + +I+                   YG+ RNLLI+
Sbjct  196   VIEQLLPIYTDIAKGTREFVPSPAECKDMIREGKGVDGERISVDPWRAFGYGVERNLLIR  255

Query  586   FKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL----PDVPPAMTDAV  419
             F  D ID+T  LA  L   S+I+ +LD+   +LPG H  PL Q       DV      A 
Sbjct  256   FASDPIDDTPQLAATLEM-SSIADLLDLQQVTLPGTHVRPLQQEFGRLTSDVGKYAQAAR  314

Query  418   NKSGELLANLA-----AGTPWET  365
              +S  L+  LA     AG P E 
Sbjct  315   TQSEALIDQLAQMARGAGVPAEA  337



>emb|CEF99959.1| Protein of unknown function DUF1350 [Ostreococcus tauri]
Length=432

 Score =   222 bits (566),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 193/313 (62%), Gaps = 9/313 (3%)
 Frame = -2

Query  1315  ERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPI-NTKPRLIVHFVGGIFAGAAPQLTYRL  1139
             ER  +D    + D     + W+ V+ A+VL P  + K   ++HF GG F GA+PQ+TY  
Sbjct  64    ERWASDAAG-AVDGSSAERGWRRVDEAYVLAPKGDAKATRVIHFCGGAFVGASPQVTYSE  122

Query  1138  FLERLV-EKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQ---DLPIFGIGHS  971
               E LV E + +VIATP A G DH  +ADE   +++RC R L+  V    +LP++G+GHS
Sbjct  123   MCETLVREGNAIVIATPIAMGLDHLRVADEAWQRYERCARELRRNVDGFDELPVYGVGHS  182

Query  970   LGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPT  791
              G+++ +LI SRY  +R GN++MSFNNK A+ AIPLF+ VL P  + + P L     SP 
Sbjct  183   FGALLTVLIASRYETKRRGNVMMSFNNKPATDAIPLFADVLAPGLRGLSPILDAANKSPL  242

Query  790   VRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYG  611
               L       QL   +PP+++++LP+++ L P+ +++ +GR  F P P E+ +LI+ YY 
Sbjct  243   RSLQRNAD-TQLREFAPPLVRELLPILDTLEPVILEIADGRAEFTPTPTESAKLIQKYYS  301

Query  610   ISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALP-DVPPA  434
               +NLLIKF+DDTIDETS LA  L+   A S  LD+++R+ PGDH  PL +    ++P  
Sbjct  302   TKKNLLIKFQDDTIDETSALAATLAGAVAASD-LDLTVRARPGDHVFPLWRDTGIEIPTE  360

Query  433   MTDAVNKSGELLA  395
             + D   + G++LA
Sbjct  361   IYDVAEQGGDILA  373



>ref|XP_007512196.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66284.1| predicted protein [Bathycoccus prasinos]
Length=494

 Score =   221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/363 (37%), Positives = 195/363 (54%), Gaps = 62/363 (17%)
 Frame = -2

Query  1327  YRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPIN----------------------  1214
             ++D+ER L    + ++ A   S+ W++V+ +WV  P                        
Sbjct  59    FKDLERSLEALAEATKGA--ESRGWRKVDDSWVFDPTKEGVFNFGGSEKEEEEEEEAVAE  116

Query  1213  -------------TKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKD-ILVIATPYASGF  1076
                           KP  + HF+GG F GA+PQLTYR+FLE+L  +   +V+ATPY   F
Sbjct  117   EEEESSSSFSKSKKKPTCVCHFIGGAFVGASPQLTYRVFLEKLAARSSCVVVATPYELSF  176

Query  1075  DHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMSF  896
             DH  + D+ QFKFDR    L   +Q LP+  IGHS+G+ +H LI SRY + R   +L+S+
Sbjct  177   DHLRVVDDCQFKFDRAFAKLDADLQTLPVVSIGHSMGAHVHALINSRYELNREALVLISY  236

Query  895   NNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlp  716
             NNK A+ A+PLF+ V VP   +I P L  +A SP +R       + + + +P  +K++L 
Sbjct  237   NNKPATDAVPLFAEVFVPGLSAISPVLQPLAASP-LRESLRDVDRNVRSFAPEAVKELLT  295

Query  715   lveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLS  536
             +V+QL PL +D+ NGR+ F P PEE + LIK YY     LLIKF+DDTIDET+VLA +L+
Sbjct  296   VVDQLEPLLLDVSNGRKEFQPTPEEAKELIKKYYSGPNTLLIKFRDDTIDETAVLASVLT  355

Query  535   ---------------------TDSAISSMLDMSIRSLPGDHGLPLHQALPD--VPPAMTD  425
                                       + + D S+++ PGDH  PL Q LP   +P ++ D
Sbjct  356   EVNSGGRSSSGSSSGSNESSSETGGANGVADFSVKTQPGDHISPLWQPLPTEILPESIVD  415

Query  424   AVN  416
             + N
Sbjct  416   SAN  418



>ref|XP_003082420.1| unnamed protein product [Ostreococcus tauri]
Length=561

 Score =   221 bits (564),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 193/313 (62%), Gaps = 9/313 (3%)
 Frame = -2

Query  1315  ERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPI-NTKPRLIVHFVGGIFAGAAPQLTYRL  1139
             ER  +D    + D     + W+ V+ A+VL P  + K   ++HF GG F GA+PQ+TY  
Sbjct  193   ERWASDAAG-AVDGSSAERGWRRVDEAYVLAPKGDAKATRVIHFCGGAFVGASPQVTYSE  251

Query  1138  FLERLV-EKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQ---DLPIFGIGHS  971
               E LV E + +VIATP A G DH  +ADE   +++RC R L+  V    +LP++G+GHS
Sbjct  252   MCETLVREGNAIVIATPIAMGLDHLRVADEAWQRYERCARELRRNVDGFDELPVYGVGHS  311

Query  970   LGSVIHLLIGSRYAVQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPT  791
              G+++ +LI SRY  +R GN++MSFNNK A+ AIPLF+ VL P  + + P L     SP 
Sbjct  312   FGALLTVLIASRYETKRRGNVMMSFNNKPATDAIPLFADVLAPGLRGLSPILDAANKSPL  371

Query  790   VRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYG  611
               L       QL   +PP+++++LP+++ L P+ +++ +GR  F P P E+ +LI+ YY 
Sbjct  372   RSLQRNAD-TQLREFAPPLVRELLPILDTLEPVILEIADGRAEFTPTPTESGKLIQKYYS  430

Query  610   ISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALP-DVPPA  434
               +NLLIKF+DDTIDETS LA  L+   A S  LD+++R+ PGDH  PL +    ++P  
Sbjct  431   TKKNLLIKFQDDTIDETSALAATLAGAVAASD-LDLTVRARPGDHVFPLWRDTGIEIPTE  489

Query  433   MTDAVNKSGELLA  395
             + D   + G++LA
Sbjct  490   IYDVAEQGGDILA  502



>ref|XP_002506841.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68099.1| predicted protein [Micromonas sp. RCC299]
Length=598

 Score =   201 bits (511),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 138/418 (33%), Positives = 215/418 (51%), Gaps = 65/418 (16%)
 Frame = -2

Query  1327  YRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPIN-TKPRLIVHFVGGIFAGAAPQL  1151
             +  +E LL+   + +  A   ++ W+E+EG W+L P +   P  +VHF GG F GA+PQ+
Sbjct  67    FERLESLLSSAAEAT--APSDARGWRELEGTWILAPPDGAAPEAVVHFCGGAFVGASPQI  124

Query  1150  TYRLFLERLVEKD-ILVIATPYASGFDHFFIADEVQFKFDRCLRFLQ----ETVQDLPIF  986
             TY LFLERL  +  + ++ATP+A GF+H  IAD+ Q  F+R L  L      +  D P F
Sbjct  125   TYGLFLERLCARARVTIVATPFAIGFEHLRIADDAQLAFERALAALAAEDPASYADAPTF  184

Query  985   GIGHSLGSVIHLLIGSRYAV----QRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPF  818
             G+GHS+GS++H +IG+RY +    +R+GN LMSFNNK A+ A+PLF+ VL P  + + P 
Sbjct  185   GVGHSMGSLLHAIIGARYRLDGPGRRAGNALMSFNNKPATDAVPLFAEVLAPGLRLLSPA  244

Query  817   LSQIATSPTV---RLGAEMTLKQLGT---LSPPIMKqvlplveqlppLYMDLINGRENFV  656
             ++ + T+P     R  AE   +   +    S  +++++LP+++Q+ P++M++ NG   FV
Sbjct  245   ITAVTTNPASLASRSAAEFVFRSPSSPFYASAGVVRELLPVLDQIEPVFMEVANGASEFV  304

Query  655   PRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLL----------------STDSA  524
             P P  TR L+  +Y + R LL++F+DD+IDET      +                  ++ 
Sbjct  305   PTPGATRELMAHHYRVPRTLLVRFEDDSIDETGDAEAAMRVAQERIRATDGDDADGDENP  364

Query  523   ISSMLDMSIRSLPGDHGLPLH---------------------QALPDVPPAMTDAVNKSG  407
               S  ++ + +LPGDH  PL                       ++ D    M DA +   
Sbjct  365   PRSDSNVRVVNLPGDHVRPLRPEPPAVAADVAASFVDAGDAVSSIADAFGIMEDASDAVA  424

Query  406   ELLANLAAGTPWETFAKEVGNTFGVESN-ILRAEVSK-------ELDLLVDVTTSWMV  257
               L  L AG  +E    EVG   G   N   + EV +       E D L     +WM 
Sbjct  425   NPLGFLRAG--FEQAKAEVGRRVGANGNGDQKGEVGEGRTDAWVEADALAGEIAAWMC  480



>gb|EPS58155.1| hypothetical protein M569_16662 [Genlisea aurea]
Length=139

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 11/140 (8%)
 Frame = -2

Query  637  RRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
            R+ I+SYYGIS+NLLIKF DD IDETS LAQ+LS+++A+SSMLDMSIRSLPG+HGLPL Q
Sbjct  6    RKQIRSYYGISKNLLIKFHDDAIDETSTLAQILSSEAAVSSMLDMSIRSLPGNHGLPLQQ  65

Query  457  ALPDVPPAMTDAVNKSGELLANLAAGTPWETFAKEVGNTFGVESNILRAEV---SKELDL  287
             LPDVPPAM  AVN  GELLA++AAGTPWE+ AK+VGNT       LR+E    +KEL+L
Sbjct  66   VLPDVPPAMAGAVNLGGELLASIAAGTPWESVAKDVGNT-------LRSETGGNAKELEL  118

Query  286  LVDVTTSWMVSNSG-PRLLR  230
            LV V  +W+ SN G PRLL+
Sbjct  119  LVGVIANWIESNPGLPRLLK  138



>ref|WP_038083882.1| hypothetical protein [Tolypothrix bouteillei]
Length=264

 Score =   170 bits (430),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 142/271 (52%), Gaps = 57/271 (21%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P N  P  IVHF+GG F   AP +TYR  LE+L  K   VIATP+ + 
Sbjct  2     DWKEISGNWVLIPRN--PIGIVHFLGGAFVATAPHITYRWLLEQLATKGYAVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH+ IA  V   F+R L  LQ++     + LPI+GIGHS+G  +HLLIGS +AV+R+GN
Sbjct  60    LDHYAIAKSVLLNFERALERLQDSSAIRKRYLPIYGIGHSMGCKLHLLIGSLFAVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+S+NN  A  AIP     LV    +I P + Q   +  V                   
Sbjct  120   ILISYNNYAARDAIP-----LVEQFNAI-PLVEQFNLAAAVE------------------  155

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET +L++  Y + RNLL+KF +DT+D+++ L
Sbjct  156   -----------------------FTPSPLETNQLVQERYAVRRNLLVKFSNDTLDQSAAL  192

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              +LL      S M  +++++L G H  PL Q
Sbjct  193   TELLK--QRFSDM--VTVQTLTGTHTTPLGQ  219



>ref|WP_008312548.1| Protein of unknown function (DUF1350) [Leptolyngbya sp. PCC 6406]
Length=253

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 145/290 (50%), Gaps = 61/290 (21%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+EV G W+  P   +P+ IVHF+GG F  +AP LTYRL LE L  +  L++ATP+ + 
Sbjct  2     DWREVTGNWLWVP--PQPKAIVHFLGGAFVASAPHLTYRLLLEALGRQGYLIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE---TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             FDH  IA EV   F++ L +LQ    + + LPI+G+GHS+G  IHLL+ S   ++R+GN+
Sbjct  60    FDHRAIAHEVAITFEQALYYLQNRGFSPRSLPIYGLGHSMGGKIHLLLSSLGRLERAGNV  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             LM+FNN  A  +IPL                                L+Q  + SP   +
Sbjct  120   LMAFNNYSARRSIPL--------------------------------LEQFTSFSPQFRE  147

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P ET  L++  Y + RNLLIKF  D IDET VL 
Sbjct  148   M--------------------EFTPSPAETLALVRDRYSVRRNLLIKFSRDDIDETRVLG  187

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELL  398
              +L       +    +I  LPG H  PL QA+P  P +   A++  G+ +
Sbjct  188   TVLMDKFPQLT----TIERLPGTHTTPLAQAVPWQPGSSFTALDALGQFV  233



>ref|WP_039742939.1| hypothetical protein [Hassallia byssoidea]
 gb|KIF35594.1| hypothetical protein PI95_15205 [Hassallia byssoidea VB512170]
Length=255

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 145/289 (50%), Gaps = 66/289 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE++G WVL P N  P  I+HF+GG F   AP LTYR  LE+L EK  ++IATP+ + 
Sbjct  2     DWKEIQGNWVLIPRN--PIGIIHFLGGAFVATAPHLTYRWLLEQLAEKGYVIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  VQ  FDR +  L ++     + LPI+G+GHS+G  +HLLIGS  +V+R+GN
Sbjct  60    LDHIAIAKSVQLNFDRVIERLHDSSALRKRYLPIYGLGHSMGCKLHLLIGSTLSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               P + Q  T+  +                   
Sbjct  120   ILISFNNYAARDAI---------------PLVEQFNTTFAIE------------------  146

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET +L++  Y + RNLLIKF +DT+D+++ L
Sbjct  147   -----------------------FTPSPLETNKLVQERYNVRRNLLIKFSNDTLDQSAAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
              ++L        M  ++ ++LPG H  PL Q +   P A    ++  G+
Sbjct  184   KEIL--QQRFPEM--VTAQTLPGSHVTPLGQDVKWQPGASFTPIDALGQ  228



>ref|WP_015209766.1| Protein of unknown function (DUF1350) [Cylindrospermum stagnale]
 ref|YP_007149204.1| Protein of unknown function (DUF1350) [Cylindrospermum stagnale 
PCC 7417]
 gb|AFZ26524.1| Protein of unknown function (DUF1350) [Cylindrospermum stagnale 
PCC 7417]
Length=255

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 146/289 (51%), Gaps = 66/289 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WV+ P N  P  I+HF+GG F   AP LTYR  LE L  K  ++IATP+ + 
Sbjct  2     DWKEIRGNWVVIPRN--PIGIIHFLGGAFVATAPHLTYRWLLEHLASKGYVIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R    LQ+T +     LPI+G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHQAIAKSVLLNFERTRERLQDTGELRKLYLPIYGVGHSMGCKLHLLIGSFFEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               P + Q+ ++  +                   
Sbjct  120   ILISFNNYAAKEAI---------------PLVEQLNSTLAIE------------------  146

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET +L++  Y I RNLLIKF +DTID+++VL
Sbjct  147   -----------------------FTPTPLETNQLVQEKYQIRRNLLIKFSNDTIDQSAVL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
              ++L   +    M  +S+++LPG+H  PL Q +   P A   A +  G+
Sbjct  184   TKIL--QARFPEM--VSVQTLPGNHTTPLGQDIKWQPGASFTAFDAFGQ  228



>ref|WP_015133729.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 ref|YP_007070793.1| hypothetical protein Lepto7376_1623 [Leptolyngbya sp. PCC 7376]
 gb|AFY37959.1| protein of unknown function DUF1350 [Leptolyngbya sp. PCC 7376]
Length=266

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 163/327 (50%), Gaps = 74/327 (23%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+E  G+W L P   +P  +VHF+GG F G APQLTY+  LERL +    VI TP+ +GF
Sbjct  3     WQESAGSWYLIP--AQPVGVVHFLGGAFVGTAPQLTYKWLLERLADSGFAVITTPFVNGF  60

Query  1075  DHFFIADEVQFKFDRCLRFLQ--ETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILM  902
             DH  IA +V  +F+  L  LQ  +T+  LP++G+GHS+G  IHLLI S + VQR+GN+L+
Sbjct  61    DHLAIARQVLNRFENILDRLQNAQTIGFLPVYGVGHSMGCKIHLLINSLFNVQRAGNVLI  120

Query  901   SFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqv  722
             S+NN     +IPL   +      SI PFL Q                             
Sbjct  121   SYNNFPVKRSIPLLDQM-----DSI-PFLDQ-----------------------------  145

Query  721   lplveqlppLYMDLINGREN--FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                         DL N  +N  F P P ET  +I+S Y   RNLLI+F++DTID+T+ L+
Sbjct  146   -----------FDLNNSIDNFEFTPSPAETNEIIQSSYQTRRNLLIQFENDTIDQTAELS  194

Query  547   QLLSTDSAISSMLDMSI-RSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
              +L     +    +M + R +PG+H  PL Q +            + GE  A      P 
Sbjct  195   PIL-----LERFPNMVVSRKIPGNHLTPLGQEID----------WQVGEGFA------PL  233

Query  370   ETFAKEVGNTFGVESNILRAEVSKELD  290
             E   K +      +  +L+AEV + L+
Sbjct  234   EALGKWMKQELSKDLVVLKAEVCRWLN  260



>ref|WP_006098134.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX78658.1| conserved hypothetical protein [Coleofasciculus chthonoplastes 
PCC 7420]
Length=269

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 141/271 (52%), Gaps = 52/271 (19%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G+WVL P  ++P  IVHF+GG F  AAPQ+TYR  LE+L  +  LV+ATP+ + 
Sbjct  2     DWQELSGSWVLIP--SRPVGIVHFLGGAFIAAAPQVTYRWLLEQLGRQGYLVVATPFLNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA EV  +F+  L  L+ T     Q LPI+G+GHS+G  +HLLIGS ++V+R+GN
Sbjct  60    LDHVAIAREVLNRFETTLDRLKATRLLRKQYLPIYGVGHSMGCKLHLLIGSLFSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIP        M   +  FL Q+   P   +                 
Sbjct  120   ILISFNNYPAKQAIPFLEQ--FNMLDQLT-FLKQLNIKPAFDV-----------------  159

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P+ET  LI   Y I RNLLIKF  D ID+T++L
Sbjct  160   ----------------------EFTPSPQETNDLIAQQYAIRRNLLIKFIKDEIDQTAIL  197

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             + +L        +L M    LPG+H  PL Q
Sbjct  198   SPVLQQRFPNMVVLQM----LPGNHLTPLGQ  224



>ref|WP_029636596.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=255

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 145/289 (50%), Gaps = 66/289 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE++G WVL P N  P  I+HF+GG F   AP LTYR  LE+L EK  +VIATP+ + 
Sbjct  2     DWKEIQGNWVLIPRN--PIGIIHFLGGAFVATAPHLTYRWLLEQLAEKGYVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   FDR +  L ++     + LPI+G+GHS+G  +HLLIGS  +V+R+GN
Sbjct  60    LDHIAIAKSVHLNFDRVIERLHDSEALRKRYLPIYGLGHSMGCKLHLLIGSLLSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               P + Q  T+  +                   
Sbjct  120   ILISFNNYAARDAI---------------PLVEQFNTTFAIE------------------  146

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET++L++  Y + RNLLIKF +DT+D+++ L
Sbjct  147   -----------------------FTPSPLETKKLVEERYNVRRNLLIKFSNDTLDQSAAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
              ++L        M  ++ ++LPG H  PL Q +   P A    ++  G+
Sbjct  184   KEILQ--QRFPEM--VTAQTLPGSHVTPLGQDVKWQPGASFTPIDALGQ  228



>ref|WP_016876506.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=261

 Score =   164 bits (415),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 137/271 (51%), Gaps = 60/271 (22%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P   KP  I+HF+GG F   AP +TYRL LE   EK  +VIATP+ + 
Sbjct  2     DWKEISGNWVLLP--QKPIGIIHFLGGAFVATAPHITYRLLLENTAEKGFVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +V   F+R L  L++        LPI+GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIAQQVLLNFERVLVRLEDRGLLGKGYLPIYGIGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIP     LV    +   F S  A                        
Sbjct  120   ILISFNNYAARDAIP-----LVEQLNTNFQFNSNFAVE----------------------  152

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET +L++  Y + RNLLIKF +DTID+++ L
Sbjct  153   -----------------------FTPSPLETTKLVQEQYNVRRNLLIKFTNDTIDQSAAL  189

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              +LL        M  ++ ++LPG+H  PL Q
Sbjct  190   TELLQ--KRFPGM--VTAQTLPGNHLTPLGQ  216



>ref|WP_008189302.1| hypothetical protein [Moorea producens]
 gb|EGJ29651.1| protein of unknown function, DUF1350 [Moorea producens 3L]
Length=257

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 146/289 (51%), Gaps = 64/289 (22%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G WVL P   +P  I+HF+GG F   AP +TYRL LE+L  +   VIATP+ + 
Sbjct  2     DWQEISGNWVLIP--NRPTGIIHFLGGAFIATAPHVTYRLLLEKLAAQRYAVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +V  +F+  L  LQ T     + LPI+GIGHS+G  +HLLIGS ++V+R+GN
Sbjct  60    LDHIAIARDVLNRFETTLNRLQVTNVLRKRYLPIYGIGHSMGCKLHLLIGSLFSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+S+NN  A  AI               PF+ Q+  +P  ++                 
Sbjct  120   ILISYNNYSADRAI---------------PFVEQLNLNPIFQV-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P+ET  LI   Y I RNLLIKF DD ID++  L
Sbjct  148   ----------------------EFTPSPQETNYLITQRYQIQRNLLIKFTDDEIDQSVSL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
              Q L       +M  ++++ +PG+H  PL Q +   P A+   ++  G+
Sbjct  186   TQTLQ--KRFPNM--VALQRIPGNHLTPLGQDVTLNPGAVFTPLDAVGQ  230



>ref|WP_019493662.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=263

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 142/271 (52%), Gaps = 61/271 (23%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             WKE+ G WVL     KP  I+HF+GG F   AP LTYRL LE L EK  +VIATP+ + F
Sbjct  3     WKEISGNWVLAT-KQKPLGIIHFLGGAFVATAPHLTYRLLLEALAEKGYIVIATPFVNTF  61

Query  1075  DHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRY-AVQRSGN  911
             DH  IA +V   F+R +  L+E        LPI+GIGHS+G  +HLLIGSR+  V+R+GN
Sbjct  62    DHDAIAQQVLLNFERAMIRLEERGILGNGYLPIYGIGHSMGCKLHLLIGSRFPKVERAGN  121

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             I +SFNN  A  A+               PF+ Q  T+ T    +++T++          
Sbjct  122   IFISFNNYAARDAV---------------PFIEQFNTAFT---NSQLTVE----------  153

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    FVP P +T  L++ YY + RNLL+KF  DTID++  L
Sbjct  154   -----------------------FVPSPAQTNDLVREYYNVRRNLLVKFTSDTIDQSVGL  190

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             +++L      + M+ M I  + G+H  PL Q
Sbjct  191   SEILR--ERFNDMVTMQI--IAGNHLTPLGQ  217



>ref|WP_015185539.1| hypothetical protein [Microcoleus sp. PCC 7113]
 ref|YP_007124816.1| hypothetical protein Mic7113_5789 [Microcoleus sp. PCC 7113]
 gb|AFZ21410.1| Protein of unknown function (DUF1350) [Microcoleus sp. PCC 7113]
Length=254

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/327 (34%), Positives = 160/327 (49%), Gaps = 80/327 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+EV  +WVL P   +P+ IVHF+GG F   APQ+TYR  LE+L  +   V+ATP+ + 
Sbjct  2     DWQEVSSSWVLIP--PRPKGIVHFLGGAFVATAPQVTYRWILEQLARQGYAVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE----TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              +H  IA +V  +F+  L  LQ     + + LPI+G+GHS+G  +HLLIGS ++V+R+GN
Sbjct  60    LNHTAIARDVLNQFETTLYRLQAKSVLSKRYLPIYGVGHSMGCKLHLLIGSLFSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               PF+ QI  +PT  +                 
Sbjct  120   ILISFNNYPAKRAI---------------PFIEQINLNPTFDI-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET  LI   Y + RNLLIKF +D ID+T+ L
Sbjct  148   ----------------------EFTPSPIETNELIAQRYEVRRNLLIKFTNDDIDQTASL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
              Q+L        M+ M  R LPG+H  PL Q          D   K+G++       TP+
Sbjct  186   IQVLQ--KRFPDMVGM--RMLPGNHLTPLGQ----------DVSWKTGDVF------TPF  225

Query  370   ETFAKEVGNTFGVESNILRAEVSKELD  290
             + F + +      + N L+ E+ + L+
Sbjct  226   DAFGQWMKQGVYRDLNQLQREILRWLE  252



>ref|WP_039729397.1| hypothetical protein [Lyngbya confervoides]
 gb|KIF16634.1| hypothetical protein QP59_23920 [Aphanocapsa montana BDHKU210001]
 gb|KIF41641.1| hypothetical protein QQ91_16915 [Lyngbya confervoides BDU141951]
Length=266

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 143/288 (50%), Gaps = 57/288 (20%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+EV G W+  P    PR I+HF+GG F  AAP +TY+L LE L ++  +++ATP+ + F
Sbjct  3     WREVSGNWLYVP--QSPRAIIHFLGGAFVAAAPNVTYKLLLEALGQRGYVIVATPFINTF  60

Query  1075  DHFFIADEVQFKFDRCLRFLQETV--QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILM  902
             DH  IA EV   FD+   +L+  V  + LPI+G+GHS+G  +HLLI S Y V+R+GN+ M
Sbjct  61    DHKAIAHEVLVTFDQARYYLENRVILKRLPIYGLGHSMGCKVHLLINSLYEVERAGNMFM  120

Query  901   SFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqv  722
             +FNN  A  +IPL   ++              A +P       M                
Sbjct  121   AFNNFSARRSIPLLDQMM--------------AFTPVKEAMTSM----------------  150

