BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c82778_g1_i1 len=1108 path=[1:0-1107]

Length=1108
                                                                      Score     E

gb|EYU40913.1|  hypothetical protein MIMGU_mgv1a025482mg                252   4e-78   
ref|XP_009802733.1|  PREDICTED: late embryogenesis abundant prote...    244   5e-75   
ref|XP_010277180.1|  PREDICTED: late embryogenesis abundant prote...    240   3e-73   
ref|XP_008451333.1|  PREDICTED: late embryogenesis abundant prote...    238   2e-72   
ref|XP_004146999.1|  PREDICTED: late embryogenesis abundant prote...    236   1e-71   
ref|XP_004169378.1|  PREDICTED: late embryogenesis abundant prote...    235   2e-71   
emb|CAN76722.1|  hypothetical protein VITISV_029641                     235   2e-71   Vitis vinifera
ref|XP_010651983.1|  PREDICTED: late embryogenesis abundant prote...    235   2e-71   
emb|CBI28707.3|  unnamed protein product                                234   5e-71   
ref|XP_009620120.1|  PREDICTED: late embryogenesis abundant prote...    231   6e-70   
ref|XP_009764712.1|  PREDICTED: uncharacterized protein LOC104216384    241   2e-68   
sp|P09444.1|LEA34_GOSHI  RecName: Full=Late embryogenesis abundan...    225   2e-67   Gossypium hirsutum [American cotton]
ref|XP_002520716.1|  Late embryogenesis abundant protein D-34, pu...    224   2e-67   Ricinus communis
ref|XP_002520715.1|  Late embryogenesis abundant protein D-34, pu...    222   3e-66   Ricinus communis
ref|XP_003590628.1|  Late embryogenesis abundant protein D-34           222   4e-66   
ref|XP_003590627.1|  Late embryogenesis abundant protein D-34           222   7e-66   
emb|CAA43046.1|  embryonic cell protein                                 221   7e-66   Daucus carota [carrots]
dbj|BAD86645.1|  ECP31 protein                                          220   1e-65   Daucus carota [carrots]
ref|XP_011079873.1|  PREDICTED: late embryogenesis abundant prote...    217   2e-64   
ref|XP_006299031.1|  hypothetical protein CARUB_v10015168mg             217   2e-64   
ref|XP_004495192.1|  PREDICTED: late embryogenesis abundant prote...    217   2e-64   
ref|XP_010917736.1|  PREDICTED: late embryogenesis abundant prote...    217   2e-64   
ref|XP_003536910.2|  PREDICTED: late embryogenesis abundant prote...    217   3e-64   
gb|KHN03807.1|  Late embryogenesis abundant protein D-34                217   4e-64   
emb|CDP12311.1|  unnamed protein product                                217   4e-64   
ref|XP_009586710.1|  PREDICTED: late embryogenesis abundant prote...    216   5e-64   
gb|KDP21438.1|  hypothetical protein JCGZ_21909                         216   6e-64   
ref|XP_002282590.1|  PREDICTED: late embryogenesis abundant prote...    216   6e-64   Vitis vinifera
gb|AIA57962.1|  late embryogenesis abundant protein 1                   214   3e-63   
ref|XP_010466531.1|  PREDICTED: late embryogenesis abundant prote...    214   4e-63   
ref|XP_002885505.1|  predicted protein                                  213   6e-63   
gb|ADQ91843.1|  late embryogenesis abundant protein group 5 protein     213   7e-63   
ref|XP_010488278.1|  PREDICTED: late embryogenesis abundant prote...    213   9e-63   
gb|KEH43869.1|  late embryogenesis abundant D-like protein              213   1e-62   
ref|XP_010256052.1|  PREDICTED: late embryogenesis abundant prote...    212   1e-62   
gb|ABB16353.1|  seed maturation protein                                 211   3e-62   Medicago truncatula
emb|CAN67177.1|  hypothetical protein VITISV_037455                     211   3e-62   Vitis vinifera
ref|XP_010679058.1|  PREDICTED: late embryogenesis abundant prote...    212   3e-62   
ref|XP_004496718.1|  PREDICTED: late embryogenesis abundant prote...    211   4e-62   
ref|XP_008811249.1|  PREDICTED: late embryogenesis abundant prote...    211   5e-62   
ref|XP_010511424.1|  PREDICTED: late embryogenesis abundant prote...    211   6e-62   
ref|NP_188888.1|  Seed maturation protein                               211   6e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335335.1|  PREDICTED: late embryogenesis abundant prote...    210   1e-61   
ref|XP_010932759.1|  PREDICTED: late embryogenesis abundant prote...    210   1e-61   
ref|XP_008797343.1|  PREDICTED: late embryogenesis abundant prote...    210   1e-61   
ref|XP_008224307.1|  PREDICTED: late embryogenesis abundant prote...    209   4e-61   
ref|XP_007200102.1|  hypothetical protein PRUPE_ppa019190mg             208   5e-61   
ref|XP_004290610.1|  PREDICTED: late embryogenesis abundant prote...    207   8e-61   
ref|XP_008390908.1|  PREDICTED: late embryogenesis abundant prote...    208   8e-61   
ref|XP_008235307.1|  PREDICTED: late embryogenesis abundant prote...    207   2e-60   
ref|XP_009370807.1|  PREDICTED: late embryogenesis abundant prote...    206   4e-60   
ref|XP_004299111.1|  PREDICTED: late embryogenesis abundant prote...    206   6e-60   
ref|XP_004139881.1|  PREDICTED: late embryogenesis abundant prote...    206   6e-60   
gb|KDO53322.1|  hypothetical protein CISIN_1g046001mg                   205   7e-60   
ref|NP_188889.1|  late embryogenesis abundant protein ECP31             205   9e-60   Arabidopsis thaliana [mouse-ear cress]
gb|EYU46567.1|  hypothetical protein MIMGU_mgv1a012107mg                205   1e-59   
ref|XP_007144645.1|  hypothetical protein PHAVU_007G173100g             204   1e-59   
ref|XP_009145325.1|  PREDICTED: late embryogenesis abundant prote...    204   2e-59   
dbj|BAA11016.1|  LEA protein in group 5                                 204   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010024280.1|  PREDICTED: late embryogenesis abundant prote...    204   3e-59   
emb|CDY38305.1|  BnaC05g29980D                                          204   3e-59   
ref|XP_008447154.1|  PREDICTED: late embryogenesis abundant prote...    204   4e-59   
ref|XP_010256054.1|  PREDICTED: late embryogenesis abundant prote...    204   4e-59   
gb|EYU41481.1|  hypothetical protein MIMGU_mgv1a011867mg                203   8e-59   
gb|KDP21437.1|  hypothetical protein JCGZ_21908                         201   2e-58   
ref|XP_002517129.1|  Late embryogenesis abundant protein D-34, pu...    201   3e-58   Ricinus communis
ref|XP_002885506.1|  ATECP31                                            201   3e-58   
ref|XP_010693766.1|  PREDICTED: late embryogenesis abundant prote...    202   8e-58   
emb|CDY10286.1|  BnaC05g29930D                                          200   9e-58   
ref|XP_008355469.1|  PREDICTED: late embryogenesis abundant prote...    201   1e-57   
ref|XP_009775953.1|  PREDICTED: late embryogenesis abundant prote...    199   1e-57   
ref|XP_006382740.1|  hypothetical protein POPTR_0005s04950g             199   3e-57   
ref|XP_007206587.1|  hypothetical protein PRUPE_ppa020371mg             199   3e-57   
ref|XP_006406157.1|  hypothetical protein EUTSA_v10021345mg             197   6e-57   
ref|XP_010090423.1|  hypothetical protein L484_025090                   197   8e-57   
ref|XP_010917735.1|  PREDICTED: late embryogenesis abundant prote...    196   2e-56   
ref|XP_006489400.1|  PREDICTED: late embryogenesis abundant prote...    196   3e-56   
ref|XP_008218178.1|  PREDICTED: late embryogenesis abundant prote...    196   4e-56   
ref|XP_006419945.1|  hypothetical protein CICLE_v10005469mg             197   4e-56   
ref|XP_010096140.1|  hypothetical protein L484_005419                   198   5e-56   
gb|AIA57963.1|  late embryogenesis abundant protein 3                   196   6e-56   
emb|CDY10647.1|  BnaA05g17150D                                          195   7e-56   
emb|CDX92944.1|  BnaA03g36660D                                          194   8e-56   
ref|XP_006480098.1|  PREDICTED: late embryogenesis abundant prote...    196   1e-55   
ref|XP_010488281.1|  PREDICTED: late embryogenesis abundant prote...    194   1e-55   
ref|XP_006444042.1|  hypothetical protein CICLE_v10023775mg             196   2e-55   
ref|XP_009364553.1|  PREDICTED: late embryogenesis abundant prote...    195   2e-55   
ref|XP_010070193.1|  PREDICTED: late embryogenesis abundant prote...    193   2e-55   
ref|XP_007143265.1|  hypothetical protein PHAVU_007G057900g             193   3e-55   
ref|XP_006433071.1|  hypothetical protein CICLE_v10003643mg             193   4e-55   
emb|CDY24310.1|  BnaC03g42830D                                          191   1e-54   
ref|XP_007224297.1|  hypothetical protein PRUPE_ppa019572mg             191   1e-54   
ref|XP_009135809.1|  PREDICTED: late embryogenesis abundant prote...    191   1e-54   
gb|KFK39540.1|  hypothetical protein AALP_AA3G257500                    191   2e-54   
ref|XP_004168899.1|  PREDICTED: late embryogenesis abundant prote...    191   6e-54   
dbj|BAK04960.1|  predicted protein                                      191   6e-54   
gb|KGN56981.1|  hypothetical protein Csa_3G146660                       191   7e-54   
ref|XP_010466535.1|  PREDICTED: late embryogenesis abundant prote...    189   1e-53   
ref|XP_003590629.1|  Late embryogenesis abundant protein D-34           187   3e-53   
ref|XP_008388644.1|  PREDICTED: late embryogenesis abundant prote...    189   3e-53   
ref|XP_004495777.1|  PREDICTED: late embryogenesis abundant prote...    188   4e-53   
ref|XP_008370878.1|  PREDICTED: late embryogenesis abundant prote...    189   4e-53   
ref|XP_008364056.1|  PREDICTED: late embryogenesis abundant prote...    185   2e-52   
ref|XP_004247663.1|  PREDICTED: late embryogenesis abundant prote...    186   2e-52   
ref|NP_001237506.1|  seed maturation protein PM24                       186   2e-52   
emb|CCW28814.1|  seed maturation protein                                186   2e-52   
ref|XP_004304720.1|  PREDICTED: late embryogenesis abundant prote...    185   3e-52   
ref|XP_004134446.1|  PREDICTED: late embryogenesis abundant prote...    191   6e-52   
ref|XP_006349691.1|  PREDICTED: late embryogenesis abundant prote...    184   1e-51   
ref|XP_010025078.1|  PREDICTED: late embryogenesis abundant prote...    184   1e-51   
ref|XP_008218177.1|  PREDICTED: late embryogenesis abundant prote...    184   3e-51   
ref|XP_007050564.1|  Late embryogenesis abundant protein D-34, pu...    184   3e-51   
ref|XP_006360815.1|  PREDICTED: late embryogenesis abundant prote...    183   3e-51   
gb|AAF21311.1|  seed maturation protein PM25                            182   5e-51   Glycine max [soybeans]
gb|KDO74561.1|  hypothetical protein CISIN_1g038380mg                   182   7e-51   
ref|XP_003559428.1|  PREDICTED: late embryogenesis abundant prote...    182   7e-51   
gb|KHG19384.1|  Late embryogenesis abundant D-34                        181   1e-50   
ref|XP_009599420.1|  PREDICTED: late embryogenesis abundant prote...    181   2e-50   
ref|XP_003562052.1|  PREDICTED: late embryogenesis abundant prote...    180   1e-49   
ref|XP_004495776.1|  PREDICTED: late embryogenesis abundant prote...    178   4e-49   
ref|XP_007050563.1|  Late embryogenesis abundant protein D-34, pu...    178   5e-49   
emb|CAA63085.1|  LEA D34 protein homologue type 1                       176   6e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237967.1|  seed maturation protein PM26                       176   1e-48   
gb|KHG05102.1|  Late embryogenesis abundant D-34                        173   1e-47   
ref|XP_010041757.1|  PREDICTED: late embryogenesis abundant prote...    172   3e-47   
ref|NP_001152643.1|  late embryogenesis abundant protein D-34           172   4e-47   Zea mays [maize]
gb|ADQ91842.1|  late embryogenesis abundant protein group 5 protein     171   4e-47   
ref|XP_002463881.1|  hypothetical protein SORBIDRAFT_01g008210          171   9e-47   Sorghum bicolor [broomcorn]
ref|XP_010277174.1|  PREDICTED: late embryogenesis abundant prote...    169   3e-46   
ref|XP_003633664.1|  PREDICTED: late embryogenesis abundant prote...    169   4e-46   
ref|XP_006299455.1|  hypothetical protein CARUB_v10015620mg             169   7e-46   
ref|XP_007144794.1|  hypothetical protein PHAVU_007G184800g             169   1e-45   
ref|XP_010041766.1|  PREDICTED: late embryogenesis abundant prote...    168   1e-45   
ref|XP_008438669.1|  PREDICTED: late embryogenesis abundant prote...    168   4e-45   
ref|XP_010045838.1|  PREDICTED: late embryogenesis abundant prote...    167   4e-45   
ref|XP_006382741.1|  seed maturation protein PM26                       164   1e-44   
ref|XP_009396738.1|  PREDICTED: late embryogenesis abundant prote...    164   6e-44   
gb|AJA33583.1|  late embryogenesis abundant protein LEA7-4              162   3e-43   
ref|XP_002512261.1|  Late embryogenesis abundant protein D-34, pu...    161   3e-43   Ricinus communis
ref|XP_011032498.1|  PREDICTED: late embryogenesis abundant prote...    160   4e-43   
ref|XP_010552068.1|  PREDICTED: late embryogenesis abundant prote...    160   9e-43   
ref|XP_007030655.1|  Seed maturation protein, putative                  158   3e-42   
emb|CAA41854.1|  rab28                                                  159   5e-42   Zea mays [maize]
ref|XP_004135801.1|  PREDICTED: late embryogenesis abundant prote...    158   5e-42   
ref|XP_004165760.1|  PREDICTED: late embryogenesis abundant prote...    158   7e-42   
ref|XP_008438670.1|  PREDICTED: late embryogenesis abundant prote...    157   4e-41   
ref|XP_006419946.1|  hypothetical protein CICLE_v10005699mg             155   8e-41   
ref|XP_006489401.1|  PREDICTED: late embryogenesis abundant prote...    155   9e-41   
ref|XP_006360786.1|  PREDICTED: late embryogenesis abundant prote...    154   3e-40   
ref|XP_003599533.1|  Late embryogenesis abundant protein D-34           152   1e-39   
ref|XP_004247564.2|  PREDICTED: late embryogenesis abundant prote...    152   2e-39   
gb|AJA33580.1|  late embryogenesis abundant protein LEA7-1              152   2e-39   
gb|KEH43047.1|  late embryogenesis abundant D-like protein              150   6e-39   
ref|XP_011082573.1|  PREDICTED: late embryogenesis abundant prote...    148   8e-39   
gb|KDO68693.1|  hypothetical protein CISIN_1g027886mg                   148   1e-38   
ref|XP_008797392.1|  PREDICTED: late embryogenesis abundant prote...    149   3e-38   
emb|CDO99067.1|  unnamed protein product                                149   3e-38   
ref|XP_006589172.1|  PREDICTED: late embryogenesis abundant prote...    148   5e-38   
gb|AFK36784.1|  unknown                                                 147   7e-38   
ref|XP_010326383.1|  PREDICTED: late embryogenesis abundant prote...    145   1e-37   
gb|KDO74560.1|  hypothetical protein CISIN_1g035654mg                   146   1e-37   
ref|XP_009411288.1|  PREDICTED: late embryogenesis abundant prote...    146   2e-37   
ref|XP_006589173.1|  PREDICTED: late embryogenesis abundant prote...    143   4e-36   
ref|XP_004985623.1|  PREDICTED: late embryogenesis abundant prote...    142   1e-35   
ref|XP_010326670.1|  PREDICTED: late embryogenesis abundant prote...    141   3e-35   
ref|XP_010679057.1|  PREDICTED: late embryogenesis abundant prote...    140   4e-35   
gb|EAY88627.1|  hypothetical protein OsI_10103                          140   7e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001049030.1|  Os03g0159600                                       139   9e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465829.1|  hypothetical protein SORBIDRAFT_01g046490          139   1e-34   Sorghum bicolor [broomcorn]
ref|XP_004986236.1|  PREDICTED: late embryogenesis abundant prote...    139   1e-34   
ref|XP_010679062.1|  PREDICTED: late embryogenesis abundant prote...    137   6e-34   
ref|XP_010679056.1|  PREDICTED: late embryogenesis abundant prote...    133   2e-32   
ref|XP_002971638.1|  hypothetical protein SELMODRAFT_172144             132   2e-32   
ref|XP_002965692.1|  hypothetical protein SELMODRAFT_84789              132   3e-32   
dbj|BAJ96619.1|  predicted protein                                      132   3e-32   
ref|XP_008651207.1|  PREDICTED: late embryogenesis abundant prote...    131   1e-31   
ref|XP_006347861.1|  PREDICTED: late embryogenesis abundant prote...    129   1e-31   
dbj|BAK03375.1|  predicted protein                                      130   2e-31   
ref|XP_011091040.1|  PREDICTED: late embryogenesis abundant prote...    131   3e-31   
ref|XP_004230131.1|  PREDICTED: late embryogenesis abundant prote...    127   5e-31   
gb|EPS67127.1|  hypothetical protein M569_07649                         125   8e-31   
gb|KDP23618.1|  hypothetical protein JCGZ_23451                         126   2e-30   
ref|XP_006394999.1|  hypothetical protein EUTSA_v10004958mg             125   2e-30   
ref|XP_009597797.1|  PREDICTED: late embryogenesis abundant prote...    125   2e-30   
ref|XP_009394613.1|  PREDICTED: late embryogenesis abundant prote...    127   3e-30   
ref|XP_011091892.1|  PREDICTED: late embryogenesis abundant prote...    126   3e-30   
gb|KFK26460.1|  hypothetical protein AALP_AA8G252100                    124   5e-30   
ref|XP_010674900.1|  PREDICTED: late embryogenesis abundant prote...    124   7e-30   
emb|CDY52497.1|  BnaAnng11440D                                          123   8e-30   
ref|XP_009129849.1|  PREDICTED: late embryogenesis abundant prote...    123   9e-30   
emb|CDY50578.1|  BnaC02g39520D                                          123   9e-30   
gb|EAZ00817.1|  hypothetical protein OsI_22847                          125   1e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_008369302.1|  PREDICTED: late embryogenesis abundant prote...    121   1e-29   
emb|CDX86185.1|  BnaA06g29020D                                          123   1e-29   
gb|EYU45247.1|  hypothetical protein MIMGU_mgv1a013828mg                123   2e-29   
ref|XP_006289560.1|  hypothetical protein CARUB_v10003106mg             122   3e-29   
ref|XP_002874409.1|  seed maturation family protein                     122   4e-29   
ref|XP_010421659.1|  PREDICTED: late embryogenesis abundant prote...    121   4e-29   
ref|XP_010455160.1|  PREDICTED: late embryogenesis abundant prote...    121   4e-29   
ref|XP_010494063.1|  PREDICTED: late embryogenesis abundant prote...    121   5e-29   
ref|XP_008450758.1|  PREDICTED: late embryogenesis abundant prote...    120   5e-29   
emb|CDX80679.1|  BnaC07g27650D                                          121   5e-29   
ref|NP_198150.1|  Seed maturation protein                               121   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151232.1|  PREDICTED: late embryogenesis abundant prote...    121   6e-29   
ref|XP_009774312.1|  PREDICTED: late embryogenesis abundant prote...    121   9e-29   
ref|NP_001057565.1|  Os06g0341300                                       122   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AIA57965.1|  late embryogenesis abundant protein 6                   118   2e-28   
emb|CDP08585.1|  unnamed protein product                                119   3e-28   
ref|NP_001051258.2|  Os03g0747400                                       121   3e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AFW67487.1|  hypothetical protein ZEAMMB73_891670                    119   4e-28   
emb|CDP08584.1|  unnamed protein product                                119   4e-28   
gb|AFW67486.1|  hypothetical protein ZEAMMB73_891670                    118   5e-28   
ref|XP_010249416.1|  PREDICTED: late embryogenesis abundant prote...    119   6e-28   
ref|XP_009111929.1|  PREDICTED: late embryogenesis abundant prote...    118   1e-27   
emb|CDY19705.1|  BnaA09g03580D                                          118   1e-27   
ref|XP_011091039.1|  PREDICTED: LOW QUALITY PROTEIN: late embryog...    118   1e-27   
gb|AJA33581.1|  late embryogenesis abundant protein LEA7-2              119   3e-27   
ref|XP_003596350.1|  Late embryogenesis abundant protein D-34           116   7e-27   
ref|XP_003596349.1|  Late embryogenesis abundant protein D-34           117   7e-27   
ref|XP_003571800.1|  PREDICTED: late embryogenesis abundant prote...    117   8e-27   
ref|XP_004965453.1|  PREDICTED: late embryogenesis abundant prote...    117   2e-26   
ref|XP_004304719.1|  PREDICTED: late embryogenesis abundant prote...    115   3e-26   
ref|XP_008374066.1|  PREDICTED: late embryogenesis abundant prote...    111   6e-26   
ref|XP_007034768.1|  Late embryogenesis abundant protein D-34 iso...    112   6e-26   
ref|XP_002453796.1|  hypothetical protein SORBIDRAFT_04g017790          115   6e-26   Sorghum bicolor [broomcorn]
ref|XP_010468377.1|  PREDICTED: late embryogenesis abundant prote...    109   2e-25   
gb|EYU20966.1|  hypothetical protein MIMGU_mgv1a019437mg                108   3e-25   
ref|XP_003596348.1|  Late embryogenesis abundant protein D-34           108   8e-25   
gb|KFK42672.1|  hypothetical protein AALP_AA1G024900                    108   2e-24   
gb|ABD32976.1|  Seed maturation protein                                 107   2e-24   Medicago truncatula
ref|XP_009119571.1|  PREDICTED: late embryogenesis abundant prote...    107   3e-24   
emb|CDY18152.1|  BnaC05g01750D                                          106   1e-23   
ref|XP_006656949.1|  PREDICTED: late embryogenesis abundant prote...    107   2e-23   
gb|EMT23291.1|  hypothetical protein F775_14150                         105   3e-23   
ref|XP_010474918.1|  PREDICTED: late embryogenesis abundant prote...    105   3e-23   
ref|XP_001781683.1|  predicted protein                                  107   4e-23   
ref|XP_004489023.1|  PREDICTED: late embryogenesis abundant prote...    105   5e-23   
ref|NP_171811.1|  responsive to abscisic acid 28                        103   8e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305695.1|  hypothetical protein CARUB_v10010425mg             103   1e-22   
ref|XP_003575514.1|  PREDICTED: late embryogenesis abundant prote...    104   2e-22   
ref|XP_010474927.1|  PREDICTED: late embryogenesis abundant prote...    101   6e-22   
ref|XP_010522730.1|  PREDICTED: late embryogenesis abundant prote...  99.4    9e-22   
ref|XP_006826269.1|  hypothetical protein AMTR_s00004p00042590          102   1e-21   
ref|XP_010481583.1|  PREDICTED: late embryogenesis abundant prote...    100   1e-21   
gb|ABD32975.1|  Seed maturation protein                               97.8    2e-21   Medicago truncatula
ref|XP_002963793.1|  hypothetical protein SELMODRAFT_25885              100   3e-21   
gb|EEE65653.1|  hypothetical protein OsJ_21239                          100   6e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007034769.1|  Late embryogenesis abundant protein D-34 iso...  98.6    6e-21   
ref|XP_002974882.1|  hypothetical protein SELMODRAFT_15747            99.0    1e-20   
ref|XP_010556781.1|  PREDICTED: late embryogenesis abundant prote...  97.8    2e-20   
ref|XP_001773842.1|  predicted protein                                98.6    4e-20   
ref|XP_003538057.1|  PREDICTED: late embryogenesis abundant prote...  94.0    2e-19   
ref|XP_010041765.1|  PREDICTED: late embryogenesis abundant prote...  93.2    8e-19   
gb|ABF98858.1|  Seed maturation protein                               92.4    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|WP_033581568.1|  hypothetical protein                             87.4    2e-17   
ref|XP_010104157.1|  hypothetical protein L484_001468                 86.7    3e-17   
ref|XP_007149042.1|  hypothetical protein PHAVU_005G035800g           88.2    3e-17   
gb|AJA33582.1|  late embryogenesis abundant protein LEA7-3            88.6    1e-16   
ref|XP_010679061.1|  PREDICTED: late embryogenesis abundant prote...  85.9    1e-16   
ref|XP_002889438.1|  predicted protein                                85.9    2e-16   
ref|XP_008338157.1|  PREDICTED: late embryogenesis abundant prote...  85.1    2e-16   
ref|XP_010248421.1|  PREDICTED: uncharacterized protein LOC104591312  85.5    7e-16   
ref|XP_009400094.1|  PREDICTED: late embryogenesis abundant prote...  84.0    2e-15   
ref|XP_002314696.1|  hypothetical protein POPTR_0010s09710g           82.8    2e-15   Populus trichocarpa [western balsam poplar]
gb|AAK71550.1|AC087852_10  putative embryonic cell protein            84.0    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AIA57964.1|  late embryogenesis abundant protein 4                 81.6    4e-15   
ref|XP_008796769.1|  PREDICTED: late embryogenesis abundant prote...  82.8    5e-15   
ref|XP_004973274.1|  PREDICTED: late embryogenesis abundant prote...  81.6    8e-15   
gb|KHG09692.1|  Late embryogenesis abundant D-34                      79.7    3e-14   
ref|XP_010045839.1|  PREDICTED: late embryogenesis abundant prote...  80.1    4e-14   
gb|KCW84218.1|  hypothetical protein EUGRSUZ_B010842                  75.1    4e-13   
ref|XP_002467200.1|  hypothetical protein SORBIDRAFT_01g021320        76.3    4e-13   Sorghum bicolor [broomcorn]
ref|XP_002444221.1|  hypothetical protein SORBIDRAFT_07g015410        75.9    8e-13   Sorghum bicolor [broomcorn]
gb|EMT30483.1|  hypothetical protein F775_15742                       74.3    5e-12   
ref|XP_011021869.1|  PREDICTED: LOW QUALITY PROTEIN: late embryog...  69.3    7e-11   
dbj|BAK08023.1|  predicted protein                                    70.1    2e-10   
gb|EMS46184.1|  hypothetical protein TRIUR3_05231                     67.0    3e-10   
ref|XP_002463880.1|  hypothetical protein SORBIDRAFT_01g008200        66.6    2e-09   Sorghum bicolor [broomcorn]
ref|NP_200139.1|  Seed maturation protein                             65.5    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AHJ80898.1|  late embryogenesis abundant protein                   62.4    5e-09   
ref|XP_010482716.1|  PREDICTED: late embryogenesis abundant prote...  65.1    5e-09   
ref|XP_010524021.1|  PREDICTED: late embryogenesis abundant prote...  64.3    8e-09   
ref|NP_200138.1|  Seed maturation protein                             64.3    8e-09   
ref|XP_010442884.1|  PREDICTED: late embryogenesis abundant prote...  63.9    1e-08   
gb|EPS71362.1|  hypothetical protein M569_03400                       62.8    2e-08   
ref|XP_006651816.1|  PREDICTED: late embryogenesis abundant prote...  61.6    4e-08   
ref|XP_002865961.1|  predicted protein                                62.0    5e-08   
ref|XP_010442883.1|  PREDICTED: late embryogenesis abundant prote...  60.1    2e-07   
ref|XP_004952922.1|  PREDICTED: late embryogenesis abundant prote...  60.1    3e-07   
ref|XP_004986565.1|  PREDICTED: late embryogenesis abundant prote...  58.9    4e-07   
ref|XP_008451148.1|  PREDICTED: late embryogenesis abundant prote...  57.8    6e-07   
ref|XP_002865960.1|  predicted protein                                57.8    1e-06   
ref|XP_006281492.1|  hypothetical protein CARUB_v10027585mg           57.4    1e-06   
ref|XP_010445672.1|  PREDICTED: late embryogenesis abundant prote...  57.4    2e-06   
ref|XP_006401725.1|  hypothetical protein EUTSA_v10015357mg           57.4    2e-06   
ref|XP_010482715.1|  PREDICTED: late embryogenesis abundant prote...  57.0    2e-06   
gb|KFK26949.1|  hypothetical protein AALP_AA8G314400                  56.6    2e-06   
gb|EAZ28574.1|  hypothetical protein OsJ_12559                        55.1    5e-06   
ref|XP_009127182.1|  PREDICTED: late embryogenesis abundant prote...  55.5    7e-06   
emb|CDY49176.1|  BnaA02g10350D                                        55.5    7e-06   
ref|XP_009132660.1|  PREDICTED: late embryogenesis abundant prote...  55.1    1e-05   
gb|KCW84219.1|  hypothetical protein EUGRSUZ_B010841                  53.9    1e-05   
gb|EMS62850.1|  hypothetical protein TRIUR3_20788                     54.3    1e-05   
ref|XP_006281995.1|  hypothetical protein CARUB_v10028222mg           54.7    1e-05   
ref|XP_004955035.1|  PREDICTED: late embryogenesis abundant prote...  53.1    3e-05   
ref|XP_008665412.1|  PREDICTED: late embryogenesis abundant prote...  53.5    4e-05   
ref|XP_004955033.1|  PREDICTED: late embryogenesis abundant prote...  52.8    5e-05   
gb|EMT14134.1|  hypothetical protein F775_52423                       53.1    7e-05   
gb|EMS62093.1|  hypothetical protein TRIUR3_32520                     52.0    9e-05   
ref|XP_004955037.1|  PREDICTED: late embryogenesis abundant prote...  51.6    1e-04   
emb|CDP03643.1|  unnamed protein product                              50.4    1e-04   
ref|XP_002978534.1|  hypothetical protein SELMODRAFT_443867           52.8    4e-04   
ref|XP_008665411.1|  PREDICTED: late embryogenesis abundant prote...  50.4    5e-04   



>gb|EYU40913.1| hypothetical protein MIMGU_mgv1a025482mg [Erythranthe guttata]
Length=256

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 194/263 (74%), Gaps = 9/263 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP  GD   +KYGDVFDVSGQLA++PI  QDAAA+Q+AEN   GQT  GGPA+
Sbjct  1    MSQEQPRRP--GD--AVKYGDVFDVSGQLASQPIAPQDAAALQAAENIVLGQTPHGGPAS  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +MQSAA  N +   V   ++T  V ++G +V E D+ G R +TEA+GG VVG+Y      
Sbjct  57   LMQSAADLNEQRGVVGHQDMTAAVMDKGATVAEADVGGYRIITEAVGGQVVGRY----GM  112

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
              T      P++ + +D ITIGEALEATAISAGDKPV +SDAAAIQAAEVRATGLGH++P
Sbjct  113  PTTEVKTGQPSSTLDADAITIGEALEATAISAGDKPVDQSDAAAIQAAEVRATGLGHVVP  172

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK-  917
            GG+GA AQ AA  NA+TT DE K K+GD+LTDA+ K+  DK VT EDA GV+ AE RNK 
Sbjct  173  GGLGAQAQSAAAYNAQTTRDEDKAKLGDILTDATLKMAGDKAVTREDAEGVIYAEIRNKQ  232

Query  918  EDHATHPagvaasmaaaaaLNQE  986
            ED ATHP GVAAS+AAAA LNQE
Sbjct  233  EDMATHPGGVAASVAAAARLNQE  255



>ref|XP_009802733.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
sylvestris]
Length=260

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 185/261 (71%), Gaps = 2/261 (1%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            M+Q+Q      G  EPIKYGDVF+VS QLA+KP+  QD   MQSAE  A G   +GGPA+
Sbjct  1    MNQEQPML--HGGSEPIKYGDVFEVSSQLASKPVAPQDVTIMQSAETIALGHVPRGGPAS  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +MQSAAA+N     V  D++TD+ R++GV+V + ++ G R V+EA+ G+VVG+YI P   
Sbjct  59   IMQSAAAQNEHLGAVSRDDMTDITRDEGVTVSQAEVGGTRLVSEAVAGEVVGQYIYPSEA  118

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                     P  G  S+  TIGEALEA A++AGDKP+ +SDAAAIQAAEVRATGL  ++P
Sbjct  119  GDGERAARYPTTGAQSESTTIGEALEAVALTAGDKPIEQSDAAAIQAAEVRATGLAEVMP  178

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+GA+AQ AA INARTT ++ KT + DVLTDA+S+L  DK V  EDA GVV AE R K 
Sbjct  179  GGIGAEAQHAAAINARTTPEDDKTSLSDVLTDATSRLIGDKAVKKEDAEGVVGAEIRAKR  238

Query  921  DHATHPagvaasmaaaaaLNQ  983
            D ATHP GVAASMA A++LN+
Sbjct  239  DLATHPGGVAASMAVASSLNE  259



>ref|XP_010277180.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nelumbo 
nucifera]
Length=259

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/261 (57%), Positives = 181/261 (69%), Gaps = 4/261 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQQQ +RP++  QEP+KYGDVF VSG LA+KPI  QDA+ MQSAEN   G+T KGG AA
Sbjct  1    MSQQQPQRPQAEQQEPVKYGDVFPVSGDLASKPIKPQDASLMQSAENLVIGRTPKGGVAA  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAAA N R   V  D+VTD+ +++GV+V E D+ GR  +TEA+G +VVG+Y      
Sbjct  61   TMQSAAATNERTGHVGHDDVTDITKDRGVTVTETDLPGRSIITEAVGDEVVGQY----TL  116

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
               P        G     ITIGEALEATA+ +GDKPV +SDAAAIQAAEVRATGL   +P
Sbjct  117  PGAPMTTAAGGTGDGPHPITIGEALEATAMVSGDKPVDQSDAAAIQAAEVRATGLNVNIP  176

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GGVGA+AQ AA +N R   DE K  +G+VLTDA++KL  DKP T  DA  VV AE RN  
Sbjct  177  GGVGAEAQSAANVNERAIRDEDKVTLGEVLTDATAKLVRDKPATRRDAERVVGAELRNNS  236

Query  921  DHATHPagvaasmaaaaaLNQ  983
            + +THP GVAA++  AA LNQ
Sbjct  237  NVSTHPGGVAAAVTEAARLNQ  257



>ref|XP_008451333.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
melo]
Length=258

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 188/261 (72%), Gaps = 6/261 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q +RP   +Q+PIKYGDVFDVSG+LA+KPI  +DAA +Q+AEN   GQT +GGPAA
Sbjct  1    MSQAQPQRPAEDNQDPIKYGDVFDVSGELASKPIAPRDAATLQAAENMVLGQTPRGGPAA  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  N R   V   +VTDV   +GV+V E  + G+RFV E++GG VVG++++P   
Sbjct  61   VMQSAANLNERAGLVGHSDVTDVAVNEGVNVTETVVDGQRFVVESVGGQVVGQFVQPNVP  120

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
             ++P         +  D I+IGEALEA+A+SAGDKP+ +SDAAAIQAAE+RATG   I+P
Sbjct  121  MRSPGAT------LDKDSISIGEALEASAVSAGDKPIDQSDAAAIQAAELRATGENKIIP  174

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+GA+AQ AA +N R   +E KT +GD+LTDA+ KL  DK VT EDA  V++AE RN  
Sbjct  175  GGIGAEAQSAATLNTRAMRNEDKTTLGDILTDATRKLPGDKTVTKEDAERVISAEIRNAP  234

Query  921  DHATHPagvaasmaaaaaLNQ  983
              AT P GVAAS+AAAA LNQ
Sbjct  235  TMATTPGGVAASVAAAARLNQ  255



>ref|XP_004146999.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
 gb|KGN44800.1| hypothetical protein Csa_7G388330 [Cucumis sativus]
Length=259

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 194/264 (73%), Gaps = 9/264 (3%)
 Frame = +3

Query  201  MSQQQARRPESGD--QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ Q +RP +GD  ++P+KYGDVFDVSG+LA+KPI  +DAA++Q+AEN   GQT +GGP
Sbjct  1    MSQGQPQRP-AGDNYKDPVKYGDVFDVSGELASKPIAPRDAASLQAAENIILGQTPRGGP  59

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AAVMQSAA  N R   V   +VTDV   +GV+V E  + G+RFV E++GG +VG++++P 
Sbjct  60   AAVMQSAANLNERAGLVGHSDVTDVALNEGVNVTETVVDGQRFVVESVGGQIVGRFVQPN  119

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
               ++P         + +D I+IGEALEA+A+SAGDKP+ +SDAAAIQAAEVRATG  +I
Sbjct  120  VPMRSPGAT------LDNDSISIGEALEASAVSAGDKPINQSDAAAIQAAEVRATGENNI  173

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            +PGG+GA+AQ AA +N R   +E KT +GD+LTDA+ KL  DK VT EDA  V++AE RN
Sbjct  174  IPGGIGAEAQSAATLNTRVMLNENKTTLGDILTDATRKLPGDKTVTKEDAERVISAEIRN  233

Query  915  KEDHATHPagvaasmaaaaaLNQE  986
                AT P GVAAS+AAAA LNQ+
Sbjct  234  DLKMATTPGGVAASVAAAARLNQQ  257



>ref|XP_004169378.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
Length=259

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 194/264 (73%), Gaps = 9/264 (3%)
 Frame = +3

Query  201  MSQQQARRPESGD--QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ Q +RP +GD  ++P+KYGDVFDVSG+LA+KPI  +DAA++Q+AEN   GQT +GGP
Sbjct  1    MSQGQPQRP-AGDNYKDPVKYGDVFDVSGELASKPIAPRDAASLQAAENIILGQTPRGGP  59

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AAVMQSAA  N R   V   +VTDV   +GV+V E  + G+RFV E++GG +VG++++P 
Sbjct  60   AAVMQSAANLNERAGLVGHSDVTDVALNEGVNVTETVVDGQRFVVESVGGQIVGRFVQPN  119

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
               ++P         + +D I+IGEALEA+A+SAGDKP+ +SDAAAIQAAEVRATG  +I
Sbjct  120  VPMRSPGAT------LDNDSISIGEALEASAVSAGDKPITQSDAAAIQAAEVRATGENNI  173

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            +PGG+GA+AQ AA +N R   +E KT +GD+LTDA+ KL  DK VT EDA  V++AE RN
Sbjct  174  IPGGIGAEAQSAATLNTRVMLNENKTTLGDILTDATRKLPGDKTVTKEDAERVISAEIRN  233

Query  915  KEDHATHPagvaasmaaaaaLNQE  986
                AT P GVAAS+AAAA LNQ+
Sbjct  234  DLKMATTPGGVAASVAAAARLNQQ  257



>emb|CAN76722.1| hypothetical protein VITISV_029641 [Vitis vinifera]
Length=259

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 181/263 (69%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQQQ  RP     EPIKY DVF VSG LA+KPI  QDAA MQSAENT  G T KGGPAA
Sbjct  1    MSQQQRPRPTQPTTEPIKYSDVFPVSGSLASKPIAPQDAATMQSAENTVLGNTQKGGPAA  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VM SAA +N R   V  + VTDVV   GV++ + ++AG R +TEA+G  VVG+Y RPP  
Sbjct  61   VMNSAATKNERAGLVSHEQVTDVVATDGVTISQANVAGSRIITEAVGDQVVGEYARPPPV  120

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
              T P        +  D ITIGEAL+ATA+SAG+KPV +SDAAAIQ AE+RATG   ++P
Sbjct  121  AMTSPAS-----ALDRDAITIGEALQATALSAGNKPVDQSDAAAIQVAEMRATGSSEVVP  175

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NAR   DE KTK+ D+LTDA++KL DDKP T EDA  V+ AE RN  
Sbjct  176  GGIAAQAQSAATTNARVILDENKTKLSDILTDATAKLPDDKPATREDAERVIGAELRNDP  235

Query  921  DHATHPagvaasmaaaaaLNQET  989
            +  T+P GVA S+AAAA LNQ T
Sbjct  236  NMVTYPGGVAESVAAAARLNQST  258



>ref|XP_010651983.1| PREDICTED: late embryogenesis abundant protein D-34 [Vitis vinifera]
Length=259

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 181/263 (69%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQQQ  RP     EPIKY DVF VSG LA+KPI  QDAA MQSAENT  G T KGGPAA
Sbjct  1    MSQQQRPRPTQPTTEPIKYSDVFPVSGSLASKPIAPQDAATMQSAENTVLGNTQKGGPAA  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VM SAA +N R   V  + VTDVV   GV++ + ++AG R +TEA+G  VVG+Y RPP  
Sbjct  61   VMNSAATKNERAGLVSHEQVTDVVATDGVTISQANVAGSRIITEAVGDQVVGEYARPPPV  120

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
              T P        +  D ITIGEAL+ATA+SAG+KPV +SDAAAIQ AE+RATG   ++P
Sbjct  121  AMTSPAS-----ALDRDAITIGEALQATALSAGNKPVDQSDAAAIQVAEMRATGSSEVVP  175

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NAR   DE KTK+ D+LTDA++KL DDKP T EDA  V+ AE RN  
Sbjct  176  GGIAAQAQSAATTNARLILDENKTKLSDILTDATAKLPDDKPATREDAERVIGAELRNDP  235

Query  921  DHATHPagvaasmaaaaaLNQET  989
            +  T+P GVA S+AAAA LNQ T
Sbjct  236  NMVTYPGGVAESVAAAARLNQST  258



>emb|CBI28707.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 181/263 (69%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQQQ  RP     EPIKY DVF VSG LA+KPI  QDAA MQSAENT  G T KGGPAA
Sbjct  1    MSQQQRPRPTQPTTEPIKYSDVFPVSGSLASKPIAPQDAATMQSAENTVLGNTQKGGPAA  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VM SAA +N R   V  + VTDVV   GV++ + ++AG R +TEA+G  VVG+Y RPP  
Sbjct  61   VMNSAATKNERAGLVSHEQVTDVVATDGVTISQANVAGSRIITEAVGDQVVGEYARPPPV  120

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
              T P        +  D ITIGEAL+ATA+SAG+KPV +SDAAAIQ AE+RATG   ++P
Sbjct  121  AMTSPAS-----ALDRDAITIGEALQATALSAGNKPVDQSDAAAIQVAEMRATGSSEVVP  175

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NAR   DE KTK+ D+LTDA++KL DDKP T EDA  V+ AE RN  
Sbjct  176  GGIAAQAQSAATTNARLILDENKTKLSDILTDATAKLPDDKPATREDAERVIGAELRNDP  235

Query  921  DHATHPagvaasmaaaaaLNQET  989
            +  T+P GVA S+AAAA LNQ T
Sbjct  236  NMVTYPGGVAESVAAAARLNQST  258



>ref|XP_009620120.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
tomentosiformis]
Length=262

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 180/258 (70%), Gaps = 10/258 (4%)
 Frame = +3

Query  240  QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrna  419
            ++PIKYGDVF+VS QLA+KP+  QDA  MQSAE+ A G   KGGPA++MQSA A+N R  
Sbjct  4    EQPIKYGDVFEVSSQLASKPVAPQDATIMQSAESIALGHVPKGGPASIMQSATAQNERIG  63

Query  420  rvDPDNVTDVVREQGVSVKEDDIAGRR----------FVTEAIGGDVVGKYIRppaeekt  569
             V  D++TD+ R++GV+V + ++ G R          F   ++   VVG+YI P      
Sbjct  64   AVSRDDMTDIARDEGVTVSQAEVGGTRSILAGLTLALFQKLSVARYVVGQYIYPSEAGDG  123

Query  570  pppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGV  749
                  P  GV S+  TIGEALEA A++AGDKP+ +SDAAAIQAAEVRATGLG ++PGG+
Sbjct  124  ERAARYPTTGVQSESTTIGEALEAVALTAGDKPIEQSDAAAIQAAEVRATGLGEVMPGGI  183

Query  750  GADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHA  929
            GA+AQ AA INARTT ++ KT + DVLTDA+S+L  DK V  EDA GVV AE R K D A
Sbjct  184  GAEAQHAAAINARTTPEDDKTTLSDVLTDATSRLIGDKAVKKEDAEGVVGAEIRTKSDLA  243

Query  930  THPagvaasmaaaaaLNQ  983
            THP GVAASMA A++LN+
Sbjct  244  THPGGVAASMAVASSLNE  261