Query  721   lplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQL  542
                                 F P PEET  LI  YY + RNLLIKF+ D +D+T  L ++
Sbjct  151   -------------------EFTPSPEETLDLIDRYYPVERNLLIKFRKDDLDQTRPLHEV  191

Query  541   LSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELL  398
             L    A  +    +++ LPG H  P+ Q L   P     A++  G+ +
Sbjct  192   LYHHFAELT----TVQILPGTHTTPMAQDLSWQPGQQFSALDAIGQFV  235



>ref|WP_016867445.1| hypothetical protein [Fischerella muscicola]
Length=262

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 138/271 (51%), Gaps = 60/271 (22%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P   KP  I+HF+GG F   AP +TYRL LE + EK  +++ATP+ + 
Sbjct  2     EWKEISGNWVLIP--GKPTGIIHFLGGAFVATAPHITYRLLLENIAEKGFVIVATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +    F+R L  L++      + LPI+GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIAQQTLLNFERTLLRLEDRGMLGKKYLPIYGIGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIP     L+    S   + S  A                        
Sbjct  120   ILISFNNYAARDAIP-----LIEQFNSTFQYNSSFAVE----------------------  152

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET++LI+  Y + RNLLIKF +DTID+++ L
Sbjct  153   -----------------------FTPSPLETKQLIQERYSVRRNLLIKFNNDTIDQSAPL  189

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             A+LL        M+   I  LPG+H  PL Q
Sbjct  190   AELL--QKRFPEMVTTQI--LPGNHLTPLGQ  216



>ref|WP_026733578.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=261

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 139/270 (51%), Gaps = 60/270 (22%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W E+ G WVL P N  P  I+HF+GG F   AP +TYRL LE +VEK  +V+ATP+A+  
Sbjct  3     WTEISGNWVLIPRN--PIGIIHFLGGAFVATAPHITYRLLLESIVEKGYIVVATPFANTL  60

Query  1075  DHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             DH  IA++V   F+R L  L++        LPI+G+GHS+G  +HLLIGS + V+R+GNI
Sbjct  61    DHRAIAEQVLLNFERALVRLEDRGALGKSYLPIYGVGHSMGCKLHLLIGSLFPVERAGNI  120

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             L+SFNN  A  AIP     L+    S   F S  A                         
Sbjct  121   LVSFNNYAAREAIP-----LIEQFNSTFQFNSNFAVE-----------------------  152

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P ET +L++  Y + RNLLIKF +DTID+++ L 
Sbjct  153   ----------------------FTPSPLETNKLVQESYNVRRNLLIKFSNDTIDQSAALT  190

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             +LL        M  +++++L G+H  PL Q
Sbjct  191   ELL--QKRFPGM--VTVQTLQGNHLTPLGQ  216



>ref|WP_017290052.1| hypothetical protein [Leptolyngbya boryana]
Length=260

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 157/338 (46%), Gaps = 92/338 (27%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G WVL P   +P  IVHF+GG F   APQLTYR  LE L E+  LV+ATP+ + 
Sbjct  2     DWQEISGNWVLIP--DRPIAIVHFLGGAFVATAPQLTYRRLLEFLGEQGYLVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE--TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNIL  905
             FDH  IA  V   F+R +  ++   +V+ LPI+GIGHS+G  +HLLIGS +AV+R+GN+L
Sbjct  60    FDHTEIAKSVLVSFERAMENVRSRVSVRYLPIYGIGHSMGCKLHLLIGSLFAVERAGNVL  119

Query  904   MSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKq  725
             +SFNN  A  A        VP+ +    F      +                        
Sbjct  120   ISFNNYAARDA--------VPLVEQFSQFFKPQGVA------------------------  147

Query  724   vlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQ  545
                                  F P P ET  LI+  Y + RNLLIKF DD+ID++  LAQ
Sbjct  148   -------------------VEFTPSPVETNALIRDRYAVRRNLLIKFADDSIDQSLGLAQ  188

Query  544   LLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWET  365
             LL  + +   M+  + R L G H  PL    PDV                       W  
Sbjct  189   LL--EESFPGMI--ATRRLKGTHVTPLG---PDV----------------------KW--  217

Query  364   FAKEVGNTFGVESNI---LRAEVSKELDLLVDVTTSWM  260
                +VG +F     I   +R EV +EL  L  V   W+
Sbjct  218   ---QVGGSFTPIDAIGQWMRQEVYRELRQLEQVVLQWL  252



>ref|WP_015145994.1| lysophospholipase [Pleurocapsa minor]
 ref|YP_007083256.1| lysophospholipase [Pleurocapsa sp. PCC 7327]
 gb|AFY79699.1| lysophospholipase [Pleurocapsa sp. PCC 7327]
Length=258

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 156/329 (47%), Gaps = 84/329 (26%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G+WVL P   +P  +VHF+GG F G AP LTYR  LE+L +    VIATP+ + 
Sbjct  2     NWQEISGSWVLIP--RRPIGVVHFLGGAFVGTAPNLTYRCLLEQLGKAGYAVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +F+  L  LQ T       LPI+G+GHS+G  +HLLIGS Y+V+R+GN
Sbjct  60    LDHAAIARSVLNRFENILERLQATNALGQSYLPIYGVGHSMGCKLHLLIGSLYSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             ILMSFNN     AI               PF+ Q+    T+ L                 
Sbjct  120   ILMSFNNYPVRRAI---------------PFIEQLELDATLNL-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P PEET  LI   Y + RNLLI+F +D ID+T++L
Sbjct  148   ----------------------EFTPSPEETNLLIAKNYEVRRNLLIRFTNDDIDQTTIL  185

Query  550   AQLLSTD--SAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGT  377
             + +L     + ++S+      +LPG+H  PL Q +   P  +                 T
Sbjct  186   SPVLQDRFPNMVASL------TLPGNHLTPLGQEINWQPSEIF----------------T  223

Query  376   PWETFAKEVGNTFGVESNILRAEVSKELD  290
             P +   + V   F    N+L+ E+ + L+
Sbjct  224   PIDAIGQWVKQGFSRNLNLLKQEILRWLN  252



>ref|WP_015192280.1| protein of unknown function DUF1350 [Stanieria cyanosphaera]
 ref|YP_007131573.1| protein of unknown function DUF1350 [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ34607.1| protein of unknown function DUF1350 [Stanieria cyanosphaera PCC 
7437]
Length=266

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 137/273 (50%), Gaps = 55/273 (20%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G+WV  P  TKP  IVHF+GG F   APQ+TYR  L++L +    +IATP+ + 
Sbjct  2     EWQEISGSWVYLP-TTKPIGIVHFLGGAFVATAPQVTYRSLLQQLGQAGFAIIATPFLNT  60

Query  1078  FDHFFIADEVQFKFDRCLRFLQE----TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +V  +F+  L  LQ     T   LPI+GIGHS+G  +HLLIGS Y V+R+GN
Sbjct  61    LDHLAIARDVLNRFETILDRLQRNNFITKGYLPIYGIGHSMGCKLHLLIGSLYEVERAGN  120

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  AS AI               PFL Q   + T+ L                 
Sbjct  121   ILISFNNYPASRAI---------------PFLEQFNNTFTLSLNVNPAFN----------  155

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET  LI S Y I RNLLIKF +DTID+T  L
Sbjct  156   ---------------------VEFSPSPTETSELIASNYNIRRNLLIKFNNDTIDQTITL  194

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
               +L        M+  +  +LPG+H  PL Q +
Sbjct  195   EPVL--QQRFPEMI--ATLTLPGNHLTPLSQEI  223



>ref|WP_017320141.1| hypothetical protein [cyanobacterium PCC 7702]
Length=262

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 141/271 (52%), Gaps = 60/271 (22%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P   +P  I+HF+GG F   AP +TYRL LE   EK  +V+ATP+ + 
Sbjct  2     NWKEISGNWVLIP--RRPIGIIHFLGGAFVATAPHITYRLLLENTAEKGFIVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE----TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA+ V   F+R L  L++    +   LPI+GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    FDHQAIAERVLVNFERALVRLEDAGVLSKGYLPIYGIGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               PFL Q   S                      
Sbjct  120   ILISFNNYAARDAI---------------PFLEQFNYS----------------------  142

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                          +    N    F+P P+ET +L++  Y + RNL+I+F +D+ID++  L
Sbjct  143   -------------FQFYYNFGLEFIPSPQETIKLVQERYKVRRNLIIRFTNDSIDQSPAL  189

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              +LL       +M  ++ ++LPG+H  PL Q
Sbjct  190   TELL--QKRFPTM--VTAKTLPGNHLTPLTQ  216



>ref|WP_009756777.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC15018.1| protein of unknown function DUF1350 [Fischerella sp. JSC-11]
Length=262

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 103/274 (38%), Positives = 139/274 (51%), Gaps = 66/274 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P   KP  I+HF+GG F   AP +TYRL LE + EK  +++ATP+ + 
Sbjct  2     EWKEISGNWVLIP--GKPTGIIHFLGGAFVATAPHITYRLLLENIAEKGFVIVATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +    F+R L  L++      + LPI+GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIAQQTLLNFERTLLRLEDRGMLGKKYLPIYGIGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPL---FSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSP  740
             IL+SFNN  A  AIPL   FS       QS   F  +   SP                  
Sbjct  120   ILISFNNYAARDAIPLIEQFSSTF----QSNSSFAVEFTPSPL-----------------  158

Query  739   PIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDET  560
                                             ET++LI+  Y + RNLLIKF +DTID++
Sbjct  159   --------------------------------ETKQLIQEKYSVRRNLLIKFNNDTIDQS  186

Query  559   SVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             + LA+LL   +    M+   I  LPG+H  PL Q
Sbjct  187   ASLAELL--QNRFPEMVTTQI--LPGNHLTPLGQ  216



>ref|WP_012410095.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001867067.1| hypothetical protein Npun_R3734 [Nostoc punctiforme PCC 73102]
 gb|ACC82124.1| protein of unknown function DUF1350 [Nostoc punctiforme PCC 73102]
Length=255

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 137/273 (50%), Gaps = 70/273 (26%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKEV G WV+ P N  P  I+HF+GG F   AP +TYR  LE+L  K  +VIATP+ + 
Sbjct  2     DWKEVRGNWVIIPRN--PIGIIHFLGGAFVATAPHITYRWLLEQLASKGYVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET--VQDL--PIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   FDR L  L ++  ++ L  PI+G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIAKSVLLNFDRTLERLHDSGALRKLYFPIYGLGHSMGCKLHLLIGSLFKVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               P + Q  ++  +                   
Sbjct  120   ILISFNNYAAKEAI---------------PLVEQFNSTLKIE------------------  146

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET +L++  Y I RNLLIKF +DTID+++ L
Sbjct  147   -----------------------FTPSPLETNKLVQERYNIRRNLLIKFSNDTIDQSAAL  183

Query  550   AQLLST--DSAISSMLDMSIRSLPGDHGLPLHQ  458
              ++L    D  +++      ++LPG H  PL Q
Sbjct  184   TKILQERFDDMVTA------QTLPGTHTTPLGQ  210



>ref|WP_017313575.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=261

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 139/271 (51%), Gaps = 60/271 (22%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P   KP  I+HF+GG F   AP +TYRL LE + EK  +++AT + + 
Sbjct  2     EWKEISGNWVLIP--PKPIGIIHFLGGAFVATAPHITYRLLLENIAEKGFVIVATSFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R L  L++      + LP++G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIAKLVLLNFERTLLRLEDRQILGKKYLPVYGLGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL                     + T +  + +T++          
Sbjct  120   ILISFNNYAARDAIPLIEQF-----------------NSTFKFNSNLTVE----------  152

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET++L++  Y + RNLLIKF DDTID+++ L
Sbjct  153   -----------------------FTPSPLETQQLVQENYSVRRNLLIKFNDDTIDQSTPL  189

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             A+LL        M+   I  L G+H  PL Q
Sbjct  190   AKLLQ--QRFGEMVTTQI--LQGNHLTPLGQ  216



>ref|WP_026720015.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=264

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 139/271 (51%), Gaps = 57/271 (21%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P   KP  IVHF+GG F   AP +TYRL LE + +K  ++IATP+ + 
Sbjct  2     EWKEISGNWVLIP--PKPTGIVHFLGGAFVATAPHITYRLLLENIADKGFVIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA+     F+R L  L++      + LP++G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIAELALLNFERTLLRLEDREMLGKKYLPVYGLGHSMGCKLHLLIGSLFQVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL         + +    S    +P + +                 
Sbjct  120   ILISFNNYAARDAIPLI--------EQLNSTFSTFNFNPNLAV-----------------  154

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET++LI+  Y I RNLL+KF +DTID+++ L
Sbjct  155   ----------------------EFTPSPLETQQLIQENYSIRRNLLVKFDNDTIDQSAPL  192

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             A+LL        M+   I  L G+H  PL Q
Sbjct  193   AKLLQ--QRFGEMVTTQI--LQGNHLTPLGQ  219



>ref|WP_007356948.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN57756.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=253

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 136/271 (50%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G WVL P   +P  IVHF+GG F   APQLTYR  LE L  +  +V+ATP+ + 
Sbjct  2     DWQEISGNWVLIP--PRPSAIVHFLGGAFVATAPQLTYRWLLEELAGQGYIVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +V  KF+  L  L  T        PI+GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHVAIARDVLNKFENALDRLYATKTLRKAYFPIYGIGHSMGCKLHLLIGSLFDVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI        P+ + I P  +                           
Sbjct  120   ILISFNNYAARDAI--------PIVEQISPVFN---------------------------  144

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P+ET R+++ +Y I RNLL+KF DD +D++ +L
Sbjct  145   ---------------------VEFTPSPQETNRIVQEHYQIRRNLLVKFADDNLDQSIIL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             A++L        M  ++++++ G+H  PL Q
Sbjct  184   AKILQ--PRFPGM--VALQTMAGNHQTPLGQ  210



>ref|WP_016949173.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=255

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 137/271 (51%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WV+ P N  P  I+HF+GG F   AP LTYRL LE+  EK  +VIATP+ + 
Sbjct  2     DWKEIRGNWVVIPRN--PIGIIHFLGGAFVATAPHLTYRLLLEQFAEKGYVVIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R L  LQ++ +     LP +G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIAQSVLLNFERTLERLQDSGELRKLYLPTYGVGHSMGCKLHLLIGSLFKVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               P + Q+ ++  +                   
Sbjct  120   ILISFNNYTAKEAI---------------PLVEQLNSTLAIE------------------  146

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P+ET +L++  Y I RNL+IKF +D +D++  L
Sbjct  147   -----------------------FTPTPQETNQLVQDLYQIRRNLIIKFSNDNLDQSLAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              ++L   +    M  +++++L G H  PL Q
Sbjct  184   TKIL--QNRFPEM--VTVQTLSGSHTTPLGQ  210



>ref|WP_015131982.1| hypothetical protein [Calothrix sp. PCC 7507]
 ref|YP_007069027.1| hypothetical protein Cal7507_5879 [Calothrix sp. PCC 7507]
 gb|AFY36193.1| protein of unknown function DUF1350 [Calothrix sp. PCC 7507]
Length=255

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 138/271 (51%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P N  P  I+HF+GG F   AP LTYR  LE++  K  +VIATP+ + 
Sbjct  2     DWKEIRGNWVLIPPN--PIGIIHFLGGAFVATAPHLTYRWVLEQVANKGYVVIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R L  L ++       LPI+G+GHS+G  +HLLIGS+ AV+R+GN
Sbjct  60    LDHTAIAKSVLLNFERTLERLYDSAALRKLYLPIYGVGHSMGCKLHLLIGSQCAVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  A        +P+ +    F S +A                        
Sbjct  120   ILISFNNYAARDA--------IPLVEQ---FNSALAIE----------------------  146

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET++L++ +Y I RNL+IKF +DTID+++ L
Sbjct  147   -----------------------FTPTPLETKKLVQEHYNIRRNLIIKFSNDTIDQSAPL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              ++L        M  ++I++L G H  PL Q
Sbjct  184   CKIL--QERFPEM--VTIQTLTGTHTTPLGQ  210



>ref|WP_006197340.1| hypothetical protein [Nodularia spumigena]
 gb|EAW44499.1| hypothetical protein N9414_16354 [Nodularia spumigena CCY9414]
Length=255

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 144/289 (50%), Gaps = 66/289 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P   KP  I+HF+GG F   AP LTYR  LE+L  K  ++IATP+ + 
Sbjct  2     DWKEIRGNWVLIP--PKPIGIIHFLGGAFVATAPHLTYRWLLEQLANKGYVIIATPFLNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE--TVQD--LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R +  LQ+  T++   LP +G+GHS+G  +HLLIGS   V+R+GN
Sbjct  60    LDHIAIAKTVLLNFERTIERLQDSGTLRQLYLPTYGLGHSMGCKLHLLIGSLLPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL       + Q    FL +   SP                     
Sbjct  120   ILISFNNYAAKEAIPL-------VEQLNSTFLVEFTPSPL--------------------  152

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                          ET ++I+  Y I RNLLIKF +DTID+++ L
Sbjct  153   -----------------------------ETNQMIQESYNIRRNLLIKFTNDTIDQSTPL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
              ++L   +  S M  ++ ++LPG H  PL Q +   P A    ++  G+
Sbjct  184   TKIL--QARFSEM--VTAQTLPGTHTTPLGQDIKWQPGASFTPLDALGQ  228



>ref|WP_016861483.1| hypothetical protein [Fischerella muscicola]
Length=261

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/307 (35%), Positives = 150/307 (49%), Gaps = 72/307 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P   KP  I+HF+GG F   AP +TYRL LE + +K  +++ATP+ + 
Sbjct  2     EWKEISGNWVLIP--PKPTGIIHFLGGAFVATAPHITYRLLLENIADKGFVIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA      F+R L  L++      + LP++G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIAKLALLNFERTLLRLEDREILGKKYLPVYGLGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIP     L+    S   F S  A                        
Sbjct  120   ILISFNNYAARDAIP-----LIEQFNSTFKFNSNFAVE----------------------  152

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET++LI+  Y + RNLLIKF +DTID+++ L
Sbjct  153   -----------------------FTPSPLETKQLIQENYSVRRNLLIKFNNDTIDQSAPL  189

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
             A+LL        M  ++ ++L G+H  PL Q          D   ++GE    L A   W
Sbjct  190   AKLLQ--QRFGEM--VATQTLQGNHLTPLGQ----------DVKWQTGEDFNPLDAIGQW  235

Query  370   ETFAKEV  350
               F +EV
Sbjct  236   --FKQEV  240



>ref|WP_035994473.1| hypothetical protein [Leptolyngbya sp. KIOST-1]
Length=257

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/271 (35%), Positives = 136/271 (50%), Gaps = 63/271 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+EV G W+L P N  PR IVHF+GG F  AAP +TY+  LE L  +   ++ATP+ + 
Sbjct  2     NWQEVSGNWILVPPN--PRAIVHFLGGAFVAAAPNVTYQWLLENLARQGFAIVATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA EV   FD+ +R+L++ V     +LPI+G+GHS+G  +HLLI   + V+R+GN
Sbjct  60    FDHSVIAQEVLITFDQAMRYLEKRVLGNGSNLPIYGLGHSMGCKVHLLINCLWEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             I MSFNN  A  +I               PFL Q      V+      ++          
Sbjct  120   IYMSFNNYPARRSI---------------PFLEQ-----AVQFNPAFNVE----------  149

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P PE T  L++  Y +  NLLIKF+ D +D+T  L
Sbjct  150   -----------------------FTPDPETTLGLVRDRYPVPHNLLIKFRSDNLDQTRPL  186

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             +++L    A  +    +++ LPG H  P+ Q
Sbjct  187   SEVLIRRFAECT----TVQLLPGSHTTPIAQ  213



>gb|AHJ27004.1| Alpha/beta superfamily hydrolase [Nodularia spumigena CCY9414]
Length=267

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 144/289 (50%), Gaps = 66/289 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P   KP  I+HF+GG F   AP LTYR  LE+L  K  ++IATP+ + 
Sbjct  14    DWKEIRGNWVLIP--PKPIGIIHFLGGAFVATAPHLTYRWLLEQLANKGYVIIATPFLNT  71

Query  1078  FDHFFIADEVQFKFDRCLRFLQE--TVQD--LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R +  LQ+  T++   LP +G+GHS+G  +HLLIGS   V+R+GN
Sbjct  72    LDHIAIAKTVLLNFERTIERLQDSGTLRQLYLPTYGLGHSMGCKLHLLIGSLLPVERAGN  131

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL       + Q    FL +   SP                     
Sbjct  132   ILISFNNYAAKEAIPL-------VEQLNSTFLVEFTPSPL--------------------  164

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                          ET ++I+  Y I RNLLIKF +DTID+++ L
Sbjct  165   -----------------------------ETNQMIQESYNIRRNLLIKFTNDTIDQSTPL  195

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
              ++L   +  S M  ++ ++LPG H  PL Q +   P A    ++  G+
Sbjct  196   TKIL--QARFSEM--VTAQTLPGTHTTPLGQDIKWQPGASFTPLDALGQ  240



>ref|WP_035158236.1| hypothetical protein [Calothrix sp. 336/3]
 gb|KFB81547.1| hypothetical protein IJ00_00370 [Calothrix sp. 336/3]
Length=259

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 140/271 (52%), Gaps = 62/271 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW E+ G W+L P N  P  I+HF+GG F   AP LTYRL LE L  K  +VIATP+ + 
Sbjct  2     DWIEISGNWILVPRN--PIGIIHFLGGAFVATAPHLTYRLLLESLAGKGFMVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +V   F+R L  L+E        LPI+G+GHS+G  +HLLIGS   V+R+GN
Sbjct  60    LDHVAIAKQVLRNFERALIRLEERSLLPSGYLPIYGVGHSMGCKLHLLIGSLCDVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+S+NN  A  AIPL           I  F SQ++++  V                   
Sbjct  120   ILISYNNYAARDAIPL-----------IQQFNSQLSSNFNVE------------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET ++I+S Y + RNLLIKF +DT+D++  L
Sbjct  151   -----------------------FTPSPLETNQIIQSSYKVRRNLLIKFTNDTLDQSLGL  187

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              +LL  +   + M  ++ ++L G+H  PL Q
Sbjct  188   TELL--NQLFAEM--VTTQTLTGNHLTPLGQ  214



>ref|WP_015150549.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007087846.1| hypothetical protein Oscil6304_4406 [Oscillatoria acuminata PCC 
6304]
 gb|AFY83926.1| Protein of unknown function (DUF1350) [Oscillatoria acuminata 
PCC 6304]
Length=270

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/272 (36%), Positives = 143/272 (53%), Gaps = 57/272 (21%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P  T  R IVHF+GG F  AAPQ+TYR  LE+L  +   +IATP+ S 
Sbjct  2     NWQEISGNWVHIPPRT--RGIVHFLGGAFLAAAPQVTYRWLLEQLSLQGYAIIATPFVSN  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA  +  +F+ C+  L+ +     + LPI+GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    FDHGAIAANILERFEWCVEQLRLSGKLPKRYLPIYGIGHSMGCKLHLLIGSLFEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+S+NN  A  +IP                + Q+ T+   +L    +++          
Sbjct  120   ILISYNNYPARRSIPFLE------------LMEQLPTAWGSKLPTAFSVE----------  157

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P PEET ++I   Y I RNL++KFKDDT+D+T +L
Sbjct  158   -----------------------FTPSPEETNQIIARNYQIKRNLIVKFKDDTLDQTLLL  194

Query  550   AQLLSTD-SAISSMLDMSIRSLPGDHGLPLHQ  458
               ++      + SML     ++PG+H  PL Q
Sbjct  195   FPVMQKRFPDLVSML-----TIPGNHLTPLSQ  221



>ref|WP_015223151.1| hypothetical protein [Cyanobacterium stanieri]
 ref|YP_007165484.1| hypothetical protein Cyast_1880 [Cyanobacterium stanieri PCC 
7202]
 gb|AFZ47835.1| protein of unknown function DUF1350 [Cyanobacterium stanieri 
PCC 7202]
Length=271

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 164/329 (50%), Gaps = 72/329 (22%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E  G WVL P  ++P  I+HF+GG F   AP LTYR  LE+L  +  L+IATP+ + 
Sbjct  2     EWQERNGNWVLAP--SQPIGIIHFLGGAFVATAPHLTYRWLLEKLASQGYLIIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  KF+  L+ L       ++ LPI+G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHKSIALYVLNKFENLLQKLDNNTGLDIKYLPIYGMGHSMGCKLHLLIGSLFEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN               P+ ++I PF+ QI   PT+       LK    + P   
Sbjct  120   ILVSFNN--------------YPLQKAI-PFMDQII--PTIT----DNLKNNWKIDP---  155

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                               N +  F P PE+T+ +I   Y   RNLLIKF +D ID+T  L
Sbjct  156   ------------------NLQFEFTPSPEKTQEIITESYTTRRNLLIKFDNDNIDQTLTL  197

Query  550   AQLLST--DSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGT  377
               +L     + +S++      +LPG+H  PL Q          D   + GE+       T
Sbjct  198   QPILKELFPNLVSTL------TLPGNHLTPLGQ----------DIDWQVGEVF------T  235

Query  376   PWETFAKEVGNTFGVESNILRAEVSKELD  290
             P++   + V  +   +  +L  EVS+ L+
Sbjct  236   PFDAIGQWVKQSLSRDIYVLEKEVSRWLN  264



>ref|WP_004163605.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI35162.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=259

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 144/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAIVATPFINT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+    +Q  LPI+G+GHS+G  +HLLIGS Y V+R GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLLQGYLPIYGLGHSMGCKLHLLIGSLYEVEREGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + +  +++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDL--ITLRTLPGNHLTPLSQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_002776659.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI07055.1| conserved hypothetical protein [Microcystis aeruginosa PCC 7941]
Length=259

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 107/300 (36%), Positives = 143/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLRQGYLPIYGLGHSMGCKLHLLIGSLYEVEREGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+  +                   
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTTFNLE------------------  148

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  149   -----------------------FSPSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + +  +++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDL--IALRTLPGNHLTPLGQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_002758145.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH96071.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
 emb|CCI18795.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9807]
Length=259

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 144/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R+GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLPQGYLPIYGLGHSMGCKLHLLIGSLYEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + +  +++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDL--IALRTLPGNHLTPLSQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_004162891.1| hypothetical protein [Microcystis aeruginosa]
 ref|YP_001659252.1| hypothetical protein MAE_42380 [Microcystis aeruginosa NIES-843]
 dbj|BAG04060.1| hypothetical protein MAE_42380 [Microcystis aeruginosa NIES-843]
 emb|CCI30097.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809]
Length=259