>ref|XP_009764712.1| PREDICTED: uncharacterized protein LOC104216384 [Nicotiana sylvestris]
Length=856

 Score =   241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 167/231 (72%), Gaps = 2/231 (1%)
 Frame = +3

Query  252  KYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvDP  431
            KYGDVF+VS ++A+KPI  +DAA++QSAEN   G   KGGPA++MQSAA  N R   V  
Sbjct  610  KYGDVFEVSEKIASKPIAPKDAASIQSAENKELGHIPKGGPASIMQSAAVLNQRFGGVGR  669

Query  432  DNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR--ppaeektpppppppaaGVV  605
            +++TD+ R++GV+V + +I G   VTEA+GG+V+ +Y                     + 
Sbjct  670  NDMTDIARDKGVTVSQTEIEGTPIVTEAVGGEVLAQYTHPSTGGGGGGGGSTVEATLSLD  729

Query  606  SDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINA  785
            +D +TIGEALE  A+SAGDKPV +SDAAAIQAAEVRATGLGH++PGGVGA+AQRAA +N 
Sbjct  730  ADVVTIGEALELAALSAGDKPVDESDAAAIQAAEVRATGLGHVVPGGVGAEAQRAAAVNI  789

Query  786  RTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHP  938
            RTT DE KTK+ DVLTDA+SKL D KPVT EDA GVV AE RNK D ATHP
Sbjct  790  RTTRDEQKTKLSDVLTDATSKLVDYKPVTKEDALGVVGAEIRNKPDLATHP  840



>sp|P09444.1|LEA34_GOSHI RecName: Full=Late embryogenesis abundant protein D-34; Short=LEA 
D-34
 emb|CAA31594.1| D-34 Lea protein [Gossypium hirsutum]
 gb|AAA33075.1| storage protein [Gossypium hirsutum]
 prf||1601521F Lea D-34 gene
Length=264

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 139/251 (55%), Positives = 172/251 (69%), Gaps = 11/251 (4%)
 Frame = +3

Query  201  MSQQQARRPESG-----DQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIK  365
            MSQ Q RRP+       +QEPIKYGDVF+VSG+LA KPI  QDAA MQ+AE    GQT K
Sbjct  1    MSQGQPRRPQQPAGQGENQEPIKYGDVFNVSGELANKPIAPQDAAMMQTAETQVLGQTQK  60

Query  366  GGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYI  545
            GG AAVMQ+AA RN +   V  +++TD+  EQGV++ E D+AGRR +TEA+ G VVG+Y+
Sbjct  61   GGTAAVMQAAATRNEQVGVVGHNDITDIAGEQGVTLAETDVAGRRIITEAVAGQVVGQYV  120

Query  546  RppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGL  725
            +      +          V+ + ITIGEALEATA +AGDKPV +SDAAA+QAAEVRATG 
Sbjct  121  QATPVMTSQVGV------VLQNAITIGEALEATAKTAGDKPVDQSDAAAVQAAEVRATGS  174

Query  726  GHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
              I+PGG+ A AQ AA  NA    DE K K+  VLT A++KL  DK VT +DA GVV+AE
Sbjct  175  NVIIPGGLAATAQSAAAHNATLDRDEEKIKLNQVLTGATAKLPADKAVTRQDAEGVVSAE  234

Query  906  ARNKEDHATHP  938
             RN  + ATHP
Sbjct  235  LRNNPNVATHP  245



>ref|XP_002520716.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
 gb|EEF41678.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
Length=256

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 180/262 (69%), Gaps = 9/262 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q RRPES DQ+P++YGDVFDV G LA KPI  +DAA+MQSAEN   G+T   GPAA
Sbjct  1    MSQGQPRRPES-DQDPVRYGDVFDVQGNLATKPIAPRDAASMQSAENQVLGETQITGPAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  NVR   V P +VTDVVR+QGV+V E +I   R VTE +G +VVG+++     
Sbjct  60   VMQSAATVNVRRGAVSPYDVTDVVRDQGVTVTEANIGSTRIVTERVGAEVVGQFVDTRVP  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                P            DITIGEALEATA S AGDKP+ +SDAAAI+AAEVRA       
Sbjct  120  VDAYPAGSDM-------DITIGEALEATAYSAAGDKPIDQSDAAAIKAAEVRALRSNETP  172

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
             GG+GA AQ AA+INAR   DE KT + DVL+DA+++L  D+ V  EDA GV++AE RNK
Sbjct  173  LGGIGAQAQSAADINARVMRDEDKTTLSDVLSDATAQLPADRAVRREDAEGVISAEIRNK  232

Query  918  EDHATHPagvaasmaaaaaLNQ  983
             D  T P GVAASMAAAA LNQ
Sbjct  233  PDMRTTPGGVAASMAAAARLNQ  254



>ref|XP_002520715.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
 gb|EEF41677.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
Length=257

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 169/244 (69%), Gaps = 8/244 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q +RP+   ++PI+YGDVF+V G LA+K I   DA+ MQSAENT  G+T KGGPA+
Sbjct  1    MSQEQPQRPQPV-KDPIRYGDVFNVHGDLASKVIAPVDASTMQSAENTVLGETRKGGPAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  NVR   VDP   T+V  + G  V E+++ G R +TE I G VV +YI P AE
Sbjct  60   VMQSAARVNVRQGLVDPHQATEVAGDPGTKVTEENVGGDRIITETIAGQVVAQYIEPRAE  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
              TP         +    ITIGEALEATA+S+G+KP+ +SDAAAIQAAEVRATG+  +LP
Sbjct  120  RTTPGG------ALDPRSITIGEALEATALSSGEKPIDQSDAAAIQAAEVRATGIAEVLP  173

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+GA+AQ AA  N R   D+ KTK+ DVL DA+ KL  DKPVT EDA  V+ AE RNK 
Sbjct  174  GGIGAEAQSAATRNPRAPRDQDKTKLSDVLMDATLKLPADKPVTREDAHAVIEAEVRNKP  233

Query  921  D-HA  929
            D HA
Sbjct  234  DMHA  237



>ref|XP_003590628.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
 gb|AES60879.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=264

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 184/269 (68%), Gaps = 14/269 (5%)
 Frame = +3

Query  201  MSQQQARRPES---GDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQ+Q +RP++    +QEPIKYGDVF+VSG+LA++PI  +DAA MQ+ EN A GQT KG 
Sbjct  1    MSQEQPQRPQAEQFSEQEPIKYGDVFNVSGELASQPIKPRDAALMQATENQALGQTQKGS  60

Query  372  PAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRp  551
            PA+VMQSAAA N     V   +++D+ + QG+SV +  +   R +TE++G  VVG+++ P
Sbjct  61   PASVMQSAAAVNTAAGLVSHGDISDIAKNQGMSVSKTKVGANRVITESVGSQVVGQFVEP  120

Query  552  paeektpppppppaaGVVSDD--ITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATG  722
                  P        G+V D   ITIGEALEA+A+S AGDKP+ +SDAAAIQAAE+RATG
Sbjct  121  DVPMNDP--------GLVLDKNAITIGEALEASALSQAGDKPLDQSDAAAIQAAEMRATG  172

Query  723  LGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNA  902
              H  PGG+GA AQ AA  N RT  D  KT +GDV++ A  KL  DK VT EDA GV+ A
Sbjct  173  KNHTEPGGLGAIAQSAATRNTRTMPDLQKTTLGDVVSGAREKLGSDKAVTREDAEGVIGA  232

Query  903  EARNKEDHATHPagvaasmaaaaaLNQET  989
            E RNK D  T P GVAASMAAAA LNQ T
Sbjct  233  ELRNKADMRTKPGGVAASMAAAATLNQNT  261



>ref|XP_003590627.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
Length=292

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 184/269 (68%), Gaps = 14/269 (5%)
 Frame = +3

Query  201  MSQQQARRPES---GDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQ+Q +RP++    +QEPIKYGDVF+VSG+LA++PI  +DAA MQ+ EN A GQT KG 
Sbjct  1    MSQEQPQRPQAEQFSEQEPIKYGDVFNVSGELASQPIKPRDAALMQATENQALGQTQKGS  60

Query  372  PAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRp  551
            PA+VMQSAAA N     V   +++D+ + QG+SV +  +   R +TE++G  VVG+++ P
Sbjct  61   PASVMQSAAAVNTAAGLVSHGDISDIAKNQGMSVSKTKVGANRVITESVGSQVVGQFVEP  120

Query  552  paeektpppppppaaGVVSDD--ITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATG  722
                  P        G+V D   ITIGEALEA+A+S AGDKP+ +SDAAAIQAAE+RATG
Sbjct  121  DVPMNDP--------GLVLDKNAITIGEALEASALSQAGDKPLDQSDAAAIQAAEMRATG  172

Query  723  LGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNA  902
              H  PGG+GA AQ AA  N RT  D  KT +GDV++ A  KL  DK VT EDA GV+ A
Sbjct  173  KNHTEPGGLGAIAQSAATRNTRTMPDLQKTTLGDVVSGAREKLGSDKAVTREDAEGVIGA  232

Query  903  EARNKEDHATHPagvaasmaaaaaLNQET  989
            E RNK D  T P GVAASMAAAA LNQ T
Sbjct  233  ELRNKADMRTKPGGVAASMAAAATLNQNT  261



>emb|CAA43046.1| embryonic cell protein [Daucus carota]
Length=256

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 178/250 (71%), Gaps = 9/250 (4%)
 Frame = +3

Query  249  IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvD  428
            IKYGDVFDVSGQL+++P+   DA+AMQ+AEN   G+T KGGPA+VMQSAAA N++   V 
Sbjct  15   IKYGDVFDVSGQLSSQPVAPNDASAMQAAENMVLGKTQKGGPASVMQSAAAANLQRGVVG  74

Query  429  PDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVV-  605
            P   T +  EQGV++ E +IAG R +TEA+GG VVG+Y+             P  AGV+ 
Sbjct  75   PHEGTPIASEQGVTISEAEIAGTRIITEAVGGQVVGQYLE------PGKFKMPSPAGVLG  128

Query  606  SDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINA  785
            SD ITIGEALE TA++AGDKPV +SDAAAIQAAEVRA+G  +  PGGV A AQ AA+ NA
Sbjct  129  SDSITIGEALETTALTAGDKPVDQSDAAAIQAAEVRASGYAY--PGGVAAAAQSAADYNA  186

Query  786  RTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaa  965
            RT     KTK+GDVL D S +L +DK VT EDA GVV AE RN  +  T+P GVA+SMAA
Sbjct  187  RTMNVASKTKLGDVLADRSIRLAEDKAVTREDAEGVVGAEVRNNPEMMTYPGGVASSMAA  246

Query  966  aaaLNQETAF  995
            AA LNQ+  F
Sbjct  247  AARLNQDPTF  256



>dbj|BAD86645.1| ECP31 protein [Daucus carota]
Length=256

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 178/249 (71%), Gaps = 7/249 (3%)
 Frame = +3

Query  249  IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvD  428
            IKYGDVFDVSGQL+++P+   DA+AMQ+AEN   G+T KGGPA+VMQSAAA N++   V 
Sbjct  15   IKYGDVFDVSGQLSSQPVAPNDASAMQAAENMVLGKTQKGGPASVMQSAAAANLQRGVVG  74

Query  429  PDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVS  608
                T +  EQGV++ E +IAG R +TEA+GG VVG+Y+ P   + T P        + S
Sbjct  75   RHEGTPIASEQGVTISEAEIAGTRIITEAVGGQVVGQYLEPGKFKMTSPAGA-----LGS  129

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D ITIGEALE TA++AGDKPV +SDAAAIQAAEVRA+G  H  PGGV A AQ AA+ NAR
Sbjct  130  DSITIGEALETTALTAGDKPVDQSDAAAIQAAEVRASGYAH--PGGVAAAAQSAADYNAR  187

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
            T     KTK+GDVL DAS +L +DK VT EDA GVV AE RN  +  T+P GVA+SMAAA
Sbjct  188  TMNVASKTKLGDVLADASIRLAEDKAVTREDAEGVVGAEVRNNPEMMTYPGGVASSMAAA  247

Query  969  aaLNQETAF  995
            A LNQ+  F
Sbjct  248  ARLNQDPTF  256



>ref|XP_011079873.1| PREDICTED: late embryogenesis abundant protein D-34-like [Sesamum 
indicum]
Length=259

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 183/262 (70%), Gaps = 5/262 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q RRP++G QE + YGD+F VSG+LA+KP+  +DAAA Q+AE+   GQT KGGPAA
Sbjct  1    MSQGQPRRPQAG-QEAVTYGDIFQVSGELASKPVAPKDAAAAQAAESIVLGQTQKGGPAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  NVR   + PD+VT+  RE GVS+ +DD+ G R +TE + G+VVG+Y    A 
Sbjct  60   VMQSAADMNVRRGVLGPDDVTEATREHGVSISQDDVGGHRVITECVAGEVVGRY----AV  115

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                 P  PP + +    +TIG+ALE+ A+SAG KPV +SDAAAIQA E RATG   ++P
Sbjct  116  AGEEGPAAPPLSALNPISMTIGQALESVALSAGVKPVDESDAAAIQAVESRATGRNQVIP  175

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GGV ++AQ AA+ NART  ++ K K+ DVL  A+ KL DD+ VT EDA   V AE RNK 
Sbjct  176  GGVASEAQSAAKHNARTMAEDKKIKLRDVLAGATWKLPDDRAVTKEDADAAVGAEIRNKA  235

Query  921  DHATHPagvaasmaaaaaLNQE  986
            D +T+P GVA SM AAA LNQ+
Sbjct  236  DMSTYPGGVAESMVAAARLNQQ  257



>ref|XP_006299031.1| hypothetical protein CARUB_v10015168mg [Capsella rubella]
 gb|EOA31929.1| hypothetical protein CARUB_v10015168mg [Capsella rubella]
Length=262

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 173/264 (66%), Gaps = 5/264 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+ Q RRP    QEP+KYGDVF+VSG+LA KPI  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQEEQPRRP----QEPVKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V P + TD+  E+GV+V + D+ G R  TE +GG VVG+Y+ P  
Sbjct  57   AVMQSAATANKRGGFVHPGDTTDLAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                           +   ITIGEALEAT  +AG+KPV +SDAAAIQAAEVRA+G   I 
Sbjct  117  VATAAATASEVLGLNLQSAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    DE K K+ DVL  A+ KL+ DK VT +DA GVV AE RN 
Sbjct  177  PGGISASAQSAANHNATVDRDEDKIKLIDVLAGATGKLSADKAVTRQDAEGVVTAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQET  989
             + +THP G+AAS+ AAA LNQ++
Sbjct  237  PNLSTHPGGIAASITAAARLNQKS  260



>ref|XP_004495192.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cicer 
arietinum]
Length=263

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 186/269 (69%), Gaps = 15/269 (6%)
 Frame = +3

Query  201  MSQQQARRP---ESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQ+Q  RP   E  +QEPIKYGDVF+VSG+LA +PI  +DAA MQ+ EN A GQT KGG
Sbjct  1    MSQEQPERPKRDEFPEQEPIKYGDVFNVSGELATQPIKPKDAALMQATENQALGQTQKGG  60

Query  372  PAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRp  551
            PA+VMQSAAA N     V+ ++++D+ + QGVSV    + G R +TE++G  V+G+++  
Sbjct  61   PASVMQSAAAVNTAAGLVNREDISDIAKNQGVSVSNMKVGGNRVITESVGSQVLGQFVE-  119

Query  552  paeektpppppppaaGVVSDD--ITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATG  722
                   P  P    G+V D   ITIGEALEA+A+S AG+K + +SDAAAIQAAE+RATG
Sbjct  120  -------PDVPMNDPGLVLDPEAITIGEALEASALSRAGNKALDQSDAAAIQAAEMRATG  172

Query  723  LGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNA  902
              H  PGG+GA+AQ AA  NART   + KT +GDV++ A  KL +DK VT EDA GV+ A
Sbjct  173  RNHTEPGGLGANAQAAATRNARTMPLQ-KTTLGDVVSGAREKLPEDKAVTREDAEGVIGA  231

Query  903  EARNKEDHATHPagvaasmaaaaaLNQET  989
            E RNK +  T P GVAAS+AAAA LNQ +
Sbjct  232  ELRNKPNMRTTPGGVAASLAAAATLNQNS  260



>ref|XP_010917736.1| PREDICTED: late embryogenesis abundant protein D-34-like [Elaeis 
guineensis]
Length=261

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 181/265 (68%), Gaps = 4/265 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RR +    EPIKYGDVF+V G+LA +P+  QDAA MQSAEN   GQT +GGPAA
Sbjct  1    MSQEQPRRTQPAQGEPIKYGDVFNVQGELACEPVAPQDAAMMQSAENQIIGQTQRGGPAA  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAAARN     V   +V+DV  +QGV+V E D+ G R VTE++GG VVG Y      
Sbjct  61   VMQSAAARNETAGLVGHRDVSDVPADQGVAVTETDLTGHRIVTESVGGQVVGSY----ET  116

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                     P  G+  D  TIG+ALEATA++AG KPV +SDAAAIQAAE RATGL  +LP
Sbjct  117  AAPVSTTALPTGGMYGDAFTIGDALEATAMTAGGKPVDQSDAAAIQAAEARATGLNEVLP  176

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GGVGA+AQ AA  N R   +E K K+ DVL+DA++KL  DK VT EDA  V  AE RN+ 
Sbjct  177  GGVGAEAQSAATANTRLMREENKIKLRDVLSDATTKLPGDKVVTREDADRVAGAEMRNRP  236

Query  921  DHATHPagvaasmaaaaaLNQETAF  995
            D +TH  GVAA++AAAA LNQ+  F
Sbjct  237  DVSTHTQGVAANVAAAARLNQDVQF  261



>ref|XP_003536910.2| PREDICTED: late embryogenesis abundant protein D-34-like [Glycine 
max]
Length=262

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 178/262 (68%), Gaps = 8/262 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q ++P+ G+Q+PIKYGDVF VS +LA KPI  +DAA MQ+ EN A GQT KGGPA+
Sbjct  1    MSQEQLKKPQ-GEQDPIKYGDVFKVSDELAFKPIAPRDAALMQATENQALGQTQKGGPAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  N+R   V   +++DV R +GVSV E  +   R +TE +G  VVG+++ P   
Sbjct  60   VMQSAATENLRAGVVGRQDISDVARNEGVSVTETKVGCHRVITEFVGRHVVGQFVEPDVP  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATGLGHIL  737
              TP         +  D ITIGEALEA+AI+ A DKPV +SDAAAIQAAE+RATG     
Sbjct  120  MNTPGT------ALERDAITIGEALEASAIAGASDKPVDESDAAAIQAAEMRATGKNETE  173

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+GA AQ AA  N RT +   KT + DVLTDA  KL  DK VT EDA GV+ AE RNK
Sbjct  174  PGGLGARAQSAATRNTRTVSHSHKTTLSDVLTDAKEKLPADKAVTREDAEGVIGAELRNK  233

Query  918  EDHATHPagvaasmaaaaaLNQ  983
             D  T P GVAASMAAAA LNQ
Sbjct  234  LDMRTTPGGVAASMAAAATLNQ  255



>gb|KHN03807.1| Late embryogenesis abundant protein D-34 [Glycine soja]
Length=284

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 179/264 (68%), Gaps = 8/264 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q ++P+ G+Q+PIKYGDVF VS +LA KPI  +DAA MQ+ EN A GQT KGGPA+
Sbjct  1    MSQEQLKKPQ-GEQDPIKYGDVFKVSDELAFKPIAPRDAALMQATENQALGQTQKGGPAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  N+R   V   +++DV R +GVSV E  +   R +TE +G  VVG+++ P   
Sbjct  60   VMQSAATENLRAGVVGRQDISDVARNEGVSVTETKVGCHRVITEFVGRHVVGQFVEPDVP  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATGLGHIL  737
              TP         +  D ITIGEALEA+AI+ A DKPV +SDAAA+QAAE+RATG     
Sbjct  120  MNTPGT------ALERDAITIGEALEASAIAGASDKPVDESDAAALQAAEMRATGKNETE  173

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+GA AQ AA  N RT +   KT + DVLTDA  KL  DK VT EDA GV+ AE RNK
Sbjct  174  PGGLGARAQSAATRNTRTVSHSHKTTLSDVLTDAKEKLPADKAVTREDAEGVIGAELRNK  233

Query  918  EDHATHPagvaasmaaaaaLNQET  989
             D  T P GVAASMAAAA LNQ +
Sbjct  234  LDMRTTPGGVAASMAAAATLNQNS  257



>emb|CDP12311.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 178/269 (66%), Gaps = 7/269 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEP-IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ   RRP+ GDQ   IKYGDVFDV   LA+K I  +DAAAMQ+AEN   GQT +GGPA
Sbjct  1    MSQDPPRRPQGGDQHYGIKYGDVFDVKEDLASKNIAPRDAAAMQAAENRVLGQTPRGGPA  60

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            +VMQSAA  N     V  D++TD+ R+QGV+V E    GRR + EA+GG VVG Y     
Sbjct  61   SVMQSAADVNQSLGVVGHDDITDITRDQGVNVAERAADGRRVIAEAVGGQVVGGYATRGG  120

Query  558  eektpppp------pppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRAT  719
                              A V    ITIGEALEATA+++G+KPV  SDAAAIQAAEV+AT
Sbjct  121  GAAAGGRAGQGQDISSSPAIVAGGGITIGEALEATALTSGNKPVDMSDAAAIQAAEVKAT  180

Query  720  GLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVN  899
            G G ++PGG+GA+AQ AA++N     DE KTK+GDVL DA+ +L DDK VT +DA  VV 
Sbjct  181  GRGQVMPGGIGAEAQAAADLNPGIWRDEDKTKLGDVLGDATDRLPDDKTVTRDDAKRVVA  240

Query  900  AEARNKEDHATHPagvaasmaaaaaLNQE  986
            AE RN  + + HP GVAAS AAAA LNQ+
Sbjct  241  AEVRNDPNASPHPGGVAASTAAAARLNQK  269



>ref|XP_009586710.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
tomentosiformis]
Length=260

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 161/245 (66%), Gaps = 3/245 (1%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MS++Q +RPE+  QEPIKYGDVF+V G+LA +PI  QDAA MQSAE   FGQT KGGPA+
Sbjct  1    MSEEQPQRPETEQQEPIKYGDVFNVRGELAKQPIAPQDAAMMQSAETMVFGQTQKGGPAS  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA +N R+  V  D  T V  ++GV+V E  + GRR +TE++ G V+G+Y+ P   
Sbjct  61   VMQSAATKNERSGLVSHDATTPVAGDEGVTVTETTVLGRRIITESVAGQVLGQYVEPVPV  120

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                              ITIGEAL  TA++AGDKP+ +SDAAAIQAAEVRATG   I P
Sbjct  121  TAAVGGAGGEPE---VAPITIGEALAVTALTAGDKPMEQSDAAAIQAAEVRATGSSLITP  177

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA +N   T D  K K+ DVLT A++KL  DK  T +DA GV+ AE RN  
Sbjct  178  GGLAATAQSAASVNEGLTQDVDKIKLNDVLTGATAKLPADKAATRQDAEGVMEAELRNNP  237

Query  921  DHATH  935
            +  T+
Sbjct  238  ELTTY  242



>gb|KDP21438.1| hypothetical protein JCGZ_21909 [Jatropha curcas]
Length=254

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 182/262 (69%), Gaps = 11/262 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q RR +  DQEPIKYGDVF+V G +A++PI   DAA MQSAE+   G+  +GGPA+
Sbjct  1    MSQGQPRRTQY-DQEPIKYGDVFNVGGDVASQPIAPVDAANMQSAESQVLGEPQRGGPAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  NVR   V+ D+V+DVVREQG++V E DI G R +TE +GG+VVG+Y++P   
Sbjct  60   VMQSAANVNVRTGAVERDDVSDVVREQGINVAEIDIGGTRVITEKVGGEVVGQYVQPRVP  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATGLGHIL  737
               P P           DIT+GEALEATA S AGDKP+ +SDAAAI+AAEVRA       
Sbjct  120  ATYPMPGM---------DITMGEALEATAYSAAGDKPIDQSDAAAIKAAEVRALRSTQTP  170

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
             GG+GA+AQ AA+ N R   DE KT + DVL DA++KL  DK VT +DA GV+ AE RNK
Sbjct  171  AGGIGAEAQSAADRNTRVMLDEDKTTLSDVLADATAKLPRDKTVTRDDAEGVIGAEIRNK  230

Query  918  EDHATHPagvaasmaaaaaLNQ  983
             +  T P GVAAS+AAAA LNQ
Sbjct  231  PNMRTTPGGVAASVAAAARLNQ  252



>ref|XP_002282590.1| PREDICTED: late embryogenesis abundant protein D-34 [Vitis vinifera]
 emb|CBI26260.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 182/261 (70%), Gaps = 6/261 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP+S DQEPIKYGDVF V+G LA KP+  QDAA MQSAE    GQT KGGPAA
Sbjct  1    MSQEQPRRPQS-DQEPIKYGDVFPVAGSLADKPVAPQDAALMQSAETAVLGQTQKGGPAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAA RN R   V   ++T+   ++GV+V E D+ GRR +TE++ G V+G+Y+ P   
Sbjct  60   TMQSAATRNERAGLVGHTDITNAAGDEGVTVTETDVPGRRIITESVAGQVLGQYVEPTPV  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
             +  P      A      ITIGEALEATA +AG+KPV +SD+AAIQAAEVRATG   I P
Sbjct  120  SQMNPTVTARQAA-----ITIGEALEATAQTAGNKPVDQSDSAAIQAAEVRATGSTIISP  174

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
             GV A AQ AA +N   T DE K K+ DVL++A+++L  DK VT +DA GV++AE RN  
Sbjct  175  TGVAAAAQSAASMNTGLTRDEDKIKLTDVLSNATARLPADKAVTRQDAEGVMSAEMRNNP  234

Query  921  DHATHPagvaasmaaaaaLNQ  983
            + ATHP GVA+S+AAAA LN+
Sbjct  235  NLATHPGGVASSVAAAARLNE  255



>gb|AIA57962.1| late embryogenesis abundant protein 1 [Jatropha curcas]
Length=254

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 181/262 (69%), Gaps = 11/262 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q RR +  DQEPIKYGDVF+V G +A++PI   DAA MQSAE+   G+  +GGPA+
Sbjct  1    MSQGQPRRTQY-DQEPIKYGDVFNVGGDVASQPIAPVDAANMQSAESQVLGEPQRGGPAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  NVR   V+ D+V+DVVREQG++V E DI G R +TE +GG+VVG+Y++P   
Sbjct  60   VMQSAANVNVRTGAVERDDVSDVVREQGINVAEIDIGGTRVITEKVGGEVVGQYVQPRVP  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATGLGHIL  737
               P P           DIT+GEALEATA S AGDKP+ +SDAAAI+AAEVRA       
Sbjct  120  ATYPMPGM---------DITMGEALEATAYSAAGDKPIDQSDAAAIKAAEVRALRSTQTP  170

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
             GG+GA+AQ AA+ N R   DE KT + DVL DA++KL  DK VT +DA GV+  E RNK
Sbjct  171  AGGIGAEAQSAADRNTRVMLDEDKTTLSDVLADATAKLPRDKTVTRDDAEGVIGEEIRNK  230

Query  918  EDHATHPagvaasmaaaaaLNQ  983
             +  T P GVAAS+AAAA LNQ
Sbjct  231  PNMRTTPGGVAASVAAAARLNQ  252



>ref|XP_010466531.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=262

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 174/264 (66%), Gaps = 5/264 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+ Q +RP    QEP+KYGDVF+VSG+LA KPI  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQEEQPQRP----QEPVKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V P + TDV  E+GV+V + D+ G R  TE +GG VVG+Y+ P  
Sbjct  57   AVMQSAATANKRGGFVHPADTTDVAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                           +   ITIGEALEAT  +AG+KPV +SDAAAIQAAEVRA+G   I 
Sbjct  117  VATATATAAETLGLNLQSAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    +E K K+ DVL  A+ KL+ DK VT +DA GVV+AE RN 
Sbjct  177  PGGIAASAQSAANHNATVDREEDKIKLIDVLAGATGKLSADKAVTRQDAEGVVSAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQET  989
             + +THP GVAAS+ AAA LNQ++
Sbjct  237  PNLSTHPGGVAASVTAAARLNQKS  260



>ref|XP_002885505.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61764.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 171/262 (65%), Gaps = 5/262 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+ Q +RP    QEP+KYGDVF+VSG+LA KPI  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQEDQPKRP----QEPVKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V P + TD+  E+GV+V + D+ G R  TE +GG VVG+Y+ P  
Sbjct  57   AVMQSAATANKRGGFVQPGDTTDLAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                           +   ITIGEALEAT  +AG+KPV +SDAAAIQAAEVRA+G   I 
Sbjct  117  VATAAATEAEAVGLSLQSAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    DE K K+ DVL  A+ KLT DK VT +DA GVV AE RN 
Sbjct  177  PGGIAASAQSAANHNATVDRDEDKIKLIDVLAGATGKLTADKAVTRQDAEGVVGAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQ  983
             + +THP GV+AS+ AAA LN+
Sbjct  237  PNLSTHPGGVSASITAAARLNE  258



>gb|ADQ91843.1| late embryogenesis abundant protein group 5 protein [Arachis 
hypogaea]
Length=265

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 177/266 (67%), Gaps = 11/266 (4%)
 Frame = +3

Query  201  MSQQQA-RRPESGDQE---PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKG  368
            MSQQQ  RRP+   QE   PIKYGD+F+VSG LA++PI  QDAA MQ+ EN A GQT KG
Sbjct  1    MSQQQTPRRPQEEGQEHKDPIKYGDIFNVSGDLASEPIMPQDAALMQATENQALGQTQKG  60

Query  369  GPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            GPA+VMQSAA  NV    V   +V+ V ++QG+ V E  I   R +TE++G  VVG+++ 
Sbjct  61   GPASVMQSAAVTNVSAGLVGRGDVSSVAKDQGICVLESKIGVNRVITESVGEQVVGEFVE  120

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATGL  725
            P    KTP         +  D ITIGEALEAT ++ A DKPV +SDAAAIQAAE+RATG 
Sbjct  121  PNVPMKTPGS------ALDKDAITIGEALEATTLAPASDKPVDQSDAAAIQAAEMRATGK  174

Query  726  GHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
              I PGG+ A AQ AA  N RT  D  KT + DVLTDA  KL  DK VT EDA GV+ AE
Sbjct  175  NEIQPGGLAAVAQSAATKNLRTMGDFQKTTLSDVLTDAKEKLPSDKAVTREDAEGVIGAE  234

Query  906  ARNKEDHATHPagvaasmaaaaaLNQ  983
             RNK D  T P GVAAS+AAAA LNQ
Sbjct  235  IRNKADMKTTPGGVAASLAAAATLNQ  260



>ref|XP_010488278.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=262

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 172/263 (65%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+ Q  RP    QEP+KYGDVF+VSG+LA KPI  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQEEQPHRP----QEPVKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V P + TD+  E+GV+V + D+ G R  TE +GG VVG+Y+ P  
Sbjct  57   AVMQSAATANKRGGFVHPGDTTDLAVERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                           +   ITIGEALEAT  +AG+KPV +SDAAAIQAAEVRA+G   I 
Sbjct  117  VATASATAAETLGLNLQSAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    DE K K+ DVL  A+ KL+ DK VT +DA GVV+AE RN 
Sbjct  177  PGGIAASAQSAANHNATVDRDEDKIKLIDVLAGATGKLSADKAVTRQDAEGVVSAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQE  986
             + +THP GVAAS+ AAA LNQ+
Sbjct  237  PNLSTHPGGVAASVTAAARLNQK  259



>gb|KEH43869.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=260

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 165/247 (67%), Gaps = 9/247 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP++G Q+PIKYGDV  VSG L+ KPIT +DAA MQSAE+   GQT  GG A+
Sbjct  1    MSQEQPRRPQAG-QDPIKYGDVLPVSGDLSQKPITPEDAAMMQSAESRVLGQTQPGGVAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA RN +   V   +VTDV  ++GV+V E  + GRR +TE +GG VVG+++ P   
Sbjct  60   VMQSAATRNEQAGIVGHKDVTDVTGDRGVTVTETQVPGRRIITETVGGQVVGQFVEPTPV  119

Query  561  ektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
            +           G V +  +TIGEALEATA + GDKPV +SDA+AIQAAEVRATG   I 
Sbjct  120  QVGLT-------GAVRESALTIGEALEATAHTVGDKPVEQSDASAIQAAEVRATGSNVIT  172

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ + AQ AA  NA    +E K K+GDVLT A++KL  DK  T +DAAGV +AE RN 
Sbjct  173  PGGLASMAQSAAAFNAECQREEEKIKMGDVLTGATAKLPADKAATRQDAAGVASAEMRNN  232

Query  918  EDHATHP  938
             D    P
Sbjct  233  PDATATP  239



>ref|XP_010256052.1| PREDICTED: late embryogenesis abundant protein D-34 [Nelumbo 
nucifera]
Length=258

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 184/262 (70%), Gaps = 7/262 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQQQ +RP++ ++EP  YGDVF VSG+L  KPI  +DAA MQ+AEN   GQT KGGPAA
Sbjct  1    MSQQQPQRPQA-EEEPFTYGDVFPVSGELEDKPILPKDAATMQAAENQVLGQTQKGGPAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +MQSAA +N R      D+ TD+   Q V+V+E DI G R +TE++GG VVG+Y++P   
Sbjct  60   MMQSAATQNERAGLFSKDDATDITGNQSVTVEETDILGNRVITESVGGQVVGQYMQPAPM  119

Query  561  ektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
            +   P        V +DD ITIGEALEA+AISAGDKPV +SDAAAIQAAE RA+      
Sbjct  120  QMRSPAS-----AVDTDDPITIGEALEASAISAGDKPVDQSDAAAIQAAEARASRQNITA  174

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA +NART  DE K K+GDVLTDA+++L  DK  + EDA  VV AE RN 
Sbjct  175  PGGIAATAQSAASMNARTMRDEDKIKLGDVLTDATARLPSDKAASREDAERVVGAELRNN  234

Query  918  EDHATHPagvaasmaaaaaLNQ  983
             + ATHP GVAAS+ AAA+LNQ
Sbjct  235  INMATHPGGVAASVVAAASLNQ  256



>gb|ABB16353.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 165/247 (67%), Gaps = 9/247 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP++G Q+PIKYGDV  VSG L+ KPIT +DAA MQSAE+   GQT  GG A+
Sbjct  1    MSQEQPRRPQAG-QDPIKYGDVLPVSGDLSQKPITPEDAAMMQSAESRVLGQTQPGGVAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA RN +   V   +VTDV  ++GV+V E  + GRR +TE +GG VVG+++ P   
Sbjct  60   VMQSAATRNEQAGIVGHKDVTDVTGDRGVTVTETQVPGRRIITETVGGQVVGQFVEPTPV  119

Query  561  ektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
            +           G V +  +TIGEALEATA + GDKPV +SDA+AIQAAEVRATG   I 
Sbjct  120  QVGLT-------GAVRESALTIGEALEATAHTVGDKPVEQSDASAIQAAEVRATGSNVIT  172

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ + AQ AA  NA    +E K K+G+VLT A++KL  DK  T +DAAGV +AE RN 
Sbjct  173  PGGLASMAQSAAAFNAECQREEEKIKMGNVLTGATAKLPADKAATRQDAAGVASAEMRNN  232

Query  918  EDHATHP  938
             D    P
Sbjct  233  PDATATP  239



>emb|CAN67177.1| hypothetical protein VITISV_037455 [Vitis vinifera]
Length=258

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 179/261 (69%), Gaps = 6/261 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q  RP+S DQEPIKYGDVF V+G LA KP+  QDAA MQSAE    GQT KGGPAA
Sbjct  1    MSQEQPPRPQS-DQEPIKYGDVFPVAGSLADKPVAPQDAALMQSAETAVLGQTQKGGPAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAA RN R   V   ++T+   ++GV+V E D+ GRR +TE++ G V+G+Y+ P   
Sbjct  60   TMQSAATRNERAGLVGHTDITNAAGDEGVTVTETDVPGRRIITESVAGQVLGQYVEPTPV  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
             +         A      ITIGEALEATA +AG+KPV +SDAAAIQ AEVRATG   I P
Sbjct  120  SQMNLTVTARQAA-----ITIGEALEATAQTAGNKPVDQSDAAAIQEAEVRATGSTIISP  174

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
             GV A AQ AA +N   T DE K K+ DVL++A+++L  DK VT +DA GV++AE RN  
Sbjct  175  TGVAAAAQSAASMNTGLTRDEDKIKLTDVLSNATARLPADKAVTRQDAEGVMSAEMRNNP  234

Query  921  DHATHPagvaasmaaaaaLNQ  983
            + ATHP GVA+S+AAAA LN+
Sbjct  235  NLATHPGGVASSVAAAARLNE  255



>ref|XP_010679058.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=267

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 178/264 (67%), Gaps = 3/264 (1%)
 Frame = +3

Query  201  MSQQQARRP--ESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            M+Q+Q +R   E   Q+PIKYGDVF VS ++A KPI   DAAAMQSAEN   G T KGGP
Sbjct  1    MAQEQPKRSGTEQDQQQPIKYGDVFLVSEKIADKPIAPLDAAAMQSAENQVLGHTQKGGP  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AAVMQSAA +NV+   +   + TDV R QG++V E  + G+R +TE++G  VV +Y  P 
Sbjct  61   AAVMQSAATKNVQAGALPRGSATDVGRNQGMTVTESIVDGQRVITESVGDQVVARYANPD  120

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                      PP+  +  D +TIGEALEAT ISAGDKP+ ++DAAAIQAAE+RATG    
Sbjct  121  PNPIPEKMVAPPS-ALDRDAVTIGEALEATVISAGDKPITQTDAAAIQAAEMRATGRTDT  179

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             PGG+GA+AQ AA  N R   DE KT +G+VL DA++KL DDKP T++DA  V+ AE RN
Sbjct  180  PPGGLGAEAQSAATRNERIMRDENKTTLGEVLADATTKLGDDKPATIQDAEKVIAAEMRN  239

Query  915  KEDHATHPagvaasmaaaaaLNQE  986
                AT+  GV  S+AAAA LNQ+
Sbjct  240  DPKMATNLGGVGESVAAAARLNQQ  263



>ref|XP_004496718.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cicer 
arietinum]
Length=260

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 165/247 (67%), Gaps = 9/247 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            M+Q+Q RR ++ DQ+PIKYGDV  VSG LA KPI  +DAA MQSAE+   GQT  GG A+
Sbjct  1    MNQEQPRRHQA-DQDPIKYGDVLPVSGDLAQKPIAPEDAAMMQSAESRVLGQTQPGGVAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA RN +   V   +VTDV  ++GV+V E  + GRR VTE+IGG VVG+++ P   
Sbjct  60   VMQSAATRNEQAGIVGHRDVTDVTCDRGVTVTETQVPGRRIVTESIGGQVVGQFVEPTPV  119

Query  561  ektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
            +           GVV +  +TIGEALEATA + GDKPV +SDA+AIQAAEVRATG   I 
Sbjct  120  QGGQT-------GVVGESALTIGEALEATAHTVGDKPVEQSDASAIQAAEVRATGCNVIT  172

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ + AQ AA  NA    DE K KIGDVL+ A++KL  DK  T +DAAGV +AE RN 
Sbjct  173  PGGLASMAQSAASYNADCQRDEDKIKIGDVLSGATAKLPADKAATRQDAAGVASAEMRNN  232

Query  918  EDHATHP  938
             D    P
Sbjct  233  PDATATP  239



>ref|XP_008811249.1| PREDICTED: late embryogenesis abundant protein D-34-like [Phoenix 
dactylifera]
Length=268

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 181/269 (67%), Gaps = 13/269 (5%)
 Frame = +3

Query  201  MSQQQARRPESGDQE--------PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQ  356
            MSQ++ RR +    E        PIKYGDVF+V G+LA +PI  +DAA MQ+AEN   GQ
Sbjct  1    MSQERPRRAQLNQAEAYAHVQGEPIKYGDVFNVQGELAREPIAPRDAAMMQAAENLVMGQ  60

Query  357  TIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVG  536
            T KGGPAAVMQSAA RN R   V   +V+ +  +QGVSV E D+ GRR V E++GG +VG
Sbjct  61   TQKGGPAAVMQSAAKRNERAGLVGHRDVSGLPADQGVSVTETDLPGRRVVAESVGGQMVG  120

Query  537  KYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRA  716
            +Y     E   P     P   +  D ITIGEAL ATA++AG KPV +SDAAA+QA EVRA
Sbjct  121  RY-----ETPAPVSMTTPEGALRGDAITIGEALGATAMTAGGKPVDESDAAALQAVEVRA  175

Query  717  TGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVV  896
            TG   +LPGGV A+AQ AA+ NAR   DE K K+ DV+TDA++KL  DK VT EDA  VV
Sbjct  176  TGRNEVLPGGVAAEAQSAADANARVMRDEDKVKLRDVVTDATTKLPADKAVTREDADRVV  235

Query  897  NAEARNKEDHATHPagvaasmaaaaaLNQ  983
             AE RN  D ATHP GVAA++AAAA LNQ
Sbjct  236  GAEMRNSPDMATHPQGVAANVAAAARLNQ  264



>ref|XP_010511424.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=262

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 172/263 (65%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+ Q  RP    QEP+KYGDVF+VSG+LA +PI  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQEEQPHRP----QEPVKYGDVFEVSGELADRPIAPEDANMMQAAETRVFGHTQKGGAA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V P + TD+  E+GV+V + DI G R  TE +GG VVG+Y+ P  
Sbjct  57   AVMQSAATANKRGGFVHPGDTTDLAVERGVTVAQTDIPGARVTTEFVGGQVVGQYVEPRP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                           +   ITIGEALEAT  +AG+KPV +SDAAAIQAAEVRA+G   I 
Sbjct  117  VATAAATAAETLGLNLQSAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRASGTNVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    +E K K+ DVL  A+ KL+ DK VT +DA GVV+AE RN 
Sbjct  177  PGGIAASAQSAANHNATVDREEDKIKLIDVLAGATGKLSADKAVTRQDAEGVVSAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQE  986
             + +THP GVAAS+ AAA LNQ+
Sbjct  237  PNLSTHPGGVAASITAAARLNQK  259



>ref|NP_188888.1| Seed maturation protein [Arabidopsis thaliana]
 dbj|BAB01464.1| seed maturation protein, LEA protein in group 5-like [Arabidopsis 
thaliana]
 gb|AAO22723.1| putative LEA protein [Arabidopsis thaliana]
 gb|AAO42419.1| putative LEA protein [Arabidopsis thaliana]
 gb|AEE76646.1| Seed maturation protein [Arabidopsis thaliana]
Length=262

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 169/262 (65%), Gaps = 5/262 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+ Q +RP    QEP+ YGDVF+VSG+LA KPI  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQEEQPKRP----QEPVTYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V P + TD+  E+GV+V + D+ G R  TE +GG VVG+Y+ P  
Sbjct  57   AVMQSAATANKRGGFVHPGDTTDLAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                           +   ITIGEALEAT  +AG+KPV +SDAAAIQAAEVRA G   I 
Sbjct  117  VATAAAMEAEVVGLSLQSAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRACGTNVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    DE K K+ DVL  A+ KL  DK VT +DA GVV+AE RN 
Sbjct  177  PGGIAASAQSAANHNATIDRDEDKIKLIDVLAGATGKLAADKAVTRQDAEGVVSAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQ  983
             + +THP GVAAS+ AAA LN+
Sbjct  237  PNLSTHPGGVAASITAAARLNE  258



>ref|XP_009335335.1| PREDICTED: late embryogenesis abundant protein D-34-like [Pyrus 
x bretschneideri]
Length=260

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 176/261 (67%), Gaps = 5/261 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q RRP   + +PIKYGDVF VSGQLA KPI  QDA  MQ+AE   FGQT KGGPAA
Sbjct  1    MSQGQPRRPREDEAQPIKYGDVFSVSGQLADKPIAPQDANMMQTAETMIFGQTQKGGPAA  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA+RN +   V  D  TDV   +GV+V E D+ G R +TE++GG VVG++++P   
Sbjct  61   VMQSAASRNEKAGLVRHDQATDVAGSEGVTVTETDVPGSRIITESVGGQVVGQHVQPTPV  120

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
             +           +  + ITIGEALEA+A +AGD+P+ +SDAAAIQAAEVRATG   I P
Sbjct  121  AQATAAGF-----MQQNSITIGEALEASAQTAGDRPIDQSDAAAIQAAEVRATGSNVISP  175

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NA T  ++ K K+ DVL+ A++KL  DK  T +DA GVV++E RN  
Sbjct  176  GGLAAMAQSAAAYNAGTEREQDKIKLTDVLSGATAKLPADKAATRQDAEGVVSSELRNNP  235

Query  921  DHATHPagvaasmaaaaaLNQ  983
               T P GVAAS+ AAA LN+
Sbjct  236  GMGTRPGGVAASVMAAARLNE  256



>ref|XP_010932759.1| PREDICTED: late embryogenesis abundant protein D-34-like [Elaeis 
guineensis]
Length=267

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 145/247 (59%), Positives = 175/247 (71%), Gaps = 5/247 (2%)
 Frame = +3

Query  243  EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnar  422
            EPIKYGDVF+V G+L  +PI  +DAA MQSAEN   GQT KGGPAAVMQSAA RN R   
Sbjct  22   EPIKYGDVFNVQGELGREPIAPRDAAMMQSAENLVMGQTQKGGPAAVMQSAANRNERAGL  81

Query  423  vDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGV  602
            V   +V+ +  +QGVSV E D+ GRR VTE++GG VVG+Y     E   P     PA  +
Sbjct  82   VGHRDVSGLPADQGVSVTETDLPGRRVVTESVGGQVVGRY-----EAPAPASMTTPAGAL  136

Query  603  VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEIN  782
              D ITIGEALEATA+ AG KPV + DAAA+QAAEVRATG   ++PGG+ A+AQ AA+ N
Sbjct  137  QGDAITIGEALEATAMIAGGKPVDQGDAAALQAAEVRATGQNEVVPGGIAAEAQSAADAN  196

Query  783  ARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasma  962
            AR   DE + K+ DV+T+A++KL  DK VT EDA  V+ AE RN+ D ATHP GVAA+MA
Sbjct  197  ARVMRDEDRVKLRDVVTNATTKLPADKAVTREDADRVIGAEMRNRPDMATHPQGVAANMA  256

Query  963  aaaaLNQ  983
            AAA LNQ
Sbjct  257  AAARLNQ  263



>ref|XP_008797343.1| PREDICTED: late embryogenesis abundant protein D-34-like [Phoenix 
dactylifera]
Length=268

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 185/270 (69%), Gaps = 15/270 (6%)
 Frame = +3

Query  201  MSQQQARRP-----ESGDQ---EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQ  356
            MSQ+Q RR      E+G +   EPIKYGDVF+V G+LA +P+   DAA MQSAEN   GQ
Sbjct  1    MSQEQPRRTQLKQAETGARAQGEPIKYGDVFNVQGELAREPVAPGDAAMMQSAENQIIGQ  60

Query  357  TIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVG  536
            T KGGPA+VMQSAAARN R   V   +V+DV  +QGV V E D+AG R V E++GG VVG
Sbjct  61   TQKGGPASVMQSAAARNERAGLVGRRDVSDVPADQGVIVTETDLAGHRIVAESVGGQVVG  120

Query  537  KYIRppaeektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGKSDAAAIQAAEVR  713
            +Y      E   P       GV   D  TIGEALEATA++AG+KPV +SDAAAIQAAE R
Sbjct  121  RY------ETAAPVSTTTPTGVAYGDAFTIGEALEATAMTAGEKPVDQSDAAAIQAAEAR  174

Query  714  ATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGV  893
            ATGL  +LPGGVGA+AQ AA  N R T +E K K+ DVLTD ++KL +DK VT EDA  V
Sbjct  175  ATGLNEVLPGGVGAEAQSAANANTRLTREEDKIKLRDVLTDVTTKLPEDKVVTREDADRV  234

Query  894  VNAEARNKEDHATHPagvaasmaaaaaLNQ  983
              AE RN+ D +THP GVA ++A+AA LNQ
Sbjct  235  AGAEMRNRLDVSTHPRGVAENVASAARLNQ  264



>ref|XP_008224307.1| PREDICTED: late embryogenesis abundant protein D-34-like [Prunus 
mume]
Length=264

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 178/266 (67%), Gaps = 11/266 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQE----PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKG  368
            MSQ+Q RRP+  +Q+    PIKYGDVF VSG LA KPI  QDA  MQ+AE   FGQT KG
Sbjct  1    MSQEQPRRPQEDEQQDKLQPIKYGDVFSVSGDLAKKPIAPQDANMMQTAETMVFGQTQKG  60

Query  369  GPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            GPAAVMQSAA RN R+  V  D  TDV   +GV+V E D+ G R VTEA+GG V+G+Y++
Sbjct  61   GPAAVMQSAATRNERSGLVRHDQATDVGGNEGVTVTETDVPGSRIVTEAVGGQVIGQYVQ  120

Query  549  ppaeektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGL  725
            P    +          G +  + ITIGEALEA+A +AGDKP+ +SDAAAIQAAEVRATG 
Sbjct  121  PTPVAQVAAG------GFMEQNAITIGEALEASAQTAGDKPIDQSDAAAIQAAEVRATGS  174

Query  726  GHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
              I PGG+ A AQ AA  NA T  ++ K K+ DVL+ A+ KL  DK  T +DA G+ +AE
Sbjct  175  NVISPGGLAAMAQSAAAYNAGTLAEQDKIKLTDVLSGATGKLPVDKAATRQDAEGIASAE  234

Query  906  ARNKEDHATHPagvaasmaaaaaLNQ  983
             RN  +  T P GVAAS+ AAA LN+
Sbjct  235  LRNNPEMGTRPGGVAASVTAAARLNE  260



>ref|XP_007200102.1| hypothetical protein PRUPE_ppa019190mg [Prunus persica]
 gb|EMJ01301.1| hypothetical protein PRUPE_ppa019190mg [Prunus persica]
Length=259

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 177/266 (67%), Gaps = 12/266 (5%)
 Frame = +3

Query  201  MSQQQARRP--ESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ+Q RR   +S  QEP+KYGDVF+VSG+LA++P+  +DAA  Q+AEN   G+T +GGP
Sbjct  1    MSQEQPRRRPDQSPGQEPLKYGDVFNVSGELASRPVAPRDAATAQAAENLVLGETQRGGP  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKED-DIAGRRFVTEAIGGDVVGKYIRp  551
            AAVMQSAA  N R   V   + T V RE+GVSV E  +  G R VTE +GG VV KY+ P
Sbjct  61   AAVMQSAATYNERARLVGHRDATKVAREEGVSVTEGINPDGNRVVTEHVGGQVVAKYVEP  120

Query  552  paeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGH  731
            P    +P         +  D ITIGEALEATA+SAGDKP+ KSDAAAIQAAE++ATG   
Sbjct  121  PLPMGSPGG------ALDRDAITIGEALEATALSAGDKPIDKSDAAAIQAAEMKATGRTE  174

Query  732  ILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEAR  911
            I PGGV A AQ AA +N R   D  K K+GDVL DA+ KL  DK VT EDA  V+ AE R
Sbjct  175  IDPGGVAAMAQYAASVNPR---DVNKKKLGDVLEDATQKLPADKVVTREDAKAVIGAEIR  231

Query  912  NKEDHATHPagvaasmaaaaaLNQET  989
            N    +T   GVA S+AAAA LNQ T
Sbjct  232  NSPTMSTTRGGVAESLAAAARLNQNT  257



>ref|XP_004290610.1| PREDICTED: late embryogenesis abundant protein D-34-like [Fragaria 
vesca subsp. vesca]
Length=254

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 145/264 (55%), Positives = 178/264 (67%), Gaps = 16/264 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQ-EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+Q  RP+ GDQ EPIKYGDVF+VSG+LA+KPI  + AA MQ+AEN   G+T KGGPA
Sbjct  1    MSQEQQHRPQQGDQLEPIKYGDVFNVSGELASKPIAPRVAATMQAAENVVLGETQKGGPA  60

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKED-DIAGRRFVTEAIGGDVVGKYIRpp  554
            AVMQSAA  N R   V   + T   RE+GV+V E  D+ G + +TE++ G VVG+Y+  P
Sbjct  61   AVMQSAATYNERAGLVGQRDATVADREEGVTVSELIDLDGNKVITESVAGQVVGQYVELP  120

Query  555  aeektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGH  731
                +P         V+ DD ITIGEALEATA+SAGDK + +SDAAAIQAAE+RATG   
Sbjct  121  EPGASPAAV------VLEDDAITIGEALEATALSAGDKQIDQSDAAAIQAAEMRATGSSE  174

Query  732  ILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEAR  911
            I PGG+ A AQ A   NAR    E +TK+ DVL DA+ K+  DK VT EDA  ++ AE R
Sbjct  175  ISPGGLAAVAQYAVSANAR----EAETKLADVLEDATQKMGADKAVTREDAKAIIGAEVR  230

Query  912  NKEDHATHPagvaasmaaaaaLNQ  983
            N    +T P G+A SMAAAA LNQ
Sbjct  231  N---MSTTPGGIAESMAAAARLNQ  251



>ref|XP_008390908.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=260

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 175/261 (67%), Gaps = 5/261 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            M+Q Q RRP   +  PIKYGDVF VSGQLA KPI  QDA  MQ+AE   FGQT KGGPA+
Sbjct  1    MNQGQPRRPREDEARPIKYGDVFSVSGQLADKPIAPQDANMMQTAETMIFGQTQKGGPAS  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA+RN R   V  D  TDV   +GV+V E D+ G R +TE++GG VVG+Y++P   
Sbjct  61   VMQSAASRNERAGLVRHDQATDVAGSEGVTVTETDVPGSRIITESVGGQVVGQYVQPTPV  120

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
             +           +  + ITIGEALEA+A +AGD+P+ +SDAAAIQAAEVRATG   I  
Sbjct  121  AQATAAGF-----MQQNSITIGEALEASAQTAGDRPIDQSDAAAIQAAEVRATGSSVISQ  175

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NA T  ++ K K+ DVL+ A++KL  DK  T +DA GVV+AE RN  
Sbjct  176  GGLAAMAQSAAAYNAGTEREQDKIKLTDVLSGATAKLPVDKAATRQDAEGVVSAELRNNP  235

Query  921  DHATHPagvaasmaaaaaLNQ  983
            D  T P GVAAS+ AAA LN+
Sbjct  236  DLGTRPGGVAASVIAAARLNE  256



>ref|XP_008235307.1| PREDICTED: late embryogenesis abundant protein D-34-like [Prunus 
mume]
Length=259

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 176/266 (66%), Gaps = 12/266 (5%)
 Frame = +3

Query  201  MSQQQARRP--ESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ+Q RR   +S   EP+KYGDVF+VSG+LA++P+  +DAA  Q+AEN   G+T +GGP
Sbjct  1    MSQEQPRRRPDQSSGLEPLKYGDVFNVSGELASRPVAPRDAATAQAAENLVLGETQRGGP  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKED-DIAGRRFVTEAIGGDVVGKYIRp  551
            AAVM SAA  N R   V   + T+V RE+GVSV E  +  G R VTE +GG VV +Y+  
Sbjct  61   AAVMHSAATYNERARLVGHKDATEVAREEGVSVTEGINPDGNRVVTEKVGGQVVAQYVE-  119

Query  552  paeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGH  731
                  P P   P   +  D ITIGEALEATA+SAGDKP+ KSDAAAIQAAE++ATG   
Sbjct  120  -----PPLPMGSPGGALDRDAITIGEALEATALSAGDKPIDKSDAAAIQAAEMKATGRTE  174

Query  732  ILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEAR  911
            I PGGV A A+ AA +N R   D  KTK+GDVL DA+ KL  DK VT EDA  V+ AE R
Sbjct  175  IAPGGVAAMAEYAASVNPR---DVNKTKLGDVLEDATQKLPADKVVTREDAKAVIGAEIR  231

Query  912  NKEDHATHPagvaasmaaaaaLNQET  989
            N    +T   GVA S+AAA+ LNQ T
Sbjct  232  NSPTMSTTRGGVAESLAAASRLNQNT  257



>ref|XP_009370807.1| PREDICTED: late embryogenesis abundant protein D-34-like [Pyrus 
x bretschneideri]
Length=259

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 174/261 (67%), Gaps = 11/261 (4%)
 Frame = +3

Query  207  QQQARRPESGD-QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAV  383
            Q Q RRP+  +  EPIKYGDVF+VSG+LA +P+  +DAA  Q+AEN   G+  +GGPAAV
Sbjct  5    QPQRRRPDQSEVPEPIKYGDVFNVSGELADRPVAPRDAATAQAAENLVLGENPRGGPAAV  64

Query  384  MQSaaarnvrnarvDPDNVTDVVREQGVSVKED-DIAGRRFVTEAIGGDVVGKYIRppae  560
            MQSAA  N R   V   + T V RE+GV+V E  +  G R VTE + G VV +Y+ PP  
Sbjct  65   MQSAATYNERFGLVGHLDSTKVAREEGVTVTETINPDGNRVVTEKVAGQVVAQYVEPPVP  124

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
              +P         +  D ITIGEALEA+A++AGDKP+ +SDAAAIQAAE+RATG   I P
Sbjct  125  MASPGGA------LDRDAITIGEALEASALTAGDKPIEQSDAAAIQAAEMRATGRNEIAP  178

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GGV A AQ AA +N R   D  KTK+GDVL DA+ KL  DKPVT EDA  V+ AE RN  
Sbjct  179  GGVAAVAQYAASVNPR---DVNKTKLGDVLEDATEKLPADKPVTREDAKAVIGAEIRNSP  235

Query  921  DHATHPagvaasmaaaaaLNQ  983
            + AT P GVA S+AAAA LNQ
Sbjct  236  NMATTPGGVAESLAAAAGLNQ  256



>ref|XP_004299111.1| PREDICTED: late embryogenesis abundant protein D-34-like [Fragaria 
vesca subsp. vesca]
Length=262

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 165/246 (67%), Gaps = 5/246 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+  RR +  ++EPIKYGD+F+VSG LA+K +  QDAA MQ+AE+   GQT KGGPAA
Sbjct  1    MSQEPPRRTQK-EKEPIKYGDIFNVSGDLASKTVAPQDAAMMQTAESMVLGQTQKGGPAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA +N R   V  D  TDV   +GV+V E D+ GRR +TE++GG V+G+Y++P   
Sbjct  60   VMQSAATQNERAGLVRHDEATDVAGNEGVTVTETDVPGRRIITESVGGQVIGQYVKPVPV  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
             +              + I+IGEALEA+A +AGD+P+  SDAAAIQAAEVRATG   I+P
Sbjct  120  AQQAAVGGYKQ----QNTISIGEALEASAQTAGDRPLDLSDAAAIQAAEVRATGSNVIVP  175

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NA T  ++ K K+ DVL+ A++KL  DK  T+EDA GVV AE RN  
Sbjct  176  GGLAATAQSAAAHNASTDREQDKIKVSDVLSGATAKLPADKAATMEDAQGVVGAEMRNNP  235

Query  921  DHATHP  938
            D    P
Sbjct  236  DMVLRP  241



>ref|XP_004139881.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
 ref|XP_004159055.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
 gb|KGN44242.1| hypothetical protein Csa_7G234140 [Cucumis sativus]
Length=264

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 176/261 (67%), Gaps = 10/261 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RR E+  Q+PIKYGDVF+++G LA+K I   DA  MQ+AE   FG+T KGGPAA
Sbjct  1    MSQEQPRRQET--QDPIKYGDVFNITGDLASKVIPPVDADMMQTAETIVFGRTQKGGPAA  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAA RN  +  V  ++V+D  R+QGV+VKE DI G R +TE + G +VG+++ P + 
Sbjct  59   TMQSAATRNELSGFVGHEDVSDAARDQGVAVKETDIPGSRIITETVAGQIVGQFVEPTSF  118

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                         V+ + +TIG+ALEATA +AGDKPV +SDAAAIQAAEVRATG   ++P
Sbjct  119  FGAA--------AVMQNAVTIGQALEATAHTAGDKPVDQSDAAAIQAAEVRATGSNVVIP  170

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NA  + DE K K+ D L DA+ +L  DK VT +DA GV++AE RN  
Sbjct  171  GGLAASAQSAASFNAGVSKDEDKIKLNDTLMDAAMRLPADKVVTKQDAEGVMSAELRNNP  230

Query  921  DHATHPagvaasmaaaaaLNQ  983
              A HP GVA S+  AA LN+
Sbjct  231  RLAAHPGGVADSITEAARLNE  251



>gb|KDO53322.1| hypothetical protein CISIN_1g046001mg [Citrus sinensis]
Length=256

 Score =   205 bits (522),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 149/261 (57%), Positives = 177/261 (68%), Gaps = 9/261 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP       IKYGDVF V G++A   +  +DAA MQ+AEN   GQ  KG  A+
Sbjct  1    MSQEQPRRP-------IKYGDVFSVEGEIAEMAVAPRDAALMQTAENAMLGQIQKGTAAS  53

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +MQSAA RN +   V  D++ DV   QGVS+ E ++ GRR +TE IGG VVG+Y +P + 
Sbjct  54   MMQSAAERNEKGGFVGHDDMADVAAGQGVSITETNLPGRRIITEEIGGQVVGQYSQPSSL  113

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
            +   PP       V    ITIGEALEATA++AG KPV  SDAAAIQAAEVRATG  +I P
Sbjct  114  QSLAPPSSHGE--VKGGGITIGEALEATALTAGKKPVEWSDAAAIQAAEVRATGRINITP  171

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GGV A AQ AA INARTT DE KTK+ D+LTDA++KL  DK VT +DA GV  AE RN  
Sbjct  172  GGVAAAAQSAATINARTTRDEDKTKLADILTDATAKLPADKQVTRKDAEGVAAAEMRNDP  231

Query  921  DHATHPagvaasmaaaaaLNQ  983
               THPAGVAAS+AAAA LNQ
Sbjct  232  MLTTHPAGVAASVAAAARLNQ  252



>ref|NP_188889.1| late embryogenesis abundant protein ECP31 [Arabidopsis thaliana]
 dbj|BAB01466.1| LEA protein in group 5 [Arabidopsis thaliana]
 gb|AAK96509.1| AT3g22500/F16J14_6 [Arabidopsis thaliana]
 gb|AAN38682.1| At3g22500/F16J14_6 [Arabidopsis thaliana]
 gb|AEE76647.1| late embryogenesis abundant protein ECP31 [Arabidopsis thaliana]
Length=256

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 138/261 (53%), Positives = 169/261 (65%), Gaps = 9/261 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP    +EP+KYGDVF+VSG+LA KPI  +DA  MQSAE   FG T KGGPAA
Sbjct  1    MSQEQPRRP----REPVKYGDVFEVSGELADKPIAPEDAKMMQSAETHVFGHTQKGGPAA  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  N+R   V PD+ T++V E+G +V E  +      TE +GG VVG+++ P   
Sbjct  57   VMQSAATTNIRGGFVHPDDKTELVAERGATV-EQTVPAATVTTEFVGGQVVGQHVEPRRV  115

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                          +   ITIGEALEAT  +AG+KPV +SDAAAIQAAE+RA+G   I  
Sbjct  116  VAAARTDEEA----LQSTITIGEALEATVKTAGNKPVDQSDAAAIQAAEMRASGTNVIAL  171

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
             GV A AQ AA+ NA    DE K K+ DVLT A+ KL+ D+ VT EDA GVV+AE RN  
Sbjct  172  AGVAASAQSAADHNATVDRDERKIKLRDVLTGAAGKLSADRAVTREDAEGVVSAEMRNNP  231

Query  921  DHATHPagvaasmaaaaaLNQ  983
               THP GVAAS+  AA LN+
Sbjct  232  KLCTHPGGVAASLTVAARLNE  252



>gb|EYU46567.1| hypothetical protein MIMGU_mgv1a012107mg [Erythranthe guttata]
Length=261

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 182/262 (69%), Gaps = 5/262 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRPE+ +QE +KYGD+F VSG+LA+KP+  +DAA  Q+AE+   GQ  KGGPAA
Sbjct  1    MSQEQPRRPEA-EQESVKYGDIFQVSGELASKPVAPRDAATAQAAESIILGQVQKGGPAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  NV    +  D+VT+  R+ GV + + D  G+R +TEA+ G+VVGKY+    E
Sbjct  60   VMQSAADVNVSRGVLHRDDVTEATRQHGVLISQTDAGGQRIITEAVAGEVVGKYVVAGEE  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
            E T PP    + G V    TIG+ALE+  +SAGDKPV +SDAAAIQA E RA+GL  ++P
Sbjct  120  ETTGPPLSALSPGAV----TIGQALESVVLSAGDKPVDESDAAAIQAVESRASGLDKVVP  175

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GGV A AQ AA+ NART  DE K K+ DVL  A SKL DD+ VT EDA   V AE RNK 
Sbjct  176  GGVAAAAQSAAKHNARTMADEKKIKLRDVLGGAISKLPDDRAVTKEDAEAAVAAELRNKL  235

Query  921  DHATHPagvaasmaaaaaLNQE  986
            D  T+P GVAAS+A AA LNQ+
Sbjct  236  DMTTYPGGVAASLATAARLNQQ  257



>ref|XP_007144645.1| hypothetical protein PHAVU_007G173100g [Phaseolus vulgaris]
 gb|ESW16639.1| hypothetical protein PHAVU_007G173100g [Phaseolus vulgaris]
Length=260

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 176/262 (67%), Gaps = 8/262 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q +RP++ +++PIKYGDVF VSG+LA++PI  +DAA MQ+ EN   GQ  KGGPA+
Sbjct  1    MSQEQPKRPQA-EKDPIKYGDVFVVSGELASQPIAPKDAALMQAKENQTLGQAQKGGPAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +MQSAA  NVR+  V     +DV REQGVSV E  + G+R +TE++G  VVG+++     
Sbjct  60   IMQSAATVNVRDGEVGRGEFSDVAREQGVSVFEGKVDGQRVITESVGRHVVGQFV-----  114

Query  561  ektpppppppaaGVVSDDITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                 P   P   +  D ITIGEALEAT ++ A DKPV +SDAAAIQAAE+RATG     
Sbjct  115  -VPEIPMETPGTALERDAITIGEALEATGVAGAFDKPVDESDAAAIQAAEMRATGKNETE  173

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
             GG+GA AQ AA  N RT     KT + DVL DA  KL  DK VT EDA GV+ AE RNK
Sbjct  174  SGGLGARAQSAATHNTRTVPQSNKTTLSDVLRDARVKLQADKVVTREDAEGVIGAELRNK  233

Query  918  EDHATHPagvaasmaaaaaLNQ  983
             D  T P GVAASMAAAA LNQ
Sbjct  234  LDMKTTPGGVAASMAAAATLNQ  255



>ref|XP_009145325.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=262

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 168/263 (64%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQQ Q RRP    QEP+KYGDVF+VSG+LA K +  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQQEQPRRP----QEPVKYGDVFEVSGELADKTVAPEDANMMQAAETRVFGHTQKGGTA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V   + TDV  E GV+V + D+ G R  TE +GG VVG+++ P  
Sbjct  57   AVMQSAATANKRGGFVQQGDATDVAAEHGVTVAQTDVPGARVTTEFVGGQVVGQFVEPMP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
               T           +   ITIGEALEA   +AG+KPV +SDAAAIQAAEVRA+G   I 
Sbjct  117  VGTTAATDAETLGLNLQSAITIGEALEAAVQTAGNKPVDQSDAAAIQAAEVRASGTSVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    DE K K+ DVL  A+ KL  DK VT +DA GVV+AE RN 
Sbjct  177  PGGIAASAQSAANHNATVDRDEEKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQE  986
             +  THP GVAAS+ AAA LN++
Sbjct  237  PNLTTHPGGVAASVTAAARLNEK  259



>dbj|BAA11016.1| LEA protein in group 5 [Arabidopsis thaliana]
Length=256

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 172/267 (64%), Gaps = 11/267 (4%)
 Frame = +3

Query  201   MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
             MSQ+Q RRP    +EP+KYGDVF+VSG+LA KPI  +DA  MQSAE   FG T KGGPAA
Sbjct  1     MSQEQPRRP----REPVKYGDVFEVSGELADKPIAPEDAKMMQSAETHVFGHTQKGGPAA  56

Query  381   VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             VMQSAA  N+R   V PD+ T++V E+G +V E  +      TE +GG VVG+++ P   
Sbjct  57    VMQSAATTNIRGGFVHPDDKTELVAERGATV-EQTVPAATVTTEFVGGQVVGQHVEPRRV  115

Query  561   ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                           +   ITIGEALEAT  +AG+KPV +SDAAAIQAAE+RA+G   I  
Sbjct  116   VAAARTDEEA----LQSTITIGEALEATVKTAGNKPVDQSDAAAIQAAEMRASGTNVIAL  171

Query  741   GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
              GV A AQ AA+ NA    +E K K+ DVLT A+ KL+ D+ VT EDA GVV+AE RN  
Sbjct  172   AGVAASAQSAADHNATVDRNERKIKLRDVLTGAAGKLSADRAVTREDAEGVVSAEMRNNP  231

Query  921   DHATHPagvaasmaaaaaLNQETAFNI  1001
                THP GVAAS+  AA LN+   F+I
Sbjct  232   KLCTHPGGVAASLTVAARLNER--FDI  256



>ref|XP_010024280.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW60731.1| hypothetical protein EUGRSUZ_H03461 [Eucalyptus grandis]
Length=262

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 160/248 (65%), Gaps = 7/248 (3%)
 Frame = +3

Query  201  MSQQQARRPESGD--QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ Q RRPE G   +EPIKYGDVF VSG LA+KP+  QDAA MQ+AE   FGQT KGGP
Sbjct  1    MSQDQPRRPEQGQAGREPIKYGDVFPVSGDLASKPVAPQDAAMMQTAETVVFGQTQKGGP  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AAVMQSAA RN R   V   + TDV  +QGV+V E ++ G+R VTE++ G VVG+Y+ P 
Sbjct  61   AAVMQSAATRNARAGLVGHRDATDVAADQGVTVTEANVPGQRIVTESVAGQVVGQYVEPK  120

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
              +   P        V    +TIGEALEA A + GDKPV + DAAAIQAAEVRATG   I
Sbjct  121  PVQHVAPAAV-----VEQGTLTIGEALEAAAQTVGDKPVDQGDAAAIQAAEVRATGSNVI  175

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             PGG+ A AQ AA  N     DE K K+G VLT A+ KL  DK  T +DA GV +AE RN
Sbjct  176  SPGGLAASAQSAAAHNEGVDRDEDKIKLGAVLTGATDKLPADKVATRQDAEGVASAELRN  235

Query  915  KEDHATHP  938
              D  T P
Sbjct  236  NPDLVTQP  243



>emb|CDY38305.1| BnaC05g29980D [Brassica napus]
Length=262

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 168/263 (64%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQQ Q RRP    QEP+KYGDVF+VSG+LA K I  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQQEQPRRP----QEPVKYGDVFEVSGELADKTIAPEDANMMQAAETRVFGHTQKGGTA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V   + TDV  E GV+V + D+ G R  TE +GG VVG+++ P  
Sbjct  57   AVMQSAATANKRGGFVQQGDATDVAAEHGVTVAQTDVPGARVTTEFVGGQVVGQHVEPMP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
               T           +   ITIGEALEA   +AG+KPV +SDAAAIQAAEVRA+G   I 
Sbjct  117  VGTTAATDAETLGLNLQSAITIGEALEAAVQTAGNKPVDQSDAAAIQAAEVRASGTSVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    DE K K+ DVL  A+ KL  DK VT +DA GVV+AE RN 
Sbjct  177  PGGIAASAQSAANHNATVDRDEDKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQE  986
             +  THP GVAAS+ AAA LN++
Sbjct  237  PNLTTHPGGVAASVTAAARLNEK  259



>ref|XP_008447154.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
melo]
Length=264

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 174/261 (67%), Gaps = 10/261 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RR E+  Q PIKYGDVF+V+G LA+K I   DA  MQ+AE   FG+T KGGPAA
Sbjct  1    MSQEQPRRQET--QHPIKYGDVFNVTGDLASKVIPPVDADMMQTAETMVFGRTQKGGPAA  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAA  N R+  V   +V+D  R+QGV+VKE DI G R +TE + G +VG+++ P + 
Sbjct  59   TMQSAATTNERSGFVGHKDVSDAARDQGVAVKETDIPGSRIITETVAGQIVGQFVEPTSF  118

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                         VV + +TIG+ALEA A +AGDKPV +SDAAAIQAAEVRATG   ++P
Sbjct  119  FGAA--------AVVQNAVTIGQALEAIAHTAGDKPVDQSDAAAIQAAEVRATGSNVVIP  170

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NA  + DE K K+ D+L DA+ +L  DK VT +DA GV++AE RN  
Sbjct  171  GGLAASAQSAASFNAGVSKDEDKIKLNDILMDAAMRLPADKVVTKQDAEGVMSAELRNNP  230

Query  921  DHATHPagvaasmaaaaaLNQ  983
              A +P GVA S+  AA LN+
Sbjct  231  RLAAYPGGVAESITEAARLNE  251



>ref|XP_010256054.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nelumbo 
nucifera]
Length=276

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 163/247 (66%), Gaps = 11/247 (4%)
 Frame = +3

Query  198  IMSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            + SQ+Q R    G QEPIKYGDVF VSG+LA KPI  QDAA MQ+AE+   G+T KGGPA
Sbjct  22   MQSQEQGRH---GKQEPIKYGDVFLVSGELADKPIAPQDAAMMQTAEHLVLGKTQKGGPA  78

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            A M SA+ARN +   V   + TD+   +GV+V E D+ G R VTEA+ G VVG+Y  P  
Sbjct  79   AKMLSASARNEKAGVVGHTDFTDITGNEGVTVSEIDVPGSRIVTEAVAGQVVGQYTEPLP  138

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
             +                 +TIGEALEA+ ++AGDKPV KSDAAAIQAAEVRATG   I+
Sbjct  139  LQPELAAQ--------QGKLTIGEALEASVVAAGDKPVDKSDAAAIQAAEVRATGQKTIM  190

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
             GG+ A AQ AA  NA+TT DE K K+GDVL  A++KL  DKPVT +DA G++NAE RN 
Sbjct  191  SGGLAASAQSAANANAQTTRDEDKIKLGDVLVVATAKLPADKPVTFQDAEGIINAEVRNN  250

Query  918  EDHATHP  938
             +   +P
Sbjct  251  PNSTIYP  257



>gb|EYU41481.1| hypothetical protein MIMGU_mgv1a011867mg [Erythranthe guttata]
Length=268

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 165/250 (66%), Gaps = 8/250 (3%)
 Frame = +3

Query  201  MSQQQARRPE--SGD-QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQ+Q +RP+   G+ QEPIKYGDVF VSG+LAAKPI  +DAA MQ+ E   FGQT KGG
Sbjct  1    MSQEQPKRPQDQGGELQEPIKYGDVFQVSGELAAKPIAPEDAAMMQAGETQVFGQTQKGG  60

Query  372  PAAVMQSaaarnvrnarvDPDNVTDVVR-EQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            PAA MQ+AA  N R   V   +V+DVV  ++GV+V E  + G R +TE++GG V+G+YI+
Sbjct  61   PAATMQAAATLNERAGLVGHRDVSDVVAGKEGVAVAETALPGARIITESVGGQVLGQYIQ  120

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
            P     T          V+   ITIGEALEATA +AG+KPV  SDAAAIQAAE RATG  
Sbjct  121  PTPVMNTAAAGGV----VMQSAITIGEALEATARTAGNKPVDHSDAAAIQAAECRATGSS  176

Query  729  HILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEA  908
             I+PGG+ A AQ AA  N     DE K K+ DVLT A +KL  DK  T +DA GV+ AE 
Sbjct  177  LIVPGGLAATAQSAAAFNDGLVGDEGKVKLADVLTGAIAKLPADKAATRDDAEGVIAAEL  236

Query  909  RNKEDHATHP  938
            RN  +  THP
Sbjct  237  RNDPNLHTHP  246



>gb|KDP21437.1| hypothetical protein JCGZ_21908 [Jatropha curcas]
Length=260

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 165/247 (67%), Gaps = 10/247 (4%)
 Frame = +3

Query  201  MSQQQARRPES-GDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+Q R+ ++  D++PI YGD+F+V G LA+ P+   DAA MQ+AEN   G+T +GGPA
Sbjct  1    MSQEQPRQTQTEQDRDPITYGDIFNVHGNLASTPVAPVDAATMQAAENRVLGETRRGGPA  60

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDD-IAGRRFVTEAIGGDVVGKYIRpp  554
            + MQSAA  N+R   VDPD  ++V R+  + V E D   G R +TE I G VV +YI P 
Sbjct  61   SAMQSAANVNLREGFVDPDEASNVARDDQIEVSESDGPGGDRVITETIAGQVVAQYIEPR  120

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
            AE  TP            D +TIGEALEAT++SAG+KPV +SDAAAIQAAEVRATG+  +
Sbjct  121  AERTTPGSIAN------RDAVTIGEALEATSLSAGEKPVEQSDAAAIQAAEVRATGINEV  174

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            LPGG+GA+AQ AA  N R  +D  K  + +VL DAS KL  DK VT EDA  V+ AE RN
Sbjct  175  LPGGIGAEAQSAATRN-RALSDRDKITLSEVLEDASLKLPADKAVTREDADRVIQAEVRN  233

Query  915  KED-HAT  932
            + D HAT
Sbjct  234  RPDMHAT  240



>ref|XP_002517129.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
 gb|EEF45292.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
Length=264

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 176/269 (65%), Gaps = 13/269 (5%)
 Frame = +3

Query  201  MSQQQARRP-ESG-----DQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTI  362
            MSQ+Q R+P E G     DQ P+KYGDVF+VSG LA+K I  +DA  MQSAE   FG T 
Sbjct  1    MSQEQPRKPTEQGGHIGQDQGPVKYGDVFNVSGDLASKTIAPEDANMMQSAETMVFGHTQ  60

Query  363  KGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKY  542
            KGG AA MQ+AA RN R   V   + TD   E+GV+V E D+ G R VTE + G VVG+Y
Sbjct  61   KGGAAATMQAAATRNERAGLVGHRDATDAASERGVTVTESDVPGARIVTERVAGQVVGQY  120

Query  543  IRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATG  722
            +                 G V + ITIGEALEATA +AG+KPV +SDAAAIQAAEVRATG
Sbjct  121  VEATPVVGMTA-------GTVQNAITIGEALEATAQTAGNKPVDQSDAAAIQAAEVRATG  173

Query  723  LGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNA  902
               I+PGG+ A AQ AA  NA    +E K K+ +VLT A++KL  DK VT  DA GVV+A
Sbjct  174  SNVIIPGGLAATAQSAACHNAAARREEDKIKLTEVLTAATTKLPADKVVTRADAEGVVSA  233

Query  903  EARNKEDHATHPagvaasmaaaaaLNQET  989
            E RN  + +THP GVAASMAAAA LN+ T
Sbjct  234  EIRNNPNLSTHPGGVAASMAAAARLNENT  262



>ref|XP_002885506.1| ATECP31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61765.1| ATECP31 [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 167/261 (64%), Gaps = 9/261 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP    +EP+KYGDVF+VSG+LA KPI  +DA  MQSAE   FG T KGGPAA
Sbjct  1    MSQEQPRRP----KEPVKYGDVFEVSGELADKPIAPEDAKMMQSAETHVFGHTQKGGPAA  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  N+R   V P + T++V E+G +V E  +      TE + G VVG+++ P   
Sbjct  57   VMQSAATTNIRGGFVHPGDKTELVAERGATV-EQTVPATTVTTEFVAGQVVGQHVEPRRI  115

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                          +   ITIGEALEAT  +AG+KPV +SDAAAIQAAE+RA+G   I  
Sbjct  116  VAAARTDEEA----LQSTITIGEALEATVKTAGNKPVDQSDAAAIQAAEMRASGTNVIAL  171

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
             GV A AQ AA+ NA    DE K K+ DVLT A+ KL+ D+ VT EDA GVV+AE RN  
Sbjct  172  AGVAASAQSAADHNATVDRDERKIKLSDVLTGAAGKLSADRAVTREDAEGVVSAEMRNNP  231

Query  921  DHATHPagvaasmaaaaaLNQ  983
               THP GVAAS+  AA LN+
Sbjct  232  KLCTHPGGVAASLTVAARLNE  252



>ref|XP_010693766.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=318

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 137/279 (49%), Positives = 174/279 (62%), Gaps = 29/279 (10%)
 Frame = +3

Query  180  Y*CVIII--MSQQQARRPESGDQ---------------------EPIKYGDVFDVSGQLA  290
            Y C I+   MSQQQ   P+ GD+                     +P++YGDVF V+G+LA
Sbjct  25   YSCDILFSKMSQQQ---PQRGDELQEQQRRDQEQQQQRQQGQPAQPVRYGDVFPVAGELA  81

Query  291  AKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVS  470
            +KP+  +DAA MQ+AEN  FGQT KGGPAA MQ+AA  N R   V    V+D    QGV+
Sbjct  82   SKPVAPRDAAMMQTAENAVFGQTQKGGPAATMQAAATVNERAGFVSHIGVSDPAARQGVT  141

Query  471  VKEDDIAGRRFVTEAIGGDVVGKYI--RppaeektpppppppaaGV-VSDDITIGEALEA  641
            V E D+ G   +TE++GG VVG+ I  RP  + +          G   +  +TIGEALEA
Sbjct  142  VTETDVPGACVITESVGGQVVGQTIQPRPVRQGENGTRKQRGIGGTGATGKVTIGEALEA  201

Query  642  TAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIG  821
             A +AGDKPV +SDAAA+QAAEVRATG   I+PGGV A AQ AA +NA+TT +E K K+G
Sbjct  202  VAATAGDKPVDQSDAAAVQAAEVRATGNTGIVPGGVAAAAQSAASMNAQTTLEEDKIKLG  261

Query  822  DVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHP  938
            D+LT+A+ KL  DK  T +DA GVV+AE RN  D AT P
Sbjct  262  DILTNATMKLPADKEATRQDAEGVVSAELRNNPDVATQP  300



>emb|CDY10286.1| BnaC05g29930D [Brassica napus]
Length=262

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 165/263 (63%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQQ Q RRP    QEP+KYGDVF+VSG+LA K I  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQQEQPRRP----QEPVKYGDVFEVSGELADKTIAPEDANMMQAAETRVFGHTQKGGTA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V   + TDV  E GV+V + D+ G R  TE +GG VVG+Y+ P  
Sbjct  57   AVMQSAATANKRGGFVQQGDATDVAAEHGVTVAQTDVPGARVTTEFVGGQVVGQYVEPMP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
               T           +   ITIGEALEA   +AG+KPV +SDA AIQAAEVRA+G   I 
Sbjct  117  VGTTAATDAETLGMNLQSAITIGEALEAAVQTAGNKPVDQSDATAIQAAEVRASGTSDIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A A+ AA  NA    DE K K+ DVL  A+ KL  DK VT +DA GVV+AE RN 
Sbjct  177  PGGIAASARSAANHNATVDRDEDKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQE  986
                 HP GVAAS+ AAA LN++
Sbjct  237  PYLTIHPGGVAASVTAAARLNEK  259



>ref|XP_008355469.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=315

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 173/273 (63%), Gaps = 17/273 (6%)
 Frame = +3

Query  207   QQQARRPESGD-QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAV  383
             Q Q RRP+  + QEPIKYGDVF+VSG+LA +P+  +DAA  Q+AEN   G+  +GGPAAV
Sbjct  5     QPQRRRPDQSEVQEPIKYGDVFNVSGELADRPVAPRDAAXAQAAENLVLGENPRGGPAAV  64

Query  384   MQSaaarnvrnarvDPDNVTDVVREQGVSVKED-DIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAA  N R   V   + T V RE+GV+V E  +  G R VTE + G VV +Y+ PP  
Sbjct  65    MQSAATYNERFGLVGHLDSTKVAREEGVTVTETINPDGNRVVTEKVAGQVVAQYVEPPVP  124

Query  561   ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
               +P         +  D ITIGE LEA+A++AGDKP+ +SDAAAIQAAE+RATG   I P
Sbjct  125   MASPGG------ALDRDAITIGETLEASALTAGDKPIEQSDAAAIQAAEMRATGRNEIAP  178

Query  741   GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
             GGV   AQ AA +N R   D  KTK+GDVL D + KL  DKPVT EDA  V+ A  RN  
Sbjct  179   GGVAGVAQYAASVNPR---DVNKTKLGDVLEDTTEKLPADKPVTREDAKAVIGAXIRNST  235

Query  921   DHATHPagvaasmaaaaaLNQE------TAFNI  1001
             + AT PAGV  S AAAA LNQ         FNI
Sbjct  236   NMATTPAGVTESQAAAAGLNQNGEKTYYYYFNI  268



>ref|XP_009775953.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
sylvestris]
Length=261

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 174/264 (66%), Gaps = 3/264 (1%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q +RPE   QE IKYGDVF+V G+LA +PI  QDAA MQSAE   FGQT KGGPAA
Sbjct  1    MSQEQPQRPEREQQEAIKYGDVFNVRGELAKQPIAPQDAAMMQSAETMVFGQTQKGGPAA  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA +N R+  V  D  T V   +GV+V E  + GRR +TE++ G V+G+ + P   
Sbjct  61   VMQSAATKNERSGFVSHDATTPVAGAEGVTVTETTVPGRRIITESVAGQVLGQSVEPVPV  120

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                              ITIGEAL ATA++AGDKPV +SDAAAIQAAEVRATG   + P
Sbjct  121  TAAVGGAGGEPE---EAPITIGEALAATALTAGDKPVEQSDAAAIQAAEVRATGSSVVTP  177

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA +N   T D  K K+ +VLT A++KL  DK  T +DA GV+ AE RN  
Sbjct  178  GGLAATAQSAASVNEGLTQDVDKIKLNNVLTGATAKLPTDKAATRQDAEGVMEAELRNNP  237

Query  921  DHATHPagvaasmaaaaaLNQETA  992
            +  T+P GVAAS+AAAA LN+ ++
Sbjct  238  ELTTYPGGVAASVAAAARLNERSS  261



>ref|XP_006382740.1| hypothetical protein POPTR_0005s04950g [Populus trichocarpa]
 gb|ERP60537.1| hypothetical protein POPTR_0005s04950g [Populus trichocarpa]
Length=263

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 167/246 (68%), Gaps = 4/246 (2%)
 Frame = +3

Query  249  IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvD  428
            IKYGDVF V G+LA KP+  +DAA MQ+AEN   GQ  +GG A++MQSAA RN R   V 
Sbjct  13   IKYGDVFSVEGELAEKPVAPRDAAMMQTAENALMGQIQRGGAASMMQSAAMRNERAGFVG  72

Query  429  PDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVS  608
              +V DV   QGVSV E ++ GRR +TEAIGG +V  + +     ++PPP        V 
Sbjct  73   HSDVNDVANYQGVSVTETEMPGRRIITEAIGGQIVRDFDQRAPLVQSPPPLFQQ----VD  128

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
              ITIGEALEATA+S G KPV  SDAAAIQAAEVRATG   I PGGV A AQ AA INAR
Sbjct  129  AGITIGEALEATALSCGQKPVEWSDAAAIQAAEVRATGRTTITPGGVAAAAQSAATINAR  188

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
             T DE KTK+ DVL DA+SKL  DKP T +DA GV  AE RN     T+PAGVAAS+AAA
Sbjct  189  MTKDEDKTKLSDVLADATSKLPADKPATRKDAEGVTGAEMRNDPFLTTNPAGVAASVAAA  248

Query  969  aaLNQE  986
            A LNQ+
Sbjct  249  ARLNQQ  254



>ref|XP_007206587.1| hypothetical protein PRUPE_ppa020371mg [Prunus persica]
 gb|EMJ07786.1| hypothetical protein PRUPE_ppa020371mg [Prunus persica]
Length=268

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 174/265 (66%), Gaps = 9/265 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFD-VSG-QLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ+Q R+PE   +E + YGDVF  V G +LA K +  +DAA MQ+ EN   G+TIKGG 
Sbjct  1    MSQEQPRKPED-QKEAVTYGDVFPGVQGVELADKLVAPKDAAIMQAEENAVLGKTIKGGA  59

Query  375  AAVMQSaaarnvrnarvDPD--NVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            AA +Q+AA +N +   V PD  N   V  ++GVSVKE ++ GRR +TE+I G  VG+Y +
Sbjct  60   AATLQTAARQNEKAGVVGPDDMNANIVTGDEGVSVKEAELPGRRIITESIAGQAVGQYSQ  119

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
                          A G     ITIGEALEATA++AG KPV  SDAAAIQAAEVRATG  
Sbjct  120  RAPLAAPNTIQAGGAGG----QITIGEALEATAMTAGQKPVEWSDAAAIQAAEVRATGRT  175