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 144/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R+GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLPQGYLPIYGLGHSMGCKLHLLIGSLYEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + +  +++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDL--IALRTLPGNHLTPLSQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_009555768.1| lysophospholipase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ71112.1| lysophospholipase [Oscillatoriales cyanobacterium JSC-12]
Length=268

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/323 (35%), Positives = 159/323 (49%), Gaps = 72/323 (22%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G WVL P   +P  ++HF+GG F   APQ+TYR  LERL  +   ++ATP+ + 
Sbjct  2     DWQELYGNWVLVP--DRPTAVIHFLGGAFVATAPQVTYRRLLERLALEGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV---QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             FDH  IA  V   F+R L  L ET    + LPI+GIGHS+G  +HLLIGS++ V+R+GNI
Sbjct  60    FDHSAIAQVVYRNFNRALETLFETQLRRRYLPIYGIGHSMGCKLHLLIGSQFEVERAGNI  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             L+SFNN  A  A+P     LV    S+   +S + +S T     E T             
Sbjct  120   LISFNNYAARDAVP-----LVEQVSSVFSQVSSLFSSVTPAFEVEFT-------------  161

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                     P P ET ++I   Y + RNLLIKF +DTID+TS LA
Sbjct  162   ------------------------PSPLETTQMISRNYQVQRNLLIKFTNDTIDQTSGLA  197

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWE  368
              +L   +    M+    ++L G H  PL    PD+   + D+               PW+
Sbjct  198   DVLR--NRFPGMV--VTQTLSGTHLTPLG---PDMKWQVGDSF-------------APWD  237

Query  367   TFAKEV-----GNTFGVESNILR  314
               A+ +      +   +E NILR
Sbjct  238   AIAQWMRQEVYRDLHQLERNILR  260



>ref|WP_028084028.1| hypothetical protein [Dolichospermum circinale]
Length=257

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 143/291 (49%), Gaps = 62/291 (21%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV+ P    P  I+HF+GG F    P LTYR  LE L  K  +VIATP+ + 
Sbjct  2     NWQEIRGNWVIIP--RHPVGIIHFLGGAFVATLPHLTYRWLLEHLAAKGYVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R L  LQE+ +     LP +GIGHS+G  +HLLIGS ++VQR+GN
Sbjct  60    LDHIAIAKNVLINFERTLERLQESGEIRKIYLPTYGIGHSMGCKLHLLIGSLFSVQRAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A+ AIPL               + Q+ +    +L  E              
Sbjct  120   ILISFNNFAANEAIPL---------------VEQLNSQLNSQLDIE--------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET ++++  Y I RNLLI+F  DT+D+++ L
Sbjct  151   -----------------------FTPTPAETNQIVRESYQIRRNLLIRFNKDTLDQSADL  187

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELL  398
              ++L       +M+  + ++L G+H  PL Q +   P       +  G+ L
Sbjct  188   TRIL--QKLFPNMI--TTQTLSGNHTTPLGQDIKWQPGTSFSPFDALGQWL  234



>ref|WP_028090816.1| hypothetical protein [Dolichospermum circinale]
Length=257

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 143/291 (49%), Gaps = 62/291 (21%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV+ P    P  I+HF+GG F    P LTYR  LE L  +  +VIATP+ + 
Sbjct  2     NWQEIRGNWVIIP--RHPVGIIHFLGGAFVATLPHLTYRWLLEHLAAQGYVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R L  LQE+ +     LP +GIGHS+G  +HLLIGS ++VQR+GN
Sbjct  60    LDHIAIAKNVLINFERTLERLQESGEIRKIYLPTYGIGHSMGCKLHLLIGSLFSVQRAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  AS AIPL               + Q+ +    +L  E              
Sbjct  120   ILISFNNFAASEAIPL---------------VEQLNSQLNSQLDIE--------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET ++++  Y I RNLLI+F  DT+D+++ L
Sbjct  151   -----------------------FTPTPAETNQIVRESYQIRRNLLIRFNKDTLDQSADL  187

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELL  398
              ++L       +M+  + ++L G+H  PL Q +   P       +  G+ L
Sbjct  188   TRIL--QKLFPNMI--TTQTLSGNHTTPLGQDIKWQPGTSFSPFDALGQWL  234



>ref|WP_006454041.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX84294.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
Length=262

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 136/273 (50%), Gaps = 62/273 (23%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+EV G W L P   +P+ IVHF+GG F  AAP LTYR  LE L ++   VIATP+ + F
Sbjct  3     WQEVSGNWFLVP--KQPKAIVHFLGGAFVAAAPHLTYRWLLEALYQEGYAVIATPFVNTF  60

Query  1075  DHFFIADEVQFKFDRCLRFLQET---VQDLPIFGIGHSLGSVIHLLIGSRYAVQ----RS  917
             DH  IA E    F++ + FL++    +QDLPI+G+GHS+G  +HLLIGS         R 
Sbjct  61    DHGAIASETLTTFNQGMVFLRKQRPELQDLPIYGLGHSMGCKVHLLIGSMLLASDQTPRV  120

Query  916   GNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPP  737
             GNI +SFNN  A  +IPL                                L+Q   L P 
Sbjct  121   GNIFISFNNYPARKSIPL--------------------------------LEQFTQLVPD  148

Query  736   IMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETS  557
                                ++ R  FVP PE+T  LI ++Y    NLL+KF++DTID+T 
Sbjct  149   FQ-----------------LDTRLEFVPSPEQTLELINTHYSTPYNLLLKFRNDTIDQTR  191

Query  556   VLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              L+ +L      ++    ++R L G H  P+ Q
Sbjct  192   PLSDVLIKRFPTTT----TVRILRGSHTTPIAQ  220



>dbj|GAL91711.1| alpha/beta superfamily hydrolase [Microcystis aeruginosa NIES-44]
Length=259

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 143/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLPQGYLPIYGLGHSMGCKLHLLIGSLYEVEREGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + +  +++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDL--ITLRTLPGNHLTPLSQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_008197527.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI30865.1| conserved hypothetical protein [Microcystis sp. T1-4]
Length=259

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 143/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLPQGYLPIYGLGHSMGCKLHLLIGSLYEVEREGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + +  +++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDL--IALRTLPGNHLTPLSQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_012306403.1| hypothetical protein [Synechococcus sp. PCC 7002]
 ref|YP_001734035.1| hypothetical protein SYNPCC7002_A0774 [Synechococcus sp. PCC 
7002]
 gb|ACA98779.1| Protein of unknown function (DUF1350) [Synechococcus sp. PCC 
7002]
Length=261

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 138/273 (51%), Gaps = 66/273 (24%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+E  G+W+L P+  +P  ++HF+GG F G APQLTY+  LE+L  +   +I TP+ +GF
Sbjct  3     WQESGGSWILIPV--QPVGVIHFLGGAFVGTAPQLTYKWLLEQLAAEGYAIITTPFVNGF  60

Query  1075  DHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             DH  IA +V  +F+  L  LQ + Q     LP++G+GHS+G  IHLLIGS + VQR+GN+
Sbjct  61    DHLAIARQVLNRFENILERLQNSNQLGYRYLPVYGVGHSMGCKIHLLIGSLFNVQRAGNV  120

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             LMS+NN               P+ +SI PF  Q     T+                    
Sbjct  121   LMSYNN--------------FPVKKSI-PFFEQFDPDNTINF------------------  147

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P ET  +I++ Y I RNLLI+F +DTID+T  L 
Sbjct  148   ---------------------EFTPSPLETNEIIQTSYQIRRNLLIQFNNDTIDQTPDLT  186

Query  547   QLLSTDSAISSMLDM-SIRSLPGDHGLPLHQAL  452
              +L     I    +M +  +L G+H  PL Q L
Sbjct  187   PIL-----IERFPNMVATLNLTGNHLTPLGQDL  214



>ref|WP_002781173.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI15185.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806]
Length=259

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 143/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLPQGYLPIYGLGHSMGCKLHLLIGSLYEVEREGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + +  +++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDL--IALRTLPGNHLTPLSQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_009545877.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_001803494.1| hypothetical protein cce_2078 [Cyanothece sp. ATCC 51142]
 gb|ACB51428.1| DUF1350-containing protein [Cyanothece sp. ATCC 51142]
Length=257

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 135/273 (49%), Gaps = 64/273 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G+ VL P    P  I+HF+GG F G AP +TYR  LE L ++   +IATP+ + 
Sbjct  2     EWQEISGSSVLVP--RYPIAIIHFLGGAFVGTAPNVTYRWLLEELAKEGYAIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA  V  +F+  L  LQ         LPI+GIGHS+G  +HLLIGS ++V+R+GN
Sbjct  60    FDHLAIARSVLNRFESILERLQANTSLGQGYLPIYGIGHSMGCKLHLLIGSLFSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AI               PFL QI     + L                 
Sbjct  120   ILISFNNYPVKKAI---------------PFLEQIDVEKYLSL-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P+ET+ +I+  Y I RNLLIKF  D IDET+VL
Sbjct  148   ----------------------EFTPSPDETKIIIEKDYQIRRNLLIKFTQDNIDETTVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
             + +L           +++++L G+H  PL Q +
Sbjct  186   SPILEVKYPTL----IALQTLSGNHLTPLSQEI  214



>ref|WP_002770150.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI03845.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9443]
Length=259

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 144/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAMVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R+GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLPQGYLPIYGLGHSMGCKLHLLIGSLYEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + ++  ++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDLI--ALRTLPGNHLTPLSQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_016516086.1| hypothetical protein [Microcystis aeruginosa]
 gb|EPF21107.1| hypothetical protein MAESPC_03053 [Microcystis aeruginosa SPC777]
Length=259

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 143/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLRQGYLPIYGLGHSMGCKLHLLIGSLYEVEREGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + +  +++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDL--IALRTLPGNHLTPLGQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_018399137.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=265

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 138/272 (51%), Gaps = 60/272 (22%)
 Frame = -2

Query  1255  WKEVE--GAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYAS  1082
             W+E+   G WVL P   +P  I+HF+GG F G APQ++YR  LE L E+  + IATP+ +
Sbjct  3     WQEISISGNWVLLP--RQPYGIIHFLGGAFVGTAPQVSYRSLLEWLAERGYVAIATPFIN  60

Query  1081  GFDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSG  914
              FDH  IA EV  +F+     LQ         LPI+GIGHS+G  +HLLIGS + VQR+G
Sbjct  61    TFDHGAIAREVLNQFESVCDRLQAQNYLGSDYLPIYGIGHSMGCKLHLLIGSAFQVQRAG  120

Query  913   NILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPI  734
             NI M++NN  A  A+               PFL Q+  +P  +    + ++         
Sbjct  121   NIFMAYNNYPAMRAV---------------PFLEQLQGNPAFQGNPALNVE---------  156

Query  733   MKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSV  554
                                     FVP P+ET+ +I   Y I RNLLI+F +D ID+T  
Sbjct  157   ------------------------FVPSPDETQAIIAKEYEIRRNLLIQFTNDDIDQTPS  192

Query  553   LAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             L  +L       S+   ++R+LPG+H  PL Q
Sbjct  193   LKAIL--QQRFPSL--TAVRTLPGNHLTPLSQ  220



>ref|WP_030005997.1| hypothetical protein [Synechococcus sp. NKBG042902]
Length=261

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 137/273 (50%), Gaps = 66/273 (24%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+E  G+W+L P+  +P  ++HF+GG F G APQLTY+  LE+L  +   +I TP+ +GF
Sbjct  3     WQESGGSWILIPV--QPVGVIHFLGGAFVGTAPQLTYKWLLEQLAAEGYAIITTPFVNGF  60

Query  1075  DHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             DH  IA +V  +F+     LQ + Q     LPI+G+GHS+G  IHLLIGS + VQR+GN+
Sbjct  61    DHLAIARQVLNRFENIFERLQNSNQLGYRYLPIYGVGHSMGCKIHLLIGSLFNVQRAGNV  120

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             LMS+NN               P+ +SI PF  Q     T+                    
Sbjct  121   LMSYNN--------------FPVKKSI-PFFEQFDPDNTINF------------------  147

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P ET  +I++ Y I RNLLI+F +DTID+T  L 
Sbjct  148   ---------------------EFTPSPLETNEIIQTSYQIRRNLLIQFNNDTIDQTPDLT  186

Query  547   QLLSTDSAISSMLDM-SIRSLPGDHGLPLHQAL  452
              +L     I    +M +  +L G+H  PL Q L
Sbjct  187   PIL-----IERFPNMVATLNLTGNHLTPLGQDL  214



>ref|WP_002739518.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH95164.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
 emb|CCI23412.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
 gb|ELP52052.1| hypothetical protein O53_4947 [Microcystis aeruginosa TAIHU98]
Length=259

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 143/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE L      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESLGNSGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLRQGYLPIYGLGHSMGCKLHLLIGSLYEVEREGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + +  +++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDL--IALRTLPGNHLTPLGQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_017300676.1| hypothetical protein [Nodosilinea nodulosa]
Length=259

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/291 (33%), Positives = 142/291 (49%), Gaps = 63/291 (22%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+EV G W+L P N  P  IVHF+GG F  AAP +TY+  LE L  +   ++ATP+ + 
Sbjct  2     NWQEVSGNWILVPPN--PIAIVHFLGGAFVAAAPSVTYQWLLENLARQGYGIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA EV   FD+ +R+L + V    + LPI+G+GHS+G  +HLLI   + V+R+GN
Sbjct  60    FDHTAIAQEVLITFDQAMRYLDKRVLTDCEPLPIYGLGHSMGCKVHLLINCLWEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             I MSFNN  A  +I               PFL Q+     V+      ++          
Sbjct  120   IYMSFNNYPAKRSI---------------PFLEQV-----VQFNPAFNIE----------  149

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P PE T  L++  Y + RNLLIKF+ DT+D+T  L
Sbjct  150   -----------------------FAPDPETTLALVRDRYPVPRNLLIKFRSDTLDQTRPL  186

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELL  398
             +++L    A  +    +++ L G H  P+ Q     P      ++  G+ +
Sbjct  187   SEVLVRRFAEMT----TVQILQGSHTTPIAQEFGWQPGTSFSPIDALGQFV  233



>ref|WP_017306309.1| hypothetical protein [Spirulina subsalsa]
Length=259

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 112/327 (34%), Positives = 151/327 (46%), Gaps = 78/327 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G WVL P N  P+ IVHF+GG F G AP +TYR  LE L +    VIATP+ + 
Sbjct  2     DWQEISGGWVLTPPN--PKGIVHFLGGAFIGTAPHITYRWLLEALSQAGYAVIATPFLNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +V  +F+  L  LQ       + LPI+G+GHS+G  +HLLIGS Y+V R GN
Sbjct  60    LDHNAIARDVLNRFETILSRLQAKNALGQRYLPIYGLGHSMGCKLHLLIGSLYSVDRVGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             ILM++NN     AI               PF  Q   +PT  L                 
Sbjct  120   ILMAYNNYPVERAI---------------PFAQQFQLTPTFNL-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P PE+T  LI + Y + RNL+IKF+ D +D++  L
Sbjct  148   ----------------------EFTPSPEDTLDLIHTDYQVRRNLIIKFRQDDLDQSYDL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               +L  +     M+ M I  LPG+H  P+        P   D    +G     L A   W
Sbjct  186   LPIL--EPKFPQMVSMQI--LPGNHLTPI--------PLGPDVKWNAGSFFTPLDAVGQW  233

Query  370   ETFAKEVGNTFGVESNILRAEVSKELD  290
               F +EV      + N L+ EV + L+
Sbjct  234   --FKQEVYR----DLNRLKDEVLRWLN  254



>ref|WP_010871849.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_440540.1| hypothetical protein slr1699 [Synechocystis sp. PCC 6803]
 ref|YP_005382407.1| hypothetical protein SYNGTI_0645 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005385577.1| hypothetical protein SYNPCCP_0645 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005408284.1| hypothetical protein SYNPCCN_0645 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005650598.1| hypothetical protein SYNGTS_0645 [Synechocystis sp. PCC 6803]
 ref|YP_007450424.1| hypothetical protein MYO_16520 [Synechocystis sp. PCC 6803]
 dbj|BAA17220.1| slr1699 [Synechocystis sp. PCC 6803]
 dbj|BAK49393.1| hypothetical protein SYNGTS_0645 [Synechocystis sp. PCC 6803]
 dbj|BAL28392.1| hypothetical protein SYNGTI_0645 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31562.1| hypothetical protein SYNPCCN_0645 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34731.1| hypothetical protein SYNPCCP_0645 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM50940.1| hypothetical protein BEST7613_2009 [Synechocystis sp. PCC 6803]
 gb|AGF50910.1| hypothetical protein MYO_16520 [Synechocystis sp. PCC 6803]
Length=282

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 143/272 (53%), Gaps = 47/272 (17%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G+WVL P   +P  +VHF+GG F G AP + YR  L  L +   +V+ATP+ + 
Sbjct  2     EWREISGSWVLVP--PQPIAVVHFLGGAFVGTAPNVAYRWLLTELGKAGYVVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE----TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA  V  +F+  L  LQ+    T   LP++G+GHSLG  +HLLIGS Y V+R+GN
Sbjct  60    FDHQAIARSVLNRFEIILERLQKQGEITTGLLPVYGLGHSLGCKLHLLIGSLYEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL++FNN     AIP             G  L+Q+     +  G +  L+QL        
Sbjct  120   ILVAFNNYPVKQAIPF------------GEQLAQLQLDKFLT-GVQKQLRQLN-------  159

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                         L +DL      F P PEET  LI   Y + RNLLIKF +D ID+T  L
Sbjct  160   ------------LQVDL---NFEFTPSPEETNLLIAENYRVRRNLLIKFSNDDIDQTLGL  204

Query  550   AQLLSTDSAISSMLDM-SIRSLPGDHGLPLHQ  458
               +L+  +A     D+ +   LPG+H  PL Q
Sbjct  205   RPILNQQTA-----DLVAYCPLPGNHLTPLGQ  231



>ref|WP_002743906.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO87245.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS47957.1| hypothetical protein C789_2258 [Microcystis aeruginosa DIANCHI905]
Length=259

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 107/300 (36%), Positives = 143/300 (48%), Gaps = 74/300 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +PR I+HF+GG F  AAP +TYR  LE +      ++ATP+ + 
Sbjct  2     NWQEIAGNWVFLP--RRPRGIIHFLGGAFVAAAPNITYRWLLESIGNSGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRC---LRFLQETVQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +FD     LR+     Q  LPI+G+GHS+G  +HLLIGS Y V+R GN
Sbjct  60    LDHKSIARTVLNRFDNIIERLRWNHSLRQGYLPIYGLGHSMGCKLHLLIGSLYEVEREGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP   P+             QI T+       E T            
Sbjct  120   ILISFNNYPIRRAIPFIEPL-------------QIDTT----FNLEFT------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                      P PEET  LI   Y I RNLLI+F+DDTID++ VL
Sbjct  151   -------------------------PSPEETNELIFQDYAIRRNLLIRFQDDTIDQSLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL      + ++  ++R+LPG+H  PL Q          D   ++GE+   L A   W
Sbjct  186   NPLLK--KRFNDLI--ALRTLPGNHLTPLGQ----------DVSWQTGEVFTPLDAIGQW  231



>ref|WP_012596770.1| hypothetical protein [Cyanothece sp. PCC 8801]
 ref|YP_002373668.1| hypothetical protein PCC8801_3548 [Cyanothece sp. PCC 8801]
 gb|ACK67512.1| protein of unknown function DUF1350 [Cyanothece sp. PCC 8801]
Length=261

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 157/321 (49%), Gaps = 79/321 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+++ G+ +L P    P  I+HF+GG F G AP LTYR  LE+L +    +IATP+ + 
Sbjct  2     EWQDISGSSILIP--PYPIAIIHFLGGAFVGTAPNLTYRWLLEQLGQSGYAIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE----TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +F+  L  LQ       + LPI+G+GHSLG  IHLLIGS + V+R+GN
Sbjct  60    LDHLAIARSVLNRFENILDRLQTQNIIKQRYLPIYGMGHSLGCKIHLLIGSLFEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AI               PFL QI    ++ L                 
Sbjct  120   ILISFNNYPVRRAI---------------PFLEQIDIDNSLNL-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P PEET+ +I   Y I RNLLIKF+ DTID+T +L
Sbjct  148   ----------------------EFTPCPEETQTIIAKDYDIRRNLLIKFRKDTIDQTLIL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL  +    +M  +S+ +LPG+H  PL Q L            ++GE+   L A   W
Sbjct  186   QPLL--EERFPNM--ISLLNLPGNHLTPLGQELN----------WEAGEVFTPLDAVGQW  231

Query  370   --ETFAKEVGNTFGVESNILR  314
               +  ++++   +G++  +LR
Sbjct  232   VKQNLSRDL---YGLKQEVLR  249



>ref|WP_036019398.1| hypothetical protein [Leptolyngbya sp. PCC 7375]
Length=252

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 147/307 (48%), Gaps = 70/307 (23%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+EV G W+L P   +P+ I+HF+GG F  AAP LTY   LE L ++   ++ATP+ + F
Sbjct  3     WQEVSGNWLLVP--DRPKAIIHFLGGAFIAAAPHLTYSWLLENLYQQGYCIVATPFINTF  60

Query  1075  DHFFIADEVQFKFDRCLRFLQETV---QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNIL  905
             DH  IADEV   FD+ + +L+  V   + +PI+G+GHS+G  +HLLI S Y ++R+GNIL
Sbjct  61    DHGAIADEVLTTFDQAMIYLRRQVIGDRYIPIYGVGHSMGCKVHLLIASLYNIERAGNIL  120

Query  904   MSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKq  725
             +SFNN  A  +IPL                                L+Q    +P     
Sbjct  121   ISFNNYPARKSIPL--------------------------------LEQFVQFAP-----  143

Query  724   vlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQ  545
                             +    F P P +T  L++  Y I  NLLIKF+ DTID+T  L+ 
Sbjct  144   ----------------DFDVEFTPSPNQTLNLVRDRYAIGHNLLIKFRRDTIDQTYDLSD  187

Query  544   LLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWET  365
             +L       +    +I+ L G H  P+ Q +   P     A +  G+ +         + 
Sbjct  188   VLYQRFPQFT----AIQILQGTHTTPIAQDVRWQPGQAFTAFDAIGQFVK--------QE  235

Query  364   FAKEVGN  344
             F K++G 
Sbjct  236   FYKDLGQ  242



>ref|WP_015179499.1| protein of unknown function DUF1350 [Oscillatoria nigro-viridis]
 ref|YP_007118717.1| protein of unknown function DUF1350 [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ10301.1| protein of unknown function DUF1350 [Oscillatoria nigro-viridis 
PCC 7112]
Length=258

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 99/272 (36%), Positives = 135/272 (50%), Gaps = 68/272 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G WV  P  +KP  IVHF+GG F   APQLTYR  LE L  +  +V+ATP+ + 
Sbjct  2     DWQEISGNWVFIP--SKPIAIVHFLGGAFVATAPQLTYRWLLEALGNQGYVVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +V  KF+  L  L+ T       LPI+G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHIAIARDVLNKFENALDRLRATKLLKSSYLPIYGMGHSMGCKLHLLIGSVFDVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  AS AI        P+ + I P  +                           
Sbjct  120   ILISFNNYAASEAI--------PIVEQISPVFN---------------------------  144

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P+ET RL+++ Y I RNLL+KF  D ID+T + 
Sbjct  145   ---------------------VEFTPSPQETNRLVQNSYQIRRNLLVKFNGDNIDQTLL-  182

Query  550   AQLLSTDSAISSMLDM-SIRSLPGDHGLPLHQ  458
                  T    +   DM ++++L G+H  PL Q
Sbjct  183   ----LTKLLKARFPDMITVQTLTGNHQTPLGQ  210



>gb|EKU98752.1| Protein of unknown function (DUF1350) [Leptolyngbya sp. PCC 7375]
Length=274

 Score =   154 bits (388),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 147/307 (48%), Gaps = 70/307 (23%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+EV G W+L P   +P+ I+HF+GG F  AAP LTY   LE L ++   ++ATP+ + F
Sbjct  25    WQEVSGNWLLVP--DRPKAIIHFLGGAFIAAAPHLTYSWLLENLYQQGYCIVATPFINTF  82

Query  1075  DHFFIADEVQFKFDRCLRFLQETV---QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNIL  905
             DH  IADEV   FD+ + +L+  V   + +PI+G+GHS+G  +HLLI S Y ++R+GNIL
Sbjct  83    DHGAIADEVLTTFDQAMIYLRRQVIGDRYIPIYGVGHSMGCKVHLLIASLYNIERAGNIL  142

Query  904   MSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKq  725
             +SFNN  A  +IPL                                L+Q    +P     
Sbjct  143   ISFNNYPARKSIPL--------------------------------LEQFVQFAP-----  165

Query  724   vlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQ  545
                             +    F P P +T  L++  Y I  NLLIKF+ DTID+T  L+ 
Sbjct  166   ----------------DFDVEFTPSPNQTLNLVRDRYAIGHNLLIKFRRDTIDQTYDLSD  209

Query  544   LLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWET  365
             +L       +    +I+ L G H  P+ Q +   P     A +  G+ +         + 
Sbjct  210   VLYQRFPQFT----AIQILQGTHTTPIAQDVRWQPGQAFTAFDAIGQFVK--------QE  257

Query  364   FAKEVGN  344
             F K++G 
Sbjct  258   FYKDLGQ  264



>ref|WP_015784230.1| hypothetical protein [Cyanothece sp. PCC 8802]
 ref|YP_003138264.1| hypothetical protein Cyan8802_2565 [Cyanothece sp. PCC 8802]
 gb|ACV01429.1| protein of unknown function DUF1350 [Cyanothece sp. PCC 8802]
Length=261

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 156/321 (49%), Gaps = 79/321 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+++ G+ +L P    P  I+HF+GG F G AP LTYR  LE+L +    +IATP+ + 
Sbjct  2     EWQDISGSSILIP--PYPIAIIHFLGGAFVGTAPNLTYRWLLEQLGQSGYAIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE----TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +F+  L  LQ       + LPI+G+GHSLG  IHLLIGS + V+R+GN
Sbjct  60    LDHLAIARSVLNRFENILDRLQTQNIIKQRYLPIYGMGHSLGCKIHLLIGSLFEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AI               PFL QI    ++ L                 
Sbjct  120   ILISFNNYPVRRAI---------------PFLEQIDIDNSLNL-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P PEET+ +I   Y I RNLLIKF+ DTID+T +L
Sbjct  148   ----------------------EFTPCPEETQTIIAKDYDIRRNLLIKFRKDTIDQTLIL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL  +    +M  +S+  LPG+H  PL Q L            ++GE+   L A   W
Sbjct  186   QPLL--EERFPNM--ISLLHLPGNHLTPLGQELN----------WEAGEVFTPLDAVGQW  231

Query  370   --ETFAKEVGNTFGVESNILR  314
               +  ++++   +G++  +LR
Sbjct  232   VKQNLSRDL---YGLKQEVLR  249



>ref|WP_015118397.1| hypothetical protein [Rivularia sp. PCC 7116]
 ref|YP_007055369.1| hypothetical protein Riv7116_2304 [Rivularia sp. PCC 7116]
 gb|AFY54822.1| Protein of unknown function (DUF1350) [Rivularia sp. PCC 7116]
Length=255

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 98/289 (34%), Positives = 140/289 (48%), Gaps = 66/289 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WK++ G+WV+ P   +P  IVHF+GG F   AP +TYRL LE L EK   +IATP+ + 
Sbjct  2     NWKQIAGSWVMVP--QRPIGIVHFLGGAFVATAPNVTYRLLLEYLAEKGFAIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQD----LPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +V   F+R +  L++        LPI+G+GHS+G  +HLLIG    V+R+GN
Sbjct  60    LDHNAIAQQVLLNFERVIVRLEDREPAFKGYLPIYGLGHSMGCKLHLLIGCSPGVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             ILMSFNN  A  AI               P + Q  T+  V                   
Sbjct  120   ILMSFNNYAARDAI---------------PLVEQFNTAVDVE------------------  146

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET  L+K  Y I RNLLIKF +D +D+++ L
Sbjct  147   -----------------------FTPSPAETYSLVKENYNIRRNLLIKFNNDNLDQSAAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
              +LL   +    M  ++ ++L G+H  PL Q +   P    + ++  G+
Sbjct  184   NKLLQ--NRFKEM--VTTQTLNGNHLTPLGQDVKWQPSQEFNPLDALGQ  228



>ref|WP_015172731.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 ref|YP_007110219.1| hypothetical protein GEI7407_2694 [Geitlerinema sp. PCC 7407]
 gb|AFY67167.1| protein of unknown function DUF1350 [Geitlerinema sp. PCC 7407]
Length=260

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 152/333 (46%), Gaps = 78/333 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P   +P  IVHF+GG F   AP +TYR  LE L ++   V+ATP+ + 
Sbjct  3     EWKELHGNWVLMP--RRPVGIVHFLGGAFVATAPHITYRWLLESLAKQGYGVVATPFVNT  60

Query  1078  FDHFFIADEVQFKFDRCLRFLQET---VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             FDH  IA +V   F+R    LQET    Q LP++G+GHS+G  +HLLIGS Y V+R+GN 
Sbjct  61    FDHQAIAQQVIRNFNRAFYQLQETDFNRQYLPVYGLGHSMGCKLHLLIGSLYPVERAGNA  120

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
              M+FNN  A  +IP                                 L+Q    +P    
Sbjct  121   FMAFNNYPAKRSIPF--------------------------------LEQFQQFTPSF--  146

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P ET  LI   Y I RNLLI+F +D ID+T  L 
Sbjct  147   -------------------SVEFTPSPAETNDLIARDYQIRRNLLIQFTNDDIDQTKTLD  187

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPWE  368
              +L       ++L    R+L G+H  PL Q          D   + GE      + +P +
Sbjct  188   IVLQKRFPRMTVL----RTLKGNHLTPLGQ----------DIAWQVGE------SFSPID  227

Query  367   TFAKEVGNTFGVESNILRAEVSKELDLLVDVTT  269
               A+ V      + N LR E+ + L+ L  + T
Sbjct  228   AIAQFVKQEVYRDLNPLRDEILRWLNPLAPLRT  260



>ref|WP_026789099.1| MULTISPECIES: hypothetical protein [Planktothrix]
 gb|KEI66323.1| hypothetical protein A19Y_1249 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=254

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/275 (37%), Positives = 135/275 (49%), Gaps = 70/275 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW  + G WVL P   +P+ I+HF+GG F    P LTYR  LE L  +   ++ATP+ + 
Sbjct  2     DWLSISGNWVLIP--PRPQAILHFLGGAFVATLPHLTYRCLLEELAHQGYAIVATPFINN  59

Query  1078  FDHFFIADEVQFKFDRCL------RFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRS  917
              DH  IA EV   F+  L      +FL+   + LPI+G+GHS+G  IHLLIGS + V+RS
Sbjct  60    LDHTAIAQEVFEIFEDGLYDLYDLQFLKR--RGLPIYGLGHSMGCKIHLLIGSLFPVERS  117

Query  916   GNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPP  737
             GNILMSFNN  AS +IPL               + QI+                      
Sbjct  118   GNILMSFNNYAASQSIPL---------------VEQISQ---------------------  141

Query  736   IMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETS  557
                            +MD+      F P PEET  L+   Y I RNLLIKF  DT+D+TS
Sbjct  142   ---------------FMDV-----EFTPSPEETNLLVSDRYQIRRNLLIKFSKDTLDQTS  181

Query  556   VLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
              L  +L  D     +   +++ L GDH  PL Q +
Sbjct  182   NLHHIL--DQKFPGL--TTLQKLNGDHQTPLGQNI  212



>ref|WP_008274448.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ92523.1| hypothetical protein CY0110_02319 [Cyanothece sp. CCY0110]
Length=257

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 137/273 (50%), Gaps = 64/273 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G+ VL P    P  I+HF+GG F G AP +TYR  LE L ++   +IATP+ + 
Sbjct  2     EWQEISGSSVLVP--RYPIAIIHFLGGAFVGTAPNVTYRWLLEELAKEGYAIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA  V  +F+  L  LQ         LPI+GIGHS+G  +HLLIGS ++V+R+GN
Sbjct  60    FDHLAIARSVLNRFENILDRLQTNTSLGQGYLPIYGIGHSMGCKLHLLIGSLFSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AI               PFL QI     + L                 
Sbjct  120   ILISFNNYPVKKAI---------------PFLEQIDVEKYLSL-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P+ET+ +I   Y I RNLL+KF +D IDET VL
Sbjct  148   ----------------------EFTPSPDETKIIIAKDYQIRRNLLVKFTNDNIDETLVL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
             + +L  D    +++  ++++L G+H  PL Q +
Sbjct  186   SPIL--DDKYPNLI--ALQNLSGNHLTPLSQEI  214



>ref|WP_006276087.1| hypothetical protein [Cylindrospermopsis raciborskii]
 gb|EFA70904.1| protein of unknown function DUF1350 [Cylindrospermopsis raciborskii 
CS-505]
Length=261

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/307 (34%), Positives = 147/307 (48%), Gaps = 74/307 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WV+ P    P  I+HF+GG F  +AP LTYR  LE+L  K  ++IATP+ +G
Sbjct  2     EWKEIRGNWVIVP--RHPVGIIHFLGGAFVASAPHLTYRWLLEQLANKGYVIIATPFVNG  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R L  L    +     LPI+G+GHS+G  + LLIGS + V+R+GN
Sbjct  60    LDHQAIAQSVLLNFERTLERLHYYGELHKLYLPIYGVGHSMGCKLQLLIGSLFEVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL   +   +   +      I  SPT                    
Sbjct  120   ILISFNNYTAKDAIPLVEQLNSTLMSDL-----MIEFSPT--------------------  154

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                        P ET ++I+  Y I RNLLIKF +D +D+++ L
Sbjct  155   ---------------------------PTETNQIIEESYQIRRNLLIKFHNDNLDQSAEL  187

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
              ++L   +  S M  +++++L G+H  PL Q          D   +SG     L A   W
Sbjct  188   TKILK--NRFSQM--VTVKTLSGNHTTPLGQ----------DIKWQSGNSFTPLDAIAQW  233

Query  370   ETFAKEV  350
               F +EV
Sbjct  234   --FKQEV  238



>ref|WP_024544945.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=261

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/272 (36%), Positives = 139/272 (51%), Gaps = 64/272 (24%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+E  G+W+L P+  +P  ++HF+GG F G APQLTY+  LE+L  +   +I TP+ + F
Sbjct  3     WQESGGSWILIPV--QPVGVIHFLGGAFVGTAPQLTYKWLLEQLAAEGYAIITTPFVNTF  60

Query  1075  DHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             DH  IA +V  +F+  L  LQ + Q     LP++G+GHS+G  IHLLIGS + VQR+GNI
Sbjct  61    DHLAIARQVLNRFENILERLQNSNQLGYRYLPVYGVGHSMGCKIHLLIGSLFNVQRAGNI  120

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             LMS+NN               P+ +SI PF  Q    P   +  E T             
Sbjct  121   LMSYNN--------------FPVKKSI-PFFEQF--DPDNNINFEFT-------------  150

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                     P P ET  +I++ Y I RNLLI+F +DT+D+T  L 
Sbjct  151   ------------------------PSPPETTEIIQTSYQIRRNLLIQFNNDTLDQTQDLT  186

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
              +L       +M  ++ R+L G+H  PL Q L
Sbjct  187   PILL--ERFPAM--VAARTLTGNHLTPLGQDL  214



>gb|AIE73329.1| hypothetical protein D082_08000 [Synechocystis sp. PCC 6714]
Length=282

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 162/328 (49%), Gaps = 63/328 (19%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G+WVL P   +P  +VHF+GG F G AP + YR  L  L +   +V+ATP+ + 
Sbjct  2     EWREISGSWVLVP--PQPIAVVHFLGGAFVGTAPNVAYRWLLTELGKAGYVVVATPFLNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE----TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA  V  +F+  L  LQ+    T   LP++G+GHSLG  +HLLIGS Y V+R GN
Sbjct  60    FDHRAIARSVLNRFEIILERLQKQGEITNGLLPVYGLGHSLGCKLHLLIGSLYEVERDGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL++FNN     AIP             G  L+Q+     + +G +  L Q         
Sbjct  120   ILIAFNNYPVKQAIPF------------GEQLAQLQLDKLL-MGVQKQLSQFNL------  160

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                           +DL      F P PEET  LI   Y + RNLLIKF +D ID+T  L
Sbjct  161   -------------QVDL---NFEFTPSPEETNLLIAENYRVRRNLLIKFSNDDIDQTLGL  204

Query  550   AQLLSTDSAISSMLDM-SIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTP  374
               +L+ ++A     D+ +   LPG+H  PL Q          D   ++G+  + L A   
Sbjct  205   RPILNQNTA-----DLVAYCPLPGNHLTPLGQ----------DIQWETGQEFSPLDAVGQ  249

Query  373   WETFAKEVGNTFGVESNILRAEVSKELD  290
             W      + N+F  +   L+ E+ + L+
Sbjct  250   W------LKNSFSQDLRRLQKEILRWLE  271



>ref|WP_027844439.1| hypothetical protein [Mastigocoleus testarum]
Length=254

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/289 (35%), Positives = 147/289 (51%), Gaps = 67/289 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G  VL P   KP  ++HF+GG F   APQ+TYRL LE L EK  LV+ATP+ + 
Sbjct  2     NWKEIAGNSVLVP--HKPIGVIHFLGGAFVATAPQVTYRLLLEYLAEKGFLVVATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE---TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
              DH  IA+     F+R L  L++       LPI+G+GHS+G  +HLLIGS + V+R+GNI
Sbjct  60    LDHRAIAENALLNFERALVRLEDRGIINGYLPIYGLGHSMGCKLHLLIGSMHPVERAGNI  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             L+SFNN  A  AIPL               L Q+ ++  V            T SP    
Sbjct  120   LISFNNYAAKEAIPL---------------LEQLNSTINVEF----------TPSP----  150

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                         ET  +++ +Y I RNLLI+F +DTID++++L 
Sbjct  151   ---------------------------SETNSIVQEHYRIRRNLLIRFSNDTIDQSNILT  183

Query  547   QLLSTDSAISSMLDMSI-RSLPGDHGLPLHQALPDVPPAMTDAVNKSGE  404
             ++L      S   +M+I ++L G+H  PL Q +   P    + ++  G+
Sbjct  184   KILQ-----SRFGEMAIAKTLTGNHLTPLGQDIKWNPGKEFNPIDAVGQ  227



>ref|WP_017747160.1| hypothetical protein [Scytonema hofmanni]
Length=255

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 100/271 (37%), Positives = 137/271 (51%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P N  P  IVHF+GG F   AP +TYR  LE+L  K   VIATP+ + 
Sbjct  2     DWKEISGNWVLIPRN--PIGIVHFLGGAFVATAPHITYRWLLEQLATKGYAVIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH+ IA  V   F+R L  LQ++     + LPI+G+GHS+G  +HLLIGS +AV+R+GN
Sbjct  60    LDHYAIAKSVLLNFERALERLQDSSAIRKRYLPIYGVGHSMGCKLHLLIGSLFAVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+S+NN  A  AIPL     +  A    P       SP       + + QL        
Sbjct  120   ILISYNNYAARDAIPLVEQFNLAAAVEFTP-------SP-------LKMNQL--------  157

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                 +E +V R               RNLL+KF +DT+D+++ L
Sbjct  158   -------------------VQEQYVVR---------------RNLLVKFSNDTLDQSAAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              +LL      S M  +++++L G H  PL Q
Sbjct  184   TELLK--QRFSDM--VTVQTLTGTHTTPLGQ  210



>gb|EWM26665.1| Protein of unknown function DUF1350 [Nannochloropsis gaditana]
Length=669

 Score =   158 bits (400),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 172/328 (52%), Gaps = 40/328 (12%)
 Frame = -2

Query  1270  GTSKDWKEVEGAWVLGPIN---TKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVI  1100
             G    W+E+ G ++L P +   + P+ ++HF+GG F GAAP LTYR  L  L E+  LV+
Sbjct  310   GLMGRWEEIGGNFLLRPPDHETSPPKAVLHFLGGAFVGAAPHLTYRYLLTGLAEQGYLVV  369

Query  1099  ATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYA-VQ  923
             ATPY   FD+  + D V  +F+R    L +    LP+ GIGHS G+++ +LI   +    
Sbjct  370   ATPYHLSFDYVQVCDTVLERFERVAIPLAKEYGALPVVGIGHSCGALLQVLITCLFPDTP  429

Query  922   RSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVR-----LGAEMTLKQ  758
             R  N L+SFNN+ A  AIP F  ++VP++ S+       A +P +      LG    L+Q
Sbjct  430   RLANALISFNNQMAQKAIPAFEELVVPLSLSLMGEDGLGAETPGMTGEGGALGPGTALRQ  489

Query  757   -LGTL-------------SP-----------PIMKqvlplveqlppLYMDLINGRENFVP  653
              LG L             SP           P++KQ + +V+QLPPL   + +G   F P
Sbjct  490   SLGRLRQNLEEVVEAYAVSPLAPSVIQNEVVPLVKQAMSVVDQLPPLLQSISDGAREFAP  549

Query  652   RPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSM------LDMSIRS  491
              P++TR + +  Y   R LL++F+DD+IDE+  L ++L    +I  M      +D+ + +
Sbjct  550   TPDDTREVCRRMYRARRTLLVRFEDDSIDESENLMKVLQESRSIMRMKRPLVKMDVRLET  609

Query  490   LPGDHGLPLHQALPDVPPAMTDAVNKSG  407
             + G H  PL Q +   PP + D +N  G
Sbjct  610   IKGTHITPLAQDIFQNPPQVVDVLNPFG  637



>ref|WP_015079462.1| hypothetical protein [Anabaena sp. 90]
 ref|YP_006996113.1| hypothetical protein ANA_C11526 [Anabaena sp. 90]
 gb|AFW94300.1| hypothetical protein ANA_C11526 [Anabaena sp. 90]
Length=257

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 96/291 (33%), Positives = 143/291 (49%), Gaps = 62/291 (21%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WVL P N  P  I+HF+GG F    P LTYR  LE L ++  ++IATP+ + 
Sbjct  2     NWQEIRGNWVLIPRN--PIGIIHFLGGAFVATLPHLTYRWLLENLADQGYVIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  VQ KF+  L  LQ+  +     LP +G+GHS+G  +HLLIGS + +QR+GN
Sbjct  60    LDHIAIAKSVQLKFEYTLEKLQDAGKLRKLYLPTYGVGHSMGCKLHLLIGSLFPIQRAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A+ AIPL               + Q+ +    +L  E              
Sbjct  120   ILISFNNFAANEAIPL---------------VEQLNSQLNSQLDIE--------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P +T ++I+  Y I RNL+I+F  DT+D+++ L
Sbjct  151   -----------------------FTPTPAQTNQIIQDSYQIRRNLVIRFNKDTLDQSANL  187

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELL  398
               +L       +M  ++ ++L G H  PL Q +   P +     +  G+ L
Sbjct  188   TTILQ--ELFPNM--VTTQTLLGTHTTPLGQDIKWQPGSSFSPFDALGQWL  234



>ref|WP_007308872.1| hypothetical protein [Crocosphaera watsonii]
 gb|EHJ15147.1| hypothetical protein CWATWH0003_0192 [Crocosphaera watsonii WH 
0003]
 emb|CCQ62177.1| hypothetical protein CWATWH0401_4940 [Crocosphaera watsonii WH 
0401]
 emb|CCQ52906.1| FIG00565783: hypothetical protein [Crocosphaera watsonii WH 8502]
 emb|CCQ59100.1| hypothetical protein CWATWH0005_4241 [Crocosphaera watsonii WH 
0005]
 emb|CCQ69851.1| hypothetical protein CWATWH0402_3378 [Crocosphaera watsonii WH 
0402]
Length=257

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 158/321 (49%), Gaps = 79/321 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W E+ G+ VL P    P  I+HF+GG F G AP  TYR  LE L ++   +IATP+ + 
Sbjct  2     EWLEISGSSVLVP--RYPIAIIHFLGGAFVGTAPNFTYRWLLEELAKEGYAIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA  V  +F+  L  LQ         LPI+GIGHS+G  +HLLIGS ++V+R+GN
Sbjct  60    FDHLAIARNVLNRFEGILDRLQTNNSLGQGYLPIYGIGHSMGCKLHLLIGSLFSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             +L+SFNN     AI               PFL Q+                         
Sbjct  120   VLISFNNYPVKKAI---------------PFLEQLDIE----------------------  142

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                          Y++L      F P P+ET+ +I+  Y + RNLL+KF DD IDET +L
Sbjct  143   ------------NYLNL-----EFTPSPDETKLIIEKDYLVRRNLLVKFTDDNIDETKIL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               +L  D    ++  +++++L G+H  PL Q          D   ++GE+   L A   W
Sbjct  186   EPIL--DDKYPNL--IALQTLSGNHLTPLSQ----------DIKWEAGEIFTPLDAVGQW  231

Query  370   --ETFAKEVGNTFGVESNILR  314
               + F++++   + +++ ILR
Sbjct  232   VKQAFSRDL---YRLKNEILR  249



>ref|WP_036003422.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=276

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 137/270 (51%), Gaps = 44/270 (16%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WVL P   +P  I+HF+GG F   APQ+TYR  LE L  +   ++ATP+ + 
Sbjct  2     EWQEIYGNWVLVP--PRPIAIIHFLGGAFVATAPQVTYRAILEALAAQGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV--QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNIL  905
              DH  IA  V    +  L +L   V  Q LPI+GIGHS+G  +HLLIGS +  +R+GNIL
Sbjct  60    LDHTTIAQRVMRMSNLALDYLTTEVLRQYLPIYGIGHSMGCKLHLLIGSLFPQERAGNIL  119

Query  904   MSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKq  725
             +SFNN  A  +IP     LV        F SQ+A+             Q  +  PP    
Sbjct  120   ISFNNYPAKRSIP-----LVEQFTQFSKFTSQLAS-------------QFNSPLPPQFAA  161

Query  724   vlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDET-SVLA  548
                          D+      F P PEET +LI   Y + RNLLIKF +D ID+T S+  
Sbjct  162   A-----------FDV-----EFTPSPEETNQLILEQYQVPRNLLIKFTNDDIDQTRSLHG  205

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              LL     ++     S++ L G H  PL Q
Sbjct  206   VLLERFPNLT-----SVQILKGSHLTPLGQ  230



>ref|WP_012626125.1| hypothetical protein [Cyanothece sp. PCC 7425]
 ref|YP_002481388.1| hypothetical protein Cyan7425_0639 [Cyanothece sp. PCC 7425]
 gb|ACL43027.1| protein of unknown function DUF1350 [Cyanothece sp. PCC 7425]
Length=255

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 139/272 (51%), Gaps = 65/272 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+EV+  WVL P  T+P  I+HF+GG F  AAPQ TY   LE L ++   +IATP+ + 
Sbjct  2     NWQEVKENWVLLP--TRPLAIIHFLGGAFVAAAPQTTYNRLLEFLAKQGYGIIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET---VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
              DH  IA EV+ KF+R L  LQ+     + LPI+G+GHS+G  +HLL+GS   V R+GNI
Sbjct  60    LDHRAIATEVETKFERALASLQQQGRLKRFLPIYGLGHSMGCKLHLLMGSLSDVNRAGNI  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
              +SFNN  A  AIPL   +      ++G   S +  +PT R                   
Sbjct  120   FLSFNNFSADQAIPLVQSL------NLG---STLEFTPTPR-------------------  151

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                         ET RLI+ +Y + RNLLI+F +D ID+T  L 
Sbjct  152   ----------------------------ETNRLIQQHYQVRRNLLIRFSNDEIDQTLQLQ  183

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
             ++L  +     ++  S+R LPG H  PL Q L
Sbjct  184   KIL--EERFPGLI--SLRQLPGSHLTPLGQDL  211



>ref|WP_008233767.1| Alpha/beta superfamily hydrolase [Richelia intracellularis]
 emb|CCH67349.1| Alpha/beta superfamily hydrolase [Richelia intracellularis HH01]
Length=268

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 94/272 (35%), Positives = 136/272 (50%), Gaps = 66/272 (24%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+E+   WV+ P N  P  IVHF+GG F G  P +TYRL LE L  K  ++IAT + +  
Sbjct  11    WQEISSNWVIVPRN--PIGIVHFLGGAFVGYLPHITYRLLLENLSAKGFIIIATSFLNSL  68

Query  1075  DHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             DH  IA +    FD+ L +LQ+        LPI+G+GHS+G  IHLLIGS Y V R GNI
Sbjct  69    DHITIAKQALLDFDQALLYLQKKSVLGKAYLPIYGVGHSMGCKIHLLIGSLYKVDRVGNI  128

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             L+SFNN  AS A        +P+ +               +L + + ++           
Sbjct  129   LISFNNYAASDA--------IPLVE---------------KLNSNLNIE-----------  154

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P+ET+ L+   Y I RNLLI+F  DT+D++++L 
Sbjct  155   ----------------------FTPTPQETQDLVHENYNIRRNLLIRFTHDTLDQSTILR  192

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
             ++L        ML  + ++L G+H  P++Q L
Sbjct  193   KIL--QQRFPEML--TAKTLQGNHFTPINQDL  220



>ref|WP_017293802.1| hypothetical protein [Geminocystis herdmanii]
Length=274

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 108/329 (33%), Positives = 164/329 (50%), Gaps = 74/329 (22%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+E  G+WVL P N  P  I+HF+GG F   AP +TYR  LE L ++  ++IAT + +  
Sbjct  5     WQEFSGSWVLIPNN--PHGIIHFLGGAFVATAPNITYRWLLENLAKQGYIIIATSFLNTL  62

Query  1075  DHFFIADEVQFKFDRCLRFLQE----TVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             DH  IA  +Q + +  L  L+      ++ LP++G+GHS+G  +HLLIGS + ++R+GNI
Sbjct  63    DHKSIAVNIQNRLENILSRLEYRLGIELRYLPMYGLGHSMGCKLHLLIGSLFDIERAGNI  122

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
              +SFNN               P+ Q+I PF+  I  S       +  LK           
Sbjct  123   FISFNN--------------YPLKQAI-PFMENIIPS------LQNNLKN----------  151

Query  727   qvlplveqlppLYMDLINGRE-NFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                         Y+ + N  E  F P PEET+ +IK  Y I RNLL+KF +D+ID+TS L
Sbjct  152   ------------YLQIDNSLEFEFTPCPEETKVIIKENYQIRRNLLVKFNNDSIDQTSTL  199

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               +L+  +   SM  +S  +L G+H  PL Q          D   + GE+  +      W
Sbjct  200   QPILT--NLFPSM--VSTLTLQGNHLTPLGQ----------DIDWQLGEMFTSFDVVGKW  245

Query  370   --ETFAKEVGNTFGVESNILRAEVSKELD  290
               + F++++ N        L  E+S+ L+
Sbjct  246   FKDNFSRDLYN--------LHREISRWLN  266



>ref|WP_013189824.1| hypothetical protein [Trichormus azollae]
 ref|YP_003719927.1| hypothetical protein Aazo_0175 ['Nostoc azollae' 0708]
 gb|ADI62804.1| protein of unknown function DUF1350 ['Nostoc azollae' 0708]
Length=255

 Score =   150 bits (378),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 140/277 (51%), Gaps = 66/277 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWK++ G WV+  I  KP  I+HF+GG F   AP LTYR  LE+L  K  +VIATP+ + 
Sbjct  2     DWKDIRGNWVI--IPPKPIGIIHFLGGAFVATAPHLTYRWLLEQLAAKGYVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R L  LQ+T +     LPI+G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHSTIAQSVLINFERTLERLQDTGELRKLYLPIYGVGHSMGCKLHLLIGSLFKVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               P + Q+ ++  +                   
Sbjct  120   ILISFNNYTAKEAI---------------PLVEQLNSTLAIE------------------  146

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET +L++  Y I RNLLIKF +D +D+++VL
Sbjct  147   -----------------------FTPTPLETNQLVEERYHIRRNLLIKFSNDNLDQSAVL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVP  440
              ++L   +    M  ++ ++L G+H  PL Q +   P
Sbjct  184   TKIL--QNRFPEM--VTTQTLSGNHTTPLGQEIKWQP  216