Query  729  HILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEA  908
            +I+PGGV A AQ AA +NAR T DE KTK+ D+L DA+SKL  DKP T  DA GV  AE 
Sbjct  176  NIVPGGVAAAAQSAATLNARATKDEEKTKLADILADATSKLPADKPATRRDAEGVTGAEM  235

Query  909  RNKEDHATHPagvaasmaaaaaLNQ  983
            RN     THP GVAAS+AAAA LNQ
Sbjct  236  RNDPFLTTHPTGVAASVAAAARLNQ  260



>ref|XP_006406157.1| hypothetical protein EUTSA_v10021345mg [Eutrema salsugineum]
 gb|ESQ47610.1| hypothetical protein EUTSA_v10021345mg [Eutrema salsugineum]
Length=262

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 166/264 (63%), Gaps = 5/264 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQQ Q  RP    QEP+KYGDVF VSG+LA K I  +DA+ MQ+AE   FG T KGG A
Sbjct  1    MSQQEQPSRP----QEPVKYGDVFQVSGELADKTIAPEDASMMQAAETRVFGHTQKGGVA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N +   V   + TD+  E+ V+V + D+ G R  TE +GG VVG+YI P  
Sbjct  57   AVMQSAATANKQGGFVHSGDTTDLAAEKSVTVAQTDVPGARVTTEFVGGQVVGQYIEPKP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                           +   ITIGEALEA   +AG+KPV +SDAAAIQAAEVRA+G   I 
Sbjct  117  VTAVAAMDAEALGLNLQSAITIGEALEAAVQTAGNKPVDQSDAAAIQAAEVRASGTNVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    DE K K+ DVL  A+ KL  DK VT +DA GV++AE RN 
Sbjct  177  PGGIAASAQSAANHNATIDRDEDKIKLVDVLAGATGKLPADKVVTRQDAEGVLSAERRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQET  989
               + HP GVAAS+ AAA LN+++
Sbjct  237  LSLSIHPGGVAASVIAAANLNEKS  260



>ref|XP_010090423.1| hypothetical protein L484_025090 [Morus notabilis]
 gb|EXB39393.1| hypothetical protein L484_025090 [Morus notabilis]
Length=247

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 141/267 (53%), Positives = 170/267 (64%), Gaps = 27/267 (10%)
 Frame = +3

Query  201  MSQQQARRP---ESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQ Q +RP   +  +QEPIK GDVF+VSG LA+KP+  +DAAAMQ+AE+ AF     G 
Sbjct  1    MSQGQPQRPRDDQLSEQEPIKNGDVFNVSGSLASKPVAPRDAAAMQAAESMAF----LGR  56

Query  372  PAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRp  551
                +Q  +            + T+V REQG +V E  + G R +TEA+GG VVG+Y+ P
Sbjct  57   HERAVQPLSG-----------DATNVAREQGATVSEKIVEGTRVITEAVGGQVVGEYVEP  105

Query  552  paeektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGK-SDAAAIQAAEVRATGL  725
                +T         GV+  D ITIGEALEATA+S  DKPV    DAAAIQAAEVRATG+
Sbjct  106  QVRARTLG-------GVLDRDAITIGEALEATALSVPDKPVDHLGDAAAIQAAEVRATGI  158

Query  726  GHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
               LPGGVGA AQ AA  NA+   DE+ T I DV+ DA+ KL  DK VT EDA GV+ AE
Sbjct  159  NLTLPGGVGATAQSAATFNAQLIADEYMTTISDVIGDATQKLPADKAVTREDAQGVIGAE  218

Query  906  ARNKEDHATHPagvaasmaaaaaLNQE  986
             RNK D +T P GVAASMAAAA LN E
Sbjct  219  VRNKPDMSTTPGGVAASMAAAARLNNE  245



>ref|XP_010917735.1| PREDICTED: late embryogenesis abundant protein D-34-like [Elaeis 
guineensis]
Length=269

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 163/251 (65%), Gaps = 4/251 (2%)
 Frame = +3

Query  243  EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnar  422
            EPIKYGDVF V G+LA +PI  +DAA MQSAEN   GQT KGG A+VMQSAA RN +   
Sbjct  23   EPIKYGDVFIVQGELAREPIAPRDAAMMQSAENQVLGQTQKGGAASVMQSAADRNEQAGL  82

Query  423  vDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGV  602
            VD   V+D+  + GV+V E D+ GRR VTEA+GG VVGKY  P        P        
Sbjct  83   VDHREVSDLPADLGVAVTETDLPGRRIVTEAVGGQVVGKYEEPAPVGTGTMPAAVQQ---  139

Query  603  VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEIN  782
              D ITIGEALE TA++AG+KPV +SDAAAIQAAEVRAT    + PGGV A AQ AA  N
Sbjct  140  -GDAITIGEALETTAMTAGEKPVEQSDAAAIQAAEVRATRTNEVPPGGVSAQAQSAATAN  198

Query  783  ARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasma  962
                 +E K K+ DVL+DA+++L  DK  T EDA  V  AE RN  D ATHP GV  ++A
Sbjct  199  TCVMREEDKVKLRDVLSDATTRLPADKAATREDADRVGVAEMRNNPDMATHPGGVGENVA  258

Query  963  aaaaLNQETAF  995
             AA LN++  F
Sbjct  259  EAARLNRDRRF  269



>ref|XP_006489400.1| PREDICTED: late embryogenesis abundant protein D-34-like [Citrus 
sinensis]
Length=261

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 136/248 (55%), Positives = 161/248 (65%), Gaps = 8/248 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQE--PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ Q RRP + DQ+  PIKYGD+F+VSG LA KPI  +DAA MQ+AE T  GQT KGGP
Sbjct  1    MSQAQPRRPGADDQQQQPIKYGDLFNVSGDLAQKPIAPEDAAMMQTAEATIMGQTQKGGP  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AAVMQSAAARN     V   +VTDV  +QGV+V E D+ GRR +TE++GG VVG++  P 
Sbjct  61   AAVMQSAAARNEGAGFVGHRDVTDVAGDQGVTVTETDVPGRRIITESVGGQVVGRHEEPT  120

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                 P         V    ITIGEALE TA +AGDKPV +SDAAAIQAAEVRATG    
Sbjct  121  PVSLAPTTGR-----VEQGAITIGEALETTAQTAGDKPVDQSDAAAIQAAEVRATGSTVT  175

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             P G+ A AQ AA  N     DE K K+  VL  A++KL  DK VT +DA G+ +AE RN
Sbjct  176  TP-GLAASAQSAAAHNETVDRDEDKIKLNQVLAGATAKLAADKAVTRQDAEGIASAEQRN  234

Query  915  KEDHATHP  938
              +  THP
Sbjct  235  NPNADTHP  242



>ref|XP_008218178.1| PREDICTED: late embryogenesis abundant protein D-34 isoform X2 
[Prunus mume]
Length=266

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 145/264 (55%), Positives = 176/264 (67%), Gaps = 9/264 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q R+PE   +E +KYGDVF   G+LA K +  +DAA MQ+AEN   G+TIKGG AA
Sbjct  1    MSQEQPRKPED-QKEAVKYGDVFP-GGELADKVVAPKDAAIMQAAENAVLGETIKGGAAA  58

Query  381  VMQSaaarnvrnarvDPDNVT-DVVR--EQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRp  551
             +Q+AA +N +   V PD++  ++V   E GVSVKE D+ GRR +TE+I G  VG+Y + 
Sbjct  59   TLQAAARQNEKAGVVGPDDMNANIVTGDEGGVSVKEADLPGRRIITESIAGQAVGQYSQR  118

Query  552  paeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGH  731
                           G     ITIGEALEATA++AG KPV  SDAAAIQAAEVRATG  +
Sbjct  119  APLAAPNTIQAGGPGG----QITIGEALEATAMTAGQKPVEWSDAAAIQAAEVRATGRTN  174

Query  732  ILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEAR  911
            I+PGGV A AQ AA +NAR T DE KTK+ D+L DA+SKL  DKP T  DA GV  AE R
Sbjct  175  IVPGGVAAAAQSAATLNARATKDEEKTKLADILADATSKLPADKPATRRDAEGVTGAEMR  234

Query  912  NKEDHATHPagvaasmaaaaaLNQ  983
            N     THP GVAAS+AAAA LNQ
Sbjct  235  NDPFLTTHPTGVAASVAAAARLNQ  258



>ref|XP_006419945.1| hypothetical protein CICLE_v10005469mg [Citrus clementina]
 gb|ESR33185.1| hypothetical protein CICLE_v10005469mg [Citrus clementina]
Length=313

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 166/253 (66%), Gaps = 8/253 (3%)
 Frame = +3

Query  186  CVIIIMSQQQARRPESGDQE--PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQT  359
             + + MSQ Q RRP + DQ+  PIKYGD+F+VSG LA KPI  +DAA MQ+AE T  GQT
Sbjct  48   LLTLKMSQAQPRRPGADDQQQQPIKYGDLFNVSGDLAQKPIAPEDAAMMQTAEATIMGQT  107

Query  360  IKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGK  539
             KGGPAAVMQSAAARN     V   +VTDV  +QGV+V E D+ GRR +TE++GG VVG+
Sbjct  108  QKGGPAAVMQSAAARNEGAGFVGHRDVTDVAGDQGVTVTETDVPGRRIITESVGGQVVGR  167

Query  540  YIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRAT  719
            +     EE TP    P    V    ITIGEALE TA +AGDKPV +SDAAAIQAAEVRAT
Sbjct  168  H-----EEPTPVSLAPTTGRVEQGAITIGEALETTAQTAGDKPVDQSDAAAIQAAEVRAT  222

Query  720  GLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVN  899
            G     P G+ A AQ AA  N     DE K K+  VL  A++KL  DK VT +DA G+ +
Sbjct  223  GSTVTTP-GLAASAQSAAAHNETVDRDEDKIKLNQVLAGATAKLAADKAVTRQDAEGIAS  281

Query  900  AEARNKEDHATHP  938
            AE RN  +  THP
Sbjct  282  AEQRNNPNADTHP  294



>ref|XP_010096140.1| hypothetical protein L484_005419 [Morus notabilis]
 gb|EXB63456.1| hypothetical protein L484_005419 [Morus notabilis]
Length=358

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 151/223 (68%), Gaps = 11/223 (5%)
 Frame = +3

Query  207  QQQARRPESG-DQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAV  383
            ++Q RRP++G D+E +KYGDVF+VSG+LA+K +  +DAA MQSAE T  GQT KGGPAA 
Sbjct  130  EEQPRRPQAGRDEEAVKYGDVFNVSGELASKTVAPRDAAMMQSAETTVLGQTQKGGPAAT  189

Query  384  MQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaee  563
            MQSAA +N R   V   + +D   ++GVSV E D+ G R VTE++ G VVG+Y++P    
Sbjct  190  MQSAATQNERAGVVGHVDASDAAEDRGVSVTETDVPGYRIVTESVAGQVVGQYVQPTPAM  249

Query  564  ktpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPG  743
            +            V   ITIGEALEATA +AGDKPV +SDAAAIQAAEVRATG   I PG
Sbjct  250  Q----------AAVVSAITIGEALEATAKTAGDKPVDQSDAAAIQAAEVRATGSNVITPG  299

Query  744  GVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVT  872
            G+ A AQ AA  NA    DE K K+ D+LTDA+SKL  DK  T
Sbjct  300  GLAATAQSAASFNAAIERDENKIKLRDILTDATSKLPADKAAT  342



>gb|AIA57963.1| late embryogenesis abundant protein 3 [Jatropha curcas]
 gb|KDP40182.1| hypothetical protein JCGZ_02180 [Jatropha curcas]
Length=274

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 162/253 (64%), Gaps = 7/253 (3%)
 Frame = +3

Query  237  DQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrn  416
            +QEPIKYGDVF+V+G LA +PI  +DA  MQSAE   FGQT KGG AA MQ+AA  N R+
Sbjct  29   EQEPIKYGDVFNVTGDLAKEPIAPEDANMMQSAETRVFGQTQKGGAAASMQAAATVNERS  88

Query  417  arvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaa  596
              V     TD   E+GV+V E D+ G R VTE + G VVG+Y+     +           
Sbjct  89   GLVGHREATDAASERGVTVMEADVPGARIVTERVAGQVVGQYVEVTPVQGLAA-------  141

Query  597  GVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAE  776
            G V + ITIGEALEA+A +AGDK V +SDAAAIQ AEVRATG   I+PGG+ A AQ AA 
Sbjct  142  GNVQNAITIGEALEASAQTAGDKAVDQSDAAAIQEAEVRATGSNVIVPGGIAATAQSAAS  201

Query  777  INARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaas  956
             NA T   E K K+ DVL+ A+SKL  DK VT  DA GVV+AE RN  +  THP GVA S
Sbjct  202  YNAATNRAEEKIKLADVLSGATSKLAADKVVTRADAEGVVSAELRNNPNLNTHPGGVAVS  261

Query  957  maaaaaLNQETAF  995
            M  AA LN+   +
Sbjct  262  MTTAARLNETINY  274



>emb|CDY10647.1| BnaA05g17150D [Brassica napus]
Length=262

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 168/263 (64%), Gaps = 5/263 (2%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQQ Q RRP    QEP+KYGDVF+VSG+LA K +  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQQEQPRRP----QEPVKYGDVFEVSGELADKTVAPEDANMMQAAETRVFGHTQKGGTA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V   + TDV  E GV+V + D+ G R  TE +GG VVG+Y+ P  
Sbjct  57   AVMQSAATANKRGGFVQQGDATDVAAEHGVTVAQTDVPGARVTTEFVGGQVVGQYVEPMP  116

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
               T           +   ITIGEALEA   +AG+KPV +SDAAAIQAAEVRA+G   I 
Sbjct  117  VGTTAATDAETLGLSLQSAITIGEALEAAVQTAGNKPVDQSDAAAIQAAEVRASGTSVIA  176

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    DE K K+ DVL  A+ KL  DK VT +DA GVV+AE RN 
Sbjct  177  PGGIAASAQSAAIHNATVDRDEEKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNN  236

Query  918  EDHATHPagvaasmaaaaaLNQE  986
             +  THP GVAAS+ AAA LN++
Sbjct  237  PNLTTHPGGVAASVTAAARLNEK  259



>emb|CDX92944.1| BnaA03g36660D [Brassica napus]
Length=256

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 159/248 (64%), Gaps = 13/248 (5%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQQ Q +RP    QEP+KYGDVF+VSG+LA + I  +DA  MQ+ E +A G T KGG A
Sbjct  1    MSQQEQPKRP----QEPVKYGDVFEVSGELADRRIAPEDARMMQAKETSALGHTQKGGIA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            A MQSAA  N R   V+P   T +  ++GVSV + D+AG R   E+IG   VG+Y+ P  
Sbjct  57   ATMQSAATANRRGGFVEPGVATYLDPDRGVSVDQTDVAGARVTKESIGVQDVGQYVEPRP  116

Query  558  eektpppppppaaGV-VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                         GV V   ITIG+ALEAT  +AG KPV +SDAAAIQAAEVRA+    I
Sbjct  117  VSTAAM-------GVSVQSKITIGQALEATVHTAGKKPVDQSDAAAIQAAEVRASSNNVI  169

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             PGGV A AQ AA+ NA    DE K K+ DVLT A+ KL +DKPVT +DA GVV+AE RN
Sbjct  170  APGGVAASAQSAADYNAPIEFDENKIKLADVLTGAAGKLQEDKPVTKQDAEGVVSAELRN  229

Query  915  KEDHATHP  938
              + +T+P
Sbjct  230  NPNLSTYP  237



>ref|XP_006480098.1| PREDICTED: late embryogenesis abundant protein D-34-like [Citrus 
sinensis]
Length=330

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 170/260 (65%), Gaps = 7/260 (3%)
 Frame = +3

Query  207  QQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVM  386
            Q Q  RP+     PI YGDVFDVSG+LA++P+ Q+DAAAMQ+AEN A G+T +GGPAAVM
Sbjct  75   QPQKLRPQHDHDLPINYGDVFDVSGELASQPVAQRDAAAMQAAENMALGKTQRGGPAAVM  134

Query  387  QSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIA-GRRFVTEAIGGDVVGKYIRppaee  563
            QSAA  N R         T + R+QGV+V E  +A G R +TEAIG  V+ +Y       
Sbjct  135  QSAAEANERAGFTSHSTATHIARDQGVTVSESTVADGNRIITEAIGDQVLAQY------A  188

Query  564  ktpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPG  743
                P     A +  D  TIGEALEATA+SAGDK V +SDAAAI AAE RA+    I PG
Sbjct  189  TPEVPTRASGAALGRDQSTIGEALEATALSAGDKAVDQSDAAAIYAAEARASATNEIKPG  248

Query  744  GVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKED  923
            G+G+ AQ AA  N RTT    K  I DV  DA++KL+DDKPVT EDA G+++ E RNK D
Sbjct  249  GIGSRAQSAATQNERTTFFSDKITISDVSGDATTKLSDDKPVTREDAEGIISPEIRNKPD  308

Query  924  HATHPagvaasmaaaaaLNQ  983
              T P GVA+SMAAAA LNQ
Sbjct  309  MRTTPGGVASSMAAAARLNQ  328



>ref|XP_010488281.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=256

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 133/261 (51%), Positives = 168/261 (64%), Gaps = 9/261 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q  RP    +EP+KYGDVF+VSG+LA KP+  +DA  MQ+AE   FG T KGG AA
Sbjct  1    MSQEQPHRP----KEPVKYGDVFEVSGELADKPVAPEDAKMMQAAETHVFGHTQKGGAAA  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +MQSAA  N+R   V P + TD+  E+GV+V E  +      TE +GG VVG+++ P   
Sbjct  57   IMQSAATSNIRGGFVHPGDKTDLAAERGVTV-EQTVPPSTVTTEFVGGQVVGQHVEPRRV  115

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                    P     +   ITIGEALEA   +AG+KPV +SDAAAIQAAE+RA+G   I  
Sbjct  116  VAAARTDEPA----LQSAITIGEALEAALKTAGNKPVDQSDAAAIQAAEMRASGTNVIAL  171

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
             G+ A AQ AA+ NA    DE K K+ DVLT A+ KL+ D+PVT +DA GVV+AE RN  
Sbjct  172  AGIAATAQSAADHNATVDRDEKKIKLVDVLTGAAEKLSSDRPVTRQDAEGVVSAEMRNNP  231

Query  921  DHATHPagvaasmaaaaaLNQ  983
               THP GVAAS+ AAA LN+
Sbjct  232  KLCTHPGGVAASLTAAARLNE  252



>ref|XP_006444042.1| hypothetical protein CICLE_v10023775mg [Citrus clementina]
 gb|ESR57282.1| hypothetical protein CICLE_v10023775mg [Citrus clementina]
Length=335

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 170/260 (65%), Gaps = 7/260 (3%)
 Frame = +3

Query  207  QQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVM  386
            Q Q  RP+     PI YGDVFDVSG+LA++P+ Q+DAAAMQ+AEN A G+T +GGPAAVM
Sbjct  80   QPQKLRPQHDHDLPINYGDVFDVSGELASQPVAQRDAAAMQAAENMALGKTQRGGPAAVM  139

Query  387  QSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIA-GRRFVTEAIGGDVVGKYIRppaee  563
            QSAA  N R         T + R+QGV+V E  +A G R +TEAIG  V+ +Y       
Sbjct  140  QSAAEANERAGFTSHSTATHIARDQGVTVSESTVADGNRIITEAIGDQVLAQY------A  193

Query  564  ktpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPG  743
                P     A +  D  TIGEALEATA+SAGDK V +SDAAAI AAE RA+    I PG
Sbjct  194  TPEVPTRASGAALGRDQSTIGEALEATALSAGDKAVDQSDAAAIYAAEARASATNEIKPG  253

Query  744  GVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKED  923
            G+G+ AQ AA  N RTT    K  I DV  DA++KL+DDKPVT EDA G+++ E RNK D
Sbjct  254  GIGSRAQSAATQNERTTFFSDKITISDVSGDATTKLSDDKPVTREDAEGIISPEIRNKPD  313

Query  924  HATHPagvaasmaaaaaLNQ  983
              T P GVA+SMAAAA LNQ
Sbjct  314  MRTTPGGVASSMAAAARLNQ  333



>ref|XP_009364553.1| PREDICTED: late embryogenesis abundant protein D-34-like [Pyrus 
x bretschneideri]
Length=291

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 146/293 (50%), Positives = 180/293 (61%), Gaps = 30/293 (10%)
 Frame = +3

Query  201   MSQQQARRPESGDQEPIKYGDVFD-VSG-QLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
             MSQ+Q R+PE   +EP+ YGDVF  V G QLA K +T +DAA +Q+AEN   GQT+KGG 
Sbjct  1     MSQEQPRKPED-QKEPVTYGDVFPGVQGAQLADKVVTPKDAAMIQAAENAVLGQTVKGGA  59

Query  375   AAVMQSaaarnvrnarvDPDNV--TDVVREQGVSVKEDDIAGRRFVTEAIGG--------  524
             AA++QSAA +N + A V   +V         GVSVKE D+ GRR +TE+IGG        
Sbjct  60    AAIIQSAATQNEKAAVVGSSDVKADVGGDGGGVSVKEADLPGRRIITESIGGKGSDSNQM  119

Query  525   --------------DVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGD  662
                           +VVG+Y +           P   + V    ITIGEALEATA++AG 
Sbjct  120   HVDQEKQRKIHELVEVVGQYSQRAPLAPPNTMHPVGGSAV---QITIGEALEATAMTAGQ  176

Query  663   KPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDAS  842
             KPV  SDAAAIQAAEVRATG  +I+PGGV   AQ AA +NAR T DE KTK+ D+L +A+
Sbjct  177   KPVEWSDAAAIQAAEVRATGRTNIVPGGVAGAAQSAATLNARATKDEEKTKLADILANAT  236

Query  843   SKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQETAFNI  1001
             SKL  DKP T  DA GV  AE RN     THP GVAAS+AAAA LN+  +  +
Sbjct  237   SKLPADKPATRRDAEGVTGAEMRNDPYLTTHPTGVAASVAAAARLNENNSSQM  289



>ref|XP_010070193.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW58827.1| hypothetical protein EUGRSUZ_H01465 [Eucalyptus grandis]
Length=256

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 172/261 (66%), Gaps = 7/261 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP+ G  +PIKYGDVFDVSG+L  KPI  +DAA MQ+AEN   G T +GG AA
Sbjct  1    MSQEQPRRPQGG-ADPIKYGDVFDVSGELKGKPIAPRDAATMQAAENMVLGGTRQGGVAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  NVR   V P  V+DV R+QGV++ + +I  RR V+EA+              
Sbjct  60   VMQSAADVNVRTGAVRPGQVSDVARDQGVTISQANIGSRRVVSEAV------GGQVVGGY  113

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
             +       P   +  + ITIGEALEA+A+SAGDKP+ +SDAAAIQAAEVRATG    +P
Sbjct  114  VQPAVDTGKPGGALDRNAITIGEALEASALSAGDKPLEQSDAAAIQAAEVRATGSNGTMP  173

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ + AQ AA  NART  DE KTK+ DVLT A+  L  DK VT EDA  V+ AE RNK 
Sbjct  174  GGIASLAQAAATRNARTAADEDKTKLADVLTIATDVLPGDKAVTREDADRVIVAEMRNKV  233

Query  921  DHATHPagvaasmaaaaaLNQ  983
            +  T P GVA SMAAAA LNQ
Sbjct  234  EMTTTPGGVAESMAAAARLNQ  254



>ref|XP_007143265.1| hypothetical protein PHAVU_007G057900g [Phaseolus vulgaris]
 gb|ESW15259.1| hypothetical protein PHAVU_007G057900g [Phaseolus vulgaris]
Length=257

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 128/246 (52%), Positives = 158/246 (64%), Gaps = 7/246 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP+ G Q+PIKYGDVF+VSG LA KP+  +DAA MQSAE    GQT  GG A+
Sbjct  1    MSQEQPRRPQPG-QDPIKYGDVFNVSGNLAKKPVAPEDAAMMQSAETRVLGQTQLGGAAS  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA +N R   V   +V DV  + GV+V E  + GRR +TEA+GG VV +Y  P   
Sbjct  60   VMQSAANQNERAGLVSHLDVNDVASDGGVTVSETQVPGRRIITEAVGGKVVQQYTEPTPV  119

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
            +            V    ITIGEALEATA + G K V +SDA+AIQAAEVRATG   + P
Sbjct  120  QTGRAR------AVRGSAITIGEALEATAQTVGYKVVDQSDASAIQAAEVRATGNNVVAP  173

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NA  + DE K K+ D+L+ A++KL  DK VT++DA GV +AE RN  
Sbjct  174  GGLAAMAQSAAAHNADCSRDEDKVKLSDLLSGATAKLAADKAVTLQDAEGVASAEVRNNP  233

Query  921  DHATHP  938
            D    P
Sbjct  234  DATATP  239



>ref|XP_006433071.1| hypothetical protein CICLE_v10003643mg [Citrus clementina]
 ref|XP_006471852.1| PREDICTED: late embryogenesis abundant protein D-34-like [Citrus 
sinensis]
 gb|ESR46311.1| hypothetical protein CICLE_v10003643mg [Citrus clementina]
Length=257

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 149/263 (57%), Positives = 176/263 (67%), Gaps = 12/263 (5%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP       IKYGDVF V G++A   +  +DAA MQ+AEN   GQ  KG  A+
Sbjct  1    MSQEQPRRP-------IKYGDVFSVEGEIAEMAVAPRDAALMQTAENAMLGQIQKGAAAS  53

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +MQSAA RN +   V  +++TDV   QGVS+ E ++ GRR +TE IGG VVG+Y      
Sbjct  54   MMQSAAERNEKGGFVGHEDMTDVAAGQGVSITETNLPGRRIITEEIGGQVVGQY---SQP  110

Query  561  ektpppppppaaGVVSDD--ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                   PP + G V     ITIGEALEATA++AG KPV  SDAAAIQAAEVRATG  +I
Sbjct  111  SPLQSLAPPSSHGEVKGGGGITIGEALEATALTAGKKPVEWSDAAAIQAAEVRATGRINI  170

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             PGGV A AQ AA INARTT DE KTK+ D+LTDA++KL  DK VT +DA GV  AE RN
Sbjct  171  TPGGVAAAAQSAATINARTTRDEDKTKLADILTDATAKLPADKQVTRKDAEGVAAAEMRN  230

Query  915  KEDHATHPagvaasmaaaaaLNQ  983
                 THPAGVAAS+AAAA LNQ
Sbjct  231  DPMLTTHPAGVAASVAAAARLNQ  253



>emb|CDY24310.1| BnaC03g42830D [Brassica napus]
Length=256

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 157/248 (63%), Gaps = 13/248 (5%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQQ Q +RP    QEP+KYGDVF+VSG+LA +PI  +DA  MQ+ E +  G T KGG A
Sbjct  1    MSQQEQPKRP----QEPVKYGDVFEVSGELADRPIAPEDARMMQAKETSVLGHTQKGGIA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            A MQSAA  N R   V+P   T +  ++GVSV++ D+AG R   E IG   VG+Y+ P  
Sbjct  57   ATMQSAATANRRAGFVEPGVATYLDPDRGVSVEQTDVAGARVTKETIGVQDVGQYVEPRP  116

Query  558  eektpppppppaaGV-VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                         GV V   ITIG+ALEAT  +AG KPV +SDAAAIQAAEVRA+    I
Sbjct  117  VATAAT-------GVSVQSKITIGQALEATVHTAGKKPVDQSDAAAIQAAEVRASSNNVI  169

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             PGGV A AQ AA+ NA    DE K K+ DVL  A+ KL +DK VT +DA GVV+AE RN
Sbjct  170  APGGVAASAQSAADYNAPIEFDENKIKLADVLAGAAGKLQEDKAVTKQDAEGVVSAELRN  229

Query  915  KEDHATHP  938
              + +T+P
Sbjct  230  NPNLSTYP  237



>ref|XP_007224297.1| hypothetical protein PRUPE_ppa019572mg [Prunus persica]
 gb|EMJ25496.1| hypothetical protein PRUPE_ppa019572mg [Prunus persica]
Length=242

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 165/265 (62%), Gaps = 31/265 (12%)
 Frame = +3

Query  201  MSQQQARRPESGDQE----PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKG  368
            MSQ+Q RRP+   Q+    PIKYGDVF VS  LA KPI  QDA  MQ+AE   FG+T KG
Sbjct  1    MSQEQPRRPQEDKQQDKPQPIKYGDVFSVSADLAKKPIAPQDANMMQTAETMVFGKTQKG  60

Query  369  GPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            GPAAVMQSAA RN R+  V  D  TDV   +GV+V E D+ G R VTEA+GG        
Sbjct  61   GPAAVMQSAATRNERSGLVRHDQATDVGGNEGVTVTETDVPGSRIVTEAVGG--------  112

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
                                + ITIGEALEA+A +AGDKP+ +SDAAAIQAAEVRATG  
Sbjct  113  -------------------QNAITIGEALEASAQTAGDKPIDQSDAAAIQAAEVRATGSN  153

Query  729  HILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEA  908
             I PGG+ A AQ AA  NA T  ++ K K+ DVL+ A+ KL  DK  T +DA G+ +AE 
Sbjct  154  VISPGGLAAMAQSAAAYNAGTLREQDKIKLTDVLSGATEKLPADKAATRQDAEGIASAEL  213

Query  909  RNKEDHATHPagvaasmaaaaaLNQ  983
            RN  +  T P GVAAS+ AAA LN+
Sbjct  214  RNNPEMGTRPGGVAASVTAAARLNE  238



>ref|XP_009135809.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=256

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 159/248 (64%), Gaps = 13/248 (5%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQQ Q +RP    QEP+K GDVF+VSG+LA + I  +DA  MQ+ E +A G T KGG A
Sbjct  1    MSQQEQPKRP----QEPVKNGDVFEVSGELADRRIAPEDARMMQAKETSALGHTQKGGIA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            A MQSAA  N R   V+P   T +  ++GVSV++ D+AG R   E+IG   VG+Y+ P  
Sbjct  57   ATMQSAATANRRGGFVEPGVATYLDPDRGVSVEQTDVAGARVTKESIGVQDVGQYVEPRP  116

Query  558  eektpppppppaaGV-VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                         GV V   ITIG+ALEAT  +AG KPV +SDAAAIQAAEVRA+    I
Sbjct  117  VSTAAM-------GVSVQSKITIGQALEATVHTAGKKPVDQSDAAAIQAAEVRASSNNVI  169

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             PGGV A AQ AA+ NA    DE K K+ DVLT A+ KL +DKPVT +DA GVV+AE RN
Sbjct  170  APGGVAASAQSAADYNAPIEFDENKIKLADVLTGAAGKLQEDKPVTKQDAEGVVSAELRN  229

Query  915  KEDHATHP  938
              + +T+P
Sbjct  230  NPNLSTYP  237



>gb|KFK39540.1| hypothetical protein AALP_AA3G257500 [Arabis alpina]
Length=263

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 169/264 (64%), Gaps = 6/264 (2%)
 Frame = +3

Query  201  MSQQQAR--RPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQQQ +  RP    QEP+ YGDVF+V+G+LA KPI  +DA  MQ+AE   FG T K G 
Sbjct  1    MSQQQEQPSRP----QEPVTYGDVFEVTGELADKPIAPEDANMMQAAETRVFGHTQKSGA  56

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AAVMQ AA  N R   V P + TD+  E+GV+V + ++ G R  TE +GG VVG+Y+ P 
Sbjct  57   AAVMQFAATANKRGGFVHPGDTTDLAAERGVTVAQTEVPGARVTTEFVGGQVVGQYVEPR  116

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                            +   ITIGEALEAT  +AG+KPV +SDAAAIQAAEVRA+G   I
Sbjct  117  PVATAEATEAEAIGLKLQSAITIGEALEATVQTAGNKPVNQSDAAAIQAAEVRASGTNVI  176

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             PGG+ A AQ AA  NA    DE K K+ DVL  A+ KL+ DK  T +DA GVV+AE RN
Sbjct  177  APGGIAASAQSAAIHNANVDRDEDKIKLIDVLAGATGKLSADKAATRQDAEGVVSAELRN  236

Query  915  KEDHATHPagvaasmaaaaaLNQE  986
              + +THP GVAAS+ AAA LN++
Sbjct  237  NPNLSTHPGGVAASVTAAARLNEK  260



>ref|XP_004168899.1| PREDICTED: late embryogenesis abundant protein D-34-like, partial 
[Cucumis sativus]
Length=301

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 134/270 (50%), Positives = 165/270 (61%), Gaps = 17/270 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQ---------EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFG  353
            MSQ+Q RR E   Q         E IKYGD+F+VSG LAA PI  +DA  M SAE    G
Sbjct  1    MSQEQPRRDEQLQQSRRNDDEQLETIKYGDIFNVSGDLAANPIAPEDARMMASAETRVLG  60

Query  354  QTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVV  533
            Q  + GPA VM++AAARNVR   +   +++DV + QG+++ E D+ G R VTE + G VV
Sbjct  61   QMHETGPADVMRAAAARNVRVGLLSSRDISDVAKSQGINISETDVPGARVVTECVAGQVV  120

Query  534  GKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVR  713
            G+Y+          P          D ITIG+ALEA     G+KPV +SDAAAIQAAEV 
Sbjct  121  GQYLDTTMTSGVEMPE--------QDVITIGQALEAACQMIGNKPVEQSDAAAIQAAEVC  172

Query  714  ATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGV  893
            ATG   I PGG+GA AQ AA  NAR   DE K K+  VLT+A+ KL  DK V+ +D  GV
Sbjct  173  ATGNNAINPGGLGATAQAAAIFNARMDRDEDKIKLNYVLTEATEKLATDKAVSRQDVEGV  232

Query  894  VNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            V+AE RN     THP GVAAS+ AAA LN+
Sbjct  233  VSAELRNNPSMTTHPGGVAASITAAARLNE  262



>dbj|BAK04960.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 179/309 (58%), Gaps = 26/309 (8%)
 Frame = +3

Query  105  RYKTTFHSTTFPDINIVHLQFSVEYY*CVIIIMSQQQARRPES--------------GDQ  242
            R+ +T H  T   +         +    V+  MSQ Q RRP S                 
Sbjct  5    RFSSTTHLVTLHTLGATR-----QVTGRVLAKMSQGQQRRPSSDQAQAGGGGGQGQGQGG  59

Query  243  EPIKYGDVFD-VSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrna  419
              ++YGDVF  V+G LA KP+  QDAA MQSAEN  FG+TIKGGPAA MQSAA RN R  
Sbjct  60   GAVRYGDVFPAVAGGLAQKPVAPQDAATMQSAENLVFGETIKGGPAATMQSAAMRNERMG  119

Query  420  rvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaG  599
             V  D  TD   EQGVSV E  + G R VTE + G  VG+Y+                AG
Sbjct  120  VVGHDQATDATAEQGVSVSETRVPGGRIVTEFVAGQAVGQYL------APDDAAGAGGAG  173

Query  600  VVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEI  779
                 ITIGEALEA   SAG +PV +SDAAAIQAAEVRATGL   +PGG+ A AQ AA+ 
Sbjct  174  GDDTKITIGEALEAAGYSAGGRPVERSDAAAIQAAEVRATGLDVNIPGGLAAQAQSAADA  233

Query  780  NARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasm  959
            NA    DE K K+GDVLT+AS+KL  DK    +DAA V +AE RNK+D    P GVAAS+
Sbjct  234  NAWAARDEEKAKLGDVLTNASTKLVADKEAEADDAARVASAEIRNKDDKTVRPGGVAASV  293

Query  960  aaaaaLNQE  986
            AAAA LN++
Sbjct  294  AAAARLNKQ  302



>gb|KGN56981.1| hypothetical protein Csa_3G146660 [Cucumis sativus]
Length=303

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 166/273 (61%), Gaps = 17/273 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQ---------EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFG  353
            MSQ+Q RR E   Q         E IKYGD+F+VSG LAA PI  +DA  M SAE    G
Sbjct  1    MSQEQPRRDEQLQQSRRNDDEQLETIKYGDIFNVSGDLAANPIAPEDARMMASAETRVLG  60

Query  354  QTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVV  533
            Q  + GPA VM++AAARNVR   +   +++DV + QG+++ E D+ G R VTE + G VV
Sbjct  61   QMHETGPADVMRAAAARNVRVGLLSSRDISDVAKSQGINISETDVPGARVVTECVAGQVV  120

Query  534  GKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVR  713
            G+Y+          P          D ITIG+ALEA     G+KPV +SDAAAIQAAEV 
Sbjct  121  GQYLDTTMTSGVEMPE--------QDVITIGQALEAACQMIGNKPVEQSDAAAIQAAEVC  172

Query  714  ATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGV  893
            ATG   I PGG+GA AQ AA  NAR   DE K K+  VLT+A+ KL  DK V+ +D  GV
Sbjct  173  ATGNNAINPGGLGATAQAAAIFNARMDRDEDKIKLNYVLTEATEKLATDKAVSRQDVEGV  232

Query  894  VNAEARNKEDHATHPagvaasmaaaaaLNQETA  992
            V+AE RN     THP GVAAS+ AAA LN+  A
Sbjct  233  VSAELRNNPSMTTHPGGVAASITAAARLNEGNA  265



>ref|XP_010466535.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=256

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 154/245 (63%), Gaps = 9/245 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q  RP    QEP+KYGDVF+VSG+LA KP+  +DA  MQ+AE   FG T KGG AA
Sbjct  1    MSQEQPHRP----QEPVKYGDVFEVSGKLADKPVAPEDAKMMQAAETHVFGHTKKGGAAA  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +MQSAA  N+R   V P + TD+  E+GV+V E  +      TE++GG VVG+++ P   
Sbjct  57   IMQSAATSNIRGGFVHPGDKTDLAAERGVTV-EQTVPPSTVTTESVGGQVVGQHVEPRRV  115

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                    P     +   ITIGEALEA   +AG+KPV +SDAAAIQAAE+RA+G   I  
Sbjct  116  VAAARTDEPA----LQSKITIGEALEAALKTAGNKPVDQSDAAAIQAAEMRASGTNVIAL  171

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
             G+ A AQ AA+ NA    DE K K+ DVLT A+ KL  D+ VT +DA GVV+AE RN  
Sbjct  172  AGIAATAQSAADHNATVDRDERKIKLVDVLTGAAEKLPSDRAVTRQDAEGVVSAEMRNNP  231

Query  921  DHATH  935
               TH
Sbjct  232  KLCTH  236



>ref|XP_003590629.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
 gb|AES60880.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=215

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 113/217 (52%), Positives = 149/217 (69%), Gaps = 14/217 (6%)
 Frame = +3

Query  201  MSQQQARRPES---GDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQ+Q +RP++    +QEPIKYGDVF+VSG+LA++PI  +DAA MQ+ EN A GQT KG 
Sbjct  1    MSQEQPQRPQAEQFSEQEPIKYGDVFNVSGELASQPIKPRDAALMQATENQALGQTQKGS  60

Query  372  PAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRp  551
            PA+VMQSAAA N     V   +++D+ + QG+SV +  +   R +TE++G  VVG+++  
Sbjct  61   PASVMQSAAAVNTAAGLVSHGDISDIAKNQGMSVSKTKVGANRVITESVGSQVVGQFVE-  119

Query  552  paeektpppppppaaGVVSDD--ITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATG  722
                   P  P    G+V D   ITIGEALEA+A+S AGDKP+ +SDAAAIQAAE+RATG
Sbjct  120  -------PDVPMNDPGLVLDKNAITIGEALEASALSQAGDKPLDQSDAAAIQAAEMRATG  172

Query  723  LGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLT  833
              H  PGG+GA AQ AA  N RT  D  KT +GDV++
Sbjct  173  KNHTEPGGLGAIAQSAATRNTRTMPDLQKTTLGDVVS  209



>ref|XP_008388644.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=291

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 146/293 (50%), Positives = 179/293 (61%), Gaps = 30/293 (10%)
 Frame = +3

Query  201   MSQQQARRPESGDQEPIKYGDVFD-VSG-QLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
             MSQ+Q RRPE   +EP+ YGDVF  V G QLA K +T +DAA +Q+AEN   GQT+KGG 
Sbjct  1     MSQEQPRRPED-QKEPVTYGDVFPGVQGAQLADKVVTPKDAAMIQAAENAVLGQTVKGGA  59

Query  375   AAVMQSaaarnvrnarvDPDNV--TDVVREQGVSVKEDDIAGRRFVTEAIGG--------  524
             AA++QSAA +N + A     +V         GVSVKE D+ GRR +TE+IGG        
Sbjct  60    AAIIQSAATQNEKAAVXGSSDVKADVGGDGGGVSVKEADLPGRRILTESIGGQGSDSNQM  119

Query  525   --------------DVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGD  662
                           +VVG+Y +               + V    ITIGEALEATA++AG 
Sbjct  120   QVDHEKQRKIHELIEVVGQYSQRAPLAPPNTMQLVGGSAV---QITIGEALEATAMTAGQ  176

Query  663   KPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDAS  842
             KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR T DE KTK+ D+L +A+
Sbjct  177   KPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARATKDEEKTKLADILANAT  236

Query  843   SKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQETAFNI  1001
             SKL  DKP T  DA GV  AE RN     THP GVAAS+AAAA LN+  +  +
Sbjct  237   SKLPADKPATRRDAEGVTGAEMRNDPYLTTHPTGVAASVAAAARLNENNSSQM  289



>ref|XP_004495777.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X2 [Cicer arietinum]
Length=263

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 171/263 (65%), Gaps = 6/263 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RR    D+E IKYGDVF+V G +  + +   DAA MQ AE    G+T KGG A+
Sbjct  1    MSQEQPRR----DEEGIKYGDVFNVQGDIGRRTVAPVDAAMMQKAETETLGKTQKGGAAS  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVK-EDDIAGRRFVTEAIGGDVVGKYIRppa  557
            VM SAA +N R+  V  D+V++V  + GVSV  E D +G + ++E+IGG VVG++ +  A
Sbjct  57   VMMSAAMKNERDGIVGHDDVSEVAADGGVSVTDETDDSGNKVISESIGGQVVGQFSQKGA  116

Query  558  eektpppppppaaGV-VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                         G      ITIGEALEAT ++AG+K V  SDAAAIQAAEVRATG  +I
Sbjct  117  MNTMATASLVEETGTGAGRGITIGEALEATVLTAGNKAVEWSDAAAIQAAEVRATGRTNI  176

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            +PGGV A AQ AA +NARTT DE KTK+ DVL DA+SKL  D+  T  DA GV  AE RN
Sbjct  177  VPGGVAAAAQSAATLNARTTKDEDKTKLADVLADATSKLPADRAATRRDAEGVTGAEMRN  236

Query  915  KEDHATHPagvaasmaaaaaLNQ  983
                 THP GV+AS+AAAA LNQ
Sbjct  237  DPYLTTHPGGVSASVAAAARLNQ  259



>ref|XP_008370878.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=294

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 175/290 (60%), Gaps = 27/290 (9%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFD-VSG-QLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ+Q+RRP+   +E +KYGDVF  V G +LA K +T +DAA MQ+AEN   G T+KGG 
Sbjct  1    MSQEQSRRPZD-QKEAVKYGDVFPGVQGAELAEKVVTPKDAAIMQAAENAVLGHTLKGGA  59

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGD---------  527
            A+ MQSAA  N +   V   +V   V   GVSVKE D+ GRR ++E+IGG          
Sbjct  60   ASFMQSAATENEKAGVVGSSDVNADVVGDGVSVKEADLPGRRIISESIGGQGPNSNQRKV  119

Query  528  --------VVGKYIRp-------paeektpppppppaaGVVSDDITIGEALEATAISAGD  662
                    ++ KY +                P      G  +  ITIGEALEATA++AG 
Sbjct  120  DHEKQRNKILEKYCQNPYXVGQYSQRAPLAAPNTIQPVGGSAGQITIGEALEATAMTAGQ  179

Query  663  KPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDAS  842
            KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR T DE KTK+ ++L DA 
Sbjct  180  KPVEYSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARATKDEEKTKLABILADAX  239

Query  843  SKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQETA  992
            SKL  DKP T  DA GV  AE RN     THP GVAAS+AAAA LN+  +
Sbjct  240  SKLPADKPATRRDAEGVTGAEMRNDPFLTTHPTGVAASVAAAARLNENNS  289