>ref|WP_011320424.1| hypothetical protein [Anabaena variabilis]
 ref|YP_324224.1| hypothetical protein Ava_3724 [Anabaena variabilis ATCC 29413]
 gb|ABA23329.1| Protein of unknown function DUF1350 [Anabaena variabilis ATCC 
29413]
Length=255

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 133/271 (49%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P N  P  I+HF+GG F   AP LTYR  LE+L  K  +VIATP+ + 
Sbjct  2     DWKEIRGNWVLVPRN--PVGIIHFLGGAFVATAPHLTYRWLLEQLGNKGYVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA+ V   F+R +  L ++       LP +GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHIAIANSVLLNFERTIERLHDSGALRKLYLPTYGIGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL               + Q  T+    L  E T   L T      
Sbjct  120   ILISFNNYAAKDAIPL---------------VEQFNTT----LAIEFTPSPLET------  154

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                             +L++  Y I RNLLIKF +D +D+++ L
Sbjct  155   -------------------------------NKLVQESYNIRRNLLIKFNNDNLDQSAAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              ++L        M  ++ ++LPG H  PL Q
Sbjct  184   TKILQVR--FPEM--VTAQTLPGTHTTPLGQ  210



>ref|WP_006632016.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK89331.1| protein of unknown function DUF1350 [Microcoleus vaginatus FGP-2]
Length=255

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/271 (36%), Positives = 136/271 (50%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G WVL P  ++P  IVHF+GG F   APQLTYR  LE L  +  LV+ATP+ + 
Sbjct  2     DWQEISGNWVLIP--SRPIGIVHFLGGAFVATAPQLTYRWLLEALGNQGYLVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA +V  KF+  L  L+ +       LPI+G+GHS+G  +HLLIGS + ++R+GN
Sbjct  60    LDHIAIARDVLNKFENALDRLRGSKLLKSSYLPIYGMGHSMGCKLHLLIGSVFDIERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  AS AI        P+ + I P  +                           
Sbjct  120   ILISFNNYAASEAI--------PIVEQISPVFN---------------------------  144

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P+ET RL++  Y I RNLL+KF  D ID+T +L
Sbjct  145   ---------------------VEFTPSPQETNRLVQDSYQIRRNLLVKFNGDNIDQTLLL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              +     +    M+  ++++L G+H  PL Q
Sbjct  184   TK--LLKARFPEMI--TVQTLTGNHQTPLGQ  210



>ref|WP_026794363.1| MULTISPECIES: hypothetical protein [Planktothrix]
Length=254

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/273 (37%), Positives = 133/273 (49%), Gaps = 66/273 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW  + G WVL P   +P+ I+HF+GG F    P LTYR  LE L  +   ++ATP+ + 
Sbjct  2     DWLSISGNWVLIP--PRPQAILHFLGGAFVATLPHLTYRCLLEELAHQGYAIVATPFINN  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA EV   F+  L  L +      + LPI+G+GHS+G  IHLLIGS + V+RSGN
Sbjct  60    LDHTAIAQEVFEIFEDGLYDLYDLQLLKRRGLPIYGLGHSMGCKIHLLIGSLFPVERSGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             ILMSFNN  AS +IPL               + QI+                        
Sbjct  120   ILMSFNNYAASQSIPL---------------VEQISQ-----------------------  141

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                          +MD+      F P PEET  L+   Y I RNLLIKF  DT+D+TS L
Sbjct  142   -------------FMDV-----EFTPSPEETNLLVSDRYQIRRNLLIKFSKDTLDQTSNL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
               +L  D     +   +++ L GDH  PL Q +
Sbjct  184   HHIL--DQKFPGL--TTLQKLNGDHQTPLGQNI  212



>ref|WP_010995259.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_485128.1| hypothetical protein alr1085 [Nostoc sp. PCC 7120]
 dbj|BAB73042.1| alr1085 [Nostoc sp. PCC 7120]
Length=255

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/271 (36%), Positives = 133/271 (49%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P N  P  I+HF+GG F   AP LTYR  LE+L  K  +VIATP+ + 
Sbjct  2     DWKEIRGNWVLVPRN--PVGIIHFLGGAFVATAPHLTYRWLLEQLGNKGYVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA+ V   F+R +  L ++       LP +GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHIAIANSVLLNFERTIERLHDSGALRKLYLPTYGIGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL               + Q  T+    L  E T   L T      
Sbjct  120   ILISFNNYAAKDAIPL---------------VEQFNTT----LAIEFTPSPLET------  154

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                             +L++  Y + RNLLIKF +D +D+++ L
Sbjct  155   -------------------------------NKLVQESYNVRRNLLIKFNNDNLDQSAAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              ++L        M  ++ ++LPG H  PL Q
Sbjct  184   TKILQVR--FPEM--VTAQTLPGTHTTPLGQ  210



>ref|WP_015196854.1| hypothetical protein [Calothrix parietina]
 ref|YP_007136173.1| hypothetical protein Cal6303_1139 [Calothrix sp. PCC 6303]
 gb|AFZ00201.1| protein of unknown function DUF1350 [Calothrix sp. PCC 6303]
Length=276

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 109/339 (32%), Positives = 157/339 (46%), Gaps = 75/339 (22%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWK++  +WVL P   KP  IVHF+GG F   AP LTYR  LE+L  +  +++ATP+ + 
Sbjct  2     DWKQITDSWVLIP--PKPIGIVHFLGGAFVATAPHLTYRWLLEQLANQGYIIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA +V  +F+R L  L++         PI+G+GHS+G  +HLLIGS + ++R+GN
Sbjct  60    FDHRAIAQQVLLQFERVLIRLEDRGILGNGYYPIYGVGHSMGCKLHLLIGSLFPIKRAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  A+P         A+S  PF  + + SP                     
Sbjct  120   ILISFNNFAARDAVPFLEQFNTSFAKS--PFAVEFSPSPA--------------------  157

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                          +T  LI+  YG+ RNLLIKF +DTID+++ L
Sbjct  158   -----------------------------QTNDLIREDYGVRRNLLIKFSNDTIDQSTNL  188

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
              ++L T      M+   I  L G H  PL Q          D   +S    + L A   W
Sbjct  189   HEILET--RFPGMVATQI--LTGTHVTPLGQ----------DFKLQSNSSFSPLDALGQW  234

Query  370   ETFAKEVGN--TFGVESNILRAEVSKELDLLVDVTTSWM  260
               F +  G+   F       + E  ++L+ L  V   W+
Sbjct  235   --FGQNKGDFTPFDALGQWFQQEAYRDLNQLKAVILRWL  271



>ref|WP_009344643.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA71567.1| Protein of unknown function DUF1350 [Raphidiopsis brookii D9]
Length=211

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 121/244 (50%), Gaps = 58/244 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WV+ P    P  I+HF+GG F  +AP LTYR  LE+   K  ++IATP+ +G
Sbjct  2     EWKEIRGNWVIVP--RHPVGIIHFLGGAFVASAPHLTYRWLLEQFANKGYVIIATPFVNG  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  KF+R L  L    +     LPI+G+GHS+G  + LLIGS + V+R+GN
Sbjct  60    LDHQAIAQSVLLKFERTLERLHYYGELHKLYLPIYGVGHSMGCKLQLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL       + Q    F+S +                         
Sbjct  120   ILISFNNYTAKDAIPL-------VEQLNSTFMSDLMIE----------------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET ++IK  Y I RNLLIKF +D +D++  L
Sbjct  151   -----------------------FSPTPTETNQIIKESYQIRRNLLIKFHNDNLDQSVEL  187

Query  550   AQLL  539
              ++L
Sbjct  188   TKIL  191



>ref|WP_015956449.1| hypothetical protein [Cyanothece sp. PCC 7424]
 ref|YP_002379733.1| hypothetical protein PCC7424_4501 [Cyanothece sp. PCC 7424]
 gb|ACK72865.1| protein of unknown function DUF1350 [Cyanothece sp. PCC 7424]
Length=259

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/271 (36%), Positives = 134/271 (49%), Gaps = 64/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E  G+WVL P    P  ++HF+GG F G AP LTYR  LE L +    +I TP+ + 
Sbjct  2     NWQEFSGSWVLIP--QHPIGVIHFLGGAFVGTAPNLTYRWLLENLGKSGYAIITTPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +F+  L  LQ T     + LPI+G+GHS+G  +HLLIGS ++V+R+GN
Sbjct  60    LDHTAIARSVLNRFETILERLQTTNALGQRYLPIYGLGHSMGCKLHLLIGSMFSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+S+NN     AIPL               + Q+    T +L                 
Sbjct  120   ILISYNNYPIRRAIPL---------------IEQLQIDKTFQL-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    FVP PEET  LI   Y I RNLLI+F +D ID+TS+L
Sbjct  148   ----------------------EFVPSPEETNVLIAKNYAIRRNLLIRFTNDEIDQTSLL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             + +L  +     M  ++  +L G+H  PL Q
Sbjct  186   SPVL--EQRFPQM--VAFLTLTGNHLTPLGQ  212



>ref|WP_015220916.1| hypothetical protein [Cyanobacterium aponinum]
 ref|YP_007163242.1| hypothetical protein Cyan10605_3147 [Cyanobacterium aponinum 
PCC 10605]
 gb|AFZ55198.1| protein of unknown function DUF1350 [Cyanobacterium aponinum 
PCC 10605]
Length=272

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/337 (32%), Positives = 150/337 (45%), Gaps = 78/337 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E  G+WVL P    P  I+HF+GG F   AP +TYR  LE+L  +  ++IAT + + 
Sbjct  2     EWQEFSGSWVLTP--PHPLGIIHFLGGAFVATAPHITYRWLLEKLARQGYIIIATSFLNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  VQ + +  L  L+      +  LPI+G+GHS+G  +HLLIGS   V+R+GN
Sbjct  60    LDHKAIAVNVQNRLENILYRLEYKQGIDINYLPIYGLGHSMGCKLHLLIGSLLKVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN     AIP         A++I P+L Q      ++L A + +           
Sbjct  120   ILISFNNYPFKKAIPF--------AENIIPYL-QDNIKNYLQLEANLDI-----------  159

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                   +F P P ET  +IK  Y I RNLLIKF DDTID+T   
Sbjct  160   ----------------------DFTPTPIETNIIIKENYHIRRNLLIKFSDDTIDQT---  194

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
                                       L LH  L  + P M  A+  SG  L  L     W
Sbjct  195   --------------------------LELHPILKQLHPNMITALQLSGNHLTPLGQDIDW  228

Query  370   ETFAKEVGNTFGVESNILRAEVSKELDLLVDVTTSWM  260
             E   +      G+ S   +   S++L  L    + W+
Sbjct  229   EMGGQLFSPIAGI-SQWFQDNFSRDLYNLYQQISRWL  264



>ref|WP_023076859.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
 gb|ESA32264.1| hypothetical protein N836_27125 [Leptolyngbya sp. Heron Island 
J]
Length=252

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 96/269 (36%), Positives = 135/269 (50%), Gaps = 62/269 (23%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+EV G W+L P   +PR I+HF+GG F  AAP LTY   LE L ++  +++ATP+ + F
Sbjct  3     WQEVSGNWLLVP--DRPRAIIHFLGGAFIAAAPNLTYGWLLENLSQQGYIIVATPFINTF  60

Query  1075  DHFFIADEVQFKFDRCLRFLQETV---QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNIL  905
             DH  IA EV   FD+ + +L+  V   + LPI+G+GHS+G  +HLLI S Y V R+GNIL
Sbjct  61    DHDAIAAEVLTTFDQAMIYLRRQVIGDRYLPIYGMGHSMGCKVHLLIASLYNVDRAGNIL  120

Query  904   MSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKq  725
             +SFNN  A  +IPL                                L+Q    +P     
Sbjct  121   ISFNNYPARKSIPL--------------------------------LEQFVQFAPD----  144

Query  724   vlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQ  545
                          D+      F P P +T  L++  Y + RNLLIKF+ DTID+T  L+ 
Sbjct  145   ------------FDI-----EFTPSPGQTLDLVRDRYTVGRNLLIKFRKDTIDQTYDLSD  187

Query  544   LLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             +L       +    +I+ L G H  P+ Q
Sbjct  188   VLFQRFPQFT----AIQILQGTHTTPVAQ  212



>ref|WP_015153643.1| hypothetical protein [Chroococcidiopsis thermalis]
 ref|YP_007090964.1| hypothetical protein Chro_1571 [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY87095.1| protein of unknown function DUF1350 [Chroococcidiopsis thermalis 
PCC 7203]
Length=257

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 134/273 (49%), Gaps = 64/273 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P   K   IVHF+GG F   APQLTYR  LE+L E++ +V+ATP+ + 
Sbjct  2     EWKEIAGNWVLVP--HKQIGIVHFLGGAFVATAPQLTYRWLLEQLAEENYVVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+  +  L        + LPI+G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIARSVLNGFENAIGQLYAKSLLRSRYLPIYGVGHSMGCKLHLLIGSLFNVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               P + Q+  +P   +                 
Sbjct  120   ILISFNNYAARDAI---------------PLVQQLNFNPGFSV-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET  L+++ Y + RNL IKF +DTID++  L
Sbjct  148   ----------------------EFTPSPLETNTLLQTRYEVRRNLAIKFTNDTIDQSEAL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
              +LL        M  +++++L G H  PL Q L
Sbjct  186   VKLL--HQRFPGM--VTLKTLSGTHTTPLSQDL  214



>ref|WP_006512476.1| Protein of unknown function (DUF1350) [Xenococcus sp. PCC 7305]
 gb|ELS00323.1| Protein of unknown function (DUF1350) [Xenococcus sp. PCC 7305]
Length=258

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 102/276 (37%), Positives = 135/276 (49%), Gaps = 69/276 (25%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIV---HFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYA  1085
             W+E  G    G I   P+ IV   HF+GG F   APQL+YR FLE++ E    +IATP+ 
Sbjct  3     WQEFSG----GSIYLPPQEIVGVVHFLGGAFVATAPQLSYRSFLEQIGEAGFAIIATPFL  58

Query  1084  SGFDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRS  917
             + FDH  IA EV  +F+     LQ       + LPI+GIGHS+G  +HLLIGS + V+R+
Sbjct  59    NTFDHLTIAKEVLNRFENICDRLQAMDAFGKRYLPIYGIGHSMGCKLHLLIGSLFNVERA  118

Query  916   GNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPP  737
             GNIL+SFNN  A+ AI               PF  QI  +  + L               
Sbjct  119   GNILISFNNYPAARAI---------------PFGEQIPVTEALDL---------------  148

Query  736   IMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETS  557
                                      F P P+ET+ LI   Y I+RNLLIKF +DTID+T 
Sbjct  149   ------------------------EFTPSPQETKNLISQDYKIARNLLIKFNNDTIDQTP  184

Query  556   VLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALP  449
              L   L      S+++    R+L G+H  PL Q +P
Sbjct  185   NLQFSLQKRFPNSTVM----RTLKGNHLTPLGQDVP  216



>ref|WP_007303252.1| hypothetical protein [Crocosphaera watsonii]
 gb|EAM52935.1| Protein of unknown function DUF1350 [Crocosphaera watsonii WH 
8501]
Length=257

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 105/321 (33%), Positives = 157/321 (49%), Gaps = 79/321 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W E+ G+ VL P    P  I+HF+GG F G AP  TYR  LE L ++   +IATP+ + 
Sbjct  2     EWLEISGSSVLVP--RYPIAIIHFLGGAFVGTAPNFTYRWLLEELAKEGYAIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA  V  +F+  L  LQ         LPI+GIGHS+G  +HLLIGS ++V+R+GN
Sbjct  60    FDHLAIARNVLNRFEGILDRLQTNNSLGQGYLPIYGIGHSMGCKLHLLIGSLFSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             +L+SFNN     AI               PFL Q+                         
Sbjct  120   VLISFNNYPVKKAI---------------PFLEQLDIE----------------------  142

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                          Y++L      F P  +ET+ +I+  Y + RNLL+KF DD IDET +L
Sbjct  143   ------------NYLNL-----EFTPSTDETKLIIEKDYLVRRNLLVKFTDDNIDETKIL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               +L  D    ++  +++++L G+H  PL Q          D   ++GE+   L A   W
Sbjct  186   EPIL--DDKYPNL--IALQTLSGNHLTPLSQ----------DIKWEAGEIFTPLDAVGQW  231

Query  370   --ETFAKEVGNTFGVESNILR  314
               + F++++   + +++ ILR
Sbjct  232   VKQAFSRDL---YRLKNEILR  249



>ref|WP_023066259.1| hypothetical protein [Lyngbya aestuarii]
 gb|ERT07596.1| hypothetical protein M595_2468 [Lyngbya aestuarii BL J]
Length=256

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 139/273 (51%), Gaps = 66/273 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W EV   WVL P   +P+ IVHF+GG F   APQ+TYR  LE++ ++  +VIATP+ + 
Sbjct  2     EWIEVSKNWVLIP--PRPKAIVHFLGGAFVATAPQITYRWLLEQIAQQGYIVIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              +H  +A +V + F+  L  L  +     + LPI+G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LNHGIMAKKVLWTFEDGLEDLYSSRRLRQRSLPIYGLGHSMGCKLHLLIGSLFPVKRAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  +I               P + Q+++   V                   
Sbjct  120   ILISFNNYAARESI---------------PLVEQLSSMMEV-------------------  145

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P +T  +++  Y I RNLLIKF  DT+D+T++L
Sbjct  146   ----------------------EFTPSPGQTNCMVQERYQIRRNLLIKFTKDTLDQTAIL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
              Q+L   S    M+  +++ L GDH  P++Q L
Sbjct  184   NQIL--QSRFPGMV--ALQQLGGDHLTPINQDL  212



>ref|WP_017654812.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=255

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/271 (37%), Positives = 133/271 (49%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P N  P  I+HF+GG F   AP LTYR  LE+L  K  ++IATP+ + 
Sbjct  2     DWKEIRGNWVLIPRN--PIGIIHFLGGAFVATAPHLTYRWILEQLANKGYVIIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R L  L +T       LP +G+GHS+G  +HLLIGS+ AV+R+GN
Sbjct  60    LDHTAIAKSVLLNFERTLERLYDTASLRKLYLPTYGVGHSMGCKLHLLIGSQSAVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL       +A    P  + I TS                      
Sbjct  120   ILISFNNYAARDAIPLVEQFNSALAIEFTP--NPIETS----------------------  155

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                             L+  R N        RR          NL+IKF +DTID+++ L
Sbjct  156   ---------------KLVQERYN-------VRR----------NLIIKFSNDTIDQSAAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             +++L        M  ++I++LPG H  PL Q
Sbjct  184   SKIL--QERFEEM--VTIQTLPGTHTTPLGQ  210



>ref|WP_039715982.1| hypothetical protein [Scytonema millei]
 gb|KIF18459.1| hypothetical protein QH73_35295 [Scytonema millei VB511283]
Length=257

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 133/273 (49%), Gaps = 64/273 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P   K   IVHF+GG F   APQLTYR  LE+L E+  +V+ATP+ + 
Sbjct  2     EWKEIAGNWVLVP--HKQIGIVHFLGGAFVATAPQLTYRWLLEQLAEEHYVVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+  +  L        + LPI+G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHTAIARSVLNGFENAIGQLYAKSLLRSRYLPIYGVGHSMGCKLHLLIGSLFNVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AI               P + Q+  +P   +                 
Sbjct  120   ILISFNNYAARDAI---------------PLVQQLNFNPGFSV-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET  L+++ Y + RNL IKF +DTID++  L
Sbjct  148   ----------------------EFTPSPLETNTLLQTRYEVRRNLAIKFTNDTIDQSEAL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
              +LL        M  +++++L G H  PL Q L
Sbjct  186   VKLL--HQRFPGM--VTLKTLSGTHTTPLSQDL  214



>ref|WP_022609397.1| protein of unknown function (DUF1350) [Rubidibacter lacunae]
 gb|ERN39787.1| protein of unknown function (DUF1350) [Rubidibacter lacunae KORDI 
51-2]
Length=259

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/271 (35%), Positives = 133/271 (49%), Gaps = 64/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+EV  +W L P  ++P  I+HF+GG F G+APQL YR  LE+L +    ++ATP+A+G
Sbjct  2     EWQEVASSWTLVP--SQPTGIIHFLGGAFVGSAPQLVYRWLLEQLAKDGYAIVATPFANG  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             F+H  IA +   +F+  L+ LQ T     Q LP++G+GHS+G  I +LIGS Y   R+GN
Sbjct  60    FEHKQIARQALSRFETTLQRLQSTPALSGQYLPVYGLGHSMGCKIQVLIGSLYGADRAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             ILM++NN  A  AIPL                                L+QL   +PP  
Sbjct  120   ILMAYNNYPARRAIPL--------------------------------LEQL-DFTPP--  144

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                G   F P P  T  +  S Y I R LL++F+ D ID++S L
Sbjct  145   -------------------GTIEFSPSPAATLAIAASDYNIPRTLLVRFQKDDIDQSSEL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
               +L       +    S+  LPG+H  P  Q
Sbjct  186   LPVLQERLPGRA----SVIVLPGNHNTPCSQ  212



>ref|WP_009786598.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW34870.1| hypothetical protein L8106_18492 [Lyngbya sp. PCC 8106]
Length=256

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 136/271 (50%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W EV   WVL P   +P+ IVHF+GG F   APQ+TYR  LE++ ++  +VIATP+ + 
Sbjct  2     EWIEVSKNWVLIP--PRPKAIVHFLGGAFVATAPQITYRWLLEQIAQQGYIVIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              +H  +A +V + F+  L  L  T     + LPI+G+GHS+G  +HLLIGS + V R+GN
Sbjct  60    LNHGIMAKKVLWTFEDGLEDLYSTRRLRQRGLPIYGLGHSMGCKLHLLIGSLFPVNRAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  +I               P + Q+++   V                   
Sbjct  120   ILISFNNYAARESI---------------PLIEQLSSMMEV-------------------  145

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P +T  +I+  Y I RNLLIKF  DT+D+T++L
Sbjct  146   ----------------------EFTPSPGQTNCMIEERYQIRRNLLIKFTKDTLDQTTIL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              Q+L        M+  +++ L GDH  P++Q
Sbjct  184   NQIL--QRRFPGMV--ALQQLGGDHLTPINQ  210



>ref|WP_027402875.1| hypothetical protein [Aphanizomenon flos-aquae]
Length=257

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 135/272 (50%), Gaps = 64/272 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WVL P N  P  I+HF+GG F    P LTYR  LE L ++  ++IATP+ + 
Sbjct  2     NWQEIRGNWVLIPRN--PIGIIHFLGGAFVATLPHLTYRWLLENLADQGYVIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  KF+  L  LQ++ +     LP +G+GHS+G  +HLLIGS + +QR+GN
Sbjct  60    LDHIAIAKSVLRKFEYTLEKLQDSGKLRKIYLPTYGVGHSMGCKLHLLIGSLFPIQRAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  AS AIPL               + Q+ +    +L  E              
Sbjct  120   ILISFNNFAASEAIPL---------------VEQLNSQLNSQLDIE--------------  150

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P +T ++++  Y I RNLLI+F  D++D+++ L
Sbjct  151   -----------------------FTPTPAQTNQIVQDSYQIRRNLLIRFNKDSLDQSANL  187

Query  550   AQLLSTDSAISSMLDM-SIRSLPGDHGLPLHQ  458
               +L          DM + ++L G H  PL Q
Sbjct  188   KIILQ-----QLFPDMVTTQTLSGTHTTPLGQ  214



>ref|WP_015113353.1| hypothetical protein [Nostoc sp. PCC 7107]
 ref|YP_007050288.1| hypothetical protein Nos7107_2534 [Nostoc sp. PCC 7107]
 gb|AFY43138.1| protein of unknown function DUF1350 [Nostoc sp. PCC 7107]
Length=255

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/272 (36%), Positives = 131/272 (48%), Gaps = 68/272 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P N  P  I+HF+GG F   AP LTYR  LE++  K  +VIATP+ + 
Sbjct  2     DWKEIRGNWVLIPKN--PIGIIHFLGGAFVATAPHLTYRWLLEQVASKGYVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   FDR L  L ++       LP +GIGHS+G  +HLLIGS Y V+R+GN
Sbjct  60    LDHIAIAQSVLLNFDRTLERLHDSAVLRKLYLPTYGIGHSMGCKLHLLIGSLYPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIPL   +   +A    P  S + T+  V+ G ++             
Sbjct  120   ILISFNNYAAKDAIPLVEQLNSTLAIEFTP--SPLETNKIVQEGYKI-------------  164

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                            RR          NLLIKF +D +D+++ L
Sbjct  165   -------------------------------RR----------NLLIKFNNDNLDQSAAL  183

Query  550   AQLLSTDSAISSMLDM-SIRSLPGDHGLPLHQ  458
              ++L          DM + ++LPG H  PL Q
Sbjct  184   TKILQ-----QRFPDMVTAQTLPGTHTTPLGQ  210



>ref|WP_019505096.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=258

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 133/273 (49%), Gaps = 63/273 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WV  P   +   IVHF+GG F   APQ +Y   LE++ +    ++ATP+ + 
Sbjct  2     EWQEISGNWVYLP-RQEIIGIVHFLGGAFVATAPQFSYSSILEQIAQAGYGIVATPFLNT  60

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA EV  +F+  L  LQ+T     + LPI+GIGHS+G  +HLLIGS Y V+R+GN
Sbjct  61    FDHLAIAREVLNRFETALERLQKTNRLGKRYLPIYGIGHSMGCKLHLLIGSLYEVERAGN  120

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A+ AIPL               + Q   SP   +                 
Sbjct  121   ILISFNNYPANRAIPL---------------MEQFDLSPVFDV-----------------  148

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F+P P +T +LI   Y I RNLLIKF  D +D+T  L
Sbjct  149   ----------------------EFIPSPLQTEQLIADNYCIRRNLLIKFSQDDLDQTIDL  186

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
               +L        M+  ++R+L G H  PL Q +
Sbjct  187   NPVL--QKRFPEMI--TLRTLTGTHLTPLSQNI  215



>ref|WP_036485540.1| hypothetical protein [Myxosarcina sp. GI1]
Length=258

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 133/273 (49%), Gaps = 63/273 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W E+ G WV  P     + IVHF+GG F   APQ++YRL LE++ +     IATP+ + 
Sbjct  2     EWLEISGGWVYLP-RRDIKGIVHFLGGAFVATAPQISYRLLLEQIGKDGYATIATPFLNT  60

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA EV  +F+  L  L +T     + LP++GIGHS+G  +HLLIGS Y ++R+GN
Sbjct  61    LDHLAIAREVLNRFETILDRLHQTNKLGKRYLPVYGIGHSMGCKLHLLIGSLYNIERAGN  120

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN   + AI               PF+ Q   + T  +                 
Sbjct  121   ILISFNNYPVNRAI---------------PFIEQFNLTSTFNV-----------------  148

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P P ET+ LI   Y I RNLL+KF +D ID+T  L
Sbjct  149   ----------------------EFSPSPIETQELIAKNYAIRRNLLVKFTNDNIDQTIEL  186

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
               +L       +M+  ++ +LPG+H  PL Q +
Sbjct  187   NPILR--QRFPNMI--ALLNLPGNHLTPLSQEI  215



>ref|WP_015161844.1| lysophospholipase [Chamaesiphon minutus]
 ref|YP_007099281.1| lysophospholipase [Chamaesiphon minutus PCC 6605]
 gb|AFY95754.1| lysophospholipase [Chamaesiphon minutus PCC 6605]
Length=257

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 132/274 (48%), Gaps = 71/274 (26%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G WV  P   +PR ++HF+GG F  AAP LTYRL LE L ++  ++IATP+ + 
Sbjct  2     DWQEISGNWVYIP--RQPRAVIHFLGGAFVAAAPHLTYRLLLEDLAKQGYVIIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQD-LPIFGIGHSLGSVIHLLIGSRYAVQRSG  914
             FDH  IA EV  +F+  L  LQ+       D LP++G+GHS+G  +HLLIGS Y V R+G
Sbjct  60    FDHRAIAGEVYNRFEDTLELLQKRRYLPADDLLPVYGLGHSMGCKLHLLIGSMYDVDRAG  119

Query  913   NILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPI  734
             N+L+SFNN  A  A+PL   + V       P         T++L AE             
Sbjct  120   NMLISFNNFSARDAVPLMGQMPVEFNMEFSP-----NPQETLKLIAE-------------  161

Query  733   MKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSV  554
                                                   YY + +NL++KF +DT+D++  
Sbjct  162   --------------------------------------YYDVQQNLIVKFSNDTLDQSYT  183

Query  553   LAQLLST--DSAISSMLDMSIRSLPGDHGLPLHQ  458
             L Q L       IS++      ++ G H  PL Q
Sbjct  184   LGQTLKQIFPGQISTL------TINGSHVTPLGQ  211



>ref|XP_002296356.1| hypothetical protein THAPS_263321 [Thalassiosira pseudonana CCMP1335]
 gb|ACI65073.1| hypothetical protein THAPS_263321 [Thalassiosira pseudonana CCMP1335]
Length=394

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/283 (33%), Positives = 146/283 (52%), Gaps = 30/283 (11%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTK--PRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYAS  1082
             W+E+ G ++L P N +  PR ++HF+GG   GAAPQLTYR  LERL  +  L++ATPY  
Sbjct  53    WEELHGNYILRPPNEQQPPRALLHFLGGALLGAAPQLTYRYLLERLSSRGYLIVATPYEL  112

Query  1081  GFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYA-VQRSGNIL  905
              FDH    DE+  KF+R    L +    +P+ G+GHS G+++H+LI S +    R+ N L
Sbjct  113   SFDHLGTCDEIIDKFERVAPSLAKQYGPVPVVGVGHSCGALLHMLITSLFPDTPRAANAL  172

Query  904   MSFNNKEASVAIPLF------SPVLV----PMAQSIGPFLSQIATSPTVRLGAEMTLKQL  755
             +S+NN+    A+PLF      +P L+    P+ Q++  FL++         G    L Q 
Sbjct  173   ISYNNRGVGEAVPLFDELSLLNPSLLTIPTPLRQTLTNFLTEPTYGALTNAGVTQLLVQS  232

Query  754   GTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDD  575
               ++  I K +            ++  G  +FVP P+      +  Y   R LL++F+ D
Sbjct  233   LDITQQIPKLID-----------EVEAGARDFVPTPDAMSSAARRAYRCRRTLLLQFESD  281

Query  574   TIDETSVLAQLLSTDSAISSM------LDMSIRSLPGDHGLPL  464
              +D++  L   L    ++  M      +D+  + LPG+H  PL
Sbjct  282   NLDDSEQLEGYLKEAESVMKMKRPMITIDLKRQVLPGNHLTPL  324



>ref|WP_015125554.1| hypothetical protein [Synechococcus sp. PCC 6312]
 ref|YP_007062555.1| hypothetical protein Syn6312_2953 [Synechococcus sp. PCC 6312]
 gb|AFY62012.1| Protein of unknown function (DUF1350) [Synechococcus sp. PCC 
6312]
Length=265

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 138/270 (51%), Gaps = 55/270 (20%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E +GAW+L P  ++   ++HFVGG F  AAPQ+TYR  LE L + + +VIATP+ + 
Sbjct  2     EWQEHKGAWILIP--SRALGVIHFVGGAFVAAAPQVTYRRLLEFLAKHNYVVIATPFLNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET---VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
              DH  +A +   +F+  L ++++     + LP++G+GHS+G  +HLL+ S Y  +R+GNI
Sbjct  60    LDHTTLAAQALRQFNTGLEYIEQRNRLKRFLPVYGLGHSMGCKLHLLMTSLYGAERAGNI  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
              ++FNN  AS +IP    VL   ++++      ++T+                       
Sbjct  120   FLAFNNYSASQSIPFMESVL--KSENLRGLRESLSTT-----------------------  154

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P ET R+I   Y + RNLLI+F++D ID+T  L 
Sbjct  155   ---------------------EFSPSPRETERMIHEGYRVRRNLLIRFQNDDIDQTPRLI  193

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
             ++L           ++ + L G+H  PL Q
Sbjct  194   RILEQRPEFL----ITSKRLAGNHLTPLGQ  219



>ref|WP_013323275.1| hypothetical protein [Cyanothece sp. PCC 7822]
 ref|YP_003888457.1| hypothetical protein Cyan7822_3230 [Cyanothece sp. PCC 7822]
 gb|ADN15182.1| protein of unknown function DUF1350 [Cyanothece sp. PCC 7822]
Length=259

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 133/271 (49%), Gaps = 64/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E  G WVL P   +P  ++HF+GG F G AP  TYR  LE L +    +I TP+ + 
Sbjct  2     NWQEFSGNWVLIP--RQPVGVIHFLGGAFVGTAPNFTYRWLLENLGKAGYAIITTPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  +F+  L  LQ T     + LPI+G+GHS+G  +HLLIGS ++V+R+GN
Sbjct  60    LDHTAIARNVLNRFESILERLQATNVLGQRYLPIYGLGHSMGCKLHLLIGSLFSVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+S+NN               P+ ++I PF+ Q+    T +L                 
Sbjct  120   ILISYNN--------------YPIRRAI-PFIEQLQIDKTFQL-----------------  147

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                    F P PEET  LI   Y + RNLLI+F +D ID+T +L
Sbjct  148   ----------------------EFAPSPEETNVLIAKNYAVRRNLLIRFNNDDIDQTILL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
               +L  +     M  ++  +L G+H  PL Q
Sbjct  186   NPVL--EQRFPQM--VATLTLKGNHLTPLGQ  212



>ref|WP_011610702.1| hypothetical protein [Trichodesmium erythraeum]
 ref|YP_720784.1| hypothetical protein Tery_0912 [Trichodesmium erythraeum IMS101]
 gb|ABG50311.1| protein of unknown function DUF1350 [Trichodesmium erythraeum 
IMS101]
Length=256

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 134/273 (49%), Gaps = 66/273 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E  G WVL P  ++P+ I+HF+GG F   AP +TYR  LE L  +   VIATP+ + 
Sbjct  2     EWQENSGNWVLIP--SRPKAIIHFLGGAFVATAPHVTYRCLLEILANQGYAVIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA+ V   F+ CL  L  +     + LPI+GIGHS+G  +HLL+GS  ++ R+GN
Sbjct  60    LDHLAIANNVLSSFENCLNHLYTSEILRKKSLPIYGIGHSMGCKLHLLMGSLNSIARAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIP+               + QI++   V            T SP I 
Sbjct  120   ILISFNNFGARNAIPM---------------VEQISSVVKVEF----------TPSPKI-  153

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                           T  +I+  Y I RNLLIKF +D ID+T  L
Sbjct  154   ------------------------------TNSIIQKRYQIRRNLLIKFNNDNIDQTLRL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQAL  452
             + +L       SM  ++++ L G+H  PL Q L
Sbjct  184   SDILRLR--FPSM--VTVQRLNGNHLTPLGQDL  212



>ref|WP_011058307.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_683265.1| hypothetical protein tll2476 [Thermosynechococcus elongatus BP-1]
 dbj|BAC10027.1| tll2476 [Thermosynechococcus elongatus BP-1]
Length=258

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 127/273 (47%), Gaps = 68/273 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+EV G W+  P   +P   +HF+GG F  AAPQLTYR  LE L E +  +IATP+ + 
Sbjct  2     EWQEVRGNWLCIP--QRPLGWIHFLGGAFVAAAPQLTYRRLLEHLAEANYGIIATPFVNS  59

Query  1078  FDHFFIADEVQFKFDRCLRFL---QETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             FDH  IA +   K D  L +L   Q     LPI+G+GHS+G  +HLLI S Y   R+GN+
Sbjct  60    FDHGAIALDALNKLDYALDWLVHRQGYPPALPIYGLGHSMGCKLHLLINSLYDGDRAGNM  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
              M+FNN  AS +IP           ++GP   +   SPT                     
Sbjct  120   FMAFNNYPASQSIPWMD--------NLGPASVEFTPSPT---------------------  150

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                         ET   I+  Y + RNLLI+F+DD ID+T+ L 
Sbjct  151   ----------------------------ETEHFIQKRYPVRRNLLIRFQDDDIDQTARLR  182

Query  547   QLLSTDSAISSMLDM-SIRSLPGDHGLPLHQAL  452
              LL          DM +   LPG+H  PL Q L
Sbjct  183   SLLRAKFG-----DMVTALKLPGNHLTPLSQDL  210



>ref|WP_010475100.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=254

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/270 (36%), Positives = 133/270 (49%), Gaps = 65/270 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+    +L P   +P  ++HF+GG F   APQ TYR  LE L  +   VIATP+ + 
Sbjct  2     NWQEIANNLILIP--PQPIALIHFLGGAFVATAPQATYRRLLEGLANQGYAVIATPFLTS  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV---QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
              DH  IA+E   +F+  +  LQ T    Q LPI+GIGHS+G  +HLLIGS + V+R+GNI
Sbjct  60    VDHAGIAEEALHQFEDTVDRLQRTARLPQFLPIYGIGHSMGCKLHLLIGSLFEVKRAGNI  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             L+SFNN     AI        P A  I P +                         PI  
Sbjct  120   LISFNNAPIDKAI--------PFADLITPAV-------------------------PI--  144

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P +T RL++ +Y + RNLL+KF +DT+D+T  L+
Sbjct  145   ---------------------EFSPNPTQTNRLVERHYQVPRNLLVKFSNDTLDQTLRLS  183

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              LL  +     M+  SI+ L G+H  PL Q
Sbjct  184   GLL--EQRFPGMI--SIQRLAGNHLTPLGQ  209



>ref|XP_005648902.1| DUF1350-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24358.1| DUF1350-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=294

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 128/268 (48%), Gaps = 62/268 (23%)
 Frame = -2

Query  1249  EVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDH  1070
             +V G WV GP   +P+  VHF+GG FAGA+PQL Y L L+ L +    VI+TPYA  F H
Sbjct  38    QVAGCWVTGPSAGRPKATVHFLGGAFAGASPQLIYPLLLQTLAKAGYTVISTPYAVTFKH  97

Query  1069  FFIADEVQFKFDRCLRFLQETVQDL------PIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
                A  V  +F+ C+  L+ + Q         + G+GHS G+++H LIG+ +A   + N 
Sbjct  98    LDCARNVHDRFNGCVEALRGSGQGFLVPEERAVHGVGHSNGALLHALIGAMFAPANASNA  157

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             L+SFNNK+   AIPL          S+GP  + +                          
Sbjct  158   LISFNNKQVKDAIPL----------SLGPIQAAVG-------------------------  182

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                              +G   F+P P E+R L++S Y +   LL++F++D IDET  + 
Sbjct  183   -----------------DGNVEFIPTPAESRALVQSAYRVPYTLLVQFENDAIDETPEMT  225

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPL  464
             ++LS+ +   +    S   LPG H  P 
Sbjct  226   RILSSANPAGT----SSVVLPGTHITPC  249



>ref|WP_012164272.1| hypothetical protein [Acaryochloris marina]
 ref|YP_001518232.1| hypothetical protein AM1_3931 [Acaryochloris marina MBIC11017]
 gb|ABW28915.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=254

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/270 (36%), Positives = 133/270 (49%), Gaps = 65/270 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+    +L P   +P  ++HF+GG F   APQ TYR  LE L  +   VIATP+ + 
Sbjct  2     NWQEIANNSILIP--PQPIALIHFLGGAFVATAPQATYRRLLEGLANQGYAVIATPFLTS  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV---QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
              DH  IA+E   +F+  +  LQ T    Q LPI+GIGHS+G  +HLLIGS + V+R+GNI
Sbjct  60    VDHAGIAEEALHQFEDTVDRLQRTARLPQFLPIYGIGHSMGCKLHLLIGSLFEVKRAGNI  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             L+SFNN     AI        P A  I P +                         PI  
Sbjct  120   LISFNNAPIDKAI--------PFADLITPAV-------------------------PI--  144

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P +T RL++ +Y + RNLL+KF +DT+D+T  L+
Sbjct  145   ---------------------EFSPNPTQTNRLVERHYQVPRNLLVKFSNDTLDQTLRLS  183

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              LL  +     M+  SI+ L G+H  PL Q
Sbjct  184   GLL--EQRFPGMI--SIQRLAGNHLTPLGQ  209



>ref|WP_009631704.1| Protein of unknown function (DUF1350) [Synechocystis sp. PCC 
7509]
Length=255

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 133/271 (49%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WVL P    P  IVHF+GG F  AAPQ+TYR  LE++ ++  +V+ATP+ + 
Sbjct  2     NWQEISGNWVLIP--PHPVGIVHFLGGAFVAAAPQVTYRWLLEQVAKQGYIVVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   FDR +  L+       Q LPI+G+GHS+G  +HLL GS ++V+RSGN
Sbjct  60    LDHSAIAQSVLQSFDRTISELKYRSLLRQQYLPIYGLGHSMGCKLHLLAGSLFSVERSGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  AIP          Q + P               E T   L T      
Sbjct  120   ILISFNNYAARDAIPF--------VQQLNP-----------AFAVEFTPSPLET------  154

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                            +++  R N                 + RNLLIKF +DT+D+++ L
Sbjct  155   --------------NNIVQERYN-----------------VRRNLLIKFSNDTLDQSAAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              QLL       +M  ++ ++L G H  PL Q
Sbjct  184   TQLL--QKRFPNM--VTAQTLNGTHTTPLGQ  210



>ref|WP_015212862.1| protein of unknown function DUF1350 [Anabaena cylindrica]
 ref|YP_007155119.1| protein of unknown function DUF1350 [Anabaena cylindrica PCC 
7122]
 gb|AFZ56209.1| protein of unknown function DUF1350 [Anabaena cylindrica PCC 
7122]
Length=255

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 93/150 (62%), Gaps = 6/150 (4%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WV+ P N  P  I+HF+GG F   AP LTYR  LE L  K  +VIATP+ + 
Sbjct  2     DWKEIRGNWVIIPRN--PIGIIHFLGGAFVATAPHLTYRWLLEELAAKGYVVIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  KF+R L  LQ++ +     LP +G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHRAIAQSVLLKFERTLERLQDSGEIRKLYLPTYGVGHSMGCKLHLLIGSLFKVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGP  821
             IL+SFNN  A  AIPL   +   +A    P
Sbjct  120   ILISFNNYTAKEAIPLVEQLNSTLAIEFTP  149



>ref|WP_024125491.1| protein of unknown function DUF1350 [Thermosynechococcus sp. 
NK55a]
 ref|YP_008900619.1| protein of unknown function DUF1350 [Thermosynechococcus sp. 
NK55a]
 gb|AHB89106.1| protein of unknown function DUF1350 [Thermosynechococcus sp. 
NK55a]
Length=258

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 130/273 (48%), Gaps = 68/273 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+EV G W+  P   +P   +HF+GG F  AAPQLTYR  LE L E    +IATP+ + 
Sbjct  2     EWQEVRGNWLCIP--QRPLGWIHFLGGAFVAAAPQLTYRRLLEHLAEAGYGIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFL---QETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             FDH  IA +   K +  L +L   Q     LPI+G+GHS+G  +HLLI S Y   R+GN+
Sbjct  60    FDHGAIALDALNKLEYALDWLVYRQGYPPALPIYGLGHSMGCKLHLLINSLYDGDRAGNM  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
              ++FNN  AS +IP          +++ P            +G E T             
Sbjct  120   FIAFNNYPASQSIPWM--------ENLTP------------VGVEFT-------------  146

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                     P P ET +LI+  Y + RNLLI+F+DD ID+T+ L 
Sbjct  147   ------------------------PSPTETEQLIQERYPVRRNLLIRFQDDDIDQTARLR  182

Query  547   QLLSTDSAISSMLDM-SIRSLPGDHGLPLHQAL  452
              LL          DM +   LPG+H  PL Q L
Sbjct  183   SLLRAKFG-----DMVTALRLPGNHLTPLSQNL  210



>ref|WP_015201253.1| hypothetical protein [Crinalium epipsammum]
 ref|YP_007140619.1| hypothetical protein Cri9333_0109 [Crinalium epipsammum PCC 9333]
 gb|AFZ11109.1| protein of unknown function DUF1350 [Crinalium epipsammum PCC 
9333]
Length=256

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 125/271 (46%), Gaps = 66/271 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+EV G WV  P       IVHF+GG F   AP +TYRL LE L  K+  +IATP+ + 
Sbjct  2     EWQEVNGNWVYIPQYHTG--IVHFLGGAFVATAPHVTYRLLLEDLASKNYAIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA  V   FDR +  L+       + LPI+G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    FDHTAIAKSVHQSFDRTIEQLRAKSLLRRRYLPIYGVGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+SFNN  A  A+PL       + Q  G F  +   SP                     
Sbjct  120   ILISFNNFAARDAVPL-------VEQFSGAFTVEFTPSPL--------------------  152

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                          ET  LI   Y + RNL+IKF +D +D++  L
Sbjct  153   -----------------------------ETISLISQRYQVKRNLIIKFNNDNLDQSLAL  183

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              + L  D     M+   I  L G H  PL Q
Sbjct  184   RETL--DKRFPGMITSQI--LKGSHVTPLGQ  210



>ref|WP_017720207.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=256

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 94/144 (65%), Gaps = 9/144 (6%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+EV G WV  P   +P  IVHF+GG F   APQLTYR  LE+LV+    V+ATP+A+ 
Sbjct  2     DWQEVAGNWVFIP--PRPTGIVHFLGGAFVATAPQLTYRWLLEQLVQSGYAVVATPFANT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA    ++F++ L  LQ T     Q LP++G+GHS+G  +HLL GS + V+R+GN
Sbjct  60    LDHAEIARSTLWRFEQTLNRLQSTGRLNKQYLPVYGVGHSMGCKLHLLTGSLFDVERAGN  119

Query  910   ILMSFNNKEASVAIPL---FSPVL  848
             IL+SFNN  AS AIPL    SPV 
Sbjct  120   ILISFNNYPASRAIPLVEQLSPVF  143



>ref|WP_009626919.1| protein of unknown function DUF1350 [Pseudanabaena biceps]
 gb|ELS32945.1| protein of unknown function DUF1350 [Pseudanabaena biceps PCC 
7429]
Length=253

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 125/264 (47%), Gaps = 65/264 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WK++E  WVL P   KP+ ++HF+GG F  AAP + Y   LE+L + +  ++ATP+ + 
Sbjct  2     EWKQIEENWVLTP--QKPKGVIHFLGGAFFAAAPHVAYSRVLEQLAQNNYAIVATPFLNN  59

Query  1078  -FDHFFIADEVQ--FKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
              FDH  IA EV   F+  R   FL       P+FG+GHS+G  IHLLI S Y   R+GNI
Sbjct  60    TFDHRQIAREVHNSFRKARSKLFLDY----FPVFGMGHSMGCKIHLLINSLYKPTRAGNI  115

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
              +++NN  A  +IP F                                K L    P +  
Sbjct  116   YIAYNNYSADRSIPFF--------------------------------KNLANTIPEM--  141

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                   F P P+ET +++ + Y  ++NLL+KF DD IDE S LA
Sbjct  142   ------------------SSMEFTPSPKETEQIVTANYQTTQNLLVKFVDDDIDEISTLA  183

Query  547   QLLSTDSAISSMLDMSIRSLPGDH  476
             QLL      + +L    ++L G H
Sbjct  184   QLLQQKFPKTVLL----QTLEGTH  203



>ref|XP_006843834.1| hypothetical protein AMTR_s00007p00259840 [Amborella trichopoda]
 gb|ERN05509.1| hypothetical protein AMTR_s00007p00259840 [Amborella trichopoda]
Length=371

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 149/311 (48%), Gaps = 25/311 (8%)
 Frame = -2

Query  1324  RDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGPIN-TKPRLIVHFVGGIFAGAAPQLT  1148
             +++ +     V  +       K ++ +    V+ P N  KP+ I+ F+GG F GA P++T
Sbjct  19    KNMRKTFISNVYNADREIYNEKGYRRLGQCLVISPSNGRKPQAIIKFLGGAFIGAIPEVT  78

Query  1147  YRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLR-----------FLQETVQ  1001
             Y   ++ L ++  L+IA PY   FDH   A EV  KF+ C+             L + + 
Sbjct  79    YSHLIDLLAKEGFLIIAVPYNVTFDHEEAAKEVYDKFNACMDMLLSSGLSHAGLLVDDIL  138

Query  1000  DLPIFGIGHSLGSVIHLLIGSRYAVQ-RSGNILMSFNNKEASVAIPLFSPVLVPMAQSIG  824
              LP++ +GHS G+++ LL GS +  +    N ++SFNNKEAS A+P F   L P+A  + 
Sbjct  139   QLPVYSVGHSNGALLQLLAGSYFGEKIPKANAIISFNNKEASEAVPYFEQ-LGPVATQLA  197

Query  823   PFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLI--------NGR  668
             P L         R  ++   K +  ++ P+++Q           ++D +         G 
Sbjct  198   PILEASPVYAMARNTSDNAFKTVLDVAGPMLQQFDQEAIGSVTKFIDQLPSVMSQVNQGV  257

Query  667   ENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTD-SAISSMLDMSIRS  491
               F P P E R  IK  Y + R LL+KF  D IDET V+ ++L    +AI   L+    +
Sbjct  258   SEFKPTPLENRDFIKCSYNVRRTLLVKFNFDAIDETDVIEEILKPRIAAIGGKLEKV--T  315

Query  490   LPGDHGLPLHQ  458
             L G H  P  Q
Sbjct  316   LNGIHITPCAQ  326



>emb|CDN15478.1| Alpha/beta superfamily hydrolase [Richelia intracellularis]
Length=263

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 88/135 (65%), Gaps = 6/135 (4%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+E+ G WV+ P N  P  I+HF+GG F G+AP +TYRL LE L  K  +VIAT + +  
Sbjct  6     WQEISGNWVVVPRN--PIGIIHFLGGAFVGSAPHITYRLLLEYLAAKGFIVIATSFFNTL  63

Query  1075  DHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             DH   A +V   FDR L  L+E        LPI+GIGHS+G  +HLLIGS Y V R+GNI
Sbjct  64    DHIASAKQVLLNFDRALLRLEEKSALGNAYLPIYGIGHSMGCKLHLLIGSLYPVTRAGNI  123

Query  907   LMSFNNKEASVAIPL  863
             L+SFNN  AS AIPL
Sbjct  124   LISFNNYAASDAIPL  138



>ref|WP_037223030.1| hypothetical protein [Richelia intracellularis]
Length=260

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 88/135 (65%), Gaps = 6/135 (4%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+E+ G WV+ P N  P  I+HF+GG F G+AP +TYRL LE L  K  +VIAT + +  
Sbjct  3     WQEISGNWVVVPRN--PIGIIHFLGGAFVGSAPHITYRLLLEYLAAKGFIVIATSFFNTL  60

Query  1075  DHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             DH   A +V   FDR L  L+E        LPI+GIGHS+G  +HLLIGS Y V R+GNI
Sbjct  61    DHIASAKQVLLNFDRALLRLEEKSALGNAYLPIYGIGHSMGCKLHLLIGSLYPVTRAGNI  120

Query  907   LMSFNNKEASVAIPL  863
             L+SFNN  AS AIPL
Sbjct  121   LISFNNYAASDAIPL  135



>ref|WP_006527615.1| Protein of unknown function (DUF1350) [Gloeocapsa sp. PCC 73106]
 gb|ELR99556.1| Protein of unknown function (DUF1350) [Gloeocapsa sp. PCC 73106]
Length=258

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/327 (31%), Positives = 150/327 (46%), Gaps = 80/327 (24%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW+E+ G+WV  P   +P  I+HF+GG F  +APQLTYR  L  + +    ++ATP+ + 
Sbjct  2     DWQEISGSWVWLP--QQPIGIIHFLGGAFVASAPQLTYRWLLTEIGKAGYAIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQET----VQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
             FDH  IA  V  +F+  +  LQ         LPI+G+GHS+G  +HLLIGS +++ R+GN
Sbjct  60    FDHLTIARSVLNRFETIVAQLQSKKLLPQGYLPIYGVGHSMGCKLHLLIGSLFSIDRAGN  119

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+S+NN  A  AIPL                         +L    TL    T SP   
Sbjct  120   ILISYNNFPARRAIPLVE-----------------------QLDVNQTLNFEFTPSP---  153

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                                         +ET  L+ + Y + RNLLI+F +D ID++  L
Sbjct  154   ----------------------------QETNELVLNNYLVRRNLLIRFNNDDIDQSLNL  185

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDVPPAMTDAVNKSGELLANLAAGTPW  371
               LL    A   ++ + I  LPG+H  PL Q          +   ++GE        TP 
Sbjct  186   NPLLQQRFA--QLICLLI--LPGNHLTPLGQ----------EITWQTGEFF------TPL  225

Query  370   ETFAKEVGNTFGVESNILRAEVSKELD  290
             + F +        +S  L+ E+ + L+
Sbjct  226   DAFGQWFKQGLSQDSYRLKQEILRWLN  252