>ref|XP_008364056.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=224

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 151/226 (67%), Gaps = 6/226 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFD-VSG-QLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ+Q+RRP+   +E +KYGDVF  V G +LA K +T +DAA MQ+AEN   G T+KGG 
Sbjct  1    MSQEQSRRPQD-QKEAVKYGDVFPGVQGAELAEKVVTPKDAAIMQAAENAVLGHTLKGGA  59

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            A+ MQSAA  N +   V   +V   V   GVSVKE D+ GRR ++E+IGG VVG+Y    
Sbjct  60   ASXMQSAATENEKAGVVGSSDVNADVVGDGVSVKEADLPGRRIISESIGGQVVGQY---S  116

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                   P      G  +  ITIGEALEATA++AG KPV  SDAAAIQAAEVRATG  +I
Sbjct  117  QRAPLAAPNTIQPVGGSAGQITIGEALEATAMTAGQKPVEYSDAAAIQAAEVRATGRTNI  176

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVT  872
            +PGGV A AQ AA +NAR T DE KTK+ ++L DA+SKL  DKP T
Sbjct  177  VPGGVAAAAQSAATLNARATKDEEKTKLANILADATSKLPADKPAT  222



>ref|XP_004247663.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
lycopersicum]
Length=267

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 137/265 (52%), Positives = 164/265 (62%), Gaps = 4/265 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQ--EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQQQ RR E GDQ  +PIKYGDVF VSG+L  K +  +DAA MQSAE    G+T K GP
Sbjct  1    MSQQQPRR-EQGDQAADPIKYGDVFAVSGELGEKAVKPEDAAMMQSAETAVLGKTQKSGP  59

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AA MQSAA  NV    V P +VTDV   +GV+V    + G   +TE++ G VV +YI+P 
Sbjct  60   AAAMQSAANVNVSAGLVQPGDVTDVAAREGVTVTGTAVPGANIITESVAGQVVAQYIQPT  119

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                  P       G    +ITIGEALEA   +   KPV + DAAAIQAAEVRATG   I
Sbjct  120  GGVGGQPQGAATTGGS-RREITIGEALEAAGQTIPGKPVDQCDAAAIQAAEVRATGSNVI  178

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             PGGV A AQ AA  N     DE K K+GDVL+ A+  L  DK  T +DA GVV AE RN
Sbjct  179  TPGGVAATAQSAAAYNESMIKDEDKVKLGDVLSGATKVLPADKAATRQDAEGVVGAELRN  238

Query  915  KEDHATHPagvaasmaaaaaLNQET  989
            K+D +T P GVAAS+  AA +N+ +
Sbjct  239  KQDMSTTPGGVAASVTVAARMNERS  263



>ref|NP_001237506.1| seed maturation protein PM24 [Glycine max]
 gb|AAF21310.1| seed maturation protein PM24 [Glycine max]
Length=259

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 155/246 (63%), Gaps = 5/246 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP+   Q+PIKYGDVFDV G LA  PI  +DAA MQSAE    G+T  GG ++
Sbjct  1    MSQEQPRRPQG--QDPIKYGDVFDVYGDLAQMPIAPEDAAMMQSAEARVLGKTQPGGASS  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA RN +   V   +VTD+  + GV+V E    GRR +TEA+GG VV +Y+ P ++
Sbjct  59   VMQSAATRNEQAGLVGHQDVTDITGDHGVTVTETTFHGRRIITEAVGGQVVEQYVEPKSQ  118

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
             +             +    +GEAL+ATA + G KPV +SDA+AIQ AEVRATG   I P
Sbjct  119  FEAGRTSCNLRRSAYNQ---LGEALKATAQTVGHKPVDQSDASAIQTAEVRATGSNVITP  175

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NA    D+ K K+ DVLT A++KL  DK  T++DA GV +AEARN  
Sbjct  176  GGLAAMAQSAAAYNADCKHDQDKVKLADVLTGATAKLPADKAATLQDAEGVASAEARNNP  235

Query  921  DHATHP  938
            D    P
Sbjct  236  DATATP  241



>emb|CCW28814.1| seed maturation protein [Arachis hypogaea]
Length=256

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 152/239 (64%), Gaps = 8/239 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRPE  D  PIKYGDVF+VSG+LA KP+  +DAA MQSAE    G+T  GG AA
Sbjct  1    MSQEQHRRPEESD--PIKYGDVFNVSGELAQKPVKPEDAAMMQSAETRVLGKTQPGGAAA  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAA  N +   V   +V +V  ++GV+V +    GRR VTE++GG VVG+Y+ P   
Sbjct  59   AMQSAATLNEQAGLVGHHDVNEVAGDRGVTVTDMQAPGRRIVTESVGGQVVGQYVEPTPV  118

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
            + +          V    ITIGEALEATA + G KPV +SDAAAIQAAEVRATG   I P
Sbjct  119  QSSRASA------VRESAITIGEALEATAQTVGSKPVEQSDAAAIQAAEVRATGSNVIQP  172

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            GG+ A AQ A   NA       K K+ D+LT A++KL  DK  T +DA GV +AEARN 
Sbjct  173  GGLAAMAQSAVAFNAGCRNPRDKIKLADILTGATAKLPADKAATHQDAEGVASAEARNN  231



>ref|XP_004304720.1| PREDICTED: late embryogenesis abundant protein D-34-like [Fragaria 
vesca subsp. vesca]
Length=261

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 176/269 (65%), Gaps = 10/269 (4%)
 Frame = +3

Query  201   MSQQQARRPESGDQEPIKYGDVFD-VSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
             MSQ+Q+++     Q+ +K+ DVF  V G+LA K +  +DAA MQ+AE+   GQ +K G A
Sbjct  1     MSQEQSKKGHDQRQKAMKFSDVFPAVQGELADKAVAPKDAATMQTAESDVVGQNLKRGAA  60

Query  378   AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
             A MQSAAA+N R   V  +++  V  E  V++ E D+ GRR +TE++GG VVG+YI+   
Sbjct  61    ATMQSAAAQNQRAGYVGLNDMNIV--EDDVTITETDLPGRRIITESVGGQVVGEYIQRTP  118

Query  558   eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                                ITIGEALE T ++A  KPV  SDAAAIQAAE+RATG   I+
Sbjct  119   LAAPSIVQAG------DGHITIGEALETTVMTARKKPVEWSDAAAIQAAEIRATGRPRIV  172

Query  738   PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
             PGGV A+AQ AA +NART  +E KT +GD+L  A+SKL DDKP T++DA GV +AE RN 
Sbjct  173   PGGVAAEAQSAATLNARTMRNEDKTTLGDILAGAASKLPDDKPTTLQDAKGVTDAEMRND  232

Query  918   EDHATHPagvaasmaaaaaLNQETAFNIT  1004
                 THP GVAAS+AAAA LNQ+ A NIT
Sbjct  233   RYQTTHPTGVAASVAAAARLNQD-ASNIT  260



>ref|XP_004134446.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
Length=506

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 134/270 (50%), Positives = 165/270 (61%), Gaps = 17/270 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQ---------EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFG  353
            MSQ+Q RR E   Q         E IKYGD+F+VSG LAA PI  +DA  M SAE    G
Sbjct  1    MSQEQPRRDEQLQQSRRNDDEQLETIKYGDIFNVSGDLAANPIAPEDARMMASAETRVLG  60

Query  354  QTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVV  533
            Q  + GPA VM++AAARNVR   +   +++DV + QG+++ E D+ G R VTE + G VV
Sbjct  61   QMHETGPADVMRAAAARNVRVGLLSSRDISDVAKSQGINISETDVPGARVVTECVAGQVV  120

Query  534  GKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVR  713
            G+Y+          P          D ITIG+ALEA     G+KPV +SDAAAIQAAEV 
Sbjct  121  GQYLDTTMTSGVEMPE--------QDVITIGQALEAACQMIGNKPVEQSDAAAIQAAEVC  172

Query  714  ATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGV  893
            ATG   I PGG+GA AQ AA  NAR   DE K K+  VLT+A+ KL  DK V+ +D  GV
Sbjct  173  ATGNNAINPGGLGATAQAAAIFNARMDRDEDKIKLNYVLTEATEKLATDKAVSRQDVEGV  232

Query  894  VNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            V+AE RN     THP GVAAS+ AAA LN+
Sbjct  233  VSAELRNNPSMTTHPGGVAASITAAARLNE  262



>ref|XP_006349691.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
tuberosum]
Length=257

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 174/256 (68%), Gaps = 8/256 (3%)
 Frame = +3

Query  231  SGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnv  410
            S + +P+ Y DVF VS +L ++ I  +DAA MQSAE+ A G   +GGPA++MQSAA++N 
Sbjct  4    SNEDKPVTYTDVFSVSSELGSEIIAPEDAAIMQSAESIALGHVPRGGPASLMQSAASQNE  63

Query  411  rnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeek----tppp  578
            R   V  +++TD  R+ GV+V + ++ G R V+E++GG+VV +YI P             
Sbjct  64   RIGVVATNDITDFARKHGVTVSQVEVGGTRVVSESVGGEVVAQYIYPSEAGGGGDDEERS  123

Query  579  ppppaaGVVSDDITIGEALEATAIS-AGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGA  755
               P  GV  + +T+GEALEA A+  AGDKP+ +SDAAAIQAAE RATG   ++PGGVGA
Sbjct  124  ARYPTTGVQEEAVTVGEALEAVALKPAGDKPIEQSDAAAIQAAEARATGRSEVVPGGVGA  183

Query  756  DAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATH  935
            +AQRAA INA+T   + KT +GDVL DA+SKL DDK V  EDA GVV AE RN  D ATH
Sbjct  184  EAQRAASINAQT---DDKTTLGDVLRDATSKLIDDKAVKKEDAEGVVAAEIRNTPDLATH  240

Query  936  PagvaasmaaaaaLNQ  983
            P GVAAS+  A+ LN+
Sbjct  241  PGGVAASITTASNLNK  256



>ref|XP_010025078.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW61664.1| hypothetical protein EUGRSUZ_H04398 [Eucalyptus grandis]
Length=277

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 171/267 (64%), Gaps = 12/267 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVF-DVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+Q RR     QEP+KYGDVF  V G+LA KP+   DAA MQ+AEN   GQ  KG  A
Sbjct  1    MSQEQPRR---RAQEPVKYGDVFASVEGELAGKPVAPNDAALMQTAENLMLGQVQKGAAA  57

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKY-----  542
            +VMQSAA +N     V  D++ ++V EQGV+V      G   +TE+IGG V+G+Y     
Sbjct  58   SVMQSAATQNEDAGVVGHDSMNEIVAEQGVNVAA--FRGGHVITESIGGQVLGQYSQRAP  115

Query  543  -IRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRAT  719
             +  P   +    P     G+    ITIGEALEATA++ GDKPV +SDAAAIQAAEVRAT
Sbjct  116  LVSGPVVPENKNKPSGDDDGIGGGPITIGEALEATALTIGDKPVERSDAAAIQAAEVRAT  175

Query  720  GLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVN  899
            G   I PGGV A AQ AA +NARTT  E KTK+ DVL  ASSKL  DKPVT  D  GV  
Sbjct  176  GRTTIAPGGVAAAAQSAATLNARTTRPEEKTKMADVLWGASSKLPSDKPVTRADVEGVTV  235

Query  900  AEARNKEDHATHPagvaasmaaaaaLN  980
            AE RN     THPAGV+A++AAAA LN
Sbjct  236  AEIRNDPFLTTHPAGVSATVAAAARLN  262



>ref|XP_008218177.1| PREDICTED: late embryogenesis abundant protein D-34 isoform X1 
[Prunus mume]
Length=288

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 145/286 (51%), Positives = 177/286 (62%), Gaps = 31/286 (11%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q R+PE   +E +KYGDVF   G+LA K +  +DAA MQ+AEN   G+TIKGG AA
Sbjct  1    MSQEQPRKPED-QKEAVKYGDVFP-GGELADKVVAPKDAAIMQAAENAVLGETIKGGAAA  58

Query  381  VMQSaaarnvrnarvDPDNVT-DVVR--EQGVSVKEDDIAGRRFVTEAIGG---------  524
             +Q+AA +N +   V PD++  ++V   E GVSVKE D+ GRR +TE+I G         
Sbjct  59   TLQAAARQNEKAGVVGPDDMNANIVTGDEGGVSVKEADLPGRRIITESIAGQGLDSNTRN  118

Query  525  -------------DVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDK  665
                         + VG+Y +                G     ITIGEALEATA++AG K
Sbjct  119  VDHEKQRKIYELVEAVGQYSQRAPLAAPNTIQAGGPGG----QITIGEALEATAMTAGQK  174

Query  666  PVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASS  845
            PV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR T DE KTK+ D+L DA+S
Sbjct  175  PVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARATKDEEKTKLADILADATS  234

Query  846  KLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            KL  DKP T  DA GV  AE RN     THP GVAAS+AAAA LNQ
Sbjct  235  KLPADKPATRRDAEGVTGAEMRNDPFLTTHPTGVAASVAAAARLNQ  280



>ref|XP_007050564.1| Late embryogenesis abundant protein D-34, putative isoform 2 
[Theobroma cacao]
 gb|EOX94721.1| Late embryogenesis abundant protein D-34, putative isoform 2 
[Theobroma cacao]
Length=284

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 131/263 (50%), Positives = 156/263 (59%), Gaps = 17/263 (6%)
 Frame = +3

Query  201  MSQQQARRPE---SGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQ+Q RRP+   + DQE IKYGDVFDV+G LA+KP+  +D   M+ AEN   G+T+  G
Sbjct  1    MSQRQPRRPQGDQTSDQEAIKYGDVFDVTGGLASKPVAPRDTETMRIAENQVLGKTLDAG  60

Query  372  PAAVMQSaaarnvrnarvDPDNVTDVVREQGVSV-KEDDIAGRRFVTEAIGGDVVGKYIR  548
             AAVMQSAA  NV +  V P     +V  +GV+V K  D+ G+  VTEAI G +VG+Y  
Sbjct  61   AAAVMQSAADVNVMSGVVCPSPGNKMVEREGVAVPKSRDLQGKVVVTEAIAGQIVGQYTP  120

Query  549  ppaeektpppppppaaGVVS-------------DDITIGEALEATAISAGDKPVGKSDAA  689
                  TP P P P  G V              + ITIGEALEATAIS GDKPV + DAA
Sbjct  121  SDVRGITPFPSPTPVRGDVGWTTSPTPTGAVDHNGITIGEALEATAISVGDKPVDQGDAA  180

Query  690  AIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPV  869
            AI+ AEVRA G       G+GA AQ AA  N R + D  K  I +VL+DASSK   DK V
Sbjct  181  AIRVAEVRAAGSNVTQRNGLGATAQAAATFNDRVSYDYNKMTISNVLSDASSKFPQDKAV  240

Query  870  TVEDAAGVVNAEARNKEDHATHP  938
            T EDA GV  AE RNK D    P
Sbjct  241  TSEDADGVRGAELRNKLDMIPTP  263



>ref|XP_006360815.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
tuberosum]
Length=263

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 152/252 (60%), Gaps = 7/252 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQ--EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQQQ RR E GDQ  +PIKYGDVF VSG+L  K +  +DAA MQSAE    G+  K GP
Sbjct  1    MSQQQPRR-EQGDQAADPIKYGDVFSVSGELGEKAVKPEDAAMMQSAETAVLGKMQKSGP  59

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AA MQSAA  NV    V P +VTDV   +GV+V    + G   +TE++ G VVG+YI+P 
Sbjct  60   AAAMQSAANVNVSAGLVQPGDVTDVAAREGVTVTGTAVPGANIITESVAGQVVGQYIQPT  119

Query  555  aeektpppppppaaGVV----SDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATG  722
                  P       G      + +ITIGEALEA   +   KPV + DAAAIQAAEVRATG
Sbjct  120  GGGGGQPQGAATTGGGGGGGSTREITIGEALEAAGQTIPGKPVDQCDAAAIQAAEVRATG  179

Query  723  LGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNA  902
               I PGGV A AQ AA  N     DE K K+GDVL+ A+  L  DK  T +DA GVV A
Sbjct  180  SNVITPGGVAATAQSAAAYNESMIKDEDKVKLGDVLSGATKVLPADKAATRQDAEGVVGA  239

Query  903  EARNKEDHATHP  938
            E RNK D +T P
Sbjct  240  ELRNKHDMSTTP  251



>gb|AAF21311.1| seed maturation protein PM25 [Glycine max]
Length=253

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 152/246 (62%), Gaps = 11/246 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP+   Q PIKYGDVF VSG LA KP+  +DAA MQSAE    GQT  GG A+
Sbjct  1    MSQEQPRRPKG--QNPIKYGDVFVVSGDLAQKPVAPEDAAMMQSAEARVLGQTQPGGAAS  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA RN +   V   +VTDV  ++GV+V E  + GRR +TEA+GG VV +Y+     
Sbjct  59   VMQSAATRNEQAGLVGHRDVTDVTGDRGVTVTETKVPGRRIITEAVGGQVVEQYVEATPV  118

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
            E            +  + ITIGEALEATA + G K V +SDA+AIQAAEVRATG   I P
Sbjct  119  EAGRSS------AIKENAITIGEALEATAQTVGQKAVDQSDASAIQAAEVRATGSNVITP  172

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  NA    D+ K K+   L  A++KL  DK  T++DA GV  AE RN  
Sbjct  173  GGLAAMAQSAAAYNADCKLDQDKVKL---LAGATAKLPADKAATLQDAEGVACAEVRNNP  229

Query  921  DHATHP  938
            D    P
Sbjct  230  DATATP  235



>gb|KDO74561.1| hypothetical protein CISIN_1g038380mg [Citrus sinensis]
Length=261

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 159/248 (64%), Gaps = 8/248 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQE--PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ Q RRP + DQ+  PIKYGD F+VSG LA KPI  +DAA MQ+AE T  GQT KGGP
Sbjct  1    MSQAQPRRPGADDQQQQPIKYGDFFNVSGDLAQKPIAPEDAAMMQTAEATIMGQTQKGGP  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AA MQSAAARN     V   +VTDV  +QGV+V E D+ GRR +TE++GG VVG++  P 
Sbjct  61   AAAMQSAAARNEGAGFVGHRDVTDVAGDQGVTVTETDVPGRRIITESVGGQVVGRHEEPT  120

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                 P         V    ITIGEALE TA +AGDKPV +SDAAAIQAAEVRATG    
Sbjct  121  PVSLAPTTGR-----VEQGAITIGEALETTAQTAGDKPVDQSDAAAIQAAEVRATGSTVT  175

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
             P G+ A AQ AA  N     DE K K+  VL  A++KL  DK VT +DA G+ +AE RN
Sbjct  176  TP-GLAASAQSAAAHNETVDRDEDKIKLNQVLAGATAKLAADKAVTRQDAEGIASAEQRN  234

Query  915  KEDHATHP  938
              +  THP
Sbjct  235  NPNADTHP  242



>ref|XP_003559428.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brachypodium 
distachyon]
Length=271

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 170/276 (62%), Gaps = 17/276 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQE---------PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENT--A  347
            MSQ Q RR    + E         P+KYGDVFDVSG LAA+P+  +DAA MQSAE++   
Sbjct  1    MSQGQPRRMSEAEGEKARQPPQDRPVKYGDVFDVSGSLAAQPVAPRDAALMQSAEDSVLG  60

Query  348  FGQTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGD  527
             GQT KGGPAA MQSAA  N R   V    ++ +  ++GV+V E  + GRR VTE++ G 
Sbjct  61   LGQTQKGGPAAAMQSAATVNARAGHVGRGQLSGLAADEGVAVTETQLPGRRVVTESVAGQ  120

Query  528  VVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISA-GDKPVGKSDAAAIQAA  704
             VG+++        P     P   +  D +TIG ALEA A SA G KPV +SDAAAI AA
Sbjct  121  TVGQFV-----APEPVAATAPGGALGKDAVTIGRALEAAAASAAGGKPVDQSDAAAIMAA  175

Query  705  EVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDA  884
            E RATG    +PGGV A AQ AA++N RT  D  K K+ DVL+DA SKL  DK  T EDA
Sbjct  176  ETRATGSDETVPGGVAATAQSAADMNDRTMCDANKVKLRDVLSDARSKLPADKGATREDA  235

Query  885  AGVVNAEARNKEDHATHPagvaasmaaaaaLNQETA  992
              VV+AE RNK + +T P GVA ++  AA LNQE A
Sbjct  236  ERVVSAEIRNKPNMSTTPGGVADAVTTAARLNQERA  271



>gb|KHG19384.1| Late embryogenesis abundant D-34 [Gossypium arboreum]
Length=261

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 161/251 (64%), Gaps = 14/251 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQQQ R+PE  ++E IKYGDVFDV G+LA KP+  +DAA MQ A N   G+T KG  AA
Sbjct  1    MSQQQPRKPE--EEEAIKYGDVFDVQGKLAEKPVAPKDAAMMQMAGNALLGETKKGCAAA  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             M SAA +N +   V  +   DV  + GV+V+E  +AG+R +TE+I  +V+G+Y +    
Sbjct  59   AMVSAAMKNEKAGFVGHE---DVNVDSGVTVEETQLAGKRIITESIENEVIGQYSQAAPL  115

Query  561  ektpppppppaaGVVSDD-----ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGL  725
               P      +     +D     ITIGEALEATA++AG+KPV  SDAAAIQAAEVRATG 
Sbjct  116  TSGPYSSCEQS----EEDGGGGPITIGEALEATALTAGNKPVEWSDAAAIQAAEVRATGR  171

Query  726  GHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
              I+PGGV A AQ AA +NAR + +E KTK+ DVL++A+ +L  DK  T  DA GV  AE
Sbjct  172  TSIMPGGVAAAAQSAATLNARASREEEKTKLCDVLSNATERLGSDKAATRRDAEGVAVAE  231

Query  906  ARNKEDHATHP  938
             RN     THP
Sbjct  232  LRNDPTLTTHP  242



>ref|XP_009599420.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nicotiana 
tomentosiformis]
Length=274

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 131/271 (48%), Positives = 163/271 (60%), Gaps = 9/271 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP+ G+ +PIKYGDVF VSG+L  K I  +DAA MQSAE    GQT +GGPA 
Sbjct  1    MSQEQPRRPQ-GEGDPIKYGDVFGVSGELGEKAIKPEDAAMMQSAETAVLGQTQRGGPAD  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAA  N+    V P +VTDV   +GV+V    + G   +TE++ G VVG+YI+P   
Sbjct  60   AMQSAANYNISAGAVQPGDVTDVAAREGVTVTGTAVPGANIITESVAGQVVGQYIQPTGG  119

Query  561  ektpppppppaaGVVSDDITIGE--------ALEATAISAGDKPVGKSDAAAIQAAEVRA  716
                        G                  ALEATA +   KP+ +SDAAAIQAAE+RA
Sbjct  120  MAQGGGGVQEQEGSGGGGGQQQGGGGITIGQALEATAQTIPGKPIDQSDAAAIQAAEIRA  179

Query  717  TGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVV  896
            TG   I PGGV A AQ AA  N     DE K K+GDVL+ A++ L  D+P T +DA GVV
Sbjct  180  TGSNVITPGGVAATAQSAAAYNESMMRDEDKVKLGDVLSGATTVLPADRPATRQDAEGVV  239

Query  897  NAEARNKEDHATHPagvaasmaaaaaLNQET  989
             AE RNK+D +T P GVAAS+  AA LN+ +
Sbjct  240  GAEIRNKQDMSTTPGGVAASVTVAARLNERS  270



>ref|XP_003562052.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brachypodium 
distachyon]
Length=302

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 189/319 (59%), Gaps = 35/319 (11%)
 Frame = +3

Query  75   FMHHPSHARRRYKTTFHSTTFPDINIVHLQFSVEYY*CVIIIMSQQQARRPESGDQE---  245
            F+ H +H    ++T   S T   + +V  + SV       +   Q Q RRP +G  +   
Sbjct  6    FLSH-THLVTNFRT-LRSATSQVVAVVISRRSVAK-----MSQGQPQPRRPSAGGDQQQH  58

Query  246  --------PIKYGDVFD--VSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSa  395
                     I+YGDVF   V G LA KP++ QDAA MQSAEN  FG T+KGGPAA MQSA
Sbjct  59   QDQDQAGGAIRYGDVFPGAVHGGLAEKPVSPQDAATMQSAENLVFGATLKGGPAAAMQSA  118

Query  396  aarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpp  575
            A+RN R   V  D  T  V++QGV V      G R VTE + G  VG+Y+ P A+     
Sbjct  119  ASRNERTGAVAHDQAT--VQKQGVCVP-----GARVVTEFVAGQAVGQYLAPDADADADD  171

Query  576  pppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGA  755
                         ITIGEALEA + +AG +PV +SDAAAIQAAEVRATGL   +PGG+ A
Sbjct  172  AA--------PSKITIGEALEAASFAAGRRPVERSDAAAIQAAEVRATGLDVNVPGGLAA  223

Query  756  DAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATH  935
             AQ+AA+ N R  +D  KT +GDVL++A+ KL  DK V  EDAA V  AEARNKED    
Sbjct  224  QAQKAADANERAASDRDKTMLGDVLSNATEKLLADKAVESEDAARVAFAEARNKEDATAR  283

Query  936  PagvaasmaaaaaLNQETA  992
            P GVAASMAAAA +N++TA
Sbjct  284  PGGVAASMAAAARINRDTA  302



>ref|XP_004495776.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X1 [Cicer arietinum]
Length=280

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 172/280 (61%), Gaps = 23/280 (8%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RR    D+E IKYGDVF+V G +  + +   DAA MQ AE    G+T KGG A+
Sbjct  1    MSQEQPRR----DEEGIKYGDVFNVQGDIGRRTVAPVDAAMMQKAETETLGKTQKGGAAS  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVK-EDDIAGRRFVTEAIGG-----------  524
            VM SAA +N R+  V  D+V++V  + GVSV  E D +G + ++E+IGG           
Sbjct  57   VMMSAAMKNERDGIVGHDDVSEVAADGGVSVTDETDDSGNKVISESIGGQVLHKVDEKER  116

Query  525  ------DVVGKYIRppaeektpppppppaaGV-VSDDITIGEALEATAISAGDKPVGKSD  683
                  +VVG++ +  A             G      ITIGEALEAT ++AG+K V  SD
Sbjct  117  KTGKLVEVVGQFSQKGAMNTMATASLVEETGTGAGRGITIGEALEATVLTAGNKAVEWSD  176

Query  684  AAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDK  863
            AAAIQAAEVRATG  +I+PGGV A AQ AA +NARTT DE KTK+ DVL DA+SKL  D+
Sbjct  177  AAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARTTKDEDKTKLADVLADATSKLPADR  236

Query  864  PVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
              T  DA GV  AE RN     THP GV+AS+AAAA LNQ
Sbjct  237  AATRRDAEGVTGAEMRNDPYLTTHPGGVSASVAAAARLNQ  276



>ref|XP_007050563.1| Late embryogenesis abundant protein D-34, putative isoform 1 
[Theobroma cacao]
 gb|EOX94720.1| Late embryogenesis abundant protein D-34, putative isoform 1 
[Theobroma cacao]
Length=287

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 156/268 (58%), Gaps = 22/268 (8%)
 Frame = +3

Query  201  MSQQQARRPE---SGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQ+Q RRP+   + DQE IKYGDVFDV+G LA+KP+  +D   M+ AEN   G+T+  G
Sbjct  1    MSQRQPRRPQGDQTSDQEAIKYGDVFDVTGGLASKPVAPRDTETMRIAENQVLGKTLDAG  60

Query  372  PAAVMQSaaarnvrnarvDPDNVTDVVREQGVSV-KEDDIAGRRFVTEAIGGDV-----V  533
             AAVMQSAA  NV +  V P     +V  +GV+V K  D+ G+  VTEAI G V     V
Sbjct  61   AAAVMQSAADVNVMSGVVCPSPGNKMVEREGVAVPKSRDLQGKVVVTEAIAGQVKYILIV  120

Query  534  GKYIRppaeektpppppppaaGVV-------------SDDITIGEALEATAISAGDKPVG  674
            G+Y        TP P P P  G V              + ITIGEALEATAIS GDKPV 
Sbjct  121  GQYTPSDVRGITPFPSPTPVRGDVGWTTSPTPTGAVDHNGITIGEALEATAISVGDKPVD  180

Query  675  KSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLT  854
            + DAAAI+ AEVRA G       G+GA AQ AA  N R + D  K  I +VL+DASSK  
Sbjct  181  QGDAAAIRVAEVRAAGSNVTQRNGLGATAQAAATFNDRVSYDYNKMTISNVLSDASSKFP  240

Query  855  DDKPVTVEDAAGVVNAEARNKEDHATHP  938
             DK VT EDA GV  AE RNK D    P
Sbjct  241  QDKAVTSEDADGVRGAELRNKLDMIPTP  268



>emb|CAA63085.1| LEA D34 protein homologue type 1 [Arabidopsis thaliana]
Length=218

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 135/212 (64%), Gaps = 6/212 (3%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+ Q +RP    QEP+ YGDVF+VSG+LA KPI  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQEEQPKRP----QEPVTYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            AVMQSAA  N R   V P + TD+  E+GV+V + D+ G R  TE +GG VVG+Y+ P  
Sbjct  57   AVMQSAATANKRGGFVHPGDTTDLAAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRP  116

Query  558  eektpppppppaaGV-VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                         G+ +   ITIGEALEAT  +AG+KPV +SDAAAIQAAEVRA G   I
Sbjct  117  VATAAVYGKQKLVGLSLQSAITIGEALEATVQTAGNKPVDQSDAAAIQAAEVRACGTNVI  176

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVL  830
             PGG+ A AQ AA  NA    DE K K+ DVL
Sbjct  177  APGGIAASAQSAANHNATIDRDEDKIKLIDVL  208



>ref|NP_001237967.1| seed maturation protein PM26 [Glycine max]
 gb|AAF21312.1| seed maturation protein PM26 [Glycine max]
Length=257

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 150/247 (61%), Gaps = 9/247 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP+   Q PIKYGDVF VSG LA KP+  +DAA MQSAE    GQT  GG A+
Sbjct  1    MSQEQPRRPKG--QNPIKYGDVFVVSGDLAQKPVAPEDAAMMQSAETRVLGQTQPGGAAS  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA RN +   V   +VTDV  ++GV+V E  + GRR +TEA+GG VV +Y+     
Sbjct  59   VMQSAATRNEQAGLVGHRDVTDVTGDRGVTVTETKVPGRRIITEAVGGQVVEQYVEATPV  118

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATG-LGHIL  737
            E            +  + ITIGEALEATA + G K V +SDA AIQAA   + G +  I 
Sbjct  119  EAGRSSA------IKENAITIGEALEATAQTVGQKAVDQSDAFAIQAAGGESNGEVNVIT  172

Query  738  PGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNK  917
            PGG+ A AQ AA  NA    D+ K K+ D+L  A++KL  DK  T++DA GV  AE RN 
Sbjct  173  PGGLAAMAQSAAAYNADCKLDQAKVKLADILAGATAKLPADKAATLQDAEGVACAEVRNN  232

Query  918  EDHATHP  938
             D    P
Sbjct  233  PDATATP  239



>gb|KHG05102.1| Late embryogenesis abundant D-34 [Gossypium arboreum]
Length=258

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 159/246 (65%), Gaps = 7/246 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q +RP    QEPIKYGDVF+V+G+LA+KPI  +DAAAMQSAEN   G+T KGG AA
Sbjct  1    MSQEQPQRP-GASQEPIKYGDVFNVTGELASKPIGPKDAAAMQSAENKILGETPKGGAAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAA  N R   V   N  DV  +QGV+V + D  G   +TEA+ G +VG+Y R P  
Sbjct  60   AMQSAAIANERAGVVS-HNQADVAGDQGVAVIKSDADGDVMITEAVAGQIVGQY-RQPDV  117

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                 P      G     ITIGEALEA AISA DKP+ +SDAAAIQAAE+RATG   I P
Sbjct  118  SAVTTPAMLVDPG----SITIGEALEAAAISAADKPIDQSDAAAIQAAEMRATGSSEITP  173

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ ++AQ AA  NART   E +  + DVL+DA++ L  DK VT EDA  VV AE RN  
Sbjct  174  GGIASEAQSAATRNARTQRFEDQATLSDVLSDATAMLPKDKAVTREDAERVVAAEVRNNP  233

Query  921  DHATHP  938
              +T P
Sbjct  234  GMSTTP  239



>ref|XP_010041757.1| PREDICTED: late embryogenesis abundant protein D-34 [Eucalyptus 
grandis]
 gb|KCW84905.1| hypothetical protein EUGRSUZ_B01734 [Eucalyptus grandis]
Length=262

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 175/266 (66%), Gaps = 11/266 (4%)
 Frame = +3

Query  201  MSQQQARR-PESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+Q RR PE      I+YGD+F V G+LA KP+T +DAA MQ+AEN  FGQT +G  A
Sbjct  1    MSQEQPRRTPEDA----IRYGDIFAVDGELAEKPVTPRDAAMMQTAENEMFGQTQRGHAA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppa  557
            A MQSAAARN R   V   +VT+V  + GV++ E D+ GRR +TE++GG VV ++ R   
Sbjct  57   AAMQSAAARNERAGLVGHSDVTEVASKDGVTITETDLPGRRVITESVGGQVVSQFSRRSP  116

Query  558  eektppppppp----aaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGL  725
                 P           G+ S  ITIGEALEA A++AG KPV  SDAAAIQAAEVRATG 
Sbjct  117  IPTMTPSSIYQIDAGKDGIGS--ITIGEALEAAALTAGQKPVEWSDAAAIQAAEVRATGR  174

Query  726  GHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
              I+PGGV A AQ AA +NART   E KT + D+L DA+SKL  DKP +  DA GV  AE
Sbjct  175  TTIVPGGVAAAAQAAATLNARTPRAEDKTTLADILGDATSKLPSDKPASRRDAEGVAGAE  234

Query  906  ARNKEDHATHPagvaasmaaaaaLNQ  983
             RN     THPAG+AAS+AAAA LNQ
Sbjct  235  MRNDPRLNTHPAGIAASVAAAARLNQ  260



>ref|NP_001152643.1| late embryogenesis abundant protein D-34 [Zea mays]
 gb|ACG48700.1| late embryogenesis abundant protein D-34 [Zea mays]
 tpg|DAA51324.1| TPA: late embryogeneis abundant protein D-34 [Zea mays]
Length=266

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 130/268 (49%), Positives = 166/268 (62%), Gaps = 12/268 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQ------EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTI  362
            MSQ Q RR   G++      +P+K+GDV DVSG+LA +P+  +DAA +Q+AE +  G T 
Sbjct  1    MSQGQPRR-RQGEEGMHAQDKPVKFGDVLDVSGELADQPVAPRDAARLQAAEQSVLGGTQ  59

Query  363  KGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKY  542
            KGGPAAV+QSAA  N R   V        V + G +V E ++AGRR VTE++GG VVGK 
Sbjct  60   KGGPAAVLQSAATVNARAGHVGRAQTACPVADAGATVTETELAGRRVVTESVGGQVVGKM  119

Query  543  IRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATG  722
            +        P     P   +  D +TIG ALEA     GD+PV +SDAAA+Q AE+ ATG
Sbjct  120  V-----SPAPVAMTDPPGALEKDAVTIGRALEAVGAMVGDRPVEQSDAAAVQVAELCATG  174

Query  723  LGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNA  902
                +PGG+ A AQ AA+ NAR T DE K K+ +VL++A  KL  DK  T EDA  VV+A
Sbjct  175  SDSTVPGGLAAAAQSAADQNARATRDEDKVKLRNVLSNAREKLPADKGATREDAERVVSA  234

Query  903  EARNKEDHATHPagvaasmaaaaaLNQE  986
            E RNK D AT P GVA ++  AA LNQE
Sbjct  235  EIRNKLDMATTPGGVADAVTTAARLNQE  262



>gb|ADQ91842.1| late embryogenesis abundant protein group 5 protein [Arachis 
hypogaea]
Length=220

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 141/224 (63%), Gaps = 8/224 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRPE  D  PIKYGDVF+VSG+LA KP+  +DAA MQSAE    G+T  GG AA
Sbjct  1    MSQEQHRRPEESD--PIKYGDVFNVSGELAQKPVKPEDAAMMQSAETRVLGKTQPGGAAA  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
             MQSAA  N +   V   +V +V  ++GV+V +    GRR VTE++GG VVG+Y+     
Sbjct  59   AMQSAATLNEQAGLVGHHDVNEVAGDRGVTVTDMQAPGRRIVTESVGGQVVGQYVE----  114

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                P     A+ V    ITIGEALEATA + G KPV +SDAAAIQAAEVRATG   I P
Sbjct  115  --PTPVQSSRASAVRESAITIGEALEATAQTVGSKPVEQSDAAAIQAAEVRATGSNVIQP  172

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVT  872
            GG+ A AQ A   NA       K K+ D+LT A++KL  DK  T
Sbjct  173  GGLAAMAQSAVAFNAGCRNPRDKIKLADILTGATAKLPADKAAT  216



>ref|XP_002463881.1| hypothetical protein SORBIDRAFT_01g008210 [Sorghum bicolor]
 gb|EER90879.1| hypothetical protein SORBIDRAFT_01g008210 [Sorghum bicolor]
Length=268

 Score =   171 bits (434),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 163/269 (61%), Gaps = 12/269 (4%)
 Frame = +3

Query  201  MSQQQARRPESGD-------QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQT  359
            MSQ Q RRP+ G+       ++P+KY DV DVSG+LA + +  +DAA +Q+AE +  G T
Sbjct  1    MSQGQPRRPQQGEDLQQHAQEQPVKYSDVLDVSGELAQRRVAPRDAALLQAAEQSVLGGT  60

Query  360  IKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGK  539
             +GGPAAV+QSAA  N R   V    +T  V + G +V E ++ GRR VTE++GG VV K
Sbjct  61   QRGGPAAVLQSAATVNARAGHVGRAQITGPVADAGATVVEAELGGRRVVTESVGGQVVSK  120

Query  540  YIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRAT  719
             +              P   +  D +TIG ALEA    AGD+PV +SDAAAIQ AE  AT
Sbjct  121  MV-----TPPHVAMTDPPGALDKDAVTIGRALEAVVAMAGDRPVDQSDAAAIQVAETCAT  175

Query  720  GLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVN  899
            G    +PGGV A AQ AA+ NAR   DE K K+ +VL++A  +L  DK  T EDA  VV+
Sbjct  176  GSHATIPGGVAAAAQSAADQNARAVRDEDKVKLRNVLSNARERLPADKGATREDAERVVS  235

Query  900  AEARNKEDHATHPagvaasmaaaaaLNQE  986
            AE RNK D  T P GVA ++  AA LNQE
Sbjct  236  AEIRNKLDMTTTPGGVADAVTTAARLNQE  264



>ref|XP_010277174.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nelumbo 
nucifera]
Length=238

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 134/262 (51%), Positives = 159/262 (61%), Gaps = 28/262 (11%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQQQ +RP++  +EPIKYG      G L   P        MQSAEN   GQT KG PA+
Sbjct  1    MSQQQPQRPQA-TEEPIKYGTYPQFPGNLQPNP----SHLKMQSAENRVLGQTQKGSPAS  55

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAAARN R    D    TD+   +G++V E+D AG R V E+I   VVG++ R    
Sbjct  56   VMQSAAARNERAGHGDD---TDITTNEGLTVAENDGAGNRIVNESIADQVVGQFKR----  108

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                            D ITIGEALEATA++ GD  V KSDAAAI+AAE+RATG   I  
Sbjct  109  ----------------DPITIGEALEATAVTVGDISVDKSDAAAIRAAELRATGGDTISQ  152

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GGV A AQ AA +NA+T   E K KIGDVL DA+ KL  D+P T EDA  V  AE R   
Sbjct  153  GGVAAAAQSAATVNAQTMRHEEKIKIGDVLMDAAIKLPGDRPATREDAEEVAGAEMRENP  212

Query  921  DHATHPagvaasmaaaaaLNQE  986
              ATHP+GVAAS+AAAA LN++
Sbjct  213  KSATHPSGVAASVAAAARLNKD  234



>ref|XP_003633664.1| PREDICTED: late embryogenesis abundant protein D-34 [Vitis vinifera]
 emb|CBI34228.3| unnamed protein product [Vitis vinifera]
Length=263

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 136/245 (56%), Positives = 162/245 (66%), Gaps = 6/245 (2%)
 Frame = +3

Query  249  IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvD  428
            IKYGDVF+V G L  KP+   DA+ MQ+AE    G+T KG  A+ MQSAAA+N R   V 
Sbjct  16   IKYGDVFNVQGDLGMKPVAPADASMMQAAETVVLGKTGKGAAASTMQSAAAKNERAGFVG  75

Query  429  PDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVS  608
             +  TDV  +QGV++ E  + GRR +TE+IG  VVG+Y          P  PP AAG   
Sbjct  76   HNQGTDVAGDQGVAIAEIQLPGRRTITESIGDQVVGEY------SAAAPLTPPSAAGGRV  129

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
              ITIGEALEA A++AG KPV  SDAAA+QAAEVRA G     PGGVGA AQ AA +NAR
Sbjct  130  GAITIGEALEAAALAAGGKPVEWSDAAAVQAAEVRAAGRTTTAPGGVGAAAQSAATLNAR  189

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
            T+ +E KTK+ DVLTDAS KL  DK  T  DA GVV AE RN  +  T+P GVAA++AAA
Sbjct  190  TSRNEDKTKLADVLTDASEKLPRDKAATRRDAEGVVRAEVRNDPNLTTYPGGVAAAVAAA  249

Query  969  aaLNQ  983
            A LNQ
Sbjct  250  ARLNQ  254



>ref|XP_006299455.1| hypothetical protein CARUB_v10015620mg [Capsella rubella]
 gb|EOA32353.1| hypothetical protein CARUB_v10015620mg [Capsella rubella]
Length=262

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 159/267 (60%), Gaps = 15/267 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q  RP    +EP+KYGDVF+VSG+LA KP+  +DA  MQ+ E   FG T KGGPAA
Sbjct  1    MSQEQPIRP----KEPVKYGDVFEVSGELADKPVAPEDAKMMQAEETRVFGHTQKGGPAA  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQSAA  N+R   V   + T++  E+GV+V E  +      TE +GG VVG+++ P   
Sbjct  57   VMQSAATTNIRGGFVHRGDKTELAAERGVTV-EQTVPPSTVTTEFVGGQVVGQHVEPRRV  115

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                          +   ITIGEALEA   +AG+KPV +SDAAAIQAAE+RA+G   I  
Sbjct  116  VAGARTDEEA----LQSSITIGEALEAAVKTAGNKPVDQSDAAAIQAAEMRASGTNVIPL  171

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLT------DDKPVTVEDAAGVVNA  902
             G+ A AQ AA+ NA    DE K K+ D+LT      T          VT +DA GVV+A
Sbjct  172  AGIAASAQSAADHNATVDRDERKIKLADILTCLICFRTGWVIRVQRGTVTRQDAEGVVSA  231

Query  903  EARNKEDHATHPagvaasmaaaaaLNQ  983
            E RN     THP GVAAS+ AAA LN+
Sbjct  232  EMRNNPKLCTHPGGVAASLTAAARLNE  258



>ref|XP_007144794.1| hypothetical protein PHAVU_007G184800g [Phaseolus vulgaris]
 gb|ESW16788.1| hypothetical protein PHAVU_007G184800g [Phaseolus vulgaris]
Length=281

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 135/279 (48%), Positives = 171/279 (61%), Gaps = 19/279 (7%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q R+ E   +E IKYGDV DV G L +KP+   DAA MQ AE+  FG+T KGG AA
Sbjct  1    MSQEQPRK-EDRQEEAIKYGDVLDVQGDLRSKPVAPVDAAIMQKAESQMFGKTEKGGAAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGG------------  524
             MQSAAA+N R+  V  +++++     G SV E    GR+  +E++G             
Sbjct  60   AMQSAAAKNERDGVVGHNDMSNAAAGGGASVTETGTPGRQVTSESVGDQVGQKSVEEKEK  119

Query  525  ------DVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDA  686
                  +VV ++ +         P      G  S  ITIGEALEAT ++AG KPV  SDA
Sbjct  120  KVNKLVEVVEQFSKKAPVNSMTSPSLVQDMGDGSGGITIGEALEATVLTAGKKPVEWSDA  179

Query  687  AAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKP  866
            AAIQAAEVRATG  +I+PGGV A AQ AA +NAR T +E KTK+ D+L DA+SKL  D+P
Sbjct  180  AAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARVTKEEDKTKLADILADATSKLPSDRP  239

Query  867  VTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
             T  DA GV  AE RN  +  THP GV+AS+AAAA +NQ
Sbjct  240  ATRRDAEGVTGAEMRNDPNLTTHPGGVSASVAAAARINQ  278