>ref|WP_011242836.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_171234.1| hypothetical protein syc0524_d [Synechococcus elongatus PCC 6301]
 ref|YP_400039.1| hypothetical protein Synpcc7942_1022 [Synechococcus elongatus 
PCC 7942]
 dbj|BAD78714.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB57052.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD58428.1| hypothetical protein M744_11575 [Synechococcus sp. UTEX 2973]
Length=262

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 131/274 (48%), Gaps = 67/274 (24%)
 Frame = -2

Query  1255  WKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGF  1076
             W+ +    VL P    P+ IVHF+GG F  AAPQ+TYR  LE L ++   VIATP+ + F
Sbjct  6     WQTIYNNAVLLP--ESPKAIVHFLGGAFIAAAPQVTYRRLLEGLGDRGFAVIATPFINTF  63

Query  1075  DHFFIADEV----QFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             DH  +ADEV    +  ++R L  L     +LPIFG+GHS+GS +HLL+G      R GN+
Sbjct  64    DHTTLADEVGRSYRLAYERLLA-LGLISPELPIFGVGHSMGSKLHLLMGCAQTSDRRGNV  122

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             L++FNN  A  +IPL                                   LG L+P    
Sbjct  123   LLAFNNYSARRSIPL-----------------------------------LGQLAPA---  144

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDET-SVL  551
                             ++    F P P  T RLI+  Y ++ NLL+KF++D ID+T  ++
Sbjct  145   ----------------LDVTVEFSPSPARTLRLIRDRYSVANNLLVKFRNDEIDQTRDLI  188

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALP  449
               L       S  L +S     G+H  P+ Q+LP
Sbjct  189   GALRDRFPETSEWLRLS-----GNHLTPVGQSLP  217



>ref|WP_017315207.1| hypothetical protein [Mastigocladopsis repens]
Length=254

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 88/136 (65%), Gaps = 6/136 (4%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P N  P  I+HF+GG F   AP LTYR  LE+L  K   +IATP+ + 
Sbjct  2     DWKEISGNWVLVPRN--PIGIIHFLGGAFVATAPHLTYRWLLEQLASKGYAIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQE--TVQ--DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   F+R L  L +  T++   LPI+GIGHS+G  +HLLIGS   V+R+GN
Sbjct  60    LDHNAIAKSVLLNFERALERLYDGSTIRKRSLPIYGIGHSMGCKLHLLIGSLLPVERAGN  119

Query  910   ILMSFNNKEASVAIPL  863
             IL+SFNN  A  AIPL
Sbjct  120   ILISFNNYGARDAIPL  135


 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = -2

Query  661  FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
            F P P ET +L++  Y + RNLL+KF +DT+D++  L +LL        M  +++++L G
Sbjct  146  FTPSPLETNKLVQERYNVRRNLLLKFTNDTLDQSVALTELLK--QRFPEM--VTVQTLNG  201

Query  481  DHGLPLHQ  458
             H  PL Q
Sbjct  202  THTTPLGQ  209



>ref|WP_015137318.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007074459.1| hypothetical protein Nos7524_0964 [Nostoc sp. PCC 7524]
 gb|AFY46862.1| Protein of unknown function (DUF1350) [Nostoc sp. PCC 7524]
Length=255

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 87/136 (64%), Gaps = 6/136 (4%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DWKE+ G WVL P N  P  I+HF+GG F   AP +TYR  LE++  K  ++IATP+ + 
Sbjct  2     DWKEIRGNWVLIPPN--PVGIIHFLGGAFVATAPHITYRWLLEQVAAKGYVIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   FDR +  L ++       LP +G+GHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHIAIAQSVLLNFDRTIERLHDSGALRKLYLPTYGLGHSMGCKLHLLIGSLFPVERAGN  119

Query  910   ILMSFNNKEASVAIPL  863
             IL+SFNN  A  AIPL
Sbjct  120   ILISFNNYAAKDAIPL  135


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 4/68 (6%)
 Frame = -2

Query  661  FVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPG  482
            F P P ET +L++  Y I RNLLIKF +D +D+++ L ++L   +    M+   I  LPG
Sbjct  147  FTPSPLETNKLVQERYNIRRNLLIKFNNDNLDQSAALTKIL--QARFPEMVTAQI--LPG  202

Query  481  DHGLPLHQ  458
             H  PL Q
Sbjct  203  THTTPLGQ  210



>ref|WP_019502873.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=255

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 85/261 (33%), Positives = 129/261 (49%), Gaps = 60/261 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WK+VE  WVL P  ++P+ +VHF+GG F  AAPQ++Y   LE+L     +++ATP+ + 
Sbjct  2     EWKQVEQNWVLTP--SQPKGVVHFLGGAFFAAAPQISYSRLLEKLASHGYVIVATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMS  899
             FDH  IA +V   F +    L   +   PIFG+GHS+G  +HLLI S +   RSGNI ++
Sbjct  60    FDHRQIAVDVHRSFQQARSKL--FLDYFPIFGLGHSMGCKLHLLINSLFQSDRSGNIFIA  117

Query  898   FNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvl  719
             +NN  A  +I               PF  ++A+          T+ ++ T+         
Sbjct  118   YNNYSADRSI---------------PFFKELAS----------TIPEMSTM---------  143

Query  718   plveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLL  539
                                F P P+ T  +I+  Y I  NLLI+F +D IDE   L++LL
Sbjct  144   ------------------EFEPSPQATLEIIERGYQIPHNLLIRFFNDDIDEIPALSKLL  185

Query  538   STDSAISSMLDMSIRSLPGDH  476
             +     S    +  ++LPG H
Sbjct  186   TRKFPSS----VKTQTLPGTH  202



>ref|XP_001772200.1| predicted protein [Physcomitrella patens]
 gb|EDQ63013.1| predicted protein [Physcomitrella patens]
Length=340

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/275 (32%), Positives = 136/275 (49%), Gaps = 30/275 (11%)
 Frame = -2

Query  1216  NTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKF  1037
             N + + ++HF+GG F GAAP + Y + +E L ++  L++ATP++  FDH   A  +  +F
Sbjct  39    NGRTKGVIHFIGGAFIGAAPDVIYSVLIELLAKEGYLIVATPFSLSFDHTVSAQGIHTRF  98

Query  1036  DRCLRFLQET---------VQDLPIFGIGHSLGSVIHLLIGSRYAVQR--SGNILMSFNN  890
             + CL +L  T         +  LP++ +GHSLG+++ ++IGS  +  R    + L+SFNN
Sbjct  99    NTCLDYLSNTGFAGLSAGDISTLPVYSVGHSLGALMQVVIGSTCSGGRLPKASALISFNN  158

Query  889   KEASVAIPLFSPVLVPMAQSIGPFLSQIA----TSPTVRLGAEMTLKQLGTLSPPIMKqv  722
             K AS A+P F          +GP L+Q+A    +SP        +   L  +    +   
Sbjct  159   KPASDAVPFF--------DQMGPTLAQVAPIVESSPATEFARAFSCTCLFVIVYYCLLLS  210

Query  721   lplveqlppLYMDLIN-GRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQ  545
                     P   D ++ G   F P P + R      Y +  NLL+KF  D IDET VL +
Sbjct  211   FRQFLDQIPAVFDQVSQGVSEFTPTPAQNRAAASLSYAVPNNLLVKFTQDAIDETDVLEE  270

Query  544   LLSTDS-AISSMLDMSIRSLPGDHGLPLHQALPDV  443
             +L   S A+   L   +  L G+H  P+    PDV
Sbjct  271   ILGPRSEALGGKLTKVV--LTGNHLTPVA---PDV  300



>ref|WP_015186847.1| protein of unknown function DUF1350 [Gloeocapsa sp. PCC 7428]
 ref|YP_007126130.1| protein of unknown function DUF1350 [Gloeocapsa sp. PCC 7428]
 gb|AFZ28970.1| protein of unknown function DUF1350 [Gloeocapsa sp. PCC 7428]
Length=260

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 127/271 (47%), Gaps = 67/271 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +WKE+ G WVL P    P  IVHF+GG F   APQLTYR  LE+L  K+  V+ATP+ + 
Sbjct  2     EWKEIAGNWVLVP--RHPVGIVHFLGGAFVATAPQLTYRWLLEQL-GKEYAVVATPFVNT  58

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV----QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V   FD  +  L +      + LP +G+GHS+G  +HLLIGS + V+R+GN
Sbjct  59    LDHAAIAQTVLNSFDNAIAELHDRALLRRRYLPTYGLGHSMGCKLHLLIGSLFDVERAGN  118

Query  910   ILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIM  731
             IL+S+NN  A  AIPL        A    P  S + T+  VR                  
Sbjct  119   ILISYNNYAARDAIPLVQQFTPTFAVEFTP--SPVETTNLVR------------------  158

Query  730   KqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVL  551
                            D    R N                     LLI+F +DTID+++ L
Sbjct  159   ---------------DRYRVRRN---------------------LLIRFTNDTIDQSTAL  182

Query  550   AQLLSTDSAISSMLDMSIRSLPGDHGLPLHQ  458
              QLL        M  +++++LPG H  PL Q
Sbjct  183   HQLLQ--QRFPEM--VTLQTLPGSHTTPLGQ  209



>ref|WP_039203247.1| hypothetical protein [Aphanizomenon flos-aquae]
 gb|KHG39207.1| hypothetical protein OA07_25005 [Aphanizomenon flos-aquae 2012/KM/D3]
 gb|KHG40245.1| hypothetical protein OA07_18700 [Aphanizomenon flos-aquae 2012/KM/D3]
Length=253

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 89/136 (65%), Gaps = 6/136 (4%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+ G WVL P N  P  I+HF+GG F    P LTYR  LE L ++  ++IATP+ + 
Sbjct  2     NWQEIRGNWVLIPRN--PIGIIHFLGGAFVATLPHLTYRWLLENLADQGYVIIATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQ----DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  IA  V  KF+  L  LQ++ +     LP +G+GHS+G  +HLLIGS + +QR+GN
Sbjct  60    LDHIAIAKSVLRKFEYTLEKLQDSGKLRKLYLPTYGVGHSMGCKLHLLIGSLFPIQRAGN  119

Query  910   ILMSFNNKEASVAIPL  863
             IL+SFNN  AS AIPL
Sbjct  120   ILISFNNFAASEAIPL  135



>ref|WP_036535177.1| hypothetical protein [Neosynechococcus sphagnicola]
 gb|KGF71959.1| hypothetical protein DO97_13675 [Neosynechococcus sphagnicola 
sy1]
Length=254

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 134/275 (49%), Gaps = 68/275 (25%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+E+   WV  P   +P  +VHF+GG F  AAPQ+TY   LE L  +  +++ATP+ + 
Sbjct  2     EWQEISNNWVWVP--PRPIGVVHFLGGAFVAAAPQVTYCRLLESLGRQGYVIVATPFVNT  59

Query  1078  FDHFFIADEVQFKFDRCLRFLQETV---QDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNI  908
             FDH  IAD+V  +F+  L  LQ TV   +  PI+G+GHS+G  +HLL+GS +A++R+GNI
Sbjct  60    FDHQAIADDVLNRFESTLERLQATVLRRKFFPIYGVGHSMGCKLHLLLGSLFAIERAGNI  119

Query  907   LMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMK  728
             L+SFNN  A  +IPL   ++  +     P     + + T RL A+               
Sbjct  120   LISFNNYSARNSIPLAETLVTALDMEFTP-----SPAATNRLVAQRY-------------  161

Query  727   qvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLA  548
                                         + RR          NLLI+F  D +D+T  L 
Sbjct  162   ----------------------------QVRR----------NLLIQFTKDELDQTKGLQ  183

Query  547   QLLSTDSAISSMLDMSIRSLPGDHGLPLHQALPDV  443
              LL  +     M  +  ++LPG+H  PL    PDV
Sbjct  184   TLL--NDRFPGM--VVTQTLPGNHLTPLG---PDV  211



>ref|XP_010520502.1| PREDICTED: uncharacterized protein LOC104799597 isoform X1 [Tarenaya 
hassleriana]
Length=398

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 137/270 (51%), Gaps = 22/270 (8%)
 Frame = -2

Query  1285  SQDAWGTSKDWKEVEGAWVLGPINTK-PRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDI  1109
             S+   G+ K +  ++   V+ P   K PR +V F+GG F GAAP++TY    E L ++  
Sbjct  60    SRGKRGSDKMYTRLDSCLVIPPPRYKEPRAVVKFLGGAFVGAAPEVTYSYLKELLAKEGY  119

Query  1108  LVIATPYASGFDHFFIADEVQFKFDRCLRFL-----------QETVQDLPIFGIGHSLGS  962
             ++I+ PY   FDH   A +V  +F+ CL  +            E + DLP+F +GHS G+
Sbjct  120   VIISVPYNVTFDHERAAKQVYERFNSCLDMMLSSGIPNADLRPEDLADLPLFSVGHSNGA  179

Query  961   VIHLLIGSRYAVQ-RSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVR  785
             ++ +L GS ++ +    N+++SFNN+ A+ A+P F   L P+ + I P +         +
Sbjct  180   LLQVLTGSYFSEKIPKANVIVSFNNRSATEAVPYFEQ-LGPLVRQIIPLVEATPVYAMAQ  238

Query  784   LGAEMTLKQ-LGTLSPPIMKqvlplveqlp-------pLYMDLINGRENFVPRPEETRRL  629
               +   LK  L T +  I+      V  L         ++ ++  G   F P+P E R  
Sbjct  239   SASGDALKGLLETAAATILNNDQEAVTSLTKLVDQLPSVFGEVAQGVSEFRPKPPENRDF  298

Query  628   IKSYYGISRNLLIKFKDDTIDETSVLAQLL  539
              KS Y +   LL+KFK DTIDE+ +L + L
Sbjct  299   CKSSYNVQHTLLVKFKSDTIDESDLLEETL  328



>ref|XP_005832598.1| hypothetical protein GUITHDRAFT_108494 [Guillardia theta CCMP2712]
 gb|EKX45618.1| hypothetical protein GUITHDRAFT_108494 [Guillardia theta CCMP2712]
Length=427

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/280 (33%), Positives = 141/280 (50%), Gaps = 46/280 (16%)
 Frame = -2

Query  1198  IVHFVGGIFAGAAPQLTYRLFLERLVEKD-ILVIATPYA--SGFDHFFIADEVQFKFDRC  1028
             IVHF+GG+F GAAP+  Y LF+E +V ++ ++VIATP A  +G DH+  A E  +KF   
Sbjct  87    IVHFIGGVFVGAAPKQAYSLFVEEMVSQERMIVIATPCAGLTGMDHYKAAFEAAYKFAGA  146

Query  1027  LRFLQETV-------QDLPIFGIGHSLGSVIHLLIGSRYAVQ------RSGNILMSFNNK  887
              + LQ  +        +LP  G+GHSLG  +HLLI S    +      R+ N+ ++FNN 
Sbjct  147   AKALQGELGSDMFDPAELPTIGMGHSLGCKVHLLINSIEDTKKIIGRVRAANVHIAFNNY  206

Query  886   EASVAIPLFSPV-------------LVPMAQSIGPFLSQIATSPTVR--LGAEMTLKQLG  752
             +A  +IP+ S +               P+ +SI  F + + T+  ++   G+E   K   
Sbjct  207   DAKKSIPILSELSKLQSEMSKGLAAAAPVLESISAFANSMKTNSQLKDVFGSESASKVFS  266

Query  751   TLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDT  572
              +   ++ +            +D       F P PE+T RL+K  Y +SRNL +KF  D 
Sbjct  267   FIE--MLSETGKNYAANNQEPLD------EFSPSPEDTMRLLKDEYSVSRNLAVKFLSDD  318

Query  571   IDETSVLAQLL-----STDSAISSMLDMSIRSLPGDHGLP  467
             ID++ +L + L     S  + I   LD+  + LPG H  P
Sbjct  319   IDQSILLCEALRDKFTSPTTGIGGRLDL--KRLPGTHITP  356



>ref|WP_015163841.1| hypothetical protein [Pseudanabaena sp. PCC 7367]
 ref|YP_007101295.1| hypothetical protein Pse7367_0562 [Pseudanabaena sp. PCC 7367]
 gb|AFY68867.1| protein of unknown function DUF1350 [Pseudanabaena sp. PCC 7367]
Length=265

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/262 (31%), Positives = 121/262 (46%), Gaps = 61/262 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W +VE  WVL P   KP+ ++HF+GG F  AAP + YR  LE+L     +++ATP+A+ 
Sbjct  2     EWLQVEQNWVLTP--PKPKGVIHFLGGAFFAAAPHIAYRRLLEKLASYGYVIVATPFANN  59

Query  1078  -FDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILM  902
              FDH  IA E    F +    L   +   P++G+GHS+G  +HLL+   Y   R+GN+ +
Sbjct  60    TFDHGQIAAETYKTFQKARSKL--FLDYFPVYGLGHSMGCKVHLLLNCYYNCDRTGNMFI  117

Query  901   SFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqv  722
             ++NN  A  ++P F  + V                 T+   AEM                
Sbjct  118   AYNNYSAKRSVPFFKELAV-----------------TIPEMAEM----------------  144

Query  721   lplveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQL  542
                                 F P PE TR L+   Y    NLL++F DD+IDE +     
Sbjct  145   -------------------EFYPSPEATRDLVDRQYKTRHNLLVRFFDDSIDEITD----  181

Query  541   LSTDSAISSMLDMSIRSLPGDH  476
             LST   +     + +++LPG H
Sbjct  182   LSTQLKLKFPETVKVQALPGTH  203



>ref|XP_010098402.1| hypothetical protein L484_018635 [Morus notabilis]
 gb|EXB74926.1| hypothetical protein L484_018635 [Morus notabilis]
Length=412

 Score =   132 bits (331),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 121/249 (49%), Gaps = 23/249 (9%)
 Frame = -2

Query  1222  PINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQF  1043
             P  TKPR +V F+GG F GAAP+LTY   +E L ++  LVI+ PY   FDH   A +V  
Sbjct  96    PTGTKPRAVVKFLGGAFIGAAPELTYSYVIELLAKEGFLVISVPYNVTFDHADAAKQVYE  155

Query  1042  KFDRCL-----------RFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQR--SGNILM  902
             +F+ CL                 + DLP+F +GHS G+++ +L GS Y  +R    N+++
Sbjct  156   RFNACLDSVLASGLPQANLTPAQLSDLPLFSVGHSNGALLQVLTGS-YFCERIPKANVII  214

Query  901   SFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqv  722
             S+NN+ A+ A+P F   L P+ + I P +         R  +    K L   +  I+   
Sbjct  215   SYNNRPATEAVPYFEQ-LGPLVRQIMPVVEASPVYSMARSASGDAWKVLIDAAGAIIPNN  273

Query  721   lplveqlppLYMD--------LINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTID  566
                       ++D        +  G   F P P E R   K+ Y I   LL+KF  DTID
Sbjct  274   DQETLISVTKFVDQLPSVFNEVTQGISEFKPTPSENRDRCKNSYNIKHTLLVKFSFDTID  333

Query  565   ETSVLAQLL  539
             ET +L + L
Sbjct  334   ETDLLEETL  342



>ref|WP_015229102.1| hypothetical protein [Dactylococcopsis salina]
 ref|YP_007171455.1| hypothetical protein Dacsa_1406 [Dactylococcopsis salina PCC 
8305]
 gb|AFZ50098.1| Protein of unknown function (DUF1350) [Dactylococcopsis salina 
PCC 8305]
Length=254

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 129/267 (48%), Gaps = 62/267 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+EV G  VL P  ++P+ ++HF+GG F   APQ+TY   LE L  +   +IATP+ + 
Sbjct  3     NWEEVAGNSVLLP--SQPKALIHFLGGAFVATAPQVTYSWLLEALAAEGYGIIATPFIND  60

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMS  899
              +H  IA     +F+   + L    + LPI+G+GHS+G  +HLLI S Y V RSGN+L+S
Sbjct  61    LNHSAIAQRALNRFETAYQRLGLFRRYLPIYGLGHSMGCKLHLLINSLYDVNRSGNLLIS  120

Query  898   FNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvl  719
             +NN  A  A+P                                 ++QL +L         
Sbjct  121   YNNYPARQAVPF--------------------------------VEQLNSLVE-------  141

Query  718   plveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLL  539
                        DL      F P PE T  L+++ Y  +R LLI+F++DTID+T  L  +L
Sbjct  142   ----------FDL-----EFTPSPERTYDLVRNDYKKTRTLLIRFQNDTIDQTQELKPIL  186

Query  538   ST-DSAISSMLDMSIRSLPGDHGLPLH  461
                   + S L +S     G+H  P++
Sbjct  187   EERHPHLVSYLQLS-----GNHLTPVN  208



>gb|EJK72521.1| hypothetical protein THAOC_05941, partial [Thalassiosira oceanica]
Length=318

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 86/145 (59%), Gaps = 3/145 (2%)
 Frame = -2

Query  1264  SKDWKEVEGAWVLGPINTK--PRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATP  1091
             S  W+E+ G ++L P  T   PR ++HF+GG   GAAPQ TYR  LERL  +  LV+ATP
Sbjct  128   SGRWEELHGNYILRPPETAGAPRALIHFLGGALLGAAPQSTYRYLLERLSSRGYLVVATP  187

Query  1090  YASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYA-VQRSG  914
             Y   FDH    DEV   F+R    L      +P+ G+GHS G+++H+LI S +    R+ 
Sbjct  188   YQLSFDHLATCDEVIDAFERVAPSLARQYGAVPVVGVGHSCGALLHMLITSLFPDTPRAA  247

Query  913   NILMSFNNKEASVAIPLFSPVLVPM  839
             N L+S+NN+    A+P F  + VP+
Sbjct  248   NALISYNNRGVGEAVPFFDELFVPL  272



>ref|WP_015227540.1| hypothetical protein [Halothece sp. PCC 7418]
 ref|YP_007169882.1| hypothetical protein PCC7418_3558 [Halothece sp. PCC 7418]
 gb|AFZ45668.1| protein of unknown function DUF1350 [Halothece sp. PCC 7418]
Length=254

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/266 (32%), Positives = 130/266 (49%), Gaps = 60/266 (23%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             +W+EV G  VL P   +P+ ++HF+GG F    PQ+TY   LE L E+   VIATP+ + 
Sbjct  3     NWEEVAGNSVLLP--PQPKGLIHFLGGAFVATVPQVTYSWLLESLAEEGYGVIATPFLND  60

Query  1078  FDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIGSRYAVQRSGNILMS  899
              +H  IA     +F+   + L    + LPI+GIGHS+G  +HLLI S Y V+R+GN+L+S
Sbjct  61    LNHSAIAQRALNRFETAYQRLGLFQRYLPIYGIGHSMGCKLHLLINSLYEVKRAGNLLIS  120

Query  898   FNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvl  719
             +NN  A  A+P                                 ++QL  L+        
Sbjct  121   YNNYPAREAVPF--------------------------------VEQLNHLAA-------  141

Query  718   plveqlppLYMDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLL  539
                        DL      F P PE T  ++++ Y  +R LL++F++DTID+T  L  +L
Sbjct  142   ----------FDL-----EFTPSPERTFDIVQNNYQKTRTLLVRFQNDTIDQTEDLKPIL  186

Query  538   STDSAISSMLDMSIRSLPGDHGLPLH  461
               +    S+  +S   L G+H  P++
Sbjct  187   --EQRFPSL--VSYLQLSGNHLTPVN  208



>ref|XP_011082162.1| PREDICTED: uncharacterized protein LOC105164990 isoform X2 [Sesamum 
indicum]
Length=448

 Score =   128 bits (322),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 98/351 (28%), Positives = 159/351 (45%), Gaps = 47/351 (13%)
 Frame = -2

Query  1291  KQSQDAWGTSKDWKEVEGAWVLGPIN-TKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEK  1115
             K     +   K ++ ++   V+ P    KP+ ++ F+GG F GA P++TY   LE L ++
Sbjct  109   KPRGSGYSNGKMYRRLDSCLVIPPTEGKKPKALIKFLGGAFIGAVPEVTYSYLLELLAKE  168

Query  1114  DILVIATPYASGFDHFFIADEVQFKFDRCLRFL-----------QETVQDLPIFGIGHSL  968
               L+I+ PY   FDH  +  E+  +F  CL  +              + DLP F IGHS 
Sbjct  169   GYLIISVPYNVTFDHELVTREIYERFHACLDLILMNGLPENGISAAEIADLPFFSIGHSN  228

Query  967   GSVIHLLIGSRYAVQ-RSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQ----IA  803
             G+++ +L+GS +  +    N ++S+NN+ AS A+P F        + +GP + Q    I 
Sbjct  229   GALLQVLVGSYFCEKIPKANAIISYNNRPASEAVPYF--------EQLGPLVKQMMPVIE  280

Query  802   TSPTVRLGAEMT--LKQLGTLSPPIMKqvlplveqlppLYMD--------LINGRENFVP  653
             TSP   +   +   LK L  ++  ++    P        ++D        +  G   F P
Sbjct  281   TSPMYSMAQSIPDGLKTLIDIAERVLPDYDPEATVSLTKFVDQLPSVFNQVAQGISEFKP  340

Query  652   RPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLS--TDSAISSMLDMSIRSLPGD  479
              P E     K  Y I   LL+KF  DTIDET +L + L    +S    +  + +R   G+
Sbjct  341   TPAENLDCFKKLYNIQHTLLVKFDFDTIDETDLLEETLKPRVESFCGKLEKVVLR---GN  397

Query  478   HGLP-LHQALPDVPPAMTDAVNKSGELLANLAAGTPWET--FAKEVGNTFG  335
             H  P + +    V P  T A      +   L A + +ET   ++ + N FG
Sbjct  398   HITPCIQEPRWQVGPVYTPA----DAIAQGLKAISLYETRVLSRTICNWFG  444



>ref|XP_005538618.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM82582.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=417

 Score =   127 bits (320),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 168/361 (47%), Gaps = 49/361 (14%)
 Frame = -2

Query  1435  QLFIRNSNSGR-CKRIKVGS-----------FNDNSTSNQPERSGIQLYRD--IERLLTD  1298
              LF R+S + R C ++  GS             D S  N P   G + Y    I R    
Sbjct  21    HLFCRSSANRRVCGKLFTGSQCPRAPRYFLVHTDKSAGNTPSTRGWEEYAGNFIFRPPHV  80