>ref|XP_010041766.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW44096.1| hypothetical protein EUGRSUZ_L02495 [Eucalyptus grandis]
Length=270

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 143/234 (61%), Gaps = 6/234 (3%)
 Frame = +3

Query  237  DQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrn  416
            D EPIKYGDVF VSG LA+KPI+ QDAA MQSAE    GQ  +GGPA  M++AAA N R 
Sbjct  23   DVEPIKYGDVFSVSGNLASKPISPQDAAMMQSAEAAVLGQPQRGGPADAMRAAAAWNERA  82

Query  417  arvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaa  596
              V   + TDV  E+G++V E  + G R +TE + G VVG+Y+      +          
Sbjct  83   GLVGRGDRTDVAAEEGITVTETGVPGGRIITERVAGQVVGQYVEGGPAAEAEAQV-----  137

Query  597  GVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAE  776
             V    ITIGEALEATA SAGDKPV ++DAAAI  AE   TG   ++PGG+ A AQ AA 
Sbjct  138  -VQQSAITIGEALEATAQSAGDKPVDRADAAAIFVAEQCVTGSNVVVPGGLAASAQTAAA  196

Query  777  INARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHP  938
             N  T  D+ K KI DVLT A++KL  D+  + +DA  VVNAE R     A HP
Sbjct  197  YNEGTLRDDAKIKISDVLTGATAKLPADRVASRQDAEWVVNAEMRTGNKAAAHP  250



>ref|XP_008438669.1| PREDICTED: late embryogenesis abundant protein D-34 isoform X1 
[Cucumis melo]
Length=315

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 158/258 (61%), Gaps = 8/258 (3%)
 Frame = +3

Query  210  QQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQ  389
            QQ R+ +    E IKYGDVF+VSG LAA PI  +DA  M SAE    GQ  + GPA VM+
Sbjct  25   QQPRQNDDEQLETIKYGDVFNVSGDLAANPIAPEDARMMASAETRVLGQMHEAGPADVMR  84

Query  390  SaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeekt  569
            +AAA NV+   +   +++DV + QG+++ E D+ G R V+E + G VVG+Y+        
Sbjct  85   AAAAHNVQVGVLSSRDISDVAKNQGINISETDVPGARVVSECVAGQVVGQYLDTTTASGV  144

Query  570  pppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGV  749
              P          D ITIG+ALEA     G+KPV +SDAAAI AAEV ATG   + PGG+
Sbjct  145  EMPE--------QDVITIGQALEAACQIIGNKPVEQSDAAAIHAAEVCATGNNAMNPGGL  196

Query  750  GADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHA  929
            GA AQ AA  NA    DE K K+  VLT A+ KL  DK V+ +D  GVV+AE RN     
Sbjct  197  GATAQAAAIFNAAMDRDEDKIKLNYVLTGATEKLATDKVVSRQDVEGVVSAELRNNPSMT  256

Query  930  THPagvaasmaaaaaLNQ  983
            THP GVAAS++AAA LN+
Sbjct  257  THPGGVAASISAAARLNE  274



>ref|XP_010045838.1| PREDICTED: late embryogenesis abundant protein D-34-like [Eucalyptus 
grandis]
 gb|KCW84217.1| hypothetical protein EUGRSUZ_B01083 [Eucalyptus grandis]
Length=270

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 143/234 (61%), Gaps = 6/234 (3%)
 Frame = +3

Query  237  DQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrn  416
            D EPIKYGDVF VSG LA+KPI  QDAA MQSAE    GQ  +GGPA  M++AAA N R 
Sbjct  23   DFEPIKYGDVFSVSGNLASKPIAPQDAAMMQSAEAAVLGQPQRGGPADAMRAAAAWNERA  82

Query  417  arvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaa  596
              V   + +DV  E+G++V E  + G R +TE + G VVG+Y+      +        +A
Sbjct  83   GLVGRGDRSDVAEEEGITVTETGVPGGRIITERVAGQVVGQYVEGSPAAEAQSQVAQQSA  142

Query  597  GVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAE  776
                  ITIGEALEATA SAGDKPV ++DAAAI  AE   TG   ++PGG+ A AQ AA 
Sbjct  143  ------ITIGEALEATAQSAGDKPVDRADAAAIFVAEQCVTGSNVVVPGGLAASAQTAAA  196

Query  777  INARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHP  938
             N  T  D+ K KI DVLT A++KL  D+  + +DA  VVNAE R     A HP
Sbjct  197  YNEGTLRDDAKIKISDVLTGATAKLPADRVASRQDAEWVVNAEMRTGNKAAAHP  250



>ref|XP_006382741.1| seed maturation protein PM26 [Populus trichocarpa]
 gb|ERP60538.1| seed maturation protein PM26 [Populus trichocarpa]
Length=206

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 130/194 (67%), Gaps = 4/194 (2%)
 Frame = +3

Query  249  IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvD  428
            IKYGDVF V G+LA KP+  +DAA MQ+AEN   GQ  +GG A++MQSAA RN R   V 
Sbjct  13   IKYGDVFSVEGELAEKPVAPRDAAMMQTAENALMGQIQRGGAASMMQSAAMRNERAGFVG  72

Query  429  PDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVS  608
              +V DV   QGVSV E ++ GRR +TEAIGG +V  + +     ++PPP        V 
Sbjct  73   HSDVNDVANYQGVSVTETEMPGRRIITEAIGGQIVRDFDQRAPLVQSPPPLFQQ----VD  128

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
              ITIGEALEATA+S G KPV  SDAAAIQAAEVRATG   I PGGV A AQ AA INAR
Sbjct  129  AGITIGEALEATALSCGQKPVEWSDAAAIQAAEVRATGRTTITPGGVAAAAQSAATINAR  188

Query  789  TTTDEFKTKIGDVL  830
             T DE KTK+ DVL
Sbjct  189  MTKDEDKTKLSDVL  202



>ref|XP_009396738.1| PREDICTED: late embryogenesis abundant protein D-34-like [Musa 
acuminata subsp. malaccensis]
Length=279

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 168/278 (60%), Gaps = 16/278 (6%)
 Frame = +3

Query  201  MSQQQARRPE----SGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKG  368
            MSQ+Q RR +    +G  +PIKYGDVF V+G LA + I  +DAA M +AEN A G T KG
Sbjct  1    MSQEQPRRTDQGWGAGCDQPIKYGDVFPVAGDLAGQTIAPRDAAMMHAAENRALGLTPKG  60

Query  369  GPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDI---AGRRFVTEAIGGDVVGK  539
            GPA+VM+SAA RN +   V  D  + +   QGVS+ + +I    G+R VTE + G  VG+
Sbjct  61   GPASVMESAATRNEQRGLVGHDQFSPIPANQGVSITQTEIHGLPGQRLVTEFVAGQAVGQ  120

Query  540  YIRppaee-------ktpppppppaaGVVS--DDITIGEALEATAISAGDKPVGKSDAAA  692
            Y+             +          GV S  D +TIGEALEA   +AGD+P+  SDAAA
Sbjct  121  YVVDAESGDGGAPGGRRGVERGQSLGGVSSWTDKMTIGEALEAAGRAAGDEPIEMSDAAA  180

Query  693  IQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVT  872
            ++AAE  ATGL  +L GG+ A AQ AA +NAR T DE KTK+GDVL DA+ +L DD+  T
Sbjct  181  VEAAESAATGLNTVLRGGIAAAAQSAATLNARITRDEDKTKLGDVLQDAAMRLLDDREAT  240

Query  873  VEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQE  986
              DA  VV AE RN  D    P GVA SM +AA  NQE
Sbjct  241  RVDAERVVRAEMRNSPDVCVRPGGVADSMVSAARFNQE  278



>gb|AJA33583.1| late embryogenesis abundant protein LEA7-4 [Pinus tabuliformis]
Length=261

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 147/248 (59%), Gaps = 12/248 (5%)
 Frame = +3

Query  201  MSQQQARRPESGDQEP--IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            M+Q QARR E+ DQ P  I YGD+FDVSG LAA+ IT QDAA MQSAE  A G+T+  G 
Sbjct  1    MNQGQARRDEAQDQLPGPITYGDIFDVSGSLAAQAITPQDAALMQSAETRALGKTLNLGA  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AAVMQ+AA  N     V+      VV EQ V+V E  + G   +TE++ G  +   IRP 
Sbjct  61   AAVMQAAAEMNESAGLVNSRAEDSVVGEQSVTVAEAQLPGVNVLTESVAGQAIRFAIRPA  120

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
              +              + D+TIGEALEA AI AGDKPV  SDA A+QAAE +ATG G I
Sbjct  121  PADYPTAA---------TADVTIGEALEAAAIRAGDKPVELSDAVAVQAAERQATGTGEI  171

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
              GGV + AQ AA++NAR      KT +GDVL+ A+  L  DK VT EDA  +   EA +
Sbjct  172  SKGGVASAAQSAADVNARLPYS-MKTTLGDVLSTATEDLLVDKAVTAEDAWRIKELEASH  230

Query  915  KEDHATHP  938
             E    +P
Sbjct  231  TETGEAYP  238



>ref|XP_002512261.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
 gb|EEF49713.1| Late embryogenesis abundant protein D-34, putative [Ricinus communis]
Length=242

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 149/268 (56%), Gaps = 30/268 (11%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q  RP+   +EPIKY D+F +    A K +     AAM  A               
Sbjct  1    MSQHQQERPQ---EEPIKYDDLFSIQADTANKAVAPPREAAMIQASAVQSAAA-------  50

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGK---YIRp  551
                              N+ D   E GV VKE D+ GRR +TE+I G +VG+    + P
Sbjct  51   -----------------KNMNDAAEEVGVRVKETDMHGRRMITESIAGQIVGQNSQRVAP  93

Query  552  paeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGH  731
                 +        +G VS  ITIGEALEATA++AG K V  SDAAAIQAAEVRATG   
Sbjct  94   TNSLGSSGAYQQGGSGNVSGGITIGEALEATALTAGQKAVEWSDAAAIQAAEVRATGRTT  153

Query  732  ILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEAR  911
            I PGGV A AQ AA +NAR T DE KTK+ D+L DA+SKL  D+P T +DA GV  AE R
Sbjct  154  ISPGGVAAAAQSAATLNARATRDEDKTKLADILADATSKLPADRPATRKDAEGVTGAEMR  213

Query  912  NKEDHATHPagvaasmaaaaaLNQETAF  995
            N     THPAGVAAS+AAAA LNQ+  F
Sbjct  214  NDPYLTTHPAGVAASIAAAARLNQQNNF  241



>ref|XP_011032498.1| PREDICTED: late embryogenesis abundant protein D-34-like [Populus 
euphratica]
Length=206

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 129/194 (66%), Gaps = 4/194 (2%)
 Frame = +3

Query  249  IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvD  428
            IKYGDVF V G+LA KP+  +DAA MQ+AEN   GQ  +GG A++MQSAA RN R   V 
Sbjct  13   IKYGDVFSVEGELAEKPVAPRDAAMMQTAENALMGQIQRGGAASMMQSAAMRNERAGFVG  72

Query  429  PDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVS  608
              +V DV   QGVSV E ++ GRR +TEAIGG +V  + +    E +PPP        V 
Sbjct  73   HSDVNDVANYQGVSVTETEMPGRRIITEAIGGQIVRDFDQRAPLEPSPPPLFQQ----VD  128

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
              ITIGEALEATA+S G KPV  SDAAAIQAAEVRA G   I PGGV A AQ AA INAR
Sbjct  129  AGITIGEALEATALSCGQKPVEWSDAAAIQAAEVRAIGRTTITPGGVAAAAQSAATINAR  188

Query  789  TTTDEFKTKIGDVL  830
             T D+ KTK+ DVL
Sbjct  189  MTKDDDKTKLSDVL  202



>ref|XP_010552068.1| PREDICTED: late embryogenesis abundant protein D-34-like [Tarenaya 
hassleriana]
Length=246

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 153/261 (59%), Gaps = 20/261 (8%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q  R     QEPIKYGDVF+VSG+LA KP+   DA  MQ+AE   FG T KGG AA
Sbjct  1    MSQAQPER-----QEPIKYGDVFNVSGELADKPVAPGDANMMQAAETRVFGHTQKGGTAA  55

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQ AAA N R+  V   + TDV  ++G++V + D+ G R  TE +GG VVG+Y+     
Sbjct  56   VMQYAAAINERSGFVHHGDTTDVAADRGITVAQTDVPGARVTTEFVGGQVVGQYVEAKPG  115

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
               P          +   ITIGEALEA    A  +   + D       ++RATG   I+ 
Sbjct  116  VTAPEAVEAG----LQSAITIGEALEA----AVHRERERDD-------QIRATGSNTIVH  160

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  N     DE K K+G+VLT A+ KL  DK  T EDA GVV+AE RN  
Sbjct  161  GGLAATAQSAATHNLTVARDEDKIKLGEVLTGATWKLPVDKEATREDAEGVVSAELRNSP  220

Query  921  DHATHPagvaasmaaaaaLNQ  983
            + +THP GVAAS+ AAA LN+
Sbjct  221  NLSTHPGGVAASITAAARLNE  241



>ref|XP_007030655.1| Seed maturation protein, putative [Theobroma cacao]
 gb|EOY11157.1| Seed maturation protein, putative [Theobroma cacao]
Length=229

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 149/229 (65%), Gaps = 4/229 (2%)
 Frame = +3

Query  297  PITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVK  476
            P+  +D A MQ+AEN   G   KG  A+ MQSAA +N     V  +   D+  E GV++K
Sbjct  2    PVAPKDVAMMQTAENAMLGHNPKGYAASAMQSAAMQNEGAGFVCHE---DLNAESGVTIK  58

Query  477  EDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISA  656
            E ++ G+R +TE++G +VVG+Y +                G   D ITIGEALEATA++A
Sbjct  59   ETELPGKRVITESVGDEVVGQYSQAAPLSSGQFSASQQG-GSTGDAITIGEALEATALTA  117

Query  657  GDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTD  836
            G KPV  SDAAAIQAAEVRATG   I+PGGV A AQ AA +NAR T DE KTK+GD+L++
Sbjct  118  GKKPVEWSDAAAIQAAEVRATGRTSIMPGGVAAAAQSAATLNARATRDEDKTKLGDILSN  177

Query  837  ASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            A++KL  DKP T  DA  V  AE RN  +  THPAGVAAS+AAAA LNQ
Sbjct  178  ATTKLPSDKPATRRDAERVTGAEMRNDPNLTTHPAGVAASVAAAARLNQ  226



>emb|CAA41854.1| rab28 [Zea mays]
Length=278

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 142/277 (51%), Positives = 169/277 (61%), Gaps = 13/277 (5%)
 Frame = +3

Query  201  MSQQQARRPES-------GDQEPIKYGDVFD-VSGQLAAKPITQQDAAAMQSAENTAFGQ  356
            MSQ+Q RRP         G+Q  ++YGDVF  VSG LA KP+ ++  A MQSAEN  FGQ
Sbjct  1    MSQEQPRRPSGHEETSGGGEQGAVRYGDVFPAVSGGLAEKPVARR-TATMQSAENLVFGQ  59

Query  357  TIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDI-AGRRFVTEAIGGDVV  533
            T+KGGPAA MQSAA  N R   V  D  TD    QGV+V E  +  G R VTE + G  V
Sbjct  60   TLKGGPAAAMQSAATTNERMGAVGHDQATDATAVQGVTVSETRVPGGGRIVTEFVAGQAV  119

Query  534  GKYIRppaeektpppppppaaGVVSDDIT---IGEALEATAISAGDKPVGKSDAAAIQAA  704
            G+Y+    +       P   AGV   DIT   IGEALEATA++AGD PV +SDAA IQAA
Sbjct  120  GQYLARDDDGGGGIAGPGAGAGVAGKDITKVTIGEALEATALAAGDAPVERSDAARIQAA  179

Query  705  EVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDA  884
            E RATGL   +PGG+   AQ AA  N+    DE K  +GDVL +A+++L  DKPV   DA
Sbjct  180  EARATGLDANVPGGLARQAQSAAAANSWAWGDEDKATLGDVLANATARLVADKPVESADA  239

Query  885  AGVVNAEARNKEDHATHPagvaasmaaaaaLNQETAF  995
             GV  AE RN+ D    P GVAASMAAAA LN+  A 
Sbjct  240  LGVAGAENRNRNDGTARPGGVAASMAAAARLNRNEAV  276



>ref|XP_004135801.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
 gb|KGN66161.1| hypothetical protein Csa_1G574780 [Cucumis sativus]
Length=259

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 161/270 (60%), Gaps = 16/270 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQ--EPIKYGDVF-DVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQQQ R+P   DQ  EPIKYGDVF  V G LA KP+T +DAAA+Q+AE    G+T+ GG
Sbjct  1    MSQQQPRKPACCDQLEEPIKYGDVFPHVEGDLANKPVTPEDAAALQAAETVLLGKTLHGG  60

Query  372  PAAVMQSaaarnvrnarvDP-DNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
             AA +QSAAA+N R   V    +V D +  + V    D +  +  VTE      +G    
Sbjct  61   AAATIQSAAAKNERAGLVGRGKDVGDQIVAEDVITNTDLVGAQEVVTEHRERVPIGPL--  118

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
                                  ITIGEALEATA++ G+K V  SDAAAIQAAEVRATG  
Sbjct  119  ----------STLNPHEEGGGGITIGEALEATALTVGEKIVEWSDAAAIQAAEVRATGRM  168

Query  729  HILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEA  908
            +I PGG+ A AQ AA +NAR T DE KTK+ DVL DA +KL+ DKP T  DA GV  AE 
Sbjct  169  NIAPGGIAATAQSAATMNARVTQDEDKTKLADVLKDARTKLSADKPATRRDAEGVTGAEM  228

Query  909  RNKEDHATHPagvaasmaaaaaLNQETAFN  998
            RN     THP GVAAS+AAAA LNQ    N
Sbjct  229  RNDPYLTTHPTGVAASIAAAARLNQSNYSN  258



>ref|XP_004165760.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cucumis 
sativus]
Length=259

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 161/270 (60%), Gaps = 16/270 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQ--EPIKYGDVF-DVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGG  371
            MSQQQ R+P   DQ  EPIKYGD+F  V G LA KP+T +DAAA+Q+AE    G+T+ GG
Sbjct  1    MSQQQPRKPACCDQLEEPIKYGDIFPHVEGDLANKPVTPEDAAALQAAETVLLGKTLHGG  60

Query  372  PAAVMQSaaarnvrnarvDP-DNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
             AA +QSAAARN R   V    +V D +  + V    D +  +  VTE      +G    
Sbjct  61   AAATIQSAAARNERAGLVGRGKDVGDQIVAEDVITNTDLVGAQEVVTEHSERVPIGPL--  118

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
                                  ITIGEALEATA++ G+K V  SDAAAIQAAEVRATG  
Sbjct  119  ----------STLNPHEEGGGGITIGEALEATALTVGEKIVEWSDAAAIQAAEVRATGRM  168

Query  729  HILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEA  908
            +I PGG+ A AQ AA +NAR T DE KTK+ DVL DA +KL+ DKP T  DA GV  AE 
Sbjct  169  NIAPGGIAATAQSAATMNARVTQDEDKTKLADVLKDARTKLSADKPATRRDAEGVTGAEM  228

Query  909  RNKEDHATHPagvaasmaaaaaLNQETAFN  998
            RN     THP GVAAS+AAAA LNQ    N
Sbjct  229  RNDPYLTTHPTGVAASIAAAARLNQSNYSN  258



>ref|XP_008438670.1| PREDICTED: late embryogenesis abundant protein D-34 isoform X2 
[Cucumis melo]
Length=311

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 155/258 (60%), Gaps = 12/258 (5%)
 Frame = +3

Query  210  QQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQ  389
            QQ R+ +    E IKYGDVF+VSG LAA PI  +DA  M SAE    GQ  + GPA VM+
Sbjct  25   QQPRQNDDEQLETIKYGDVFNVSGDLAANPIAPEDARMMASAETRVLGQMHEAGPADVMR  84

Query  390  SaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeekt  569
            +AAA NV+   +   +++DV + QG+++ E D+ G R V+E     V G+Y+        
Sbjct  85   AAAAHNVQVGVLSSRDISDVAKNQGINISETDVPGARVVSEC----VAGQYLDTTTASGV  140

Query  570  pppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGV  749
              P          D ITIG+ALEA     G+KPV +SDAAAI AAEV ATG   + PGG+
Sbjct  141  EMPE--------QDVITIGQALEAACQIIGNKPVEQSDAAAIHAAEVCATGNNAMNPGGL  192

Query  750  GADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHA  929
            GA AQ AA  NA    DE K K+  VLT A+ KL  DK V+ +D  GVV+AE RN     
Sbjct  193  GATAQAAAIFNAAMDRDEDKIKLNYVLTGATEKLATDKVVSRQDVEGVVSAELRNNPSMT  252

Query  930  THPagvaasmaaaaaLNQ  983
            THP GVAAS++AAA LN+
Sbjct  253  THPGGVAASISAAARLNE  270



>ref|XP_006419946.1| hypothetical protein CICLE_v10005699mg [Citrus clementina]
 gb|ESR33186.1| hypothetical protein CICLE_v10005699mg [Citrus clementina]
Length=253

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 154/263 (59%), Gaps = 17/263 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQE--PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ++ RRP  G +   PIKY DVF+VSG LA+K +  QDAA MQSAE  AFG T  GG 
Sbjct  1    MSQEEPRRPREGQEPRGPIKYDDVFNVSGGLASKAVAPQDAAMMQSAETAAFGSTQPGGQ  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            A VM+SAA  N R   V      D   +QGV++   +I   R +TE++ G VVG+Y++  
Sbjct  61   AEVMRSAARINERAGLVSRG---DAAADQGVTITGTEIPAGRIITESLDGQVVGQYVQVA  117

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
            AE  T               IT+G+ALEAT  + GDKPV  SDAAAI+ AE+RATG   +
Sbjct  118  AEATTQQGA-----------ITVGQALEATMQTIGDKPVELSDAAAIREAEMRATGSNIV  166

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
              GG  A AQ AA  N     DE K K+ DVL  AS+ L   K VT +DA  VVNAE RN
Sbjct  167  TQGGYAASAQSAAAYNTGMIGDEDKIKLRDVLAGASAAL-PAKVVTRQDAEAVVNAERRN  225

Query  915  KEDHATHPagvaasmaaaaaLNQ  983
                 THP GVA SM  AA LN+
Sbjct  226  SPQLTTHPGGVAESMETAATLNE  248



>ref|XP_006489401.1| PREDICTED: late embryogenesis abundant protein D-34-like [Citrus 
sinensis]
Length=253

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 126/263 (48%), Positives = 153/263 (58%), Gaps = 17/263 (6%)
 Frame = +3

Query  201  MSQQQARRPESGDQE--PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ++ RRP  G +   PIKY DVF+VSG LA+K +  QDAA MQSAE  AFG T  GG 
Sbjct  1    MSQEEPRRPREGQEPRGPIKYDDVFNVSGGLASKAVAPQDAAMMQSAETAAFGSTQPGGQ  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            A VM+S A  N R   V      D   +QGV++   +I   R +TE++ G VVG+Y++  
Sbjct  61   AEVMRSTARINERAGLVSRG---DAAADQGVTITGTEIPAGRIITESLDGQVVGQYVQVA  117

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
            AE  T               IT+G+ALEAT  + GDKPV  SDAAAI+ AE+RATG   +
Sbjct  118  AEATTQQGA-----------ITVGQALEATMQTIGDKPVELSDAAAIREAEMRATGSNIV  166

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
              GG  A AQ AA  N     DE K K+ DVL  AS+ L   K VT +DA  VVNAE RN
Sbjct  167  TQGGYAASAQSAAAYNTGMIGDEDKIKLRDVLAGASAAL-PAKVVTRQDAEAVVNAERRN  225

Query  915  KEDHATHPagvaasmaaaaaLNQ  983
                 THP GVA SM  AA LN+
Sbjct  226  SPQLTTHPGGVAESMETAATLNE  248



>ref|XP_006360786.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
tuberosum]
Length=259

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 159/244 (65%), Gaps = 6/244 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q +RPE+  ++P+KY D F+V G+LA +PI  QDAA MQSAE+  FG+  KGGPA+
Sbjct  1    MSQEQPQRPET--EQPLKYRDFFNVKGELADQPIAPQDAAMMQSAESMVFGKNQKGGPAS  58

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQ+AAA+N R+  V  ++ T +  ++GV+V E  + GRR +TE++ G V+G+Y+ P   
Sbjct  59   VMQTAAAKNERSGHVSHEDTTQLAGDEGVTVAETKLPGRRIITESVAGQVLGRYVEPLPA  118

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                         V    ITIGEAL ATA++AG+KPV +SDAAAIQAAE RATG   + P
Sbjct  119  TAAATTEGD----VEEAPITIGEALAATALTAGEKPVEQSDAAAIQAAEARATGSSVVTP  174

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  N   T D  K K+ DVLT A++KL  DK  T +DA GV+ AE RN  
Sbjct  175  GGLAATAQSAASANEGLTQDVDKIKLNDVLTGAAAKLPADKAATRQDAQGVMEAELRNNP  234

Query  921  DHAT  932
               T
Sbjct  235  SLTT  238



>ref|XP_003599533.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
 gb|AES69784.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=269

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 159/272 (58%), Gaps = 12/272 (4%)
 Frame = +3

Query  201  MSQQQARR--PESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MS  Q  R   E  +QEPIKYG+VF+VSG LA++ I+ Q AA M +AE    GQ   G P
Sbjct  1    MSHGQPTRLQEEINNQEPIKYGEVFNVSGDLASETISPQAAANMAAAEFNVLGQAQPGSP  60

Query  375  AAVMQSaaarnvrn--arvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            AA MQ+AA  N  +    V    + ++V++ G+ V E   A RR VTEA+ G ++G+ + 
Sbjct  61   AAAMQAAALINEASGQCLVGRHGIAEMVKDHGIRVTETTAANRRVVTEAVDGQIIGRRVE  120

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
            P A             G   D ITIGEALEA  IS GDKPV ++DA AI AAE+RATG  
Sbjct  121  PDAHFVPMNMGSAAIDG---DPITIGEALEAAGISVGDKPVDQNDADAISAAEIRATGER  177

Query  729  HILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEA  908
             + P GVGA AQ AA +N+     E  TK+ DVLTDA+ KL  D+ VT+EDA  V +AE 
Sbjct  178  CVRPDGVGATAQSAATLNSHANRIEEMTKLSDVLTDATDKLAADRAVTIEDAEAVYDAEV  237

Query  909  RNKED-----HATHPagvaasmaaaaaLNQET  989
                      +   P G+AASMA AA LNQET
Sbjct  238  HKNSSTQQMMNIAEPGGIAASMATAAKLNQET  269



>ref|XP_004247564.2| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X1 [Solanum lycopersicum]
Length=279

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 171/264 (65%), Gaps = 6/264 (2%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q +RPE   ++P+KYGD F+V G LA +PI  QDAA MQSAE   FG+  KGGPA+
Sbjct  22   MSQDQPQRPER--EQPLKYGDCFNVKGDLADQPIAPQDAAMMQSAEAMVFGKNQKGGPAS  79

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQ+AAA+N R+  V  D  T +  ++G++V E  + GRR +TE++ G V+G+Y+ P   
Sbjct  80   VMQAAAAKNERSGHVSHDATTQLAGDEGITVAETKLPGRRIITESVAGQVLGQYVEPLPV  139

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                         V    ITIGEAL ATA++AG+KPV +SDAAAIQAAE RATG   + P
Sbjct  140  TAAAATGGD----VEEAPITIGEALAATALTAGEKPVEQSDAAAIQAAEARATGSSVVTP  195

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  N     D  K K+ DVLT A++KL  DK  T +DA GV+ AE RN  
Sbjct  196  GGLAATAQSAASANEGLAQDVDKIKLNDVLTGAAAKLPADKATTRQDAQGVMEAELRNNP  255

Query  921  DHATHPagvaasmaaaaaLNQETA  992
                +P GVAAS+AAAA LN++++
Sbjct  256  TLTAYPGGVAASVAAAARLNEKSS  279



>gb|AJA33580.1| late embryogenesis abundant protein LEA7-1 [Pinus tabuliformis]
Length=270

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 147/257 (57%), Gaps = 21/257 (8%)
 Frame = +3

Query  201  MSQQQARRPESGDQEP-----------IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTA  347
            M+Q QARR E+ DQ P           I YGD+FDVSG LAA+ IT QDAA MQSAE  A
Sbjct  1    MNQGQARRDEAQDQLPRDEAQDQLPGPITYGDIFDVSGSLAAQAITPQDAALMQSAETRA  60

Query  348  FGQTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGD  527
             G+T+K G AAVMQ+AA  N     ++      VV EQGV+V E  + G    TE + G 
Sbjct  61   LGKTLKVGAAAVMQAAAEMNESAGLLNSRAEDSVVGEQGVTVAEAQLPGVNVTTEYVAGQ  120

Query  528  VVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAE  707
             +   IRP   +              + D+TIGEALEA A+ AGDKPV  SDA A+QAAE
Sbjct  121  AIRSAIRPAPADYPT---------AATADVTIGEALEAAAMRAGDKPVELSDAVAVQAAE  171

Query  708  VRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAA  887
             +ATG G I  GGV + AQ AA++NAR      KT +GDVL+ A+  L  DK VT EDA 
Sbjct  172  RQATGTGEISKGGVASAAQAAADVNARLPYS-MKTTLGDVLSTATEDLPVDKAVTAEDAR  230

Query  888  GVVNAEARNKEDHATHP  938
             +   EA + E    +P
Sbjct  231  RIKELEASHTETGEAYP  247



>gb|KEH43047.1| late embryogenesis abundant D-like protein [Medicago truncatula]
Length=241

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 156/264 (59%), Gaps = 28/264 (11%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RR E G    IKYGDVF+V G + ++ +   DAA MQ AE    G+T KGG AA
Sbjct  1    MSQEQPRREEEG----IKYGDVFNVEGDIGSRTVAPVDAAMMQKAETQMHGKTQKGGAAA  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTE-AIGGDVVGKYIRppa  557
             MQSAA +N                      + D I G   ++E A  G VV +  +   
Sbjct  57   SMQSAAMKN----------------------ERDGIVGHNDMSENAADGGVVEQLSQNAP  94

Query  558  eektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                 P          +D  +TIGEALEATA++AG KPV  SDAAAIQAAEVRATG  +I
Sbjct  95   MNTMTPASLVKDMSAGADGGVTIGEALEATALTAGQKPVEWSDAAAIQAAEVRATGRTNI  154

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            +PGGV A AQ AA +NARTT +E KTK+GD+L DA++KL  D+  T  DA GV  AE RN
Sbjct  155  VPGGVAAAAQSAATLNARTTKEEDKTKLGDILADATTKLPADRAATRRDAEGVTGAEMRN  214

Query  915  KEDHATHPagvaasmaaaaaLNQE  986
                 THP GV+ASMAAAA LNQ+
Sbjct  215  DPYLTTHPGGVSASMAAAARLNQK  238



>ref|XP_011082573.1| PREDICTED: late embryogenesis abundant protein D-34 [Sesamum 
indicum]
Length=197

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 139/184 (76%), Gaps = 5/184 (3%)
 Frame = +3

Query  435  NVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDD  614
            ++TD+V +QG +V E DI+G R +TE IGG VVG+Y +P  + KTP P          D 
Sbjct  18   DMTDIVMDQGATVSEADISGYRVITETIGGQVVGRYGQPTEDTKTPAPTSGEM-----DP  72

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEATA+SAGDKP+  SDAAAIQAAEVRATGLGH++ GG+ A+AQ AA  N  TT
Sbjct  73   ITIGEALEATALSAGDKPIDASDAAAIQAAEVRATGLGHVVHGGIAAEAQSAAARNVLTT  132

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
             DE KTK+ DVL DA++KLT DKPVT EDA GV++AE RNK + ATHP GVAA++AAAA 
Sbjct  133  RDEDKTKLADVLVDATAKLTVDKPVTREDAEGVISAEIRNKPELATHPGGVAAAVAAAAR  192

Query  975  LNQE  986
            LN++
Sbjct  193  LNEQ  196



>gb|KDO68693.1| hypothetical protein CISIN_1g027886mg [Citrus sinensis]
Length=217

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 140/221 (63%), Gaps = 7/221 (3%)
 Frame = +3

Query  324  MQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIA-GRR  500
            MQ+AEN A G+T +GGPAAVMQSAA  N R         T + R+QGV+V E  +A G R
Sbjct  1    MQAAENMALGKTQRGGPAAVMQSAAEANERAGFTSHSTATHIARDQGVTVSESTVADGNR  60

Query  501  FVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKS  680
             +TEAIG  V+ +Y           P     A +  D  TIGEALEATA+SAGDK V + 
Sbjct  61   IITEAIGDQVLAQY------ATPEVPTRASGAALGRDQSTIGEALEATALSAGDKAVDQR  114

Query  681  DAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDD  860
            DAAAI AAE RA+    I PGG+G+ AQ AA  N RTT    K  I DV  DA++KL+DD
Sbjct  115  DAAAIYAAEARASATNEIKPGGIGSRAQSAATQNERTTFFSDKITISDVSGDATTKLSDD  174

Query  861  KPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            KPVT EDA G+++ E RNK D  T P GVA+SMAAAA LNQ
Sbjct  175  KPVTREDAEGIISPEIRNKPDMRTTPGGVASSMAAAARLNQ  215



>ref|XP_008797392.1| PREDICTED: late embryogenesis abundant protein D-34-like [Phoenix 
dactylifera]
Length=259

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 154/248 (62%), Gaps = 9/248 (4%)
 Frame = +3

Query  201  MSQQQARRPESGDQE--PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ+Q  R + G  +  P+KYGDVF+V G L  +PI  + AA MQSAEN   G T  GGP
Sbjct  1    MSQEQPTRRQEGQTQTQPVKYGDVFNVQGGLEDQPIAPKAAAMMQSAENLVLGHTPTGGP  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            AAVM S+A+RN + + V   +V D    QGVSV E  + G R +TE+I G V  +Y++  
Sbjct  61   AAVMMSSASRNEQASFVGHQDVGDGPASQGVSVAEIHLPGCRVLTESIAGQVR-EYLQAF  119

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                        +A      I+IG+ALEATA +AG+KPV +SDAAAIQAAE RATG   +
Sbjct  120  PSGFGGGSRGRDSA------ISIGQALEATARTAGNKPVDRSDAAAIQAAEARATGTNMV  173

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
              GGV A AQ AA+ NAR T DE KTK+ DVL++A++KL  DK VT  DA  V  AE RN
Sbjct  174  ASGGVAATAQAAADANARITRDENKTKLADVLSNATAKLPADKAVTRADAERVTGAEMRN  233

Query  915  KEDHATHP  938
              + AT P
Sbjct  234  DPEMATRP  241



>emb|CDO99067.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 132/225 (59%), Gaps = 20/225 (9%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RRP+ G QEPIK GDVF V+G+LA KPI   DAA MQ+AE    GQT +GGPAA
Sbjct  1    MSQEQPRRPQEG-QEPIKDGDVFSVTGELAGKPIAPGDAAMMQAAETRVLGQTQRGGPAA  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVV-GKYIRppa  557
             MQSA   N R       +VTD                 R +TEA+ G V  G + R   
Sbjct  60   AMQSAVTINERAGLASHTDVTD-----------------RMITEAVAGQVFPGGFGRERG  102

Query  558  eektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHIL  737
                         G V+  ITIGEALEATA +AG+KP  +SDAAAIQAA+VRATG   I+
Sbjct  103  GYGQQARAGAGGGGAVTGAITIGEALEATAQTAGNKPGEQSDAAAIQAAQVRATGSNVII  162

Query  738  PGGVGADAQRAAEIN-ARTTTDEFKTKIGDVLTDASSKLTDDKPV  869
            PGGV A AQ AA  N A    DE K K+G VLTDA+ +L  DK V
Sbjct  163  PGGVAATAQSAASSNEAGQLRDEDKIKLGHVLTDATVELPADKSV  207



>ref|XP_006589172.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X1 [Glycine max]
Length=284

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 112/267 (42%), Positives = 146/267 (55%), Gaps = 24/267 (9%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q ++ E+ ++E IKYGDVF+V G++ +KP    DA  MQ AE    G+T K G A 
Sbjct  1    MSQEQPQK-ENHEEEGIKYGDVFNVKGEMKSKPEAPVDAGMMQKAETETTGKTQKAGAAM  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDD--IAGRRFVTEAIGGDVVGKYIRpp  554
               +A       A     N  +V  + GVSV E +  ++G + ++E++ G VV +     
Sbjct  60   QSAAAKNERGGMAGHKDKN--NVAADGGVSVTETEAHLSGSQVISESVAGQVVNRLEEKK  117

Query  555  aeektp-------------------ppppppaaGVVSDDITIGEALEATAISAGDKPVGK  677
             +                              AG     ITIGEALEAT ++AG KPV  
Sbjct  118  RKVNKLVEVVKQFNQKAPLNTMTPPSIVQEMGAGGAGSGITIGEALEATVLTAGKKPVEW  177

Query  678  SDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTD  857
            SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR T DE K K+ D+L DA+SKL  
Sbjct  178  SDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARVTKDEEKIKLADILADATSKLPS  237

Query  858  DKPVTVEDAAGVVNAEARNKEDHATHP  938
            D+  T  DA GV  AE RN  +  THP
Sbjct  238  DRAATRRDAEGVTGAEMRNDPNLTTHP  264



>gb|AFK36784.1| unknown [Medicago truncatula]
Length=241

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 155/264 (59%), Gaps = 28/264 (11%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q RR E G    IKYGDVF+V   + ++ +   DAA MQ AE    G+T KGG AA
Sbjct  1    MSQEQPRREEEG----IKYGDVFNVEDDIGSRTVAPVDAAMMQKAETQMHGKTQKGGAAA  56

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTE-AIGGDVVGKYIRppa  557
             MQSAA +N                      + D I G   ++E A  G VV +  +   
Sbjct  57   SMQSAAMKN----------------------ERDGIVGHNDMSENAADGGVVEQLSQNAP  94

Query  558  eektpppppppaaGVVSDD-ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                 P          +D  +TIGEALEATA++AG KPV  SDAAAIQAAEVRATG  +I
Sbjct  95   MNTMTPASLVKDMSAGADGGVTIGEALEATALTAGQKPVEWSDAAAIQAAEVRATGRTNI  154

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            +PGGV A AQ AA +NARTT +E KTK+GDVL DA++KL  D+  T  DA GV  AE RN
Sbjct  155  VPGGVAAAAQSAATLNARTTKEEDKTKLGDVLADATTKLPADRAATRRDAEGVTGAEMRN  214

Query  915  KEDHATHPagvaasmaaaaaLNQE  986
                 THP GV+ASMAAAA LNQ+
Sbjct  215  DPYLTTHPGGVSASMAAAARLNQK  238



>ref|XP_010326383.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
lycopersicum]
Length=216

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 146/221 (66%), Gaps = 7/221 (3%)
 Frame = +3

Query  324  MQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRF  503
            MQS E+ A G   +GGPA++MQSAA++N R   VD     D   E+GV+V + ++ G R 
Sbjct  1    MQSVESVALGHVPRGGPASLMQSAASQNERMGVVD---TKDFATERGVTVSQVEVGGTRL  57

Query  504  VTEAIGGDVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISA-GDKPVGKS  680
            V+E++GG+VV +YI P            P  GV  D +T+GEALEA A+   G+KP+ +S
Sbjct  58   VSESVGGEVVAQYIYPSGAADEERSTRYPTTGVQEDAVTVGEALEAVALKPEGNKPIEQS  117

Query  681  DAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDD  860
            DAAAIQAAE RATG   ++PGGVGA+AQ AA INA+T   + KT + DVL DA+SKL +D
Sbjct  118  DAAAIQAAEARATGRSEVVPGGVGAEAQCAASINAQT---DDKTTLRDVLKDATSKLIED  174

Query  861  KPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            K    EDA GVV AE RN  D ATHP GVAAS+  A+ LN+
Sbjct  175  KAAKREDAEGVVGAEIRNTLDLATHPGGVAASITTASDLNE  215



>gb|KDO74560.1| hypothetical protein CISIN_1g035654mg [Citrus sinensis]
Length=243

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 121/265 (46%), Positives = 148/265 (56%), Gaps = 31/265 (12%)
 Frame = +3

Query  201  MSQQQARRPESGDQE--PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ++ RRP  G +   PIKY DVF+VSG LA+K +  QDAA MQSAE  AFG T  GG 
Sbjct  1    MSQEEPRRPREGQEPRGPIKYDDVFNVSGGLASKAVAPQDAAMMQSAETAAFGSTQPGGQ  60

Query  375  A--AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            A  A + S                 D   +QGV++   +I   R +TE++ G VVG+Y++
Sbjct  61   AERAGLVSRG---------------DAAADQGVTITGTEIPAGRIITESLDGQVVGQYVQ  105

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
              AE  T               IT+G+ALEAT  + GDKPV  SDAAAI+ AE+RATG  
Sbjct  106  VAAEATTQQGA-----------ITVGQALEATMQTIGDKPVELSDAAAIREAEMRATGSN  154

Query  729  HILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEA  908
             +  GG  A AQ AA  N     DE K K+ DVL  AS+ L   K VT +DA  VVNAE 
Sbjct  155  ILTQGGYAASAQSAAAYNTGMIGDEDKIKLRDVLAGASAAL-PAKVVTRQDAEAVVNAER  213

Query  909  RNKEDHATHPagvaasmaaaaaLNQ  983
            RN     THP GVA SM  AA LN+
Sbjct  214  RNSPQLTTHPGGVAESMETAATLNE  238



>ref|XP_009411288.1| PREDICTED: late embryogenesis abundant protein D-34-like [Musa 
acuminata subsp. malaccensis]
Length=266

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 163/265 (62%), Gaps = 3/265 (1%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q  RP  G ++PI+YGDVF VSG LA + I+ +DAA MQSAEN A GQT +GG A+
Sbjct  1    MSQNQPTRPVRGQEQPIRYGDVFAVSGSLAGEAISPRDAAMMQSAENRALGQTPQGGAAS  60

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAG---RRFVTEAIGGDVVGKYIRp  551
            VM+SAA  N +   V  +  +D    QGVSV + DI G   +R VTE + G  VG+Y   
Sbjct  61   VMESAAMWNEQCGLVGHEQFSDTPGRQGVSVTQTDIPGCPGQRLVTEFVAGQAVGQYFFN  120

Query  552  paeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGH  731
             A           A  + +D ++IGEALEA A +AG+KPV  SDAAAIQAAE  A G   
Sbjct  121  TAPGGGADEAGGVAVEMWTDKVSIGEALEAAATTAGNKPVDASDAAAIQAAEATAAGANA  180

Query  732  ILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEAR  911
            + PGGV A AQ AA  NA    D+ KTK+GDV+ DAS  +  DK  T EDA  VV AE R
Sbjct  181  VTPGGVAAAAQAAAAANALKYRDDEKTKLGDVVADASVWMAMDKEATREDAERVVAAEMR  240

Query  912  NKEDHATHPagvaasmaaaaaLNQE  986
            N  +   HP GV ASM AAA LNQE
Sbjct  241  NNPELRAHPGGVGASMVAAARLNQE  265



>ref|XP_006589173.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X2 [Glycine max]
Length=275

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 160/275 (58%), Gaps = 19/275 (7%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q ++ E+ ++E IKYGDVF+V G++ +KP    DA  MQ AE    G+T K G A 
Sbjct  1    MSQEQPQK-ENHEEEGIKYGDVFNVKGEMKSKPEAPVDAGMMQKAETETTGKTQKAGAAM  59

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDD--IAG----------RRFVTEAIGG  524
               +A       A     N  +V  + GVSV E +  ++G          +R V + +  
Sbjct  60   QSAAAKNERGGMAGHKDKN--NVAADGGVSVTETEAHLSGSQVVNRLEEKKRKVNKLV--  115

Query  525  DVVGKYIRppaeektpppppppaaGV--VSDDITIGEALEATAISAGDKPVGKSDAAAIQ  698
            +VV ++ +        PP      G       ITIGEALEAT ++AG KPV  SDAAAIQ
Sbjct  116  EVVKQFNQKAPLNTMTPPSIVQEMGAGGAGSGITIGEALEATVLTAGKKPVEWSDAAAIQ  175

Query  699  AAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVE  878
            AAEVRATG  +I+PGGV A AQ AA +NAR T DE K K+ D+L DA+SKL  D+  T  
Sbjct  176  AAEVRATGRTNIVPGGVAAAAQSAATLNARVTKDEEKIKLADILADATSKLPSDRAATRR  235

Query  879  DAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            DA GV  AE RN  +  THP GV+AS+AAAA LN+
Sbjct  236  DAEGVTGAEMRNDPNLTTHPGGVSASVAAAARLNK  270



>ref|XP_004985623.1| PREDICTED: late embryogenesis abundant protein D-34-like [Setaria 
italica]
Length=280

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 166/276 (60%), Gaps = 12/276 (4%)
 Frame = +3

Query  201  MSQQQARRPE------SGDQEPIKYGDVFD-VSGQLAAKPITQQDAAAMQSAENT--AFG  353
            MSQ Q RRP        G+   ++YGDVF  VSG LA KP+  QDAA MQSAE+    FG
Sbjct  1    MSQGQPRRPSDQQQAAGGEHGAVRYGDVFPAVSGGLAEKPVAPQDAATMQSAESLVFGFG  60

Query  354  QTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVV  533
            QTI+GGP A MQSAA  N R   V  D  TD    QGV+V E  + G R VTE + G  V
Sbjct  61   QTIRGGPGATMQSAATTNERMGVVGHDQATDATAVQGVTVSETRVPGGRLVTEFVAGQAV  120

Query  534  GKYIRppaeektpppppppaaGVVSDD---ITIGEALEATAISAGDKPVGKSDAAAIQAA  704
            G+Y+ P              A     D   +TIGEALEATA++AGD+PV +SDAAAIQAA
Sbjct  121  GQYLAPDDATAGGAAGAGGVAAAGVVDNTKVTIGEALEATALAAGDEPVERSDAAAIQAA  180

Query  705  EVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDA  884
            E RATGL   +PGG+ A AQ AA  N     DE KT IGDVL +A++KL  DK V   DA
Sbjct  181  EARATGLHANVPGGLAAQAQSAAAANEWAARDEDKTTIGDVLANATAKLVADKTVESADA  240

Query  885  AGVVNAEARNKEDHATHPagvaasmaaaaaLNQETA  992
              V  AE RNK D    P GVAASMAAAA LN++ A
Sbjct  241  LRVAGAENRNKGDATARPGGVAASMAAAAKLNRDEA  276



>ref|XP_010326670.1| PREDICTED: late embryogenesis abundant protein D-34-like isoform 
X2 [Solanum lycopersicum]
Length=276

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 168/264 (64%), Gaps = 9/264 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q +RPE   ++P+KYGD F+V G LA +PI  QDAA MQSAE   FG+  KGGPA+
Sbjct  22   MSQDQPQRPER--EQPLKYGDCFNVKGDLADQPIAPQDAAMMQSAEAMVFGKNQKGGPAS  79

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            VMQ+AAA+N R+  V  D  T +  ++G++V E  + GRR +TE++ G V+G+Y+ P   
Sbjct  80   VMQAAAAKNERSGHVSHDATTQLAGDEGITVAETKLPGRRIITESVAGQVLGQYVEPLPV  139

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                         V    ITIGEAL ATA++AG+KPV +SDAAAIQAAE RATG   + P
Sbjct  140  TAAAATGGD----VEEAPITIGEALAATALTAGEKPVEQSDAAAIQAAEARATGSSVVTP  195

Query  741  GGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKE  920
            GG+ A AQ AA  N     D  K K+ D    A++KL  DK  T +DA GV+ AE RN  
Sbjct  196  GGLAATAQSAASANEGLAQDVDKIKLND---GAAAKLPADKATTRQDAQGVMEAELRNNP  252

Query  921  DHATHPagvaasmaaaaaLNQETA  992
                +P GVAAS+AAAA LN++++
Sbjct  253  TLTAYPGGVAASVAAAARLNEKSS  276



>ref|XP_010679057.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=260

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 116/249 (47%), Positives = 152/249 (61%), Gaps = 12/249 (5%)
 Frame = +3

Query  201  MSQQQARRPESG--DQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            M+Q+Q RR   G   +EPIKYGDVF VSG+ A KPI  +DAAAM+SAE    G +  GGP
Sbjct  1    MAQEQPRREAVGPEQEEPIKYGDVFYVSGEAAEKPILPEDAAAMKSAEEIIMGHSPLGGP  60

Query  375  AAVMQSaaarnvrnarvDPDN--VTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            A++M+SAA  NV+   VDP++   T+ +R   V+  E    G R VTE++  +VVG+Y+ 
Sbjct  61   ASLMRSAADSNVQAGLVDPNSRQATEGIR---VTEFEPKNHGTRVVTESVNDEVVGQYVE  117

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
            P      P         V    +TIGE L+A A  AGD+P+ ++DAAAI+AAE RA G  
Sbjct  118  PKFVGVPPTEGATT---VNKGGVTIGETLDAVARCAGDQPIDRADAAAIEAAEKRAVG-N  173

Query  729  HILPG-GVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
             + PG G+GA+A  AA  NAR   + + T I DVL DAS KL  DK VT EDA  V+ AE
Sbjct  174  DLPPGWGLGAEAHHAACWNARAPQEGYMTTIDDVLKDASHKLVRDKIVTREDAKEVLEAE  233

Query  906  ARNKEDHAT  932
             +N  + AT
Sbjct  234  VKNDPEMAT  242



>gb|EAY88627.1| hypothetical protein OsI_10103 [Oryza sativa Indica Group]
Length=276

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 155/257 (60%), Gaps = 11/257 (4%)
 Frame = +3

Query  201  MSQQQARRPE------SGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTI  362
            MSQ+Q RRP        G ++ I+YGDVF V+G LAAKPI  +DAA MQSAEN   G+T+
Sbjct  1    MSQEQPRRPSEKAAGGGGGEQGIRYGDVFPVTGSLAAKPIAPRDAATMQSAENLVLGKTV  60

Query  363  KGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDI-AGRRFVTEAIGGDVVGK  539
            KGGPAA M+SAA+RN     V  D  TD   EQGV+V +  +  G R VTE + G  VG 
Sbjct  61   KGGPAAAMESAASRNEEMGVVGHDQATDAAAEQGVNVSDTLVPGGGRIVTEFVAGQAVGH  120

Query  540  YIRppaeektpppppppaaGVVSDD----ITIGEALEATAISAGDKPVGKSDAAAIQAAE  707
            Y+               A G V  +    ITIGEALEA A++AG  PV +SDAAAIQAAE
Sbjct  121  YVEQDDGAAVVAGVVGAAPGAVRVEEPAKITIGEALEAAALAAGGTPVERSDAAAIQAAE  180

Query  708  VRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAA  887
             +ATG    +PGG+ A AQ AA  N  T  D  KTK+GDVL++A++KL  DK V   DAA
Sbjct  181  AKATGTDTYMPGGLAAQAQSAAVANLWTARDADKTKLGDVLSNATAKLAADKEVESGDAA  240

Query  888  GVVNAEARNKEDHATHP  938
             V  AE RNK   A  P
Sbjct  241  RVAGAETRNKPGAAARP  257



>ref|NP_001049030.1| Os03g0159600 [Oryza sativa Japonica Group]
 gb|AAN06848.1| Putative abscisic acid-induced protein [Oryza sativa Japonica 
Group]
 gb|ABF94089.1| Seed maturation protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF10944.1| Os03g0159600 [Oryza sativa Japonica Group]
 dbj|BAG97815.1| unnamed protein product [Oryza sativa Japonica Group]
Length=276

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 155/257 (60%), Gaps = 11/257 (4%)
 Frame = +3

Query  201  MSQQQARRPE------SGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTI  362
            MSQ+Q RRP        G ++ I+YGDVF V+G LAAKPI  +DAA MQSAEN   G+T+
Sbjct  1    MSQEQPRRPSEKAAGGGGGEQGIRYGDVFPVTGSLAAKPIAPRDAATMQSAENLVLGKTV  60

Query  363  KGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDI-AGRRFVTEAIGGDVVGK  539
            KGGPAA M+SAA+RN     V  D  TD   EQGV+V +  +  G R VTE + G  VG 
Sbjct  61   KGGPAAAMESAASRNEEMGVVGHDQATDAAAEQGVNVSDTLVPGGGRIVTEFVAGQAVGH  120

Query  540  YIRppaeektpppppppaaGVVSDD----ITIGEALEATAISAGDKPVGKSDAAAIQAAE  707
            Y+               A G V  +    ITIGEALEA A++AG  PV +SDAAAIQAAE
Sbjct  121  YVEQDDGAAVVAGVVGAAPGAVRVEEPAKITIGEALEAAALAAGGTPVERSDAAAIQAAE  180

Query  708  VRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAA  887
             +ATG    +PGG+ A AQ AA  N  T  D  KTK+GDVL++A++KL  DK V   DAA
Sbjct  181  AKATGTDTYMPGGLAAQAQSAAVANLWTARDADKTKLGDVLSNATAKLAADKEVESGDAA  240

Query  888  GVVNAEARNKEDHATHP  938
             V  AE RNK   A  P
Sbjct  241  RVAGAEMRNKPGAAARP  257



>ref|XP_002465829.1| hypothetical protein SORBIDRAFT_01g046490 [Sorghum bicolor]
 gb|EER92827.1| hypothetical protein SORBIDRAFT_01g046490 [Sorghum bicolor]
Length=283

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 143/279 (51%), Positives = 173/279 (62%), Gaps = 15/279 (5%)
 Frame = +3

Query  201  MSQQQARRPE------SGDQEPIKYGDVFD-VSGQLAAKPITQQDAAAMQSAENTAFGQT  359
            MSQ+Q RRP       SG+Q  ++YGDVF  V+G LA KP+  QDAA MQSAEN  FGQT
Sbjct  1    MSQRQPRRPSGHQETTSGEQGAVRYGDVFPAVAGGLAEKPVAPQDAATMQSAENLVFGQT  60

Query  360  IKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGK  539
            ++GGPAA MQSAA  N R   V  D  TD    QGV+V E  + G R VTE + G  VG+
Sbjct  61   LRGGPAAAMQSAATANERMGAVGHDQATDATAVQGVTVSETRVPGGRIVTEFVAGQAVGQ  120

Query  540  YIRppaeektpppppppaaGVVSD--------DITIGEALEATAISAGDKPVGKSDAAAI  695
            Y+    +           A   S          +TIGEALEATA++AGD PV +SDAAAI
Sbjct  121  YLARDDDAGGGGGGAGAGARGASAGGVGKDMTKVTIGEALEATALAAGDAPVERSDAAAI  180

Query  696  QAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTV  875
            QAAE RATGL   +PGG+ A AQ AA  NA  + DE K  +GDVL +A+++L  DKPV  
Sbjct  181  QAAEARATGLDANVPGGLAARAQSAAAANAWASRDEDKATLGDVLANAATRLVADKPVES  240

Query  876  EDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQETA  992
             DA GV  AE RN++D    P GVAASMAAAA LN++ A
Sbjct  241  GDALGVAGAENRNRDDGTARPGGVAASMAAAARLNRDEA  279



>ref|XP_004986236.1| PREDICTED: late embryogenesis abundant protein D-34-like [Setaria 
italica]
Length=266

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 163/269 (61%), Gaps = 12/269 (4%)
 Frame = +3

Query  201  MSQQQARRPESGD------QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTI  362
            MSQ Q RRP  G+       +PIKYGDVFDV+G LA +P+  +DAA +QSAE    G+T 
Sbjct  1    MSQGQPRRPPQGEAAPQVPDQPIKYGDVFDVTGDLADRPVAPRDAALLQSAEQAVLGRTQ  60

Query  363  KGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKY  542
            +GGPAAV+QSAAA N R   V    +T    + G +V E ++ G R VTE++GG  V K 
Sbjct  61   RGGPAAVLQSAAALNARAGHVGKGQITGPAADAGATVTEAELPGLRVVTESVGGQAVAKL  120

Query  543  IRppaeektpppppppaaGVVSDDITIGEALEATAISA-GDKPVGKSDAAAIQAAEVRAT  719
            + P     T P           D +TIG ALEA A +A G KPV +SDAAA+QAAE+ AT
Sbjct  121  VTPAPVVATDPSGAAD-----QDAVTIGRALEAVAATAAGGKPVDQSDAAAVQAAEMCAT  175

Query  720  GLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVN  899
                  PGGV A AQ AA+ NAR   DE K K+ DVL++A  K+  D+  T EDA  VV+
Sbjct  176  ASSATAPGGVAAAAQAAADHNARAARDEDKVKLRDVLSNAREKMPADRGATGEDAERVVS  235

Query  900  AEARNKEDHATHPagvaasmaaaaaLNQE  986
            AE RNK D AT   GVA ++  AA LNQE
Sbjct  236  AEIRNKLDMATTLGGVAEAVTTAARLNQE  264



>ref|XP_010679062.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=254

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 135/240 (56%), Gaps = 26/240 (11%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            M+  Q RR E G    IKYGDVF++SG++A +PI+ +DAAAM+SAEN AFG+TIKGGPA+
Sbjct  1    MAHDQQRRGEGG---AIKYGDVFEMSGEMAEQPISPRDAAAMRSAENRAFGKTIKGGPAS  57

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +M  AA +NV    V P++       QG+                    V G        
Sbjct  58   IMLEAAKKNVEAGIVGPESDDAHTSHQGL--------------------VEGNPWHESQP  97

Query  561  ektpppppppaaG---VVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGH  731
                        G   + +  +T+GEALEA A + GDKPV  SDAAAIQ AE+ ATG   
Sbjct  98   SHAQMESALSVEGMGDIGATGVTMGEALEAAAEAVGDKPVDHSDAAAIQVAEMIATGTNA  157

Query  732  ILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEAR  911
             L  G+GA+AQ AA +N +   DE KTK+ D++  A++ LTDDKPVT  DA  V  AE R
Sbjct  158  ALGSGLGAEAQAAATVNEQMMYDEDKTKLSDIIGGATNSLTDDKPVTKWDAERVKAAELR  217



>ref|XP_010679056.1| PREDICTED: late embryogenesis abundant protein D-34-like [Beta 
vulgaris subsp. vulgaris]
Length=260

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 149/240 (62%), Gaps = 8/240 (3%)
 Frame = +3

Query  201  MSQQQARRPE-SGDQEPIKYGDVFDVSGQ-LAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MS++Q +R E + ++EPIKYGDVF VSGQ LA KPI  +DAAAM++ E T  GQ     P
Sbjct  1    MSKEQYQRDEMASNEEPIKYGDVFYVSGQVLANKPILPEDAAAMEAGERTVMGQIPLCSP  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            A+VM++AAA NV++  V P++       +G+ V E D+ G R VTE +  +VVG+Y+ P 
Sbjct  61   ASVMEAAAAINVQSGSVSPNSGP---INKGIQVVETDMNGIRIVTETVDDEVVGQYVEPN  117

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
                   PP         + +TIGEALEA A+SAGD  V  +DAAAI+AAE RA G   +
Sbjct  118  FTGVNLTPPAQTPE---RESVTIGEALEAVALSAGDHAVDSADAAAIEAAEKRALGTDTL  174

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
              G +  +A  AA  NA+    E +T + D+L DAS KL  D+PVT EDA  ++ AEA+N
Sbjct  175  PHGSLAEEAHHAAAWNAQILRCEIRTTMDDILRDASDKLPHDRPVTHEDAKAILEAEAQN  234



>ref|XP_002971638.1| hypothetical protein SELMODRAFT_172144 [Selaginella moellendorffii]
 gb|EFJ27387.1| hypothetical protein SELMODRAFT_172144 [Selaginella moellendorffii]
Length=253

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 143/239 (60%), Gaps = 20/239 (8%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ+Q +RP       + YGD+F+VSG++  + IT +DAA MQSAE  AFGQT K G A+
Sbjct  1    MSQEQMQRP-------VTYGDIFNVSGEMGKQAITSEDAALMQSAETQAFGQTQKHGAAS  53

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppae  560
            +MQ+AA  NV+   +  D  + V  + GV+V+E  + G    TE +    V   IRP   
Sbjct  54   LMQAAADHNVKTGALSADAHSPVA-DIGVTVRETVVPGAAIDTEFVANVPVTGVIRPLPT  112

Query  561  ektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILP  740
                           ++ +TIGEALEA A+ A D+P+  SDA AIQ+AE RATG      
Sbjct  113  APEVAS---------ANAVTIGEALEAAALGAIDQPIEHSDACAIQSAETRATGAPVTSK  163

Query  741  GGVGADAQRAAEINARTTTDEF-KTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            GG+ + AQ AAE+N R   D+F KT IGD+LTDA++ L  DK VT EDA  V+ AEAR+
Sbjct  164  GGLSSTAQSAAELNPR--VDDFAKTTIGDLLTDATTYLATDKVVTQEDAIKVIEAEARH  220



>ref|XP_002965692.1| hypothetical protein SELMODRAFT_84789 [Selaginella moellendorffii]
 gb|EFJ33112.1| hypothetical protein SELMODRAFT_84789 [Selaginella moellendorffii]
Length=248

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 138/226 (61%), Gaps = 13/226 (6%)
 Frame = +3

Query  240  QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrna  419
            Q P+ YGD+F+VSG++  + IT +DA+ MQSAE  AFGQT K G A++MQ+AA  NV+  
Sbjct  2    QRPVTYGDIFNVSGEMGKQAITSEDASLMQSAETQAFGQTQKHGAASLMQAAADHNVKTG  61

Query  420  rvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaG  599
             + PD  + V  + GV+V+E  + G    TE +    V   +RP                
Sbjct  62   ALSPDAHSPVA-DIGVTVRETVVPGAAIDTEFVANVPVTGVVRPLPTAPEVAS-------  113

Query  600  VVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEI  779
              ++ +TIGEALEA A+ A D+P+  SDA AIQ+AE RATG      GG+ + AQ AAE+
Sbjct  114  --ANAVTIGEALEAAALGAIDQPIEHSDACAIQSAETRATGAPVTSKGGLSSTAQSAAEL  171

Query  780  NARTTTDEF-KTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            N R   D+F KT IGD+LTDA++ L  DK VT EDA  V+ AEAR+
Sbjct  172  NPR--VDDFAKTTIGDLLTDATTYLATDKVVTQEDAIKVIEAEARH  215



>dbj|BAJ96619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 140/249 (56%), Gaps = 21/249 (8%)
 Frame = +3

Query  201  MSQQQARR--PESGDQE---PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFG----  353
            M+Q QA R  P    QE   PI+YG VF V+G LA + I  +DA AM++AE +  G    
Sbjct  1    MAQAQATRGDPMKAQQEQPEPIQYGHVFAVTGDLAVQAIAPRDAEAMRTAEESVQGVQVP  60

Query  354  QTIKGGPAAVMQSaaarnvrna--rvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGD  527
            Q   GG +A +    A     A   V P   +D   +QG++V +  + G R VTE + G 
Sbjct  61   QASGGGFSAAVAMETAAAYNQAVGAVRPGQASDAATKQGITVTQTAVPGGRIVTEFVAGQ  120

Query  528  VVGKYIRppaeektpppppppaaGVVSDD---ITIGEALEATAISAGDKPVGKSDAAAIQ  698
            VVG+Y                   +V +D   +TIGEA+EA A+SAGD+P+ ++DAAAI+
Sbjct  121  VVGQY-------SVADQAMMQQQQLVEEDASKVTIGEAMEAAALSAGDRPLEETDAAAIR  173

Query  699  AAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVE  878
            AAE +A G   ++PGG+   A  AA  NA    DE K  +GDVL+DA++KL DDKP   E
Sbjct  174  AAETQAQGEDKVMPGGLADQAWAAASANAWAERDEDKITVGDVLSDATTKLADDKPAARE  233

Query  879  DAAGVVNAE  905
            DAA VV AE
Sbjct  234  DAARVVQAE  242



>ref|XP_008651207.1| PREDICTED: late embryogenesis abundant protein D-34-like [Zea 
mays]
 tpg|DAA43457.1| TPA: rab28 protein [Zea mays]
Length=291

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 146/288 (51%), Positives = 171/288 (59%), Gaps = 24/288 (8%)
 Frame = +3

Query  201  MSQQQARRPES-------GDQEPIKYGDVFD-VSGQLAAKPITQQDAAAMQSAENTAFGQ  356
            MSQ+Q RRP         G+Q  ++YGDVF  VSG LA KP+  QDAA MQSAEN  FGQ
Sbjct  1    MSQEQPRRPSGHEETSGGGEQGAVRYGDVFPAVSGGLAEKPVAPQDAATMQSAENLVFGQ  60

Query  357  TIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDI-AGRRFVTEAIGGDVV  533
            T+KGGPAA MQSAA  N R   V  D  TD    QGV+V E  +  G R VTE + G  V
Sbjct  61   TLKGGPAAAMQSAATANERMGAVGHDQATDATAVQGVTVSETRVPGGGRIVTEFVAGQAV  120

Query  534  GKYI------------RppaeektpppppppaaGVVSDDI---TIGEALEATAISAGDKP  668
            G+Y+                           +AGV   DI   TIGEALEATA++AGD P
Sbjct  121  GQYLARDDDDGAAATAGGGIAGPGAGAGGGASAGVAGKDITKVTIGEALEATALAAGDAP  180

Query  669  VGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSK  848
            V +SDAAAIQAAE RATGL   +PGG+ A AQ AA  N+    DE K  +GDVL +A+++
Sbjct  181  VERSDAAAIQAAEARATGLDANVPGGLAAQAQSAAAANSWAWGDEDKATLGDVLANATAR  240

Query  849  LTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQETA  992
            L  DKPV   DA GV  AE RN+ D    P GVAASMAAAA LN+  A
Sbjct  241  LVADKPVESADALGVAGAENRNRNDGTARPGGVAASMAAAARLNRNEA  288



>ref|XP_006347861.1| PREDICTED: late embryogenesis abundant protein D-34-like [Solanum 
tuberosum]
Length=206

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 114/171 (67%), Gaps = 10/171 (6%)
 Frame = +3

Query  471  VKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAI  650
            V+E  +A ++ V E+IGG V GK                  +G V  +ITIGEALEAT +
Sbjct  27   VQESSLARKKAVAESIGGQVHGK--------DRKQVSSESVSGRV--NITIGEALEATVV  76

Query  651  SAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVL  830
            +AG KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA  NAR T +E KTK+ ++L
Sbjct  77   TAGSKPVDYSDAAAIQAAEVRATGRTNIIPGGVAAAAQSAATRNARLTKEEEKTKLAEIL  136

Query  831  TDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
             +ASSKL  DKPVT +DA GV+ AE RN  +  T P GVAAS+AAAA LNQ
Sbjct  137  AEASSKLPSDKPVTRKDAEGVIGAELRNDPNLCTRPGGVAASIAAAARLNQ  187



>dbj|BAK03375.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=263

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 132/230 (57%), Gaps = 16/230 (7%)
 Frame = +3

Query  243  EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFG----QTIKGGPAAVMQSaaarnv  410
            EPI+YG VF V+G LA + I  +DA AM++AE +  G    Q   GG +A +    A   
Sbjct  9    EPIQYGHVFAVAGDLAVQAIAPRDAEAMRTAEESVQGVQVPQASGGGFSAAVAMETAAAY  68

Query  411  rna--rvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektppppp  584
              A   V P   +D   +QG++V +  + G R VTE + G VVG+Y              
Sbjct  69   NQAVGAVRPGQASDAATKQGITVTQTAVPGGRIVTEFVAGQVVGQY-------SVADQAM  121

Query  585  ppaaGVVSDD---ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGA  755
                 +V +D   +TIGEA+EA A+SAGD+P+ ++DAAAI+AAE +A G   ++PGG+  
Sbjct  122  MQQQQLVEEDASKVTIGEAMEAAALSAGDRPLEETDAAAIRAAETQAQGEDKVMPGGLAD  181

Query  756  DAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
             A  AA  NA    DE K  +GDVL+DA++KL DDKP   EDAA VV AE
Sbjct  182  QAWAAASANAWAERDEDKITVGDVLSDATTKLADDKPAAREDAARVVQAE  231



>ref|XP_011091040.1| PREDICTED: late embryogenesis abundant protein D-34-like [Sesamum 
indicum]
Length=332

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +3

Query  438  VTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDDI  617
            VT V  EQGV+V E D+ G R +TE++GG V+G++++P                V    I
Sbjct  157  VTVVAGEQGVTVAETDLPGTRIITESVGGQVLGQFVQPTPVAAG---------AVPQGAI  207

Query  618  TIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTT  797
            TIGEALE +  +AGDKPV  SD AAIQ AE RATG   I PGG+ A AQ AA  N     
Sbjct  208  TIGEALEVSGRAAGDKPVEFSDVAAIQVAECRATGSDLITPGGLTATAQSAAAYNQAVAE  267

Query  798  DEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHP  938
            DE K ++ DVLT A++KL  DK  T EDA  ++NAE RN  D  THP
Sbjct  268  DEGKVRLADVLTGATAKLPADKAATREDAEEIINAELRNDPDLKTHP  314



>ref|XP_004230131.1| PREDICTED: late embryogenesis abundant protein D-34 [Solanum 
lycopersicum]
Length=200

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 114/171 (67%), Gaps = 10/171 (6%)
 Frame = +3

Query  471  VKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAI  650
            V+E  +A ++ V E+IGG V GK  +  + E                +ITIGEALEAT +
Sbjct  21   VQESSLARKKAVAESIGGQVHGKDRKQVSSESVSGRA----------NITIGEALEATVV  70

Query  651  SAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVL  830
            +AG +PV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA  NAR T +E KTK+ ++L
Sbjct  71   TAGSRPVDYSDAAAIQAAEVRATGRTNIIPGGVAAAAQSAATRNARLTKEEEKTKLAEIL  130

Query  831  TDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
             +ASSKL  DKPVT +DA GV+ AE RN  +  T P GVAAS+AAAA LNQ
Sbjct  131  AEASSKLPSDKPVTRKDAEGVIGAELRNDPNLCTRPGGVAASIAAAARLNQ  181



>gb|EPS67127.1| hypothetical protein M569_07649, partial [Genlisea aurea]
Length=140

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  612  DITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINART  791
            +ITIGEALEATA++AG +PV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA  NAR 
Sbjct  3    EITIGEALEATALTAGHRPVDYSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATRNARL  62

Query  792  TTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaa  971
              DE KTK+G++LTDASSKL  DKPVT  DA GV+ AE RN  +  T P GVAAS+AAAA
Sbjct  63   PRDEDKTKLGEILTDASSKLPSDKPVTRRDAEGVIGAEVRNDPNLCTRPGGVAASLAAAA  122

Query  972  aLNQ  983
             LNQ
Sbjct  123  RLNQ  126



>gb|KDP23618.1| hypothetical protein JCGZ_23451 [Jatropha curcas]
Length=205

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 113/175 (65%), Gaps = 3/175 (2%)
 Frame = +3

Query  480  DDIAGRRFVTEAIGGD--VVGKYIRppaeektpppppppaaGVV-SDDITIGEALEATAI  650
            +D   +R + E+I G   +  +Y      +  P     P  GV     ITIGEALEATA+
Sbjct  30   EDKPEKRLIKESIAGQMQIAEQYSNRAQIQSLPTTITFPQGGVSGCGGITIGEALEATAL  89

Query  651  SAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVL  830
            +AG KPV  SDAAAIQAAEVRATG   I PGGV A AQ AA +NAR T DE KTK+ D+L
Sbjct  90   TAGQKPVEWSDAAAIQAAEVRATGRTTISPGGVAAAAQSAATLNARATRDEDKTKLADIL  149

Query  831  TDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQETAF  995
             DA+SKL  D+P T +DA GV  AE RN     THPAGVAAS+AAAA LNQ+ +F
Sbjct  150  ADATSKLPADRPATRKDAEGVTGAEMRNDPYLTTHPAGVAASIAAAARLNQQNSF  204



>ref|XP_006394999.1| hypothetical protein EUTSA_v10004958mg [Eutrema salsugineum]
 gb|ESQ32285.1| hypothetical protein EUTSA_v10004958mg [Eutrema salsugineum]
Length=191

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR T
Sbjct  67   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARAT  126

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +D+ KT + +VLT ASSKL  DKP T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  127  SDDDKTTLAEVLTGASSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  186

Query  975  LNQ  983
            +NQ
Sbjct  187  INQ  189



>ref|XP_009597797.1| PREDICTED: late embryogenesis abundant protein D-34 [Nicotiana 
tomentosiformis]
Length=208

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 115/166 (69%), Gaps = 8/166 (5%)
 Frame = +3

Query  486  IAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDK  665
            +A ++ V E+IGG V+G+  + P   ++              +ITIGEALEATA++AG++
Sbjct  30   LARKKAVAESIGGQVLGQDKKAPLSSESVSSGKT--------NITIGEALEATALTAGNR  81

Query  666  PVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASS  845
            PV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA  NAR T +E KTK+ ++L DAS+
Sbjct  82   PVDYSDAAAIQAAEVRATGRTNIIPGGVAAAAQSAATRNARVTKEEEKTKLAEILADAST  141

Query  846  KLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            KL  DKPVT +DA GV+ AE RN  +  T P GVAAS+AAAA LNQ
Sbjct  142  KLPADKPVTRKDAEGVIGAELRNDPNLCTRPGGVAASIAAAARLNQ  187



>ref|XP_009394613.1| PREDICTED: late embryogenesis abundant protein D-34-like [Musa 
acuminata subsp. malaccensis]
Length=280

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 155/265 (58%), Gaps = 8/265 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q RRP    + P + GDV  V+G  A + IT + A  M SAEN   G+T   GPA+
Sbjct  20   MSQNQPRRPGQSQERPTRCGDVLPVAGGHAGEAITPRAADMMPSAENRVLGRTPNDGPAS  79

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAG---RRFVTEAIGGDVVGKYIRp  551
             M+SAA RN +        V++    Q VSV + DI G   +R VT+ + G  VG+Y+  
Sbjct  80   GMESAATRNKQRGV-----VSNAPGLQDVSVTQTDIPGSPGQRLVTKFVAGQAVGRYVIY  134

Query  552  paeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGH  731
              E          +  + +D +TIGEALEATA +AGDK V  SDAAAIQAAE  ATG+  
Sbjct  135  RGEGGDDQGGGGCSVAMWTDKVTIGEALEATATTAGDKTVEASDAAAIQAAEATATGVNA  194

Query  732  ILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEAR  911
            ++PGGV A AQ AA  NA    ++ KT++G V+ DA+ +L  DK  T  DA  V+ AE R
Sbjct  195  VMPGGVAAAAQAAAAANASRDRNDDKTRLGQVVKDAAIRLPVDKVATRRDAERVLAAEMR  254

Query  912  NKEDHATHPagvaasmaaaaaLNQE  986
            N  D  T+P GV ASM AAA LNQ+
Sbjct  255  NNPDLLTYPGGVGASMVAAARLNQQ  279



>ref|XP_011091892.1| PREDICTED: late embryogenesis abundant protein D-34 [Sesamum 
indicum]
Length=227

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +3

Query  612  DITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINART  791
            DITIGEALEATA++AG +PV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA  NAR 
Sbjct  82   DITIGEALEATALTAGHRPVDYSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATRNARV  141

Query  792  TTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaa  971
              DE KTK+G++L+DASSKL  DKPVT  DA GV+ AE RN  +  T P GVAAS+AAAA
Sbjct  142  PRDEDKTKLGEILSDASSKLPSDKPVTRRDAEGVIGAELRNDPNLCTRPGGVAASVAAAA  201

Query  972  aLNQETAF  995
             LNQ  + 
Sbjct  202  RLNQTNSL  209



>gb|KFK26460.1| hypothetical protein AALP_AA8G252100 [Arabis alpina]
Length=181

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR T
Sbjct  57   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARVT  116

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +D+ KT + DVLT ASSKL  DK  T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  117  SDDEKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  176

Query  975  LNQ  983
            +NQ
Sbjct  177  INQ  179



>ref|XP_010674900.1| PREDICTED: late embryogenesis abundant protein D-34 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEAL+AT ++AG K V +SDAAAIQAAEVRATG  +I+PGG+ A AQ AA+INAR+T
Sbjct  93   ITIGEALQATVLTAGQKAVDRSDAAAIQAAEVRATGQTNIMPGGLAATAQSAAQINARST  152

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            T + K  + DVL+DA+SKL  D+PVT +DA GV+ AE RN  + +T+P GVAAS+  AA 
Sbjct  153  TSK-KITLADVLSDAASKLPKDRPVTRQDAEGVLGAEFRNNPNISTYPGGVAASVVEAAR  211

Query  975  LNQ  983
            +NQ
Sbjct  212  MNQ  214



>emb|CDY52497.1| BnaAnng11440D [Brassica napus]
Length=183

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  59   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGKTNIMPGGVAASAQSAATLNARAN  118

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +++ KT + DVLT ASSKL  DKP T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  119  SEDDKTTLADVLTGASSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  178

Query  975  LNQ  983
            +NQ
Sbjct  179  INQ  181



>ref|XP_009129849.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=181

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  57   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGKTNIMPGGVAASAQSAATLNARAN  116

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +++ KT + DVLT ASSKL  DKP T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  117  SEDDKTTLADVLTGASSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  176

Query  975  LNQ  983
            +NQ
Sbjct  177  INQ  179



>emb|CDY50578.1| BnaC02g39520D [Brassica napus]
Length=184

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  60   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGKTNIMPGGVAASAQSAATLNARAN  119

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +++ KT + DVLT ASSKL  DKP T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  120  SEDDKTTLADVLTGASSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  179

Query  975  LNQ  983
            +NQ
Sbjct  180  INQ  182



>gb|EAZ00817.1| hypothetical protein OsI_22847 [Oryza sativa Indica Group]
Length=277

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 147/253 (58%), Gaps = 17/253 (7%)
 Frame = +3

Query  243  EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFG----QTIKGGPAA--VMQSaaar  404
            E IKYG VF V+G+LA +PI  +DAAAM+SAE +  G    Q I GG +A   M++AAA 
Sbjct  26   EAIKYGHVFAVTGELAGQPIAPRDAAAMRSAEESVPGVPVPQDIGGGYSAGVAMETAAAY  85

Query  405  nvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektppppp  584
            N     V P   +D    QG++V +  + G R +TE + G VVG+Y       +      
Sbjct  86   NQAVGAVRPGQASDAATNQGIAVTQTSVPGGRIITEFVAGQVVGQYSVADQAVEQD----  141

Query  585  ppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQ  764
                   +  IT+GEALEATA++AG++PV ++D  AI+AAE+ A G    +PGG+   AQ
Sbjct  142  -------ATKITVGEALEATALAAGERPVDRTDVEAIRAAEMAAQGSDVTMPGGLADQAQ  194

Query  765  RAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPag  944
             AA  NA    D+ K  +GDVLTDA++KL  DK    EDAA VV AEA +     T   G
Sbjct  195  AAARSNADADRDDDKITVGDVLTDATAKLAGDKVAGAEDAAKVVQAEAYSDAAARTRAGG  254

Query  945  vaasmaaaaaLNQ  983
            V A+++ AA LNQ
Sbjct  255  VGAAVSTAARLNQ  267



>ref|XP_008369302.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=141

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = +3

Query  615   ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
             ITIGEALEATA++AG KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR T
Sbjct  11    ITIGEALEATAMTAGQKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARAT  70

Query  795   TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
              DE KTK+ D+L +A+SKL  DKP T  DA GV  AE RN     THP GVAAS+AAAA 
Sbjct  71    KDEEKTKLADILANATSKLPADKPATRRDAEGVTGAEMRNDPYLTTHPTGVAASVAAAAR  130

Query  975   LNQETAFNI  1001
             LN+  +  +
Sbjct  131   LNENNSSQM  139



>emb|CDX86185.1| BnaA06g29020D [Brassica napus]
Length=191

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  67   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARAN  126

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +DE KT + DVLT A  KL  DKP T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  127  SDEEKTTLADVLTGARGKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  186

Query  975  LNQ  983
            +NQ
Sbjct  187  INQ  189



>gb|EYU45247.1| hypothetical protein MIMGU_mgv1a013828mg [Erythranthe guttata]
Length=209

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +3

Query  612  DITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINART  791
            +ITIGEALEATA++AG +PV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA  NAR 
Sbjct  67   EITIGEALEATALTAGHRPVDYSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATRNARL  126

Query  792  TTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHP  938
              DE KTK+G++L+DASSKL  DKPVT  DA GV+ AE RN  +  T P
Sbjct  127  PRDEDKTKLGEILSDASSKLPSDKPVTRRDAEGVIGAELRNDPNLCTRP  175



>ref|XP_006289560.1| hypothetical protein CARUB_v10003106mg [Capsella rubella]
 gb|EOA22458.1| hypothetical protein CARUB_v10003106mg [Capsella rubella]
Length=193

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR T
Sbjct  69   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARVT  128

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +++ KT + DVLT ASSKL  DK  T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  129  SEDDKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  188

Query  975  LNQ  983
            +NQ
Sbjct  189  INQ  191



>ref|XP_002874409.1| seed maturation family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50668.1| seed maturation family protein [Arabidopsis lyrata subsp. lyrata]
Length=192

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  68   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARVG  127

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +D+ KT + DVLT ASSKL  DK  T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  128  SDDTKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  187

Query  975  LNQ  983
            +NQ
Sbjct  188  INQ  190



>ref|XP_010421659.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=189

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +N+R T
Sbjct  65   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNSRVT  124

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +++ KT + DVLT ASSKL  DK  T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  125  SEDEKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  184

Query  975  LNQ  983
            +NQ
Sbjct  185  INQ  187



>ref|XP_010455160.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=189

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +N+R T
Sbjct  65   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNSRVT  124

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +++ KT + DVLT ASSKL  DK  T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  125  SEDEKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  184

Query  975  LNQ  983
            +NQ
Sbjct  185  INQ  187



>ref|XP_010494063.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
 ref|XP_010494064.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=189

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +N+R T
Sbjct  65   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNSRVT  124

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +++ KT + DVLT ASSKL  DK  T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  125  SEDEKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  184

Query  975  LNQ  983
            +NQ
Sbjct  185  INQ  187



>ref|XP_008450758.1| PREDICTED: late embryogenesis abundant protein D-34 [Cucumis 
melo]
Length=161

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = +3

Query  630  ALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFK  809
            ALEATA++ G+KPV  SDAAAIQAAEVRATG  +I PGG+ A AQ AA +NAR T DE K
Sbjct  38   ALEATALAVGEKPVEWSDAAAIQAAEVRATGRMNIAPGGIAATAQSAATMNARITQDEDK  97

Query  810  TKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQET  989
            TK+ DVL DA S+L+ D+P T  DA GV  AE RN     THP GVAAS+AAAA LNQ  
Sbjct  98   TKLADVLKDARSRLSADRPATRRDAEGVAGAEMRNDPSLTTHPTGVAASIAAAARLNQSN  157

Query  990  AFN  998
              N
Sbjct  158  HSN  160



>emb|CDX80679.1| BnaC07g27650D [Brassica napus]
Length=191

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  67   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARVN  126

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +D+ KT + DVLT A  KL  DKP T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  127  SDDEKTTLADVLTGARGKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  186

Query  975  LNQ  983
            +NQ
Sbjct  187  INQ  189



>ref|NP_198150.1| Seed maturation protein [Arabidopsis thaliana]
 dbj|BAC43241.1| putative embryonic abundant protein [Arabidopsis thaliana]
 gb|AED93755.1| Seed maturation protein [Arabidopsis thaliana]
Length=192

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  68   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARIG  127

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +D+ KT + DVLT ASSKL  DK  T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  128  SDDTKTTLADVLTGASSKLPSDKAATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  187

Query  975  LNQ  983
            +NQ
Sbjct  188  INQ  190



>ref|XP_009151232.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=192

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  68   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARAN  127

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +D+ KT + DVLT A  KL  DKP T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  128  SDDEKTTLADVLTGARGKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  187

Query  975  LNQ  983
            +NQ
Sbjct  188  INQ  190



>ref|XP_009774312.1| PREDICTED: late embryogenesis abundant protein D-34 [Nicotiana 
sylvestris]
Length=203

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 114/166 (69%), Gaps = 8/166 (5%)
 Frame = +3

Query  486  IAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDK  665
            +A ++ V E+IGG V+G+  + P   ++              +ITIGEALEATA++AG++
Sbjct  26   LARKKAVAESIGGQVLGQDKKAPLSSESVSSGKT--------NITIGEALEATALTAGNR  77

Query  666  PVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASS  845
            PV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA  NAR T +E KTK+ ++L DAS+
Sbjct  78   PVDYSDAAAIQAAEVRATGRTNIIPGGVAAAAQSAATRNARVTKEEEKTKLAEILADASA  137

Query  846  KLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            KL  DK VT +DA GV+ AE RN  +  T P GVAAS+AAAA LNQ
Sbjct  138  KLPADKLVTRKDAEGVIGAELRNDPNLCTRPGGVAASIAAAARLNQ  183



>ref|NP_001057565.1| Os06g0341300 [Oryza sativa Japonica Group]
 dbj|BAD61548.1| putative Late embryogenesis abundant protein D-34 [Oryza sativa 
Japonica Group]
 dbj|BAD61622.1| putative Late embryogenesis abundant protein D-34 [Oryza sativa 
Japonica Group]
 dbj|BAF19479.1| Os06g0341300 [Oryza sativa Japonica Group]
 dbj|BAG98114.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 147/253 (58%), Gaps = 17/253 (7%)
 Frame = +3

Query  243  EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFG----QTIKGGPAA--VMQSaaar  404
            E IKYG VF V+G+LA +PI  +DAAAM+SAE +  G    Q I GG +A   M++AAA 
Sbjct  26   EAIKYGHVFAVTGELAGQPIAPRDAAAMRSAEESVPGVPVPQDIGGGYSAGVAMETAAAY  85

Query  405  nvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektppppp  584
            N   A V P   +D    QG++V +  + G R +TE + G VVG+Y       +      
Sbjct  86   NQAVAAVRPGQASDAATNQGIAVTQTSVPGGRIITEFVAGQVVGQYSVADQAVEQD----  141

Query  585  ppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQ  764
                   +  IT+GEALEATA++AG++PV ++D  AI+AAE+ A G    +PGG+   AQ
Sbjct  142  -------ATKITVGEALEATALAAGERPVDRTDVEAIRAAEMAAQGSDVTMPGGLADQAQ  194

Query  765  RAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPag  944
             AA  NA    D+ K  +GDVLTDA++KL  DK    EDAA VV AE  +     T   G
Sbjct  195  AAARSNADADRDDDKITVGDVLTDATAKLAGDKVAGAEDAAKVVQAETYSDAAARTRAGG  254

Query  945  vaasmaaaaaLNQ  983
            V A+++ AA LNQ
Sbjct  255  VGAAVSTAARLNQ  267



>gb|AIA57965.1| late embryogenesis abundant protein 6, partial [Jatropha curcas]
Length=143

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D +TIGEALEAT++SAG+KPV +SDAAAIQAAEVRATG+  +LPGG+GA+AQ AA  N R
Sbjct  16   DAVTIGEALEATSLSAGEKPVEQSDAAAIQAAEVRATGINEVLPGGIGAEAQSAATRN-R  74

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKED-HAT  932
              +D  +  + +VL DAS KL  DK VT EDA  V+ AE RN+ D HAT
Sbjct  75   ALSDRDRITLSEVLEDASLKLPADKAVTREDADRVIQAEVRNRPDMHAT  123



>emb|CDP08585.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = +3

Query  603  VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEIN  782
            +   ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA  N
Sbjct  35   LRSSITIGEALEAAVLTAGNKPVDYSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATRN  94

Query  783  ARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasma  962
            AR T DE KTK+ DVL++A +KL  DKPVT  DA GV+ AE RN  +  T P GVAAS+A
Sbjct  95   ARVTRDEDKTKLADVLSEACTKLPADKPVTRRDAEGVIGAELRNDPNLTTRPGGVAASLA  154

Query  963  aaaaLNQETAFN  998
            AAA LNQ    N
Sbjct  155  AAARLNQTMNRN  166



>ref|NP_001051258.2| Os03g0747400 [Oryza sativa Japonica Group]
 dbj|BAF13172.2| Os03g0747400 [Oryza sativa Japonica Group]
Length=257

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 149/267 (56%), Gaps = 21/267 (8%)
 Frame = +3

Query  201  MSQQQARRP--ESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            MSQ Q RRP  +     P+ YGDVFDVSG+LA +P+  +DAA +QSAE    G+  KGGP
Sbjct  1    MSQGQPRRPPPDGSGARPVMYGDVFDVSGELAGQPVAPRDAAKLQSAEEAVLGEAQKGGP  60