Query  1297  TVKQSQ-DAWGTSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLV  1121
              V+ SQ  A+GT              P+   P+ +VHF+GG F GAAPQ+ YR FLE+L 
Sbjct  81    IVRPSQRTAYGTGNG----------TPL--PPKALVHFLGGAFVGAAPQVAYRWFLEQLA  128

Query  1120  EKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPIFGIGHSLGSVIHLLIG  941
              +  +V+ATPY   FDH +  D+V  +F      L      +P+ GIGHSLG+++H L G
Sbjct  129   LEGFVVVATPYRLSFDHLWTMDDVLTRFSAAAGMLALDYGPIPVVGIGHSLGALLHTLGG  188

Query  940   SRYAVQ---RSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEM  770
             S +      ++ N+L++FNN+ A  AIPLF   + P+ +++            + +    
Sbjct  189   SLFCNADGYKAANVLIAFNNRRAEDAIPLFREFIAPVVKTVAQTGELSDVIERLVIDGPA  248

Query  769   TLKQL-----GTLSP--------PIMKqvlplveqlppLYMDLINGRENFVPRPEETRRL  629
             T   L       + P         +++Q   L +Q+PPL+ ++ +G   F P P E    
Sbjct  249   TFDTLFDTVTDVVFPGSRDSELFALVRQSRALAQQIPPLFAEVADGAFAFNPDPIEVMEA  308

Query  628   IKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSAISSMLDMSIRSLPGDHGLPLHQALP  449
             I++ Y + + L++ FK+D +D++  L + L  +         ++  L G H  P  Q   
Sbjct  309   IRTLYKVRQTLIVSFKNDILDDSRSLQKALDPERG------ATVIRLGGTHLTPCAQDFL  362

Query  448   D  446
             D
Sbjct  363   D  363



>ref|XP_011082159.1| PREDICTED: uncharacterized protein LOC105164990 isoform X1 [Sesamum 
indicum]
 ref|XP_011082160.1| PREDICTED: uncharacterized protein LOC105164990 isoform X1 [Sesamum 
indicum]
 ref|XP_011082161.1| PREDICTED: uncharacterized protein LOC105164990 isoform X1 [Sesamum 
indicum]
Length=449

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 98/352 (28%), Positives = 159/352 (45%), Gaps = 48/352 (14%)
 Frame = -2

Query  1291  KQSQDAWGTSKDWKEVEGAWVLGPIN-TKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEK  1115
             K     +   K ++ ++   V+ P    KP+ ++ F+GG F GA P++TY   LE L ++
Sbjct  109   KPRGSGYSNGKMYRRLDSCLVIPPTEGKKPKALIKFLGGAFIGAVPEVTYSYLLELLAKE  168

Query  1114  DILVIATPYASGFDHFFIADEVQFKFDRCLRFL-----------QETVQDLPIFGIGHSL  968
               L+I+ PY   FDH  +  E+  +F  CL  +              + DLP F IGHS 
Sbjct  169   GYLIISVPYNVTFDHELVTREIYERFHACLDLILMNGLPENGISAAEIADLPFFSIGHSN  228

Query  967   GSVIHLLIGSRYAVQ-RSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQ----IA  803
             G+++ +L+GS +  +    N ++S+NN+ AS A+P F        + +GP + Q    I 
Sbjct  229   GALLQVLVGSYFCEKIPKANAIISYNNRPASEAVPYF--------EQLGPLVKQMMPVIE  280

Query  802   TSPTVRLGAEMT---LKQLGTLSPPIMKqvlplveqlppLYMD--------LINGRENFV  656
             TSP   +   +    LK L  ++  ++    P        ++D        +  G   F 
Sbjct  281   TSPMYSMAQSIPGDGLKTLIDIAERVLPDYDPEATVSLTKFVDQLPSVFNQVAQGISEFK  340

Query  655   PRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLS--TDSAISSMLDMSIRSLPG  482
             P P E     K  Y I   LL+KF  DTIDET +L + L    +S    +  + +R   G
Sbjct  341   PTPAENLDCFKKLYNIQHTLLVKFDFDTIDETDLLEETLKPRVESFCGKLEKVVLR---G  397

Query  481   DHGLP-LHQALPDVPPAMTDAVNKSGELLANLAAGTPWET--FAKEVGNTFG  335
             +H  P + +    V P  T A      +   L A + +ET   ++ + N FG
Sbjct  398   NHITPCIQEPRWQVGPVYTPA----DAIAQGLKAISLYETRVLSRTICNWFG  445



>ref|XP_002516172.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46174.1| conserved hypothetical protein [Ricinus communis]
Length=410

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 125/263 (48%), Gaps = 22/263 (8%)
 Frame = -2

Query  1264  SKDWKEVEGAWVLGP-INTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPY  1088
             SK + +++   V+ P    KPR I+ F+GG F GA P++TY   +E L ++  +V+  PY
Sbjct  79    SKKYSKIDSCVVIPPPKGKKPRAIIKFLGGAFIGAVPEVTYGYLIELLAKEGYVVVLVPY  138

Query  1087  ASGFDHFFIADEVQFKFDRCLRFLQET-----------VQDLPIFGIGHSLGSVIHLLIG  941
                FDH   A++V  KF+ CL  L  +           +  LP+F +GHS G+++ +L G
Sbjct  139   NVTFDHAHAANQVYEKFNACLDLLLTSGLPDANLTPAQLVGLPVFSVGHSNGALLQVLTG  198

Query  940   SRYAVQ-RSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTL  764
             S +       N ++SFNN+ A+ A+P F   L P+   + P +         R  +    
Sbjct  199   SYFCDNIPKANAIISFNNRPATEAVPYFEQ-LGPLINQMMPIVEASPMYSIARSASGDAW  257

Query  763   KQLGTLSPPIMKqvlplveqlppLYMD--------LINGRENFVPRPEETRRLIKSYYGI  608
             K L   +  I+             ++D        +  G   F PRP E R   ++ Y +
Sbjct  258   KMLIDTAGAIIPDSEQEALTSLTRFVDQLPSVMSQVTEGVSEFKPRPSENRDCCRNSYNV  317

Query  607   SRNLLIKFKDDTIDETSVLAQLL  539
                LL+KF  DTIDET +L + L
Sbjct  318   QHTLLVKFTSDTIDETDLLEETL  340



>ref|XP_009399642.1| PREDICTED: uncharacterized protein LOC103983983 [Musa acuminata 
subsp. malaccensis]
Length=400

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 132/278 (47%), Gaps = 24/278 (9%)
 Frame = -2

Query  1222  PINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQF  1043
             P   KPR +V F+GG F GA P++TY   +E L ++  LV++ PY   FDH   A EV  
Sbjct  83    PAGRKPRAVVKFLGGAFVGAVPEVTYSFLMEWLAKEGFLVVSVPYNVTFDHEKAAKEVYE  142

Query  1042  KFDRCLRFLQET-----------VQDLPIFGIGHSLGSVIHLLIGSRYAVQ-RSGNILMS  899
             +F  C+  L  +           +  LP++ +GHS G+++ +LIGS +  +    N+++S
Sbjct  143   RFHCCMDSLFASGIPDTGITALDISSLPLYSVGHSNGALLQMLIGSYFDEKIAKANVIIS  202

Query  898   FNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvl  719
             FNN+ A+ A+P F     PM   + P + +       R  +    K L   +  +++   
Sbjct  203   FNNRPAAEAVPYFEQ-FGPMVSQVIPIIEESPVYSMARNASGDAWKYLLDTAGLLIQDYD  261

Query  718   plveqlppLYMD----LIN----GRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDE  563
                      ++D    +IN    G   F P P E R   K  Y +   LL+KF  D IDE
Sbjct  262   QEAVVSLTKFIDQLPSVINQVTQGTSEFKPTPPENREFFKKSYSVPHTLLVKFSVDAIDE  321

Query  562   TSVLAQLLSTD-SAISSMLDMSIRSLPGDHGLPLHQAL  452
             T +L  +L     +I  M++    +L G+H  P  Q L
Sbjct  322   TDLLEDILKPRVESIGGMVEKI--TLSGNHLTPCLQDL  357



>ref|XP_010273902.1| PREDICTED: uncharacterized protein LOC104609313 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273903.1| PREDICTED: uncharacterized protein LOC104609313 isoform X1 [Nelumbo 
nucifera]
Length=425

 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/291 (29%), Positives = 140/291 (48%), Gaps = 25/291 (9%)
 Frame = -2

Query  1264  SKDWKEVEGAWVLGPI-NTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPY  1088
             +K ++ ++   V+ P    KPR I+ F+GG F GA P++TY   +E L ++  L+I+ PY
Sbjct  92    NKIYRRLDSCLVIPPSRGQKPRAIIKFLGGAFIGAVPEVTYSYLIELLAKEGFLIISVPY  151

Query  1087  ASGFDHFFIADEVQFKFDRCLRFLQET-----------VQDLPIFGIGHSLGSVIHLLIG  941
                FDH   A EV  KF+ CL  +  +           +  LPI+ +GHS G+++ LL G
Sbjct  152   NVTFDHSQAAQEVYEKFNSCLDMILTSGLPDANLSAGELVHLPIYSVGHSNGALLQLLTG  211

Query  940   SRYAVQ-RSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQIATSPTVRLGAEMTL  764
             S ++ +    N  +S+NN+ A+ A+P F   L P+   + P +         R+ +    
Sbjct  212   SYFSEKIPKANAAISYNNRPATEAVPYFEQ-LGPLVSQMMPLMEASPMYSMARIASGDAW  270

Query  763   KQLGTLSPPIMKqvlplveqlppLYMD--------LINGRENFVPRPEETRRLIKSYYGI  608
             K L   +  ++++           ++D        +  G   F P P E R   K+ Y +
Sbjct  271   KALLDTAGAMIQEYDQEAMVSLTKFVDQLPSVMNQVTQGVSEFKPTPSENRDCFKNSYNV  330

Query  607   SRNLLIKFKDDTIDETSVLAQLLSTD-SAISSMLDMSIRSLPGDHGLPLHQ  458
                LL+KF  D IDET ++ ++L     A++  L+  +  L G+H  P  Q
Sbjct  331   QHTLLVKFNSDAIDETDLVEEVLKPRVDAMAGTLEKVV--LSGNHLTPCIQ  379



>ref|XP_004498831.1| PREDICTED: uncharacterized protein LOC101514791 [Cicer arietinum]
Length=407

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/297 (29%), Positives = 141/297 (47%), Gaps = 51/297 (17%)
 Frame = -2

Query  1312  RLLTDTVKQSQDAWG--------TSKDWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAP  1157
             +++ +T K + D +          SK +  ++   V+ P  + PR I+ F+GG F GA P
Sbjct  53    KMVANTTKIASDMYVGRNTSVRINSKLYTNLDSCLVIPPPTSNPRAIIKFLGGAFIGAIP  112

Query  1156  QLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFL-----------QE  1010
             +LTY   LE L ++  LV+  PY   FDH   A +V  +F  CL  +             
Sbjct  113   ELTYGYLLEFLAKEGFLVVVVPYNVTFDHSQAAKQVYERFHTCLDTILTYGLPQANLSPA  172

Query  1009  TVQDLPIFGIGHSLGSVIHLLIGSRYAVQR-SGNILMSFNNKEASVAIPLFSPVLVPMAQ  833
              + DLP+F +GHS G+++ LL GS ++ +    N ++++NN+ A+ A+P F        +
Sbjct  173   QLVDLPLFSVGHSNGALLQLLTGSLFSEKLPKANAVIAYNNRPATEAVPYF--------E  224

Query  832   SIGPFLSQ----IATSPTVRLGA-------EMTLKQLGTLSPPIMKqvlplveqlppLYM  686
              +GP +SQ    +  +P   +         +M L  +G+    +++     V      ++
Sbjct  225   QLGPAVSQLMPVVVANPIYSIARNAPGDAWKMMLDAVGS----VLQDSEQEVLNSLTKFV  280

Query  685   DLI--------NGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLL  539
             D +         G   F P P E R   KS Y +   LL+KF  DTIDET++L + L
Sbjct  281   DQLPLVMNEVSQGVSEFKPTPSENRDCFKSSYNVKHTLLVKFNFDTIDETNILEETL  337



>ref|WP_006616796.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005072902.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI94364.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR57030.1| hypothetical protein APPUASWS_013540 [Arthrospira platensis str. 
Paraca]
Length=258

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 88/136 (65%), Gaps = 6/136 (4%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW E    WVL P   KP+ IVHF+GG F  +AP +TYR  LE+L  +   +IATP+ + 
Sbjct  2     DWLEFSDNWVLIP--PKPKAIVHFLGGAFVASAPHITYRWLLEQLALQGYAIIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLR--FLQETVQ--DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  +A EV + F+  L   F  + ++   LPI+GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHGNMAREVLWTFEDGLEDLFAAQKLRRRGLPIYGIGHSMGCKLHLLIGSLFEVERAGN  119

Query  910   ILMSFNNKEASVAIPL  863
             IL+SFNN  A  +IPL
Sbjct  120   ILLSFNNYAARQSIPL  135



>ref|XP_004246026.1| PREDICTED: uncharacterized protein LOC101256996 [Solanum lycopersicum]
Length=408

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 137/277 (49%), Gaps = 28/277 (10%)
 Frame = -2

Query  1300  DTVKQSQDAWGTSKDWKEVEGAWVLGPIN-TKPRLIVHFVGGIFAGAAPQLTYRLFLERL  1124
             ++ + + +   T K +K ++   V+ P    KP+ I+ FVGG F GA P++TY   LE L
Sbjct  67    NSTRTNYNTPTTGKFYKRMDSCLVIPPPKGIKPKAIIKFVGGAFIGAVPEVTYSYLLENL  126

Query  1123  VEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFL-----------QETVQDLPIFGIG  977
               +  L+I  PY   FDH  ++ +V  +F  C   +            + + DLP++ +G
Sbjct  127   AREGYLIICVPYNVTFDHAQVSRQVFERFHACFDPILASGLPDSGLSADDIVDLPLYSVG  186

Query  976   HSLGSVIHLLIGSRYAVQ-RSGNILMSFNNKEASVAIPLFS----------PVLVPMAQS  830
             HS G++I  L+GS +  +    N+++S+NN+ AS A+P F           PV+ P    
Sbjct  187   HSNGALIQALVGSYFCEKIPKANVIISYNNRPASEAVPYFEQLGLLVGQMVPVISPAYS-  245

Query  829   IGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPR  650
                 ++Q A+   +R+  +     +    P  +  +    +QLP ++ +L  G   F P 
Sbjct  246   ----MAQSASGDALRVLLDTAGTIIPDYDPETVVSLTKFADQLPLVFGELAQGISEFKPT  301

Query  649   PEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLL  539
             P E     K+ Y ++R LL+KF +D IDET  L + L
Sbjct  302   PSENLECFKNAYNVNRTLLVKFDNDAIDETDRLEETL  338



>ref|XP_005704505.1| hydrolase [Galdieria sulphuraria]
 gb|EME27985.1| hydrolase [Galdieria sulphuraria]
Length=398

 Score =   125 bits (313),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 97/322 (30%), Positives = 151/322 (47%), Gaps = 45/322 (14%)
 Frame = -2

Query  1330  LYRDIERLLTDTVKQSQDAWGTSKDWKEVEGAWVLGP---INTKPRLIVHFVGGIFAGAA  1160
             L+R   R L + V +S  A      W+  +  ++L P    +  P  ++HFVGG F G++
Sbjct  42    LHRRTWRFLENLVGRSFGA-NRVPQWEHFDKLYLLRPSTVFSRTPLGVIHFVGGAFVGSS  100

Query  1159  PQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQ-DLPIFG  983
              QL YR  LE LV+   LVI TPY + FDH   A+ V   F R +R LQE     LP+ G
Sbjct  101   SQLAYRSLLEGLVQLGYLVIVTPYDTSFDHLVAAESVNSSFVRVMRQLQEEYGIALPVVG  160

Query  982   IGHSLGSVIHLLIGSRYA---VQRSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLS  812
             + HSLG +I +L    +    V   G+I M++NNK    A+PL+  +L+P  Q    +  
Sbjct  161   LSHSLGCIIQILSSCLFPHVDVNTKGHIFMAYNNKPLKKAVPLYKELLIPSIQMFSSW--  218

Query  811   QIATSPTVRLGAEMTLKQLGTL--------SPPIMKqvlplveqlppLY-----------  689
                + P   + +  T K++ +L           IM+ +     +    +           
Sbjct  219   ---SIPKEEMNS--TWKRISSLFEGFIVSTGDSIMENIDSKTLKEQVYFNWQQIQRAWKQ  273

Query  688   -----MDLINGRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLLSTDSA  524
                    + +GR+ F P P +   +I   Y  S +++I+ +DD IDE+  L +LL     
Sbjct  274   LDPLLEQIQSGRDEFHPSPSDIENIIIQKYSHS-SIIIRCEDDLIDESLQLYRLLRGRD-  331

Query  523   ISSMLDMSIRSLPGDHGLPLHQ  458
                 L + +RS+PG H  PL Q
Sbjct  332   ----LYIKLRSVPGTHLTPLEQ  349



>ref|XP_006359942.1| PREDICTED: uncharacterized protein LOC102601990 [Solanum tuberosum]
Length=408

 Score =   124 bits (312),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 130/266 (49%), Gaps = 28/266 (11%)
 Frame = -2

Query  1267  TSKDWKEVEGAWVLGPIN-TKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATP  1091
             T K +K ++   V+ P    KP+ I+ FVGG F GA P++TY   LE L  +  L+I  P
Sbjct  78    TGKFYKRMDSCLVIPPPKGIKPKAIIKFVGGAFIGAVPEVTYSYLLENLAREGYLIICVP  137

Query  1090  YASGFDHFFIADEVQFKFDRCLRFLQET-----------VQDLPIFGIGHSLGSVIHLLI  944
             Y   FDH  +  +V  +F  C   +  +           + DLP++ +GHS G++I  L+
Sbjct  138   YNVTFDHAQVTRQVFDRFHACFDSILASGLPDSGLSAADIVDLPLYSVGHSNGALIQALV  197

Query  943   GSRYAVQ-RSGNILMSFNNKEASVAIPLFS----------PVLVPMAQSIGPFLSQIATS  797
             GS +  +    N+++S+NN+ AS A+P F           PV+ P        ++Q A+ 
Sbjct  198   GSYFCEKIPKANVIISYNNRPASEAVPYFEQLGLLVGQMVPVISPAYS-----MAQSASG  252

Query  796   PTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLIKSY  617
               +R+  +     +    P  +  +    +QLP ++ +L  G   F P P E     K+ 
Sbjct  253   DALRVLLDTAGTIIPDYDPETVVSLTKFADQLPSVFGELAQGISEFKPTPSENLECFKNA  312

Query  616   YGISRNLLIKFKDDTIDETSVLAQLL  539
             Y + R LL+KF +D IDET  L + L
Sbjct  313   YNVKRTLLVKFDNDAIDETDRLEETL  338



>ref|WP_006622140.1| MULTISPECIES: hypothetical protein [Arthrospira]
 gb|EDZ95912.1| protein of unknown function DUF1350 [Arthrospira maxima CS-328]
 emb|CCE17326.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 gb|EKD09962.1| hypothetical protein SPLC1_S120270 [Arthrospira platensis C1]
 emb|CDM92487.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
Length=258

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 88/136 (65%), Gaps = 6/136 (4%)
 Frame = -2

Query  1258  DWKEVEGAWVLGPINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASG  1079
             DW E    WVL P   KP+ IVHF+GG F  +AP +TYR  LE+L  +   +IATP+ + 
Sbjct  2     DWLEFSDNWVLIP--PKPKAIVHFLGGAFVASAPHITYRWLLEQLGLQGYAIIATPFINT  59

Query  1078  FDHFFIADEVQFKFDRCLR--FLQETVQ--DLPIFGIGHSLGSVIHLLIGSRYAVQRSGN  911
              DH  +A EV + F+  L   F  + ++   LPI+GIGHS+G  +HLLIGS + V+R+GN
Sbjct  60    LDHGNMAREVLWTFEDGLEDLFAAQKLRRRGLPIYGIGHSMGCKLHLLIGSLFEVERAGN  119

Query  910   ILMSFNNKEASVAIPL  863
             IL+SFNN  A  +IPL
Sbjct  120   ILISFNNYTARQSIPL  135



>ref|XP_008452805.1| PREDICTED: uncharacterized protein LOC103493718 isoform X1 [Cucumis 
melo]
Length=418

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/297 (31%), Positives = 146/297 (49%), Gaps = 39/297 (13%)
 Frame = -2

Query  1261  KDWKEVEGAWVLGPINTKP-RLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYA  1085
             K +K++E   V+ P   KP R I+ F+GG F GA P+++Y   +E L ++  L+I+ PY 
Sbjct  88    KIYKQLESCLVIPPPRGKPPRAIIKFLGGAFIGAIPEVSYSYLIEFLAKEGFLIISVPYN  147

Query  1084  SGFDHFFIADEVQFKFDRCLRFLQET-----------VQDLPIFGIGHSLGSVIHLLIGS  938
               FDH   A +V  +F  CL  +  +           + +LP+F +GHS G+++ +L GS
Sbjct  148   VTFDHANAARQVFERFHVCLDTILASGLPDEDISPSQLVNLPLFSVGHSNGALLQVLTGS  207

Query  937   RYAVQ-RSGNILMSFNNKEASVAIPLFSPVLVPMAQSIGPFLSQ----IATSPTVRLGAE  773
              ++ +    N ++SFNN+ A+ A+P F        + +GP  SQ    +  SP   +   
Sbjct  208   YFSEKIPKANAIISFNNRPATEAVPYF--------EQLGPLTSQMMPVVQASPVYSMARS  259

Query  772   MT-------LKQLGTLSP----PIMKqvlplveqlppLYMDLINGRENFVPRPEETRRLI  626
             ++       L   G + P     ++  +   V+QLP ++  +  G   F P P E R   
Sbjct  260   VSEDARKILLDAAGAIVPDSDREVLNSLTKFVDQLPSVFNQVTEGVSEFRPTPSENRDCF  319

Query  625   KSYYGISRNLLIKFKDDTIDETSVLAQLLSTD-SAISSMLDMSIRSLPGDHGLPLHQ  458
             K  Y +   LL+KF  DTIDET +L Q L     +I+  L+     L G+H  P  Q
Sbjct  320   KCNYNVQNTLLVKFISDTIDETDLLEQTLKPRVESINGTLEKV--ELSGNHITPCVQ  374



>ref|XP_002308506.2| hypothetical protein POPTR_0006s23430g [Populus trichocarpa]
 gb|EEE92029.2| hypothetical protein POPTR_0006s23430g [Populus trichocarpa]
Length=419

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/285 (30%), Positives = 131/285 (46%), Gaps = 30/285 (11%)
 Frame = -2

Query  1327  YRDIERLLTDT-VKQSQDAWGTSKDWKEVEGAWVLGPIN-TKPRLIVHFVGGIFAGAAPQ  1154
             Y D   ++T+T  KQ Q        + ++E   V+ P    KPR I+ F+GG F GA P+
Sbjct  70    YGDGNTVITNTNYKQRQK-------YTQMESCLVIPPPKGRKPRAIIKFLGGAFIGAVPE  122

Query  1153  LTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQFKFDRCLRFLQET-----------  1007
             +TY   +E L +   +VI  PY   FDH   AD+V  +F+ CL  L ++           
Sbjct  123   VTYSCLIELLAKDGYVVILVPYNVTFDHSKAADQVYERFNACLDLLLQSGLPHDGLTASE  182

Query  1006  VQDLPIFGIGHSLGSVIHLLIGSRYAVQ-RSGNILMSFNNKEASVAIPLFSPVLVPMAQS  830
             +  LP+F +GHS G+++ +L GS +  +    N ++SFNN+ A+ A+P F   L P+   
Sbjct  183   LVGLPLFSVGHSNGALLQVLTGSYFCEKIPKANAIISFNNRPATEAVPYFE-QLGPLVNQ  241

Query  829   IGPFLSQIATSPTVRLGAEMTLKQLGTLSPPIMKqvlplveqlppLYMD--------LIN  674
             + P           R  +    K L   +  I+             ++D        +  
Sbjct  242   MMPVFEASPMYAMARSASGDAWKVLLDTAGTIIPDSEQEALISLTKFVDQLPSVFGQVTE  301

Query  673   GRENFVPRPEETRRLIKSYYGISRNLLIKFKDDTIDETSVLAQLL  539
             G   F P P E R   ++ Y +   LL+KF  D IDET VL + L
Sbjct  302   GISEFKPTPSENRDCCRNSYNVQHTLLVKFNSDAIDETDVLEETL  346



>dbj|BAJ89705.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/255 (31%), Positives = 124/255 (49%), Gaps = 35/255 (14%)
 Frame = -2

Query  1222  PINTKPRLIVHFVGGIFAGAAPQLTYRLFLERLVEKDILVIATPYASGFDHFFIADEVQF  1043
             P   +P  +V F+GG F GAAP+ TY   LE L ++  LV+  PY   FDH   A EV  
Sbjct  83    PRGARPLAVVKFLGGAFIGAAPEATYGYLLELLAQEGFLVVCVPYNVTFDHAAAAREVFE  142

Query  1042  KFDRCLRFLQET-----------VQDLPIFGIGHSLGSVIHLLIGSRYAVQ-RSGNILMS  899
             +F  C   L+ +           +  LP++ +GHS G+++ LL+GS ++ +    N ++S
Sbjct  143   RFHGCYDALRASGLPEAGLSALDIAGLPLYSVGHSNGALLQLLVGSYFSEKIPKANAIVS  202

Query  898   FNNKEASVAIPLFSPVLVPMAQSIGPFLSQIA----TSPTVRLGAEMT---LKQLGTLSP  740
             FNN+ AS A+P F        + IGP +SQ+     TSP   +  + +    K L  L+ 
Sbjct  203   FNNRPASEAVPYF--------EQIGPLISQLTPMMETSPVYSVARDASGNAWKALFDLAG  254

Query  739   PIMKqvlplveqlppLYMD--------LINGRENFVPRPEETRRLIKSYYGISRNLLIKF  584
              ++++           ++D        +  G   F P P E R   K+ Y +   LL+KF
Sbjct  255   GLIREYDQEAMVSVSKFVDQLPLVMNQVTEGVSEFKPTPPENREFCKNSYSVPNTLLVKF  314

Query  583   KDDTIDETSVLAQLL  539
               D ID+T ++  +L
Sbjct  315   SVDAIDDTEIIEDIL  329



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4708716422032