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQG--VSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            AA MQSAAA N R   V    VT  + ++G  V+V E ++ GRR VTE++ G VV +   
Sbjct  61   AAAMQSAAAINARAGHVGRAQVTGAIADEGVAVAVAETELPGRRVVTESVAGQVVARL--  118

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
                         P+  +  D +TIG ALE            +      +AAE+ ATG  
Sbjct  119  ---ATPPRVVATQPSGSLDKDAVTIGRALE-----------WRPRPPRRRAAEMLATGRT  164

Query  729  HILPGGVGADAQRAAEINARTTT-DEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
              +PGGV A AQ AA+ NA     DE + K+ DVLT A  KL  DK  T EDA  V +AE
Sbjct  165  VTVPGGVAAAAQAAADHNAAPAARDEDRIKLRDVLTGARGKLPADKAATREDAERVPSAE  224

Query  906  ARNKEDHATHPagvaasmaaaaaLNQE  986
             RN+ D AT P GVA ++ AAA LNQE
Sbjct  225  VRNRPDMATTPGGVADAVTAAARLNQE  251



>gb|AFW67487.1| hypothetical protein ZEAMMB73_891670 [Zea mays]
Length=207

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 98/248 (40%), Positives = 126/248 (51%), Gaps = 50/248 (20%)
 Frame = +3

Query  243  EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnar  422
            +P+K+GDV DVSG+L  +P+  +DAA +Q+AE +  G T KGGPAAV+QS A  N R   
Sbjct  6    KPVKFGDVLDVSGELDDQPVAPRDAARLQAAEQSVPGGTQKGGPAAVLQSVATVNARAGH  65

Query  423  vDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGV  602
            V        V + G ++ E ++AGRR VTE++GG VVGK +        P     P   +
Sbjct  66   VGRAQTACPVADAGATITETELAGRRVVTESVGGQVVGKMV-----TPAPVAMTDPPGAL  120

Query  603  VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEIN  782
              D +TIG ALEA     GD+PV +SDAAA+Q                           N
Sbjct  121  EKDAVTIGRALEAVGAMVGDRPVEQSDAAAVQ---------------------------N  153

Query  783  ARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasma  962
            AR                   KL  DK  T EDA  VV+AE RNK D AT P G+A ++ 
Sbjct  154  AR------------------EKLPADKGATWEDAERVVSAEIRNKLDMATTPGGMADAVT  195

Query  963  aaaaLNQE  986
             AA LNQE
Sbjct  196  TAARLNQE  203



>emb|CDP08584.1| unnamed protein product [Coffea canephora]
Length=183

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = +3

Query  603  VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEIN  782
            +   ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA  N
Sbjct  48   LRSSITIGEALEAAVLTAGNKPVDYSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATRN  107

Query  783  ARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasma  962
            AR T DE KTK+ DVL++A +KL  DKPVT  DA GV+ AE RN  +  T P GVAAS+A
Sbjct  108  ARVTRDEDKTKLADVLSEACTKLPADKPVTRRDAEGVIGAELRNDPNLTTRPGGVAASLA  167

Query  963  aaaaLNQETAFN  998
            AAA LNQ    N
Sbjct  168  AAARLNQTMNRN  179



>gb|AFW67486.1| hypothetical protein ZEAMMB73_891670 [Zea mays]
Length=178

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 103/169 (61%), Gaps = 5/169 (3%)
 Frame = +3

Query  243  EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnar  422
            +P+K+GDV DVSG+L  +P+  +DAA +Q+AE +  G T KGGPAAV+QS A  N R   
Sbjct  6    KPVKFGDVLDVSGELDDQPVAPRDAARLQAAEQSVPGGTQKGGPAAVLQSVATVNARAGH  65

Query  423  vDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGV  602
            V        V + G ++ E ++AGRR VTE++GG VVGK +        P     P   +
Sbjct  66   VGRAQTACPVADAGATITETELAGRRVVTESVGGQVVGKMV-----TPAPVAMTDPPGAL  120

Query  603  VSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGV  749
              D +TIG ALEA     GD+PV +SDAAA+Q AE+ ATG    +PGG+
Sbjct  121  EKDAVTIGRALEAVGAMVGDRPVEQSDAAAVQVAELCATGSDSTVPGGL  169



>ref|XP_010249416.1| PREDICTED: late embryogenesis abundant protein D-34-like [Nelumbo 
nucifera]
Length=194

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEATA+ AGDKPV +SDAAA+QA EVRATGL   + GGVGA+AQ A  +N +  
Sbjct  70   ITIGEALEATAMVAGDKPVNQSDAAAVQAVEVRATGLNVNITGGVGAEAQFAVNVNEQAM  129

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
             DE K  +GDV+TDA++KL  +KP T  DA  VV  E R   + +THP GVAA++  AA 
Sbjct  130  RDEDKVTLGDVITDATAKLVRNKPATRRDAERVVGVELRINSNVSTHPRGVAAAVTEAAR  189

Query  975  LNQ  983
            LNQ
Sbjct  190  LNQ  192



>ref|XP_009111929.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brassica 
rapa]
Length=191

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  67   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARAN  126

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +++ KT +  VLT A SKL  DKP T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  127  SEDDKTTLAVVLTGARSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  186

Query  975  LNQ  983
            +NQ
Sbjct  187  INQ  189



>emb|CDY19705.1| BnaA09g03580D [Brassica napus]
Length=191

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEA  ++AG+KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR  
Sbjct  67   ITIGEALEAAVLTAGNKPVEWSDAAAIQAAEVRATGRTNIMPGGVAASAQSAATLNARAN  126

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
            +++ KT +  VLT A SKL  DKP T +DA GV  AE RN     T+P GVAAS+AAAA 
Sbjct  127  SEDDKTTLAVVLTGARSKLPSDKPATRKDAEGVTGAEMRNDPHLTTYPTGVAASVAAAAR  186

Query  975  LNQ  983
            +NQ
Sbjct  187  INQ  189



>ref|XP_011091039.1| PREDICTED: LOW QUALITY PROTEIN: late embryogenesis abundant protein 
D-34, partial [Sesamum indicum]
Length=197

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 115/193 (60%), Gaps = 18/193 (9%)
 Frame = +3

Query  372  PAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRp  551
            PAAVMQ+AA RN R   V   +VTDV  ++GV+V E ++ G R +TE++GG VVG+Y+  
Sbjct  1    PAAVMQAAATRNERVGLVGHRDVTDVAGKEGVTVAETNLPGTRIITESVGGQVVGQYVES  60

Query  552  paeektpppppppaaGVVSDDITIG----EALEATAISAGDKPVGKSDAAAIQAAEVRAT  719
                            V+  + T G     ++  +A +AGDKPV  SDAAAIQAAE RAT
Sbjct  61   KP--------------VMQTEATGGAVRHYSVTXSARAAGDKPVDHSDAAAIQAAECRAT  106

Query  720  GLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVN  899
            G   I PGG+ A AQ AA  N     DE K ++ ++LT A++KL  DK  T EDA G+++
Sbjct  107  GSNMITPGGLAATAQSAAAFNEGLVGDEGKVRLANILTGATTKLPADKAATREDAEGILS  166

Query  900  AEARNKEDHATHP  938
            AE RN  +  THP
Sbjct  167  AEVRNDPNLKTHP  179



>gb|AJA33581.1| late embryogenesis abundant protein LEA7-2 [Pinus tabuliformis]
Length=262

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 139/249 (56%), Gaps = 13/249 (5%)
 Frame = +3

Query  267   FDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvDPDNVTD  446
             F VS  L  +PIT +DAA MQSAE  A G+++KGG AA+MQSAA  N R   VDP   T 
Sbjct  5     FRVSYDLGKEPITVKDAALMQSAETRAAGRSLKGGAAAIMQSAAEINERLGLVDPKRET-  63

Query  447   VVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDDITIG  626
             +   +G++V E  I G+   TE + G  V   I+P + + +            +D +TIG
Sbjct  64    IAAAEGMAVIETQIPGQVVSTEFVAGQPVHSEIKPVSTQHSVAA---------TDAMTIG  114

Query  627   EALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEF  806
             +ALEA A+  G+KP+  +DA AIQ+AE RATG      GG+ A AQ AAE+N R   D  
Sbjct  115   QALEAAAMKEGEKPIDPNDARAIQSAEKRATGNPVTQKGGIAATAQAAAELNPR-VNDVG  173

Query  807   KTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagva--asmaaaaaLN  980
             KT + ++L  A++ L  DK VT EDA  +V AEAR        P       +M +AA LN
Sbjct  174   KTTLSNILLAATTDLPADKAVTREDAEKIVEAEARGSPHGRPRPPSGVIGEAMQSAAKLN  233

Query  981   QETAFNITV  1007
             +E  F   V
Sbjct  234   EERGFTPAV  242



>ref|XP_003596350.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
 gb|AES66601.1| seed maturation protein [Medicago truncatula]
Length=223

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 4/134 (3%)
 Frame = +3

Query  144  INIVHLQFSVEYY*CVIIIMSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAA  323
            INI  L F   +     IIMSQ+Q RR E   QEPIKYGDVF+VSG+L+++PI  +DAA 
Sbjct  25   INIKSLIFKSSFG-NNNIIMSQEQPRRHE---QEPIKYGDVFNVSGELSSQPIAPRDAAT  80

Query  324  MQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRF  503
            MQSAE   FGQT K GPA++M SAA +N     +  +  T++ R +GV+V E    G+R 
Sbjct  81   MQSAEYRTFGQTRKDGPASLMTSAAQKNEDAGFIKHNTATNIARNEGVAVSETYDGGKRV  140

Query  504  VTEAIGGDVVGKYI  545
            +TE +GG V+GK++
Sbjct  141  ITETLGGQVLGKFV  154



>ref|XP_003596349.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
 gb|AES66600.1| seed maturation protein [Medicago truncatula]
Length=252

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 4/134 (3%)
 Frame = +3

Query  144  INIVHLQFSVEYY*CVIIIMSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAA  323
            INI  L F   +     IIMSQ+Q RR E   QEPIKYGDVF+VSG+L+++PI  +DAA 
Sbjct  25   INIKSLIFKSSFG-NNNIIMSQEQPRRHE---QEPIKYGDVFNVSGELSSQPIAPRDAAT  80

Query  324  MQSAENTAFGQTIKGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRF  503
            MQSAE   FGQT K GPA++M SAA +N     +  +  T++ R +GV+V E    G+R 
Sbjct  81   MQSAEYRTFGQTRKDGPASLMTSAAQKNEDAGFIKHNTATNIARNEGVAVSETYDGGKRV  140

Query  504  VTEAIGGDVVGKYI  545
            +TE +GG V+GK++
Sbjct  141  ITETLGGQVLGKFV  154



>ref|XP_003571800.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brachypodium 
distachyon]
Length=267

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 134/231 (58%), Gaps = 8/231 (3%)
 Frame = +3

Query  246  PIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnarv  425
            P++YGDVF V G+LA  PI  QDAA MQ+AE+   G+T K GPA+VMQSAAARNVR   V
Sbjct  27   PVRYGDVFAVHGELAGAPIAPQDAATMQAAESAVLGRTPKSGPASVMQSAAARNVRAGAV  86

Query  426  DPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVV  605
                 T    E GV+V E  + G R  TE + G  VG+     A ++             
Sbjct  87   AHGEATGAAAELGVTVSETRVPGGRIFTEFVAGQHVGQEFVSAAADEEASLAD-------  139

Query  606  SDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINA  785
               IT+GEALEATA SAG++PV  SDAAAI+AAE R  G      G + A A+ AA+ NA
Sbjct  140  GTKITMGEALEATAFSAGEEPVEASDAAAIEAAEARVNGATPAA-GSLAARARAAADANA  198

Query  786  RTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHP  938
                +E KT++ DVL DA+ KL  DK V  EDAA VV AE R K D    P
Sbjct  199  VAEREEDKTRLRDVLADATVKLGADKEVEREDAARVVGAEVRGKPDATARP  249



>ref|XP_004965453.1| PREDICTED: late embryogenesis abundant protein D-34-like [Setaria 
italica]
Length=288

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 99/261 (38%), Positives = 137/261 (52%), Gaps = 26/261 (10%)
 Frame = +3

Query  198  IMSQQQARRPESG----------DQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTA  347
            + +QQQ+ + + G          +Q  I+YG VF V+G LA +PI  +DAAAM+SAE++ 
Sbjct  13   LQAQQQSDKAQLGQGQGLQDLQPEQAAIRYGHVFAVTGYLAGQPIAPRDAAAMRSAEDSV  72

Query  348  FGQTIKGGPAAVMQSaaarnvrnarvD------PDNVTDVVREQGVSVKEDDIAGRRFVT  509
             G  +  G      +A A     A         P   +D    QG++V +  + G R VT
Sbjct  73   PGVQVPEGAGGGFSAATAMETAAAYNQAVGAVRPGQASDAAAVQGITVTQTAVPGGRVVT  132

Query  510  EAIGGDVVGKYIRppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAA  689
            E + G VVG+Y                     +  ITIGEALEATA + G +P+ ++DA 
Sbjct  133  EFVAGQVVGQYSVADPPPAAEED---------ATKITIGEALEATARAGGGRPIDRADAE  183

Query  690  AIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPV  869
            AI+AAE+ A      +PGG+G  AQ AA  NA+ T D  K K+GDVL+DA++KL  DK  
Sbjct  184  AIRAAEMSAHRADVAMPGGLGDQAQAAARANAQATRDGDKVKLGDVLSDATAKLAGDKAA  243

Query  870  TVEDAAGVVNAEARN-KEDHA  929
              EDA  V+ AE  N  E HA
Sbjct  244  GAEDATRVIQAETFNDAEAHA  264



>ref|XP_004304719.1| PREDICTED: late embryogenesis abundant protein D-34-like [Fragaria 
vesca subsp. vesca]
Length=257

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +3

Query  627  EALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEF  806
            EALEATA++AG KPV  SDAAAIQAAEVRATG  +I+PGGV A AQ AA +NAR T DE 
Sbjct  131  EALEATAMTAGQKPVEWSDAAAIQAAEVRATGRTNIVPGGVAAAAQSAATLNARATRDED  190

Query  807  KTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQ  983
            KTK+ D+L DA+SKL  DKP T  DA GV  AE RN     THP GVAAS+AAAA LNQ
Sbjct  191  KTKLADILADATSKLPADKPATRRDAEGVTGAEMRNDPYLTTHPTGVAASVAAAARLNQ  249



>ref|XP_008374066.1| PREDICTED: late embryogenesis abundant protein D-34-like [Malus 
domestica]
Length=130

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 88/125 (70%), Gaps = 8/125 (6%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D ITIGEALEA+A++AG+KP+ +SDAAAIQAAE+RATG   I PGGV A AQ AA +N R
Sbjct  11   DAITIGEALEASALTAGNKPIEQSDAAAIQAAEMRATGPNEIAPGGVAAVAQYAASVNPR  70

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
               D  KTK+     DA+ KL  DKPVT EDA  V+ AE RN  + AT P GV  S+AAA
Sbjct  71   ---DVNKTKL-----DATEKLPADKPVTREDAKAVIGAEIRNSPNMATTPGGVVESLAAA  122

Query  969  aaLNQ  983
            A LNQ
Sbjct  123  AGLNQ  127



>ref|XP_007034768.1| Late embryogenesis abundant protein D-34 isoform 1 [Theobroma 
cacao]
 gb|EOY05694.1| Late embryogenesis abundant protein D-34 isoform 1 [Theobroma 
cacao]
Length=173

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 103/162 (64%), Gaps = 12/162 (7%)
 Frame = +3

Query  456  EQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGVVSDD-ITIGEA  632
            +Q VS  E D++GRR +TE+    V+G+Y++      T         GV+    ITIGEA
Sbjct  4    DQVVSFSETDVSGRRIITES----VLGQYVQATPVPTTQI-------GVIQQTAITIGEA  52

Query  633  LEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKT  812
            LEATA +  DKPV +SDAAAIQAAEVRATG   I+PGG+ A AQ AA  NA    +E K 
Sbjct  53   LEATAQTTRDKPVDQSDAAAIQAAEVRATGSNVIIPGGLAATAQSAAAQNASVNRNEEKI  112

Query  813  KIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHP  938
            ++ +VLT A++KL  DK VT +D  GVV+AE RN  + AT P
Sbjct  113  RLNEVLTGATAKLPADKAVTRQDDEGVVSAELRNNPNVATRP  154



>ref|XP_002453796.1| hypothetical protein SORBIDRAFT_04g017790 [Sorghum bicolor]
 gb|EES06772.1| hypothetical protein SORBIDRAFT_04g017790 [Sorghum bicolor]
Length=283

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 122/228 (54%), Gaps = 15/228 (7%)
 Frame = +3

Query  249  IKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaar------nv  410
            I+YG VF VSG LA +PI  +DAAAM+SAE++  G  +  G      +A A       N 
Sbjct  34   IRYGHVFAVSGDLAGQPIGPRDAAAMRSAEDSVAGVQVPQGAGGGFSAATAMETAAAYNQ  93

Query  411  rnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektppppppp  590
                V P   +D     G++V +  + G R VTE + G VVG+Y                
Sbjct  94   AVGAVHPGQASDTAAMHGIAVTQTAVPGGRIVTEFVAGQVVGQYSVADPPPPAEED----  149

Query  591  aaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRA  770
                 +  ITIGEALEATA + G +P+ ++DA AI+AAE+ A G    +PGG+G  A+ A
Sbjct  150  -----ATKITIGEALEATARAGGGRPIDRADAEAIRAAEMSAHGADVAMPGGLGDQARAA  204

Query  771  AEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            A  NA+ T D  K K+GDVL+D ++KL  DK    EDA  VV  E  N
Sbjct  205  ARANAQATRDGDKVKLGDVLSDVTAKLAGDKAARTEDATRVVQTETFN  252



>ref|XP_010468377.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=124

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 80/116 (69%), Gaps = 5/116 (4%)
 Frame = +3

Query  201  MSQQ-QARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPA  377
            MSQ+ Q +RP    QEP+KYGDVF+VSG+LA KPI  +DA  MQ+AE   FG T KGG A
Sbjct  1    MSQEEQPQRP----QEPVKYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAA  56

Query  378  AVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYI  545
            AVMQSAA  N R   V P + TDV  E+GV+V + D+ G R  TE +GG VVG+Y+
Sbjct  57   AVMQSAATANKRGGFVHPADTTDVAAERGVTVAQTDVPGARVTTEFVGGQVVGQYV  112



>gb|EYU20966.1| hypothetical protein MIMGU_mgv1a019437mg, partial [Erythranthe 
guttata]
Length=98

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 1/97 (1%)
 Frame = +3

Query  699  AAEVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVE  878
            AAEVRATGLGH++PGG+GA AQ AA  NA+TT DE K K+GD+LTDA+ K+  DK VT E
Sbjct  1    AAEVRATGLGHVVPGGLGAQAQSAAAYNAQTTRDEDKAKLGDILTDATLKMAGDKAVTRE  60

Query  879  DAAGVVNAEARNK-EDHATHPagvaasmaaaaaLNQE  986
            DA GV+ AE RNK ED ATHP GVAAS+AAAA LNQE
Sbjct  61   DAEGVIYAEIRNKQEDMATHPGGVAASVAAAARLNQE  97



>ref|XP_003596348.1| Late embryogenesis abundant protein D-34 [Medicago truncatula]
 gb|AES66599.1| seed maturation protein [Medicago truncatula]
Length=134

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ++ RRPE   QEPIKYGD+F+VSG L+++PI  +DAA MQSAE+       K GPA+
Sbjct  1    MSQEKPRRPE---QEPIKYGDIFNVSGDLSSQPIAPRDAATMQSAEDRTLDHARKDGPAS  57

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKY  542
            +M SAA +N     +D +  T++ R +GV+V E +  G+R +TE +GG V+GKY
Sbjct  58   LMTSAAQKNEDAGFIDNNTATNIARNEGVAVSEINNGGKRVITETLGGQVLGKY  111



>gb|KFK42672.1| hypothetical protein AALP_AA1G024900 [Arabis alpina]
Length=170

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D +TIGEALEATA+S GDKPV + DAAAIQAAE RATG     PGG+ A AQ AA  N R
Sbjct  44   DTVTIGEALEATALSFGDKPVDRQDAAAIQAAETRATGEFKTCPGGLAAAAQLAAATNER  103

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
            T  +E K  I D+LTDAS KL  DK VT EDA  VV AE +N  +  T P GVA SM+A 
Sbjct  104  TVLEEGKVTIADILTDASEKLPGDKVVTSEDAEAVVGAELKNSPEMKTTPGGVADSMSAG  163

Query  969  aaLNQE  986
            A LNQ+
Sbjct  164  ARLNQQ  169



>gb|ABD32976.1| Seed maturation protein [Medicago truncatula]
Length=143

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = +3

Query  195  IIMSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGP  374
            IIMSQ+Q RR E   QEPIKYGDVF+VSG+L+++PI  +DAA MQSAE   FGQT K GP
Sbjct  33   IIMSQEQPRRHE---QEPIKYGDVFNVSGELSSQPIAPRDAATMQSAEYRTFGQTRKDGP  89

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVV  533
            A++M SAA +N     +  +  T++ R +GV+V E    G+R +TE +GG  +
Sbjct  90   ASLMTSAAQKNEDAGFIKHNTATNIARNEGVAVSETYDGGKRVITETLGGQAI  142



>ref|XP_009119571.1| PREDICTED: late embryogenesis abundant protein D-34 [Brassica 
rapa]
 emb|CDX89910.1| BnaA10g01720D [Brassica napus]
Length=177

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 83/125 (66%), Gaps = 0/125 (0%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D +TIGEALE TA+S GDKPV + DAAAIQAAE RATG     PGG+   AQ AA  N R
Sbjct  51   DTVTIGEALEVTALSLGDKPVDRKDAAAIQAAETRATGDSKTRPGGLAEAAQEAAATNER  110

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
            T  +E K  I D+LTDA+ KL  DK VT EDA  VV AE RN  +  T P GVA SM+A 
Sbjct  111  TALEEAKVTIADILTDATEKLPGDKVVTSEDAEAVVGAELRNSPEMKTTPGGVADSMSAG  170

Query  969  aaLNQ  983
            A LNQ
Sbjct  171  ARLNQ  175



>emb|CDY18152.1| BnaC05g01750D [Brassica napus]
Length=177

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 83/125 (66%), Gaps = 0/125 (0%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D +TIGEALE TA+S GDKPV + DAAAIQAAE RATG     PGG+   AQ AA  N R
Sbjct  51   DTVTIGEALEVTALSLGDKPVDRKDAAAIQAAETRATGDSKTRPGGLAEAAQEAAATNER  110

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
            T  +E K  I D+LTDA+ KL  DK VT EDA  VV AE +N  +  T P GVA SM+A 
Sbjct  111  TALEEAKVTIADILTDATEKLQGDKVVTSEDAEAVVGAELKNSPEMKTTPGGVADSMSAG  170

Query  969  aaLNQ  983
            A LNQ
Sbjct  171  ARLNQ  175



>ref|XP_006656949.1| PREDICTED: late embryogenesis abundant protein D-34-like [Oryza 
brachyantha]
Length=273

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 138/242 (57%), Gaps = 17/242 (7%)
 Frame = +3

Query  207  QQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFG----QTIKGGP  374
            Q  A+  E G  E IKYG VF V+G+LA +PI  +DAAAM+SAE++  G    Q I GG 
Sbjct  12   QLHAQSQEQGQTEAIKYGHVFAVTGELADQPIAPRDAAAMRSAEDSVPGVLVQQEIGGGY  71

Query  375  AA--VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIR  548
            +A   M++AAA N     V P   +D    QG++V +  + G R +TE + G VVG+Y  
Sbjct  72   SAGVAMETAAAYNQAVGAVRPGQASDAATNQGIAVTQTAVPGGRIITEFVAGQVVGQYSV  131

Query  549  ppaeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLG  728
                 +             +  IT+GEALEATA++A ++PV ++D  AI+AAE+ A    
Sbjct  132  ADQPVEQD-----------ASKITVGEALEATALAADNRPVDRTDVEAIRAAEMMAQESD  180

Query  729  HILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEA  908
              +PGG+   AQ AA  NA    D+ K  +G++LTDA++KL  DK   +EDAA V  AE 
Sbjct  181  VTMPGGLTDQAQAAARANAVAERDDDKITVGELLTDATAKLAGDKVAGMEDAARVAQAEK  240

Query  909  RN  914
             N
Sbjct  241  YN  242



>gb|EMT23291.1| hypothetical protein F775_14150 [Aegilops tauschii]
Length=191

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 77/114 (68%), Gaps = 6/114 (5%)
 Frame = +3

Query  201  MSQQQARRPESGD----QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAEN--TAFGQTI  362
            MSQ Q RRPE G+      PIKYGDVFDVSG+LAA+P+  +DAA +QSAEN     GQT 
Sbjct  1    MSQGQPRRPEGGEAMQADRPIKYGDVFDVSGELAAQPVAPRDAAMLQSAENEVLGLGQTQ  60

Query  363  KGGPAAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGG  524
            KGGPAAVMQSAA  N R   V    +T  V + GV+V E D+ GRR +TE++ G
Sbjct  61   KGGPAAVMQSAATLNARAGHVGRGQLTGPVADAGVTVTEADLPGRRVITESVAG  114


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 77/178 (43%), Gaps = 57/178 (32%)
 Frame = +3

Query  624  GEALEA-TAISAGD----------KPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRA  770
            GEA++A   I  GD          +PV   DAA +Q+AE    GLG    GG  A  Q A
Sbjct  12   GEAMQADRPIKYGDVFDVSGELAAQPVAPRDAAMLQSAENEVLGLGQTQKGGPAAVMQSA  71

Query  771  AEINAR------------------TTTD----------------------------EFKT  812
            A +NAR                  T T+                            E K 
Sbjct  72   ATLNARAGHVGRGQLTGPVADAGVTVTEADLPGRRVITESVAGQAAADQNERAAREEDKV  131

Query  813  KIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaaLNQE  986
            K+ DVL+DA SKL  DK  T EDA  VV+AE RNK D  T P GVA ++  AA LNQE
Sbjct  132  KLRDVLSDARSKLPADKGATREDAERVVSAEMRNKLDLTTTPGGVAEAVTTAARLNQE  189



>ref|XP_010474918.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=182

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D +TIGEALEATA+S GDKPVG+ DAAAIQAAE RATG     PGG+ A AQ AA  N +
Sbjct  56   DTVTIGEALEATALSLGDKPVGRKDAAAIQAAETRATGEFKTRPGGLAAAAQAAAASNEQ  115

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
            T ++E K  I D+LTDA+ +L  DK VT EDA  VV AE R+  +  T P GVA SM+A 
Sbjct  116  TVSEEDKVTIEDILTDAAERLPGDKVVTSEDAEAVVGAELRSSSEMKTTPGGVADSMSAG  175

Query  969  aaLNQ  983
            A LNQ
Sbjct  176  ARLNQ  180



>ref|XP_001781683.1| predicted protein [Physcomitrella patens]
 gb|EDQ53496.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 126/224 (56%), Gaps = 12/224 (5%)
 Frame = +3

Query  240  QEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrna  419
            Q+PI YG++F   G+L +  +  +DAA MQSAE   FGQT K G A+VMQ+AA  NV+  
Sbjct  9    QKPITYGNIFGAVGKLGSDSVLPEDAALMQSAEARTFGQTQKDGAASVMQAAAELNVKAG  68

Query  420  rvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaG  599
             V+ D  + V  E+GV  +E  + G     E I G  V   ++P   +            
Sbjct  69   FVEKDAHSQVA-EKGVMAQEILVPGAEIDVEYIAGQPVIANVKPTPVDPFL---------  118

Query  600  VVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEI  779
            V  D +TIG+ALEA A+ +G +PV  SDA AIQ+A  RATG      G + A A  AAE+
Sbjct  119  VAQDAVTIGDALEAAAVGSGQRPVEDSDARAIQSAVARATGAPPTA-GSLAAAAMSAAEL  177

Query  780  NARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEAR  911
            N R    + KT + D+L DA+  L  DK VT EDAA V++AE R
Sbjct  178  NPRVPNAD-KTTLADILMDATIDLEADKTVTQEDAAKVLDAEMR  220



>ref|XP_004489023.1| PREDICTED: late embryogenesis abundant protein D-34-like [Cicer 
arietinum]
Length=208

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 79/115 (69%), Gaps = 3/115 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ++ RRPE   +EPIKYGDVF+VSG L++ PI  +DAA MQSAE+   GQT K GPA+
Sbjct  1    MSQEKPRRPE---KEPIKYGDVFNVSGDLSSTPIAPRDAATMQSAEDQTLGQTRKDGPAS  57

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYI  545
            +M SAA +N     V  +  T++ R +GV+V      G+R +TE +GG V+GK++
Sbjct  58   LMTSAAQKNESAGFVGHETATNIARNEGVTVGLTYDGGKRVITETLGGQVLGKFV  112



>ref|NP_171811.1| responsive to abscisic acid 28 [Arabidopsis thaliana]
 gb|AAD25796.1|AC006550_4 Similar to rab28 protein gb|X59138 from Zea mays. EST gb|AA042774 
comes from this gene [Arabidopsis thaliana]
 gb|AEE27533.1| responsive to abscisic acid 28 [Arabidopsis thaliana]
Length=182

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D +TIGEALEATA+S GDKPV + DAAAIQAAE RATG     PGG+   AQ AA  N +
Sbjct  56   DTVTIGEALEATALSLGDKPVDRRDAAAIQAAETRATGESKGRPGGLAVAAQAAATTNEQ  115

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
            T ++E K  I D+LTDA+ +L  DK VT EDA  VV AE R+  +  T P GVA SM+A 
Sbjct  116  TVSEEDKVNIADILTDAAERLPGDKVVTSEDAEAVVGAELRSSSEMKTTPGGVADSMSAG  175

Query  969  aaLNQE  986
            A LNQ+
Sbjct  176  ARLNQQ  181



>ref|XP_006305695.1| hypothetical protein CARUB_v10010425mg [Capsella rubella]
 gb|EOA38593.1| hypothetical protein CARUB_v10010425mg [Capsella rubella]
Length=178

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D +TIGEALEATA+S GDKPV + DAAAIQAAE RATG     PGG+ A AQ AA  N +
Sbjct  52   DTVTIGEALEATALSLGDKPVDRKDAAAIQAAETRATGESDTRPGGLAAAAQAAAATNEQ  111

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
              ++E K  I D+LTDA+ KL  DK VT EDA  VV AE R+  +  T P GVA SM+A 
Sbjct  112  ALSEEGKVTIADILTDAAEKLRGDKVVTSEDAEAVVGAELRSSPEMKTTPGGVADSMSAG  171

Query  969  aaLNQ  983
            A LNQ
Sbjct  172  ARLNQ  176



>ref|XP_003575514.1| PREDICTED: late embryogenesis abundant protein D-34-like [Brachypodium 
distachyon]
Length=278

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 126/225 (56%), Gaps = 11/225 (5%)
 Frame = +3

Query  243  EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENT----AFGQTIKGGPAAVMQSaaarnv  410
            EPI+YG VF V+G LA +PI  +DAAAM+SAE +    A         A  M++AAA N 
Sbjct  29   EPIQYGHVFAVTGDLAVQPIAPRDAAAMRSAEESVQGGAHAGGGGFRAATAMETAAAYNQ  88

Query  411  rnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektppppppp  590
                V P   +     QG++V +  + G   VTE + G VVG+Y                
Sbjct  89   AVGAVRPGQASHAAYGQGIAVTQTPVPGGCVVTEFVAGQVVGQYSVADQPMVMEEED---  145

Query  591  aaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRA  770
                 S  +TIGEA+EA A+SAGD+PV ++DA AI+AAE +A G G  +PGG+   AQ A
Sbjct  146  ----ASSKVTIGEAMEAAALSAGDRPVDEADAQAIRAAEAQAQGAGKTMPGGLADQAQAA  201

Query  771  AEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAE  905
            A  N R  +D  K  +GDVL+DA++KL  D+    EDAA VV AE
Sbjct  202  ARANLRAQSDRDKIMVGDVLSDATTKLAGDRAAGREDAARVVEAE  246



>ref|XP_010474927.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=182

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D +TIGEALEATA+S GDKPV + DAAAIQAAE RATG     PGG+ A AQ AA  N +
Sbjct  56   DTVTIGEALEATALSLGDKPVNRKDAAAIQAAESRATGEFKTRPGGLAAAAQAAAVANEQ  115

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
            T  +E K  I D+LTDA+ +L  DK VT EDA  VV AE R+  +  T P GVA SM+A 
Sbjct  116  TVLEEDKVTIEDILTDAAGRLPGDKVVTSEDAEAVVGAELRSSSEMKTTPGGVADSMSAG  175

Query  969  aaLNQ  983
            A LNQ
Sbjct  176  ARLNQ  180



>ref|XP_010522730.1| PREDICTED: late embryogenesis abundant protein D-34-like [Tarenaya 
hassleriana]
Length=127

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 83/124 (67%), Gaps = 3/124 (2%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            +TIGEALEATAIS GDKPV + DAAAIQ AE RATG G  +PGGV A AQ  A +N R  
Sbjct  6    VTIGEALEATAISIGDKPVDRKDAAAIQTAETRATG-GKTVPGGVAATAQAVATLNERNI  64

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaaaa  974
              E +  I DVLTDA  KL  D+ VTV+DA  VV AE RN     T P GVA SM+A A 
Sbjct  65   --ESRVTISDVLTDAMDKLLRDRAVTVDDAEAVVGAELRNSPAMKTTPGGVADSMSAGAR  122

Query  975  LNQE  986
            LNQ+
Sbjct  123  LNQQ  126



>ref|XP_006826269.1| hypothetical protein AMTR_s00004p00042590 [Amborella trichopoda]
 gb|ERM93506.1| hypothetical protein AMTR_s00004p00042590 [Amborella trichopoda]
Length=238

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 93/258 (36%), Positives = 119/258 (46%), Gaps = 49/258 (19%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ Q +RP       IKYGD F VSG  A + +  +DAA MQSAE    G T KGG AA
Sbjct  1    MSQGQPQRP-------IKYGDAFPVSGDHANQTVAPRDAAMMQSAEGLVLGLTQKGGAAA  53

Query  381  VMQSaaarnvrnarvDPDNVTDVVRE-QGVSVKEDDIAGRRFVTEAIGGDVVGKY-----  542
                +AA                V E QGV+V E ++  RR V E++GG VV  +     
Sbjct  54   ATMHSAADRNEAVGAVAHEEFSAVGEGQGVTVAEAELPDRRVVVESVGGQVVRLFAQALS  113

Query  543  -----IRppaeektpppppppaaGVVSD-DITIGEALEATAISAGDKPVGKSDAAAIQAA  704
                 +R    +          AG + +  +TIGEALEAT ++AG K V +SDA+AI+ A
Sbjct  114  QGVGQLRERTGDVQGGGELRQGAGDLGEGKLTIGEALEATGLTAGHKVVEQSDASAIEEA  173

Query  705  EVRATGLGHILPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDA  884
            E+RA+G                              + G     A+ KL  DKPVT EDA
Sbjct  174  EMRASG------------------------------RSGGRSAAATEKLPADKPVTWEDA  203

Query  885  AGVVNAEARNKEDHATHP  938
              +  AE RN     THP
Sbjct  204  ERIAAAEMRNNPKLTTHP  221



>ref|XP_010481583.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
 ref|XP_010481591.1| PREDICTED: late embryogenesis abundant protein D-34-like [Camelina 
sativa]
Length=182

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +3

Query  609  DDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINAR  788
            D +TIGEALEATA+S GDKPV + DAAAIQAAE RA+G     PGG+ A AQ AA  N +
Sbjct  56   DTVTIGEALEATALSLGDKPVDRKDAAAIQAAETRASGEFKTRPGGLAAAAQAAAAANEQ  115

Query  789  TTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaasmaaa  968
            T ++E K  I D+LTDA+ +L  DK VT EDA  VV AE R+  +  T P GVA SM+A 
Sbjct  116  TVSEEDKVTIEDILTDAAERLPGDKVVTSEDADAVVGAELRSSSEMKTTPGGVADSMSAG  175

Query  969  aaLNQ  983
            A LNQ
Sbjct  176  ARLNQ  180



>gb|ABD32975.1| Seed maturation protein [Medicago truncatula]
Length=114

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 3/108 (3%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAA  380
            MSQ++ RRPE   QEPIKYGD+F+VSG L+++PI  +DAA MQSAE+       K GPA+
Sbjct  1    MSQEKPRRPE---QEPIKYGDIFNVSGDLSSQPIAPRDAATMQSAEDRTLDHARKDGPAS  57

Query  381  VMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGG  524
            +M SAA +N     +D +  T++ R +GV+V E +  G+R +TE +GG
Sbjct  58   LMTSAAQKNEDAGFIDNNTATNIARNEGVAVSEINNGGKRVITETLGG  105



>ref|XP_002963793.1| hypothetical protein SELMODRAFT_25885, partial [Selaginella moellendorffii]
 gb|EFJ35664.1| hypothetical protein SELMODRAFT_25885, partial [Selaginella moellendorffii]
Length=238

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 94/236 (40%), Positives = 123/236 (52%), Gaps = 22/236 (9%)
 Frame = +3

Query  219  RRPES-GDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSa  395
            ++P+S G  +P  YG+VF+  G L  +PIT +DAA M+S EN  FGQT+KGG AA MQSA
Sbjct  1    QQPQSRGASQPT-YGEVFNARGDLREQPITAEDAAMMRSVENARFGQTMKGGTAAKMQSA  59

Query  396  aarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpp  575
              R    A   P   TD   +QGV       AG          DVV   I       +  
Sbjct  60   VDRASAAASATPAGATD---DQGVPA-----AGTV--------DVVDHPITIGEVRSSSK  103

Query  576  pppppaaGVVSDDITIG---EALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGG  746
                  AG            +ALE  A + GDKP+ + DA  IQ+AE RATG    +   
Sbjct  104  FLALVLAGNADTCFCFAITAQALEVAAENIGDKPITRPDAKVIQSAESRATGNATGVKRV  163

Query  747  VGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            V A+AQ AA++NA  +T E  T + DVL +A++K+  DK VT EDA+ V + E RN
Sbjct  164  VAAEAQSAADMNAAGSTTEIPT-VKDVLDNAAAKMPIDKVVTHEDASRVQSVEKRN  218



>gb|EEE65653.1| hypothetical protein OsJ_21239 [Oryza sativa Japonica Group]
Length=263

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 136/249 (55%), Gaps = 23/249 (9%)
 Frame = +3

Query  243  EPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaaarnvrnar  422
            E IKYG VF V+G+LA +PI  +DAAAM+SAE +  G     G A  M++AAA N   A 
Sbjct  26   EAIKYGHVFAVTGELAGQPIAPRDAAAMRSAEESDIGGGYSAGVA--METAAAYNQAVAA  83

Query  423  vDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRppaeektpppppppaaGV  602
            V P   +D    QG++V +  + G R +TE + G VVG+Y                   V
Sbjct  84   VRPGQASDAATNQGIAVTQTSVPGGRIITEFVAGQVVGQY-------------SVADQAV  130

Query  603  VSD--DITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAE  776
              D   IT+GEALEATA++AG++PV ++D  AI+AAE+ A G    +PGG+    Q AA 
Sbjct  131  EQDATKITVGEALEATALAAGERPVDRTDVEAIRAAEMAAQGSDVTMPGGLADQGQAAAR  190

Query  777  INARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHPagvaas  956
                  +     +  D +TDA++KL  DK    EDAA VV AE  +     T   GV A+
Sbjct  191  ------SKADADRDDDKITDATAKLAGDKVAGAEDAAKVVQAETYSDAAARTRAGGVGAA  244

Query  957  maaaaaLNQ  983
            ++ AA LNQ
Sbjct  245  VSTAARLNQ  253



>ref|XP_007034769.1| Late embryogenesis abundant protein D-34 isoform 2 [Theobroma 
cacao]
 gb|EOY05695.1| Late embryogenesis abundant protein D-34 isoform 2 [Theobroma 
cacao]
Length=187

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +3

Query  615  ITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGGVGADAQRAAEINARTT  794
            ITIGEALEATA +  DKPV +SDAAAIQAAEVRATG   I+PGG+ A AQ AA  NA   
Sbjct  61   ITIGEALEATAQTTRDKPVDQSDAAAIQAAEVRATGSNVIIPGGLAATAQSAAAQNASVN  120

Query  795  TDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARNKEDHATHP  938
             +E K ++ +VLT A++KL  DK VT +D  GVV+AE RN  + AT P
Sbjct  121  RNEEKIRLNEVLTGATAKLPADKAVTRQDDEGVVSAELRNNPNVATRP  168


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = +3

Query  201  MSQQQARRPESGDQ---EPIKYGDVFDVSGQLAAKPI  302
            MSQ Q+RRP++GDQ   +PIKY DVF+V+G+LA KPI
Sbjct  1    MSQGQSRRPQAGDQRESQPIKYEDVFNVTGELANKPI  37



>ref|XP_002974882.1| hypothetical protein SELMODRAFT_15747, partial [Selaginella moellendorffii]
 gb|EFJ24402.1| hypothetical protein SELMODRAFT_15747, partial [Selaginella moellendorffii]
Length=238

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 120/236 (51%), Gaps = 22/236 (9%)
 Frame = +3

Query  219  RRPESGDQEPIKYGDVFDVSGQLAAKPITQQDAAAMQSAENTAFGQTIKGGPAAVMQSaa  398
            ++P+S       YG+VF+  G L  +PIT +DAA M+S EN  FGQTIKGG AA MQSA 
Sbjct  1    QQPQSRGASQPTYGEVFNARGDLREQPITAEDAAMMRSVENARFGQTIKGGTAAKMQSAV  60

Query  399  arnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGG-DVVGKYIRppaeektpp  575
             R    A   P + TD   +QGV               A G  DVV   I       +  
Sbjct  61   DRASAAASATPASATD---DQGVP--------------ATGTVDVVDHPITIGEVRSSSK  103

Query  576  pppppaaGVVSDDITIG---EALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHILPGG  746
                  AG            +ALE  A + GDKP+ + DA  IQ+AE RATG    +   
Sbjct  104  FLAFVLAGNADTCFCFAITAQALEVAAENIGDKPITRPDAKVIQSAESRATGNATGVKRV  163

Query  747  VGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            V A+AQ AA++NA  +T    T + DVL +A++K+  DK VT EDA+ V + E RN
Sbjct  164  VAAEAQSAADMNAAGSTTAIPT-VKDVLDNAAAKMPIDKVVTHEDASRVQSVEKRN  218



>ref|XP_010556781.1| PREDICTED: late embryogenesis abundant protein D-34-like [Tarenaya 
hassleriana]
Length=223

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 137/264 (52%), Gaps = 45/264 (17%)
 Frame = +3

Query  201  MSQQQARRPESGDQEPIKYGDVFDVSGQLAA--KPITQQDAAAMQSAENTAFGQTIKGGP  374
            M+Q+Q  +PE   ++PIK  DVF+VS    A   P+T  DAA +Q+   T   +T+ G  
Sbjct  1    MAQKQ--QPEM-PRDPIKCHDVFNVSDPEIADDPPVTAGDAATVQT---TDVQKTLTGSS  54

Query  375  AAVMQSaaarnvrnarvDPDNVTDVVREQGVSVKEDDIAGRRFVTEAIGGDVVGKYIRpp  554
            A+ M S+           P N  +                 R  TE+I    +GK++ P 
Sbjct  55   ASTMPSS-----------PANFNN-----------------RATTESIREQAMGKFVDPA  86

Query  555  aeektpppppppaaGVVSDDITIGEALEATAISAGDKPVGKSDAAAIQAAEVRATGLGHI  734
             EE+ P            D +TIGEALEA AIS GDKPV + DAAAI  AE   TG G  
Sbjct  87   EEEEDPEGTAG------GDTVTIGEALEAAAISIGDKPVDRKDAAAIHTAETIVTG-GKT  139

Query  735  LPGGVGADAQRAAEINARTTTDEFKTKIGDVLTDASSKLTDDKPVTVEDAAGVVNAEARN  914
            +PGGV A A+ AA +N      E K  I DVLTDA  KL  DK VT EDA  VV AE RN
Sbjct  140  VPGGVAAAAEAAAAMNEMNV--ESKVTIADVLTDAMDKLPRDKEVTGEDAEAVVGAELRN  197

Query  915  KEDHATHPagvaasmaaaaaLNQE  986
              +  T P GVA SM+A A LN++
Sbjct  198  SPEMKTTPGGVADSMSAGARLNRQ  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2641654646